WO2011141658A1 - Peptides with antiprotease activity - Google Patents

Peptides with antiprotease activity Download PDF

Info

Publication number
WO2011141658A1
WO2011141658A1 PCT/FR2011/050927 FR2011050927W WO2011141658A1 WO 2011141658 A1 WO2011141658 A1 WO 2011141658A1 FR 2011050927 W FR2011050927 W FR 2011050927W WO 2011141658 A1 WO2011141658 A1 WO 2011141658A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
peptide
rvh
peptides
2apro
Prior art date
Application number
PCT/FR2011/050927
Other languages
French (fr)
Inventor
Jean-Claude Cortay
Nisrine Falah
Manuel Rosa-Calatrava
Original Assignee
Universite Claude Bernard Lyon I
Hospices Civils De Lyon
Ecole Normale Superieure De Lyon
Centre National De La Recherche Scientifique
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Universite Claude Bernard Lyon I, Hospices Civils De Lyon, Ecole Normale Superieure De Lyon, Centre National De La Recherche Scientifique filed Critical Universite Claude Bernard Lyon I
Publication of WO2011141658A1 publication Critical patent/WO2011141658A1/en

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/81—Protease inhibitors
    • C07K14/8107—Endopeptidase (E.C. 3.4.21-99) inhibitors
    • C07K14/8139—Cysteine protease (E.C. 3.4.22) inhibitors, e.g. cystatin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
    • G01N2333/08—RNA viruses
    • G01N2333/085—Picornaviridae, e.g. coxsackie virus, echovirus, enterovirus
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
    • G01N2333/08—RNA viruses
    • G01N2333/085—Picornaviridae, e.g. coxsackie virus, echovirus, enterovirus
    • G01N2333/095—Rhinovirus
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/90—Enzymes; Proenzymes
    • G01N2333/914—Hydrolases (3)
    • G01N2333/948—Hydrolases (3) acting on peptide bonds (3.4)
    • Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the present invention relates to the general field of antivirals and more particularly, antiviral agents directed against enteroviruses. More specifically, the invention relates to novel peptides which exhibit a protease inhibitory activity (also called anti-protease activity), and in particular peptides which are of interest for the prophylactic or therapeutic treatment of a memberal infection. enterovirus, and in particular by a Rhinovirus or an Echovirus or a poliovirus or Enterovirus 71.
  • Enteroviruses are non-enveloped single-stranded RNA viruses of positive polarity. They belong to the family Picornaviridae. Currently, different species of human enteroviruses have been identified: enterovirus A, enterovirus B (including Echoviruses including ECHOvirus 6), enterovirus C (with poliovirus), enterovirus D and human rhinovirus (RVH) A (comprising about 75 members including RVH-2), B (comprising about 25 members), C and D. These species are defined according to phylogenetic criteria based, in particular on that part of the genome encoding the structural proteins.
  • Enteroviruses may be responsible for various types of pathologies, benign or severe, such as acute flaccid paralysis, aseptic meningitis, foot-hand-mouth syndrome, respiratory diseases, colds, otitis, sinusitis, acute or chronic heart disease, diarrhea, pancreatitis
  • the EV-71 has become much more aggressive in Asian countries and causes large-scale epidemics (Kairis, Sauter et al., 2009).
  • an EV-71 epidemic affected more than 90,000 children in Taiwan and caused 78 deaths (Ho, Chen and others 1999, Liu, Tseng et al., 2000).
  • proteases 3C named 3Cpro
  • 2A called 2Apro
  • 3Cpro The proteases 3C
  • 2Apro 2A of the rhinovirus
  • Different compounds have been tested for their ability to inhibit the activity of these proteases.
  • Rupintrivir AG7088 and Compound 1 for 3Cpro; elastinal, MPCMK (methoxysuccinyl-Ala-Ala-Pro-Val-chloromethylketone), z-VAM.fmk and homophthalimide (LY353349) for 2Apro (Molla, Hellen et al., 1993; Wang, Johnson et al. 1998, Deszcz, Seipelt et al., 2004, Deszcz and Cencic et al., 2006). None of these compounds are currently used in therapy and no clinical trials including them have been described in the literature.
  • the present invention proposes to provide novel peptidomimetics useful for the treatment of an enterovirus infection, and in particular a human rhinovirus.
  • the subject of the present invention is therefore the peptides whose C-terminal portion has the sequence LVLQTM (SEQ ID No. 9), as well as the chemical derivatives of such peptides, with the exception of the RBM6 delta 6 protein.
  • the subject of the invention is also the chemical derivatives of such peptides which correspond to peptides whose C-terminal portion has the sequence LVLQTM (SEQ ID No. 9), but are substituted on the NH 2 of their N-terminal end and or on their C-terminal end by modification of the -COOH group of the methionine.
  • such peptides may be substituted on the NH 2 of their N-terminus by an acetyl group, a benzoyl group, a tosyl group or a benzyloxycarbonyl (Z) group, and / or on their C-terminal end by modification.
  • such peptides are substituted on their C-terminal end by modifying the -COOH group of the methionine to form a fluoromethylketone.
  • the peptide corresponding to the sequence LVLQTM (SEQ ID No. 9), as well as the chemical derivatives of this peptide, and in particular the peptide LVLQTM (SEQ ID No. 9) whose NH 2 group of its N-terminal end is functionalized by a benzyloxycarbonyl group and the -COOH group of its C-terminal methionine is modified to a fluoromethylketone are examples of peptide according to the invention.
  • the peptides according to the invention have a C-terminal peptide sequence LVLQTM (SEQ ID No. 9) which corresponds to a pseudo-substrate of the 2Apro of the RVH-2 and which mimics the sequence P1-P6 (according to the nomenclature proposed by Schechter and Berger (Schechter and Berger 1968) of the half cleavage site of some natural substrates of 2Apro.
  • this motif was directly involved in (Interaction with 2Apro of the RVH-2
  • the inventors have demonstrated that the peptides according to the invention exhibit a more active spectrum.
  • the invention also relates to the peptides of which the C-terminal portion corresponds to the sequence LVLQTM (SEQ ID No. 9) according to the invention, as well as the RBM6 delta 6 protein in an isolated form, which exhibit inhibitory activity.
  • a viral or cellular protease in particular an inhibitory activity of the protease 2A or 3C of the rhinovirus and / or a protease (viral or non-viral) having, in particular, the same catalytic properties as the protease 2A rhinovirus.
  • the subject of the invention is also the peptides whose C-terminal part has the sequence LVLQTM (SEQ ID No. 9), the chemical derivatives of such peptides, as well as the RBM6 delta 6 protein in a isolated form, used for diagnostic purposes or for the therapeutic or prophylactic treatment of Enterovirus infection or for the manufacture of a medicament for the therapeutic or prophylactic treatment of Enterovirus infection, as well as the compositions pharmaceutical compositions comprising them, in association with a pharmaceutically acceptable excipient.
  • peptide is meant any sequence of amino acids, without greater limitation of size.
  • the term peptide therefore encompasses large peptides, classically referred to as proteins.
  • the claimed peptides have a well-defined C-terminus and, on the other hand, the rest of the peptide can exhibit great variability.
  • peptide refers to a sequence of two or more amino acids linked together by peptide bonds or modified peptide bonds. Apart from their C-terminal portion corresponding to the sequence LVLQTM (SEQ ID No.
  • the amino acids present in the peptides according to the invention may be acids natural amines: Leucine (Leu), Glycine (Gly), Alanine (Ala), Isoleucine (Ile), Valine (val), Serine (Ser) Threonine (Thr), Phenylalanine (Phe), Tryptophan (Trp), Tyrosine (Tyr ), Proline (pro), Cysteine (Cys), Methionine (Met), Asparagine (Asn), Glutamine (Gin), Arginine (Arg), Lysine (Lys), Histidine (His), Aspartic Acid (Asp), Glutamic acid (Glu) which are conformation L, or non-natural amino acids, named unconventional amino acids such as in particular the amino acids below:
  • amino acid therefore refers to natural amino acids and non-natural amino acids, called unconventional amino acids.
  • unconventional amino acid derived from a natural amino acid is meant an amino acid belonging to the above list whose name includes the name of the natural amino acid from which it is derived.
  • chemical derivative of the peptides according to the invention is understood to mean peptides which comprise one or more additional groups which are not naturally present on peptide sequences.
  • the extreme N-terminal amino acid and / or C-terminal methionine may be functionalized, with, for example, one of the functions below.
  • the peptides according to the invention can be in protected form.
  • the form of protection must obviously be a biologically compatible form and must preferably be compatible with prophylactic and therapeutic use.
  • Many biologically compatible forms of protection can be envisaged.
  • the peptides according to the invention may be substituted on their N-terminal end with an acetyl group, a benzoyl group, a tosyl group or a benzyloxycarbonyl (Z) group, or on their C-terminus by amidation of the hydroxyl function.
  • the chemical derivatives of the peptides may not exactly comprise the sequence LVLQTM (SEQ ID NO: 9), but an LVLQTM sequence in which only one or at least one amino acid has been functionalized, in particular with a function above mentioned.
  • the natural peptides or proteins are preferably used in an isolated form.
  • purified or isolated peptide or protein is meant that the peptide or protein in question is obtained in a form substantially free of macromolecules of the same type. That is to say, preferably, the peptide or the protein in question represents at least 75% by weight, preferably at least 85% by weight, and more preferably at least 95% by weight, or even more than 98% by weight. mass of biological macromolecules present of the same type (but water, buffers or molecules of low molecular weight, especially less than 1000 daltons may be present). Purification methods are known to those skilled in the art.
  • a naturally occurring protein can, for example, be purified from lysates ⁇ and cell extracts, the supernatant of the culture medium by methods used individually or in combination, such as fractionation, chromatography methods, techniques immunoaffinity using specific mono or polyclonal antibodies, etc.
  • the peptides may be of any size, but comprise at least the 6 amino acids SEQ ID No. 9 LVLQTM (IMH.2-> COOH) as defined in the context of the invention.
  • the binding to the LVLQTM sequence is via the first Leucine.
  • Each of the amino acids present in the peptides according to the invention may be a natural or unconventional amino acid.
  • the peptides according to the invention comprise, for example, from 6 to 1000 amino acids. Nevertheless, when the peptides according to the invention will have to be administered in a pharmaceutical composition, depending on the nature of this composition, it may be advantageous that their size does not exceed 50 or 20 amino acids.
  • these peptides will correspond to artificial peptides. That is, they will not match the entire sequence of a biological protein.
  • biological protein is meant any protein naturally occurring and naturally produced by a living organism, and especially the RBM6 delta 6 protein of sequence: MWGDSRPANR TGPFRGSQEE RFAPGWNRDY PPPPLKSHAQ ERHSGNFPGR DSLPFDFQGH SGPPFANVEE HSFSYGARDG PHGDYRGGEG PGHDFRGGDF SSSDFQSRDS SQLDFRGRDI HSGDFRDREG PPMDYRGGDG TSMDYRGREA PHMNYRDRDA HAVDFRGRDA PPSDFRGRGT YDLDFRGRDG SHADFRGRDL SDLDFRAREQ SRSDFRNRDV SDLDFRDKDG TQVDFRGRGS GTTDLDFRDR DTPHSDFRGR HRSRTDQDFR GREMGSCMEF KDREMPPVDP NILDYIQPST QDREHSGMNV NR
  • inhibitory activity of a protease is meant a minimum inhibitory activity of 50% on at least one reference test for measuring the inhibitory activity on said protease.
  • a test of hydrolysis of the colorimetric substrate TRPIITTA (SEQ ID No. 18) -pNa and in particular the test described in the examples below, may be used as a reference test.
  • treatment means any prophylactic or suppressive therapeutic measure of a disease or disorder leading to a desirable clinical effect or any beneficial effect, including in particular the suppression or decrease of one or more symptoms, regression, slowing or cessation of the progression of the virus or the disorder associated with it.
  • terapéuticaally effective amount is meant any amount of a composition that improves one or more of the characteristic parameters of the viral condition being treated.
  • the invention particularly relates to a more specific family of peptides as previously defined.
  • the invention relates to the peptides which correspond to the sequence LVLQT (SEQ ID No. 9), as well as the chemical derivatives of such peptides.
  • the peptides according to the invention can be obtained by proteolysis or synthetically, chemically.
  • the peptides according to the invention can be obtained by solid phase or liquid homogeneous chemical synthesis, or by enzymatic synthesis, or by genetic engineering, according to techniques well known to those skilled in the art.
  • the peptides according to the invention are of particular interest for prophylactic and therapeutic purposes, for the treatment of enterovirus infections, in mammals and, in particular, in humans, and in particular human rhinovirus infections, such as RVH-2, with Echovirus infections such as TECHO-6, or poliovirus infections, coxsackievirus infections, and enterovirus 71 infections whose protease 2A activity is also inhibited by the LVLQTM motif (SEQ ID NO: 9).
  • the peptides according to the invention and the isolated RBM6 delta 6 protein can therefore be used as medicaments for the treatment of colds, otitis, sinusitis, or acute flaccid paralysis, aseptic meningitis, hand-foot-and-mouth syndrome, respiratory diseases. , acute or chronic heart disease, diarrhea, pancreatitis, ocular involvement, encephalitis. They can also be used to diagnose enteroviruses present in biological samples.
  • the subject of the present invention is also the use of a peptide according to the invention for the in vitro diagnosis of an enterovirus, and in particular of a human rhinovirus such as RVH-2, or of an echovirus or of
  • the peptide is used for the detection of a protease, and in particular protease 2A or 3C, of the Enterovirus to be diagnosed.
  • the detection may be carried out in any type of biological sample, according to techniques well known to those skilled in the art.
  • the peptides according to the invention and the isolated RBM6 delta 6 protein may be used to inhibit a viral protease or a cellular protease such as elastase, chymotrypsin-like proteases and caspases (Skern, Sommergruber et al., 1991 ).
  • enterovirus protease 2A is a cysteine protease whose activity can be modulated by known inhibitors of cellular proteases.
  • the P2A of RVH-14 and type 1 poliovirus is inhibited by specific elastase inhibitors (Molla, Hellen et al., 1993).
  • the peptides according to the invention and the isolated RBM6 delta 6 protein may be used to inhibit viral or non-viral proteases, other than enteric virus proteases 2A and 3C, if these proteases have catalytic properties close to 2Apro viral and in particular cysteine proteases.
  • One of the applications is the use of a peptide according to the invention or of the RBM6 delta 6 protein in the preparation of cell lysates, in particular to supplement cocktails of protease inhibitors.
  • the invention relates to the peptides according to the invention, as well as the isolated RBM6 delta 6 protein, for their use as medicaments, as well as the pharmaceutical compositions containing one of the peptides according to the invention.
  • invention or the isolated RBM6 delta 6 protein, in combination with at least one suitable pharmaceutical excipient are suitable pharmaceutical excipients.
  • suitable or acceptable pharmaceutical excipient any compound or vehicle entering a pharmaceutical composition which does not cause or almost no side reactions and which makes it possible, for example, to facilitate the administration of the peptides according to the invention, to increase their life and / or efficiency in the body, to increase their solubility, or to improve their conservation.
  • pharmaceutically acceptable excipients are well known to those skilled in the art and will be adapted by the latter, depending on the nature and mode of administration of the peptides according to the invention.
  • the peptide may, for example, be solubilized in one or more pharmaceutically acceptable solvents, conventionally used by those skilled in the art, such as, for example, water, glycerol, ethanol, propylene glycol, butylene glycol, dipropylene glycol, ethoxylated or propoxylated diglycols, cyclic polyols, petrolatum, a vegetable oil and any mixture of these solvents.
  • the peptide may also be formulated in a pharmaceutical vector, such as liposomes, or adsorbed onto powdery organic polymers, inorganic carriers such as talcs and bentonites, and more generally solubilized in, or attached to, any pharmaceutically acceptable carrier.
  • the peptides according to the invention may, for example, be administered orally, sublingually, subcutaneously, intramuscularly, intravenously, topically, intratracheally, intranasally, transdermally, rectally or intraocularly.
  • Their modes of administration, dosages and optimal dosage forms will be determined according to the criteria generally taken into account in the establishment of a treatment adapted to a patient such as, for example, the age or body weight of the patient, the severity of his condition. general, tolerance to treatment and the observed side effects.
  • the peptide will be present within the composition in a therapeutically effective amount.
  • a peptide according to the invention may be present in the compositions of the invention at a concentration of between approximately 0.0005 and 500 ppm (parts per million, weight / weight), and preferably at a concentration of between 0, About 1 and 5 ppm based on the total weight of the final composition.
  • a peptide according to the invention may be used alone or in combination with at least one other active agent, in a pharmaceutical composition.
  • the peptides according to the invention may in particular be used in combination with an already known protease inhibitor and / or with a compound under evaluation. The invention therefore also relates to pharmaceutical compositions containing such combinations.
  • Figure 1 shows an alignment of the C-terminal ends of the peptides identified in double hybrid.
  • the common sequence unit L-X-L-X-T / N-Z (where X is any amino acid and Z is a hydrophobic amino acid) is shown and aligned with the P6-P1 residues of various known cleavage sites of 2Apro.
  • FIGS. 2A and 2B show replenishment experiments of a complete cleavage site of 2Apro of RVH-2 from peptides IKL TL (SEQ ID No. 2), LSLVTL (SEQ ID No. 3), FRLTTL (SEQ ID NO: 4), LCLHTC (SEQ ID NO: 5), LFLYTC (SEQ ID NO: 6), LYIYTV (SEQ ID NO: 7), LKLQTV (SEQ ID NO: 8), LVLQTM (SEQ ID NO: 9) , LRLKNL (SEQ ID NUO) and LRLRNL (SEQ ID NO: 11).
  • Figure 3 shows the results of so-called "pull-down” experiments conducted in the presence of 2Apro of RVH-2 and peptide LVLQTM (SEQ ID No. 9).
  • Bacterial lysates containing the Streptag-SUMO, Streptag-SUMO-SEQ ID No. 9 or RVH-2 2Apro- (His) 6 proteins were mixed in pairs and subjected to Strep-coated magnetic beads affinity chromatography. -Tactin. The fixed complexes were separated on SDS-PAGE acrylamide gel and stained with Coomassie Blue.
  • Lane 3 2Apro- (His) 6 of RVH-2 purified on Nickel beads.
  • Figures 4A, 4B and 4C show replenishment experiments of a complete cleavage site of 2Apro of RVH-2 or ECHO 6 from the LVLQTM peptide (SEQ ID NO: 9).
  • Recombinant luciferases 61 kDa containing the hybrid sites LVLQTM-GPSDM (SEQ ID No. 14) (FIG. 4A), LQTM-GPSDM (SEQ ID No. 19) (FIG. 4B) or ⁇ -GPSDM (SEQ ID No.
  • Figure 4C were synthesized in a transcription / translation in vitro in the presence of 35 S-methionine and incubated with 2Apro- (His) 6 of the RVH-2 or 2Apro- (His) 6 ECHO 6 recombinants. Samples of the incubation medium were taken at times 15, 30 and 45 minutes, then the proteins were separated by SDS-PAGE and analyzed by fluorography. Figure 5 shows the percent inhibition of StrepTag-SUMO-SEQ ID NO: 9 peptide on the cleavage activity of 2Apro of RVH-2 in vitro.
  • the cleavage of the RVH-2 2Apro-specific TRPI1TTA (SEQ ID No.18) -p-nitroanilide (25 ⁇ ) colorimetric substrate was measured in vitro in the presence of different concentrations of Streptag-SUMO protein, whether or not containing the peptide LVLQTM (SEQ ID NO: 9). Absorbance measurements were made continuously for 10 min at 405 nm and the initial rate of each reaction was determined. The percent inhibition for a given concentration of Streptag-SUMO protein or StrepTag-SUMO-SEQ ID NO: 9 was calculated by reporting the determined initial reaction rates in the presence and absence of the protein. The percent inhibition values given are the average of the values obtained from 3 independent experiments. Standard deviations are also represented.
  • Figure 6 shows the inhibition in this case of the eIF-4Gase activity of the
  • Figure 7 shows the inhibition of infection of A549 cells overexpressing RBM6 delta 6274-520 by RVH-2 ( Figure 7A), RVH-14 ( Figure 7B) or EV68 (Figure 7C).
  • A549 cells transiently overexpressing the RBM6 delta 6274-520, RBM6 delta 6274-514 or SUMO proteins used here as a negative control were infected with RVH-2, RVH-14 or EV68 at a MOI of 1 20h.
  • the antiviral effect was determined by the measurement of TCID50 (infectious dose 50% in sensitive tissue culture).
  • Figure 8 shows the different groups of viruses belonging to the enterovirus genus. The serotypes on which the efficacy of the LVLQTM peptide has been demonstrated are surrounded.
  • Figure 9A Irreversible inhibition model of 2Apro of the RVH-2 by the peptide zLVLQTM.fmk by formation of a covalent bond between the peptide and the catalytic cysteine of the protease
  • FIG. 9B The cleavage of the TRPIITTA (SEQ ID No. 18) - p-nitroanilide (25 ⁇ ) color specific substrate of the 2Apro of the RVH-2 was measured in vitro in the presence of different concentrations of the zLVLQTM.fmk peptide. Absorbance measurements were made continuously at 405 nm for 10 minutes and the initial rate of each reaction was determined. The percentage inhibition for a given concentration of zLVLQTM.fmk peptide was calculated by reporting the determined initial reaction rates in the presence and absence of peptide. The percent inhibition values given are the average of the values obtained from 3 independent experiments. Standard deviations are also represented.
  • FIG. 9C A549 cells were treated with DMSO (control) or 100 ⁇ l and 200 ⁇ l of peptide zLVLQTM.fmk for 1 h and then transfected with a messenger RNA coding for 2Apro of RVH-2 or RVH-14 or of ECHO-6 or poliovirus or EVr71 or control RNA for 2 h. Cells were then transfected for 3 h with either capped mRNA or IRNA-encoding mRNA encoding Renilla luciferase. The first has the 5'UTR region of the ⁇ -Globin RNA while the second has the 5'UTR region of the encephalomyocarditis virus RNA. Cells were lysed and luciferase activity was measured by luminometry. The luciferase activity values result from the average values obtained from 3 independent experiments. Standard deviations are also represented.
  • FIG. 9D A549 cells were treated with DMSO (control) or 100 ⁇ l and 200 ⁇ l of peptide zLVLQTM.fmk for 1 h and then transfected with messenger RNA encoding 2Apro of PV-1 or EV-or control RNA for 2 h. Cells were then transfected for 3 h with either capped mRNA or IRNA-encoding mRNA encoding Renilla luciferase. The former has the 5'UTR region of the ⁇ -Globin RNA while the latter has the 5'UTR region of the encephalomyocarditis virus RNA. Cells were lysed and luciferase activity was measured by luminometry. The luciferase activity values result from the average values obtained from 3 independent experiments. Standard deviations are also represented.
  • Figure 9E A549 cells were infected with RVH-2 or RVH-14 at a MOI of 1 and treated with peptide zLVLQTM.fmk at a concentration of 100 ⁇ or 200 ⁇ for 12 h. The antiviral effect was determined by measuring TCID 50 in the supernatant of the infected cells.
  • FIGURE 9F A549 cells were treated with different concentrations of zLVLQTM.fmk for 24 hours. The viability of the cells thus treated was measured by an MTT test.
  • Figure 10 shows the in vivo inhibitory effect of zLVLQTM peptide (SEQ ID NO: 9) .fmk on the replication of RVH-2 in mouse lungs.
  • 6 week old Balb / c female mice intranasally infected with 10 5 pfu of RVH-2 and treated with 20 ⁇ M, 200 ⁇ M or 500 ⁇ M zLVLQTM.fmk.
  • the mice were sacrificed at 24, 48 or 120 hours after infection and their lungs were harvested and ground.
  • the antiviral effect was determined by the measurement of TCID50 in the crushed lungs of infected mice.
  • Figure 11 shows the inhibitory effect of zLVLQTM peptide (SEQ ID NO: 1
  • RBM6 delta 6 cellular protein (GenBank: FU56542) that results from the alternative splicing of the RBM6 pre-mRNA (Timmer, Terpstra et al., 1999).
  • the alignment of the C-terminus of each of these 51 peptides made it possible to isolate 10 different ones (one of which corresponded to the end of RBM6 delta 6, LVLQTM, SEQ ID No. 9) which had in common at their C-terminal end, the peptide motif X1-X2-X3-X4-X5-X6 in which: Xi and X3, which are identical or different, are Leu or Ile,
  • X2 and X4 which are identical or different, are any amino acid
  • X 5 is Asn or Thr
  • X 6 is a hydrophobic amino acid.
  • the peptides are IKLVTL (SEQ ID NO: 2), LSLVTL (SEQ ID NO: 2), LSLVTL (SEQ ID NO: 1)
  • Figure 1 shows the complete peptide sequences of isolated clones comprising said peptides.
  • the moiety X X2-X3-X4-X5-X6 as defined in the context of the invention mimics in part the half-site of P4-P1 cleavage presented in Figure 1 (P 4 LXTXPI) of several known natural substrates of 2Apro enteroviruses.
  • the motifs P 3QTM i and P4LQT P2 of RBM6 delta 6 are identical to those found at the same positions at the RVH-2 2Apro cleavage sites of PABP1 (Poly A Binding Protein) and the VP1-2Apro junction of the polyprotein of RVH-62 respectively, as shown in Figure 1.
  • This site contains at the P6-P1 positions the peptide IKLVTL (SEQ ID No. 2) or LSLVTL (SEQ ID No. 3) or FRLTTL (SEQ ID No. 4) or LCLHTC (SEQ ID No. 5) or LFLYTC (SEQ ID No. 6) or LYIYTV (SEQ ID No.
  • LKLQTV SEQ ID NO: 8
  • LVLQTM SEQ ID NO: 9
  • LRLKNL SEQ ID NO: 10
  • LRLRNL SEQ ID NO: 11
  • GPSDM SEQ ID N 15
  • the sequence LVLQTM - GPSDM is an example of such sequences.
  • nucleotide sequences encoding IKLVTL (SEQ ID No. 2) - GPSDM (SEQ ID No. 15) or LSLVTL (SEQ ID No. 3) -GPSDM (SEQ ID No. 15) or FRLTTL (SEQ ID No. 4) - GPSDM (SEQ ID No. 15) or LCLHTC (SEQ ID No. 5) - GPSDM (SEQ ID No. 15) or LFLYTC (SEQ ID No. 6) -GPSDM (SEQ ID No.
  • the protease 2A of the RVH-2 is cloned in the vector pSCodon1.2 (Eurogentec) between the NdeI and XhoI restriction sites in fusion with a label (His) e on the C-terminal side.
  • This plasmid is used to transform an E.coli B strain of SE1 type [F-, CmR, ompT, Ion, hsdSB (rB-, mB-), gal, dcm, DE3 (lad, T7polymerase under the control of the PlacUVS promoter). , ccdB +].
  • 2Apro of RVH-2 was produced by culturing the bacteria in a ZYP-5052 self-induction medium (Studier 2005) at 37 ° C for 5-6 hours with shaking, then at 20 ° C for 16-18 hours. .
  • the cells are lysed with BugBuster (Novagen), centrifuged at 40000g for 15 min and the centrifugation supernatant obtained is subjected to Nickel resin affinity chromatography (HIS-Select TM HF Nickel resin, Sigma).
  • the 95% purified 2Apro is dialyzed against a D buffer (100 mM Tris-HCl, pH 7.5, 200 mM NaCl, 4 mM DTT) and concentrated on a Vivaspin (Sartorius Stedium Biotech) column. It is stored at -20 ° C. in buffer D containing 50% glycerol.
  • SEQ ID NO: 15 or FRLTTL (SEQ ID NO: 4) - GPSDM (SEQ ID NO: 15) or LCLHTC (SEQ ID NO: 5) -GPSDM (SEQ ID NO: 15) or LFLYTC (SEQ ID NO: 6) -GPSDM (SEQ ID N ° 15) or LYIYTV (SEQ ID NO: 7) - GPSDM (SEQ ID NO: 15) or LKLQTV (SEQ ID NO: 8) -GPSDM (SEQ ID NO: 15) or LVLQTMCSEQ ID NO: 9) -GPSDM (SEQ ID NO.
  • each dilution 100 ⁇ l of each dilution is then mixed with 100 ⁇ l of luciferin, substrate of luciferase. Each mixture is thus deposited in a well of a 96-well plate and the luciferase activity is measured by chemiluminescence (FIG. 2B).
  • Figure 2B shows that all peptides [IKLVTL (SEQ ID NO: 2), LSLVTL (SEQ ID NO: 3), FRLTTL (SEQ ID NO: 4), LCLHTC (SEQ ID NO: 5), LFLYTC (SEQ ID NO.
  • Protease 2A RVH-2 is cloned into the vector pSCodonl.2 overexpression (Eurogentec) between the restriction sites NdeI and XhoI and fused with a tag (His) 6 C-terminal side.
  • the nucleotide sequence encoding the LVLQTM motif, SEQ ID No. 9 is cloned into the pET-SUMO vector (Invitrogen), between two Bsal restriction sites, in phase at the C-terminus of the SUMO protein.
  • the Streptag WSHPQFEK tag (SEQ ID NO: 13) is added on the N-terminal side of the SUMO-SEQ ID No. 9 fusion protein. This construct is transferred into the vector pSCodon1.2.
  • a pSCodon1.2 [streptag-SUMO] plasmid is constructed to serve as a control in the experiments described hereinafter.
  • E. coli strain SE1 [F-, CmR, ompT, Ion, hsdSB (rB-, mB-), gal, dcm, DE3 (lad, T7polymerase under the control of PlacUVS promoter). , ccdB +] and produce the proteins expressed by each of these constructs.
  • Bacteria are cultured in a ZYP-5052 (Studier 2005) self-induction medium at. 37 ° C for 5-6 hours with stirring. They are then transferred to 20 ° C for 16 to 18 hours. The cells are lysed with a mixture of detergents (BugBuster, Novagen).
  • the lysates thus obtained are collected in pairs (StrepTag-SUMO-SEQ ID No. 9 and RVH-2 2Apro- (His) 6 or StrepTag-SUMO and RVH-2 2Apro- (His) 6 ) and subjected to chromatography. of affinity on magnetic beads coated with Strep-Tactin (Qiagen) for one hour. Protein complexes attached to the beads after several washes are separated on SDS-PAGE acrylamide gel and stained with Coomassie Brillant Blue R250.
  • RVH-2 2Apro- (His) 6 co-eluted with StrepTag-SUMO-SEQ ID No. 9 but not with StrepTag-SUMO, as shown in Figure 3, by comparing Streptag tracks.
  • the SEQ ID No. 9 motif is necessary and sufficient to interact in vitro with the protease 2A of the RVH-2, which confirms the results obtained in double-hybrid.
  • cleavage site LVLQTM-GPSDM (SEQ ID NO: 14) by the 2Apro echovirus 6 (MGAFGQQSGAVYVG YRVV RHLATHTDWQ CVWEDY RDLLVSTTTAHGCD ⁇ ARCHCTSGVYFCASRN HYPWFEGPGLVEVQESEYYPKRYQSHVLLAAGLSEPGDC GGILRCEHGVIGIVTMEGWGFADVRDLLWLEDDAMEQLEHHHHHH, SEQ ID NO: 17), another member of the enterovirus type, has been studied.
  • nucleotide sequences coding for LVLQTM-GPSDM (SEQ ID No. 14) or LQTM-GPSDM or ⁇ -GPSDM (SEQ ID No. 16) are inserted between the NheI and BglII sites of a nucleotide sequence coding for a peptide linking the N and C-terminal domains of a recombinant luciferase in the pGloSensor TM -10F vector (Promega).
  • the corresponding proteins are synthesized in an in vitro transcription / translation system in the presence of [ 35 S] methionine this time (TNT SP6 High Yield Wheat Germ Master Mix, Promega). The whole is incubated for 2 hours at 25 ° C.
  • the protease 2A of the RVH-2 is cloned in the vector pSCodon1.2 (Eurogentec) between the NdeI and XhoI restriction sites in fusion with a label (His) e on the C-terminal side.
  • This plasmid is used to transform an EcoH type strain SE1 [F-, CmR, ompT, Ion, hsdSBfrB-, mB-], gal, dcm, DE3 (lad, T7polymerase under the control of the PlacUVS promoter), ccdB + ].
  • RVH-2 2Apro of RVH-2 was produced by culturing the bacteria in a ZYP-5052 self-induction medium (Studier 2005) at 37 ° C for 5-6 hours with shaking, then at 20 ° C for 16-18 hours. .
  • the cells are lysed with BugBuster (Novagen), centrifuged at 40000g for 15 min and the centrifugation supernatant obtained is subjected to a nickel resin affinity chromatography (HIS-Select TM HF Nickel resin, Sigma).
  • the 95% purified 2Apro is dialyzed against a D buffer (100 mM Tris-HCl, pH 7.5, 200 mM NaCl, 4 mM DTT) and concentrated on a Vivaspin (Sartorius Stedium Biotech) column. It is stored at -20 ° C. in buffer D containing 50% glycerol.
  • the 2Apro ECHO 6 is cloned into the vector pSCodonl.2 (Eurogentec) between the restriction sites NdeI and XhoI fused with a tag (His) 6 C-terminal side. This plasmid is used to transform an SE1 type Eco // B strain and produce ECHO 6 2Apro according to the culture and purification conditions described above.
  • the radioactive luciferases (13 ⁇ l) synthesized previously and containing the LVLQTM-GPSDM (SEQ ID No. 14) or LQTM-GPSDM or PIITTA-GPSDM (SEQ ID No. 16) cleavage sites are incubated for 45 min at 30 ° C. presence of 2 ⁇ l of recombinant RVH-2 2Apro (His) e or 2 ⁇ g of 2Apro (His) 6 of purified ECHO 6 and 13 ⁇ l of 2X reaction buffer (100 mM HEPES / NaOH, pH 7.9, 200 mM NaCl, 2 mM EDTA, 10mM DTT).
  • 2X reaction buffer 100 mM HEPES / NaOH, pH 7.9, 200 mM NaCl, 2 mM EDTA, 10mM DTT.
  • Figure 4A shows that in the presence of RVH-2 protease 2A, luciferase containing the LVLQTM-GPSDM site (SEQ ID NO: 14 - 61 kDa) is cleaved into two fragments of 25 kDa and 36 kDa in the first 15 minutes of the reaction with the same efficiency as that observed for the natural cleavage site ⁇ -GPSDM (SEQ ID No. 16).
  • FIG. 4A also shows that ECHO 6A 2Apro has substantially the same cleavage characteristics of the LVLQTM-GPSDM substrate (SEQ ID No. 14) as the RVH-2 2Apro with complete digestion of the site in less than 15 min.
  • the LVLQTM motif (SEQ ID No. 9) is also recognized as an authentic half-site cleavage by 2Apro of ECHO 6.
  • the latter has a strong sequence homology with 2Apro other enteroviruses (Poliovirus , Coxsackievirus), it is quite possible to apply these results to all 2Apro enteroviruses.
  • FIG. 4B shows that RVH-2 2Apro also cleaves the LQTM-GPSDM substrate (SEQ ID NO: 19). However, the complete digestion of this site is observed only after 30 min of incubation with 2Apro unlike the site LVLQTM-GPSDM (SEQ ID No. 14) which is fully digested in the first fifteen minutes of incubation. 'incubation.
  • the LVLQTM motif SEQ ID No. 9 has a higher affinity than the LQTM sequence for the 2Apro of RVH-2. The same type of result is observed for ECHOô 2Apro.
  • the peptide LVLQTM (SEQ ID No. 9) is used in the context of the invention. 5)
  • the peptide LVLQTM inhibits the cleavage activity of 2Apro of RVH-2 in vitro
  • the activity test is carried out at 25 ° C in a final volume of 1 mL with a buffer containing 100 mM NaCl, 50 mM HEPES / IMaOH pH8, 1 mM EDTA and 10 mM DTT.
  • Different concentrations of the StrepTag-SUMO-SEQ ID No. 9 or StrepTag-SUMO recombinant proteins are preincubated with 0.2 ⁇ l of 2Apro of the RVH-2 for 5 min. 25 ⁇ l of substrate are then added to initiate the reaction.
  • Absorbance measurements are made continuously at 405 nm for 10 minutes to determine the initial rate of each reaction.
  • the percent inhibition for a given StrepTag-SUMO-SEQ ID No. 9 peptide concentration was calculated by reporting the determined initial reaction rates in the presence and absence of peptide.
  • the percentage inhibition values given in Figure 5 result from the average of the values obtained from 3 independent experiments. Standard deviations are also represented.
  • RBM6 delta 6 cellular protein has a C-terminal motif LVLQTM (SEQ ID NO: 9) necessary and sufficient to interact with 2Apro of RVH-2,
  • this motif mimics the residue sequence at the P6-P1 positions of the 2Apro cleavage site of the RVH polyprotein and inhibits the cleavage activity of this enzyme
  • this motif represents a pseudo-substrate of 2Apro of RVH-2 but also of 2Apro of ECHO 6, the latter enzyme being homologous to 2Apro of other members of the same genus Enterovirus (Coxsackievirus, Poliovirus),
  • the 10 ⁇ M ICSO value measured for the LVLQTM peptide (SEQ ID NO: 9) is much lower than that described (600 ⁇ ) for the 2 octapeptides ARGKLQTF and RGFMLSTL inhibitors of poliovirus 2Apro (Ventoso, Barco et al., 1999).
  • A549 cells are maintained in culture in DMEM medium (Dulbecco modified medium, BioWhittaker) supplemented with 10% (v / v) fetal calf serum, 2 mM L-glutamine, 100 U / mL of penicillin and 100 ⁇ g / ml streptomycin, in an incubator at 37 ° C and in a saturated humidity atmosphere containing 5% CO2.
  • DMEM medium Dulbecco modified medium, BioWhittaker
  • 10% (v / v) fetal calf serum 2 mM L-glutamine, 100 U / mL of penicillin and 100 ⁇ g / ml streptomycin
  • the cells are detached from the support by trypsin-EDTA treatment and reseeded in a culture flask containing 15 ml of fresh medium.
  • A549 cells are seeded in 6 cm culture dishes (Corning) to reach 80% confluency at the time of transfection.
  • the vectors pCiNeo [2xStreptag-RBM6 delta 6274-520] and / or p3xFlag [3xFlag-RVH-2 2Apro] are transfected using the NanoJuice reagents (Novagen) according to the manufacturer's recommendations. Control
  • the cellular proteins are extracted after 48 hours of transfection according to the following protocol:
  • the cells are incubated for 15 min in ice with Mammalian Protein Extraction Reagent lysis solution (Pierce) supplemented with a cocktail of protease inhibitors (Complete protease inhibitor Cocktail, Roche) (100 ⁇ L per dish).
  • the concentration of the proteins thus extracted is determined using the solution The Better Bradford Assay Kit (Pierce). 60 ⁇ g of protein from each sample are mixed with Laemmli 6X, heated for 5 min at 100 ° C. and then deposited for analysis on 6% acrylamide gel. After migration at 90 V for about 2 hours, the proteins are transferred to a nitrocellulose membrane for 1h30 to 400 mA. The membrane is then saturated with 5% milk (diluted in IX TBS) for lh at room temperature then incubated overnight at 4 ° C with an anti- eIF-4G (polyclona! Rabbit) diluted in 1000th the saturation solution.
  • the membrane is incubated for one hour at room temperature with an anti-human rabbit antibody coupled to peroxidase (GE Healthcare) diluted 2000 e in the saturation solution.
  • the membrane is washed 4 times 20 min with TBS-tween (0.1%) and then subjected to analysis. Solutions 1 and 2 of the Pierce ECL Detection kit are used according to the instructions provided and the films (Amersham hyperfilm, GE Healthcare) are used to detect the signal.
  • RBM6 delta 6274-520 which contains peptide LVLQTM (SEQ ID NO: 9) and 2Apro of RVH-2 are coexpressed in A549 cells
  • the eIF-4Gase activity of 2Apro is inhibited, as shown in FIG. Figure 6, comparing runways RVH-2 2Apro and RVH-2 2Apro + RBM6 delta 6274-520.
  • RBM6 delta 6274-520 The expression of the C-terminal fragment of RBM6 delta 6 (RBM6 delta 6274-520,) inhibits the infection of A549 cells by RVH-2, RVH-14 and ⁇ - 68
  • A549 cells are maintained in culture in DMEM medium (Dulbecco modified medium, BioWhittaker) supplemented with 10% (v / v) fetal calf serum, 2 mM L-glutamine, 100 U / mL penicillin and 100 ⁇ g / mL streptomycin. Incubation is performed at 37 ° C in a saturated humidity atmosphere containing 5% CO 2. At confluence, the cells are detached from the support by treatment with trypsin-EDTA and reseeded in a culture flask containing 15 ml of fresh medium. On the day before transfection, A549 cells are seeded in 6-well plates to reach 80% confluency at the time of transfection.
  • DMEM medium Dulbecco modified medium, BioWhittaker
  • Expression vectors pCiNeo [2xStreptag-RBM6 delta 6274-520] or pCiNeo [2xStreptag-RBM6 delta 627 -514] or pCDNA3 [Streptag-SUMO] are transfected using the NanoJuice reagents (Novagen) according to the manufacturer's recommendations.
  • RBM6 delta 6274-514 corresponds to the form truncated RBM6 delta 6274-520 identified in double hybrid without the C-terminal sequence LVLQTM (SEQ ID No. 9).
  • SUMO is a protein used here as a control.
  • the cells are infected with RVH-2 at a MOI 1 after 24 hours of transfection according to the following protocol:
  • the cells are rinsed once with DMEM medium 2% serum, 2 mM L-glutamine, 100 U / mL penicillin and 100 ⁇ g / mL streptomycin
  • the cells are inoculated with the virus and 1.5 ml of DMEM medium 2% serum are added
  • the cells thus inoculated are incubated at 34 ° C. for 20 hours.
  • the supernatant of the infected cells is removed 20 hours after infection with RVH-2.
  • Supernatants are titrated on MRC5 cells and DICTSO is determined by the method of Reed and Muench (Reed LJ, 1938) according to the following protocol:
  • the MRC5 cells are maintained in culture in EMEM medium
  • the cell survival medium (1.4 mL) is changed before distribution of plaque viral suspensions.
  • the plates are incubated at 34 ° C for 5 days.
  • TCID 50 is calculated according to the method of Reed and Muench.
  • FIG. 7A shows that in cells overexpressing RBM6 delta 6274-520 (fragment which contains at its C-terminal end the peptide LVLQTM, SEQ ID No. 9), the viral titer reaches 10 5 5 TCID 50 / mL whereas for cells overexpressing the control protein (SUMO), the resulting titre of 7.5 TCID 50 / ml, is approximately 100-fold higher.
  • RBM6 delta 6274-520 reduces the production of RVH-2 viruses in A549 cells.
  • cells overexpressing RBM6 delta 6274-514 a fragment which does not contain at the C-terminal end the peptide LVLQTM, SEQ ID No.
  • the viral titre obtained from 10 7 ' 3 TCID50 / mL demonstrates that the LVLQTM sequence ( SEQ ID No. 9) located at the C-terminus of RBM6 delta 6274-520 is responsible for the decrease in viral production in A549 cells.
  • the amino acid sequence LVLQTM (SEQ ID No. 9) located at the C-terminus of the RBM6 delta 6 protein inhibits in vitro the RVH-2 and ECHO-6 proteases 2A. and substantially decreases infection of A549 cells by RVH-2, RVH-14 and EV68.
  • the peptide LVLQTM (SEQ ID No. 9) represents an inhibitor of different members of the enterovirus genus and therefore has a broad spectrum of action (FIG. 8).
  • FIG. 5 shows that the inhibition of the activity of 2Apro of the RVH-2 by the peptide LVLQTM (SEQ ID No. 9) is not complete since this peptide reversibly binds to the active site of the protease .
  • the LVLQTM peptide was modified by adding a fluoromethylketone group (fmk) at its C-terminus (this group being known to form a covalent link with the catalytic cysteine of cysteine proteases) and a benzyloxycarbonyl group. (z) at its N-terminus which gives it a better cell permeability.
  • fmk fluoromethylketone group
  • z at its N-terminus which gives it a better cell permeability.
  • zLVLQTM peptide (SEQ ID NO: 9) .fmk is an irreversible inhibitor of RVH-2 protease 2A
  • the activity test is carried out at 25 ° C in a final volume of 1 mL with a buffer containing 100 mM NaCl, 50 mM HEPES / NaOH pH8, 1 mM EDTA and 10 mM DTT.
  • Different concentrations of zLVLQTM (SEQ ID NO : 9) .fmk are preincubated with 0.2 ⁇ l of 2Apro RVH-2 for 5 min. 25 ⁇ l of substrate are then added to initiate the reaction.
  • Absorbance measurements are made continuously at 405 nm for 10 minutes to determine the initial rate of each reaction.
  • the percent inhibition for a given concentration of zLVLQTM peptide (SEQ ID NO: 9) .fmk was calculated by reporting the determined initial reaction rates in the presence and absence of peptide.
  • the percentage inhibition values given in Figure 9B result from the average of the values obtained from 3 independent experiments. The standard deviations are also represented.
  • RVH-2 protease 2A known inhibitors of RVH-2 protease 2A (Sommergruber, Ahorn et al., 1992, Deszcz, Seipelt et al., 2004) demonstrating the strong inhibitory potential of zLVLQTM peptide (SEQ ID NO: 9) .fmk. 8.2)
  • the zLVLQTM peptide (SEQ ID NO: 9) .fmk inhibits the eIF-4Gase activity of RVH-2, RVH-14, ECHO-6, PV and EV-71 2Apro in A549 cells
  • A549 cells are maintained in culture in DMEM medium (Dulbecco modified medium, BioWhittaker) supplemented with 10% (v / v) fetal calf serum, 2 mM L-glutamine, 100 U / ml penicillin and 100 ⁇ g / ml. mL of streptomycin. Incubation is carried out at 37 ° C in a saturated humidity atmosphere containing 5% CO 2 . At confluence, the cells are detached from the support by treatment with trypsin-EDTA and reseeded in a culture flask containing 15 ml of fresh medium. On the day before transfection, A549 cells are seeded in 48-well plates to reach 80% confluency at the time of transfection.
  • DMEM medium Dulbecco modified medium, BioWhittaker
  • the cells are treated with 100 ⁇ l or 200 ⁇ l of zLVLQTM (SEQ ID No. 9). Fmk for 1 h and then transfected (TransIT, Mirus) with mRNAs coding for 2Apro of RVH-2, RVH-14 , ECHO-6, PV or EV-71 for 2 hours. The cells were then transfected (TransIT, Mirus) for 3 h with capped mRNA or mRNA exhibiting a 5 'IRR encoding Renilla luciferase. The first has the 5'UTR region of the ⁇ -Globin RNA while the second has the 5'UTR region of the encephalomyocarditis virus RNA.
  • Luciferase activity was measured using the Promega Renilla Luciferase Assay System Kit:
  • the cells were lysed with 50 ⁇ l of IX iysis buffer per well and stirred for 15 min at room temperature.
  • FIG. 9C shows that in the presence of protease 2A of RVH-2, RVH-14 or ECHO-6, the activity of Renilla luciferase whose mRNA is capped decreases with respect to the control situation ( GFP), in favor of the translation and the activity of Renilla luciferase, the mRNA of which has an IRES in 5 '. This is due to the cleavage of the translation initiation factor elF-4G, necessary for the translation of the capped mRNAs.
  • the enteroviral proteases tested therefore seem to be active in this system.
  • Figure 9D shows that zLVLQTM (SEQ ID NO: 9) .fmk acts in the same way on poliovirus 2Apro and EV-71 demonstrating its broad spectrum of action against 2Apro enteroviruses.
  • A549 cells are maintained in culture in DMEM medium (Dulbecco modified medium, BioWhittaker) supplemented with 10% (v / v) fetal calf serum, 2 mM L-glutamine, 100 U / mL penicillin and 100 ⁇ g / mL streptomycin. Incubation is performed at 37 ° C in a saturated humidity atmosphere containing 5% CO 2 . At confluence, the cells are detached from the support by treatment with trypsin-EDTA and reseeded in a culture flask containing 15 ml of fresh medium. On the day before transfection, A549 cells are seeded in 6-well plates to reach 80% confluency at the time of transfection.
  • DMEM medium Dulbecco modified medium, BioWhittaker
  • the cells are infected with RVH-2 or RVH-14 at a MOI of 1 and treated with zLVLQTM (SEQ ID No. 9) .fmk at 100 ⁇ M and 200 ⁇ M: 1. the culture medium is sucked
  • the cells are rinsed once with DMEM medium 2% serum, 2 mM L-glutamine, 100 U / mL penicillin and 100 ⁇ g / mL streptomycin
  • the cells are inoculated with a mixture of virus and peptide zLVLQTM.fmk
  • the cells thus inoculated are incubated at 34 ° C. for 12 hours.
  • TCID50 is determined by the method of Reed and Muench (Reed LJ, 1938) according to the following protocol:
  • the MRC5 cells are maintained in culture in EMEM medium
  • the cell survival medium (1.4 mL) is changed before distribution of plaque viral suspensions.
  • the plates are incubated at 34 ° C for 5 days.
  • TCID 50 is calculated according to the method of Reed and Muench.
  • the viability of A549 cells in the presence of different concentrations of zLVLQTM (SEQ ID NO: 9) .fmk was determined by an MTT test (3- (4,5-dimethylthiazol-2-yl) -2,5-diphenyltetrazolium bromide) .
  • A549 cells are maintained in culture in DMEM medium (Dulbecco modified medium, BioWhittaker) supplemented with 10% (v / v) fetal calf serum, 2 mM L-glutamine, 100 U / mL penicillin and 100 ⁇ g / ml of streptomycin. Incubation is performed at 37 ° C in a saturated humidity atmosphere containing 5% CO 2 . At confluence, the cells are detached from the support by treatment with trypsin-EDTA and reseeded in a culture flask containing 15 ml of fresh medium. On the day before treatment, A549 cells were seeded in 96-well plates to reach 90% confluency at the time of transfection.
  • DMEM medium Dulbecco modified medium, BioWhittaker
  • the cells are treated with DMSO or different concentrations of zLVLQTM (SEQ ID No. 9) .fmk for 24 hours.
  • the cells thus treated are then brought into contact with 30 ⁇ of MTT (5 mg / ml, Sigma) preheated at 37 ° C. for 3 h.
  • the supernatant of the cells is then aspirated, 150 ⁇ l of DMSO are added per well and the absorbance at 540 nm is measured.
  • the percentage of cell viability is calculated relative to DMSO-treated cells. This experiment is repeated at least 3 times.
  • Figure 9F shows that zLVLQTM (SEQ ID No. 9) .fmk is not toxic when its concentration is less than 400 ⁇ . 9)
  • the peptide zLVLQTM (SEQ ID No. 9) .f) k inhibits the replication of RVH-2 in vivo in mice
  • mice Six week old female Balb / c mice are anesthetized with 50 ⁇ l of ketamine (520 L Rompun 2%, 1.53 ml Imalgene 1000, qs 20 ml water). They were infected intranasally with 10 5 pfu of RVH-2 contained in 25 uL of EMEM 2% serum and then treated intranasally with 20 ⁇ , 200 ⁇ or 500 ⁇ of zLVLQTM.fmk contained in 25 uL of DMSO. Only DMSO control is performed.
  • ketamine 520 L Rompun 2%, 1.53 ml Imalgene 1000, qs 20 ml water. They were infected intranasally with 10 5 pfu of RVH-2 contained in 25 uL of EMEM 2% serum and then treated intranasally with 20 ⁇ , 200 ⁇ or 500 ⁇ of zLVLQTM.fmk contained in 25 uL of DMSO. Only DMSO control is
  • mice are sacrificed 24h, 48h or 120h post-infection and the lungs are removed and then ground in 500 ⁇ l of EMEM medium.
  • Mice sacrificed 120h post-infection receive a second injection of DMSO or 20 ⁇ , 200 ⁇ or 500 ⁇ of zLVLQTM (SEQ ID No. 9) .fmk 48h post-infection.
  • the lysates thus obtained are centrifuged at 15,000 rpm for 15 min at 4 ° C.
  • TCID50 is determined by the method of Reed and Muench (Reed LJ, 1938).
  • Figure 10A shows that the weight of the mice infected with RVH-2 and then treated with the peptide zLVLQTM (SEQ ID No. 9) .fmk or DMSO alone varies only 5 to 10% during the infection which shows that the peptide zLVLQTM (SEQ ID No. 9) .fmk has low toxicity in vivo at the concentrations tested.
  • the viral titer decreases nearly 30-fold in the lungs of mice treated with the lowest doses of peptide (20 ⁇ ) and this from 24h post-infection ( Figure 10B). This decrease which is Depending on the dose of peptide used, the compound zLVLQTM (SEQ ID No. 9) .fmk thus inhibits the replication of RVH in vivo.
  • 3C-Express kit is composed of purified Rhinovirus 3Cpro (47kDa) and a GST-fused substrate protein (68kDa) containing the LEVLFQ-GP cleavage site (SEQ ID No. 2D). The substrate is thus cleaved between the Gln / Gly residues by the 3C protease in two fragments of 42 and 26 kDa.
  • Proteins were separated on SDS-PAGE acrylamide gel and stained with Coomassie Blue R250.
  • Figure 11 shows that in the presence of protease 3C, the substrate is cleaved into two fragments of 42 kDa and 26 kDa. This cleavage is inhibited in the presence of 50 ⁇ l of zLVLQTMfSEQ ID No. 9) .fmk.
  • Pathol

Abstract

The present invention relates to a novel family of peptides of which the C‑terminal part corresponds to the sequence LVLQTM (SEQ ID No°9), and also the chemical derivatives of such peptides, with the exception of the RBM6 delta 6 protein, and also the RBM6 delta 6 protein, for the protease-inhibiting activity thereof. They can in particular be used for the therapeutic or prophylactic treatment of an infection with an enterovirus and in particular human rhinovirus such as RVH-2, or else in the diagnostic field for detecting the 2A and 3C proteases.

Description

PEPTIDES A ACTIVITE ANTIPROTEASIQUE  PEPTIDES WITH ANTIPROTEASE ACTIVITY
La présente invention concerne le domaine général des antiviraux et plus particulièrement, des agents antiviraux dirigés contre les Entérovirus. Plus précisément, l'invention concerne de nouveaux peptides qui présentent une activité inhibitrice d'une protéase (également nommée activité anti- protéasique), et en particulier des peptides qui présentent un intérêt pour le traitement prophylactique ou thérapeutique d'une infection par un membre du genre Entérovirus, et notamment par un Rhinovirus ou un Echovirus ou un poliovirus ou l'Enterovirus 71.  The present invention relates to the general field of antivirals and more particularly, antiviral agents directed against enteroviruses. More specifically, the invention relates to novel peptides which exhibit a protease inhibitory activity (also called anti-protease activity), and in particular peptides which are of interest for the prophylactic or therapeutic treatment of a memberal infection. enterovirus, and in particular by a Rhinovirus or an Echovirus or a poliovirus or Enterovirus 71.
Les entérovirus sont des virus non-enveloppés à ARN simple brin de polarité positive, Ils appartiennent à la famille des Picornaviridae. Actuellement, différentes espèces d'entérovirus humains ont été identifiées : les entérovirus A, les entérovirus B (avec notamment les Echovirus dont l'ECHOvirus 6), les entérovirus C (avec les Poliovirus), les Entérovirus D et les Rhinovirus Humains (RVH) A (comprenant environs 75 membres dont le RVH-2), B (comprenant environ 25 membres), C et D. Ces espèces sont définies selon des critères phylogénétiques basés, notamment sur la partie du génome codant les protéines structurales.  Enteroviruses are non-enveloped single-stranded RNA viruses of positive polarity. They belong to the family Picornaviridae. Currently, different species of human enteroviruses have been identified: enterovirus A, enterovirus B (including Echoviruses including ECHOvirus 6), enterovirus C (with poliovirus), enterovirus D and human rhinovirus (RVH) A (comprising about 75 members including RVH-2), B (comprising about 25 members), C and D. These species are defined according to phylogenetic criteria based, in particular on that part of the genome encoding the structural proteins.
Les entérovirus peuvent être responsables de différents types de pathologies, bénignes ou sévères, telles que notamment des paralysies flasques aiguës, méningites aseptiques, syndrome pieds-mains-bouche, maladies respiratoires, rhumes, otites, sinusites, cardiopathies aiguës ou chroniques, diarrhées, pancréatites, atteintes oculaires, encéphalites... En particulier, depuis la fin des années 1990, l'EV-71 est devenu beaucoup plus agressif dans les pays asiatiques et provoque des épidémies de grande ampleur (Kairis, Sauter et al. 2009). Ainsi, en 1998, une épidémie à EV-71 a touché plus de 90 000 enfants à Taiwan et a été la cause de 78 décès (Ho, Chen et al. 1999; Liu, Tseng et al. 2000). Plus récemment, une épidémie de syndrome pied-main-bouche a touché des nourrissons et des jeunes enfants dans la ville de Fuyang (province de l'Anhui) en Chine en 2008 : 4496 cas ont été répertoriés dont 22 mortels. Par ailleurs, la présentation clinique du RVH ne se limite pas au simple rhume, puisque ce virus est également associé aux otites moyennes aiguës chez l'enfant (Pitkaranta, Virolainen et al. 1998) et aux sinusites chez l'adulte (Pitkaranta, Arruda et al. 1997). De plus, il peut être la cause de complications graves chez les sujets à risque tels que les patients asthmatiques (Nicholson, Kent et al. 1993) ou ceux souffrant d'immunodéficience. Aucun traitement spécifique contre le Rhinovirus Humain n'est disponible actuellement et aucun vaccin n'existe pour prévenir cette infection puisque près de 100 sérotypes différents du RVH ont été caractérisés/ Le traitement de la maladie vise essentiellement à en soulager les symptômes. Enteroviruses may be responsible for various types of pathologies, benign or severe, such as acute flaccid paralysis, aseptic meningitis, foot-hand-mouth syndrome, respiratory diseases, colds, otitis, sinusitis, acute or chronic heart disease, diarrhea, pancreatitis In particular, since the end of the 1990s, the EV-71 has become much more aggressive in Asian countries and causes large-scale epidemics (Kairis, Sauter et al., 2009). For example, in 1998, an EV-71 epidemic affected more than 90,000 children in Taiwan and caused 78 deaths (Ho, Chen and others 1999, Liu, Tseng et al., 2000). More recently, an outbreak of foot-hand-mouth syndrome affected infants and young children in Fuyang City, Anhui Province, China in 2008: 4496 cases were reported including 22 deaths. Moreover, the clinical presentation of RVH is not limited to the simple cold, since this virus is also associated with acute otitis media in children (Pitkaranta, Virolainen et al., 1998) and adult sinusitis (Pitkaranta, Arruda et al., 1997). In addition, it can cause severe complications in at-risk subjects such as asthmatic patients (Nicholson, Kent et al., 1993) or those with immunodeficiency. No specific treatment against human rhinovirus is currently available and no vaccine exists to prevent this infection since nearly 100 different serotypes of RVH have been characterized / The treatment of the disease aims essentially to relieve the symptoms.
Différentes approches chimio-thérapeutiques ont tenté et tentent toujours de mieux combattre le RVH. Ces approches peuvent être classées en deux groupes et consistent à :  Different chemotherapeutic approaches have tried and are still trying to better combat RVH. These approaches can be divided into two groups and consist of:
1er groupe : 1st group:
(1) inhiber l'étape de déshabillage du virus par fixation de différents ligands au niveau de la capside. Plusieurs composés synthétiques ont fait l'objet d'essais cliniques aux Etats-Unis : Disoxaril (WIN 51711), WIN 54954, Pleconaril (WIN 63843, picovir), Pirodavir (R 77975) et R 61837 (Patick, 2006). Aucun d'entre eux n'a été approuvé par l'US Food and Drug Administration.  (1) inhibit the virus undressing step by attaching different ligands at the capsid. Several synthetic compounds have been the subject of clinical trials in the United States: Disoxaril (WIN 51711), WIN 54954, Pleconaril (WIN 63843, picovir), Pirodavir (R 77975) and R 61837 (Patick, 2006). None of them have been approved by the US Food and Drug Administration.
(2) empêcher l'attachement du virus sur son récepteur. Près de 90% des sérotypes du RVH utilisent le récepteur ICAM-1 pour se fixer aux cellules susceptibles d'être infectées. Ainsi, une des stratégies adoptées consisté à bloquer cette fixation en utilisant des formes solubles de ICAM-1 (sICAM-1) (Turner, Wecker et al. 1999; Turner 2001). Le Tremacamra (BIRR-4), mis au point par Boechringer Ingelheim, a été évalué dans 4 essais cliniques en double-aveugle (Turner, Wecker et al. 1999). Le Tremacamra est capable de réduire la gravité des rhumes provoqués de manière expérimentale qu'il soit administré avant ou après infection. Cette molécule semble, cependant, moins efficace quand elle est administrée à des temps variables de 12h et plus après infection. Par ailleurs, il a été rapporté qu'une réponse humorale peut se développer contre ces formes solubles de ICAM-1 et diminuer ainsi leur efficacité. (3) diminuer la réponse inflammatoire provoquée par l'infection par le RVH en utilisant des interférons. Les interférons sont au centre des réponses antivirales et anticancéreuses par l'intermédiaire de cascades de signalisation engendrées par leur fixation à des récepteurs spécifiques. Plusieurs études ont évalué l'efficacité d'un interféron alpha 2b recombinant dans la prévention ou le traitement de rhumes dus au RVH (Hayden, Albrecht et al. 1986; Sperber, Levine et al. 1989). Dans ces études, l'injection intranasale d'interféron s'est montrée efficace à la fois dans les rhumes « naturels » et expérimentaux, quand elle a été effectuée avant infection. Par contre, elle n'a eu peu ou pas d'effets, quand elle a été administrée chez des patients déjà infectés. Plusieurs effets secondaires, comme des saignements de la muqueuse nasale, ont également été relevés dans ces études. (2) prevent the attachment of the virus to its receptor. Nearly 90% of RVH serotypes use the ICAM-1 receptor to attach to susceptible cells. Thus, one of the strategies adopted was to block this fixation using soluble forms of ICAM-1 (sICAM-1) (Turner, Wecker et al 1999, Turner 2001). Tremacamra (BIRR-4), developed by Boechringer Ingelheim, has been evaluated in four double-blind clinical trials (Turner, Wecker et al., 1999). Tremacamra is capable of reducing the severity of experimentally induced colds whether administered before or after infection. This molecule seems, however, less effective when it is administered at variable times of 12 hours and more after infection. Moreover, it has been reported that a humoral response can develop against these soluble forms of ICAM-1 and thus reduce their effectiveness. (3) decrease the inflammatory response caused by RVH infection using interferons. Interferons are at the center of antiviral and anticancer responses via signaling cascades generated by their attachment to specific receptors. Several studies have evaluated the efficacy of recombinant interferon alpha 2b in the prevention or treatment of colds due to RVH (Hayden, Albrecht et al., 1986, Sperber, Levine et al., 1989). In these studies, intranasal injection of interferon has been shown to be effective in both "natural" and experimental colds, when done before infection. On the other hand, it has had little or no effect when administered to previously infected patients. Several side effects, such as bleeding from the nasal mucosa, have also been noted in these studies.
2ème groupe : 2nd group:
inhiber l'activité des protéases virales. Les protéases 3C (nommée 3Cpro) et 2A (nommée 2Apro) du rhinovirus sont des cibles thérapeutiques particulièrement intéressantes. En effet, elles jouent un rôle essentiel dans le cycle réplicatif du virus : elles catalysent la maturation du précurseur protéique viral et sont au centre des perturbations de certaines fonctions intracellulaires induites par l'infection par le Rhinovirus. Différents composés ont été testés pour leur capacité à inhiber l'activité de ces protéases. Le Rupintrivir (AG7088) et le Compound 1 pour la 3Cpro ; l'elastinal, le MPCMK (methoxysuccinyl-Ala-Ala-Pro-Val-chloromethylketone), le z-VAM.fmk et l'homophthalimide (LY353349) pour la 2Apro (Molla, Hellen et al. 1993; Wang, Johnson et al. 1998; Deszcz, Seipelt et al. 2004; Deszcz, Cencic et al. 2006). Aucun de ces composés n'est actuellement utilisé en thérapie et aucun essai clinique les incluant n'a été décrit dans la littérature. inhibit the activity of viral proteases. The proteases 3C (named 3Cpro) and 2A (called 2Apro) of the rhinovirus are particularly interesting therapeutic targets. Indeed, they play an essential role in the replicative cycle of the virus: they catalyze the processing of the viral protein precursor and are at the center of the disturbances of certain intracellular functions induced by the infection with Rhinovirus. Different compounds have been tested for their ability to inhibit the activity of these proteases. Rupintrivir (AG7088) and Compound 1 for 3Cpro; elastinal, MPCMK (methoxysuccinyl-Ala-Ala-Pro-Val-chloromethylketone), z-VAM.fmk and homophthalimide (LY353349) for 2Apro (Molla, Hellen et al., 1993; Wang, Johnson et al. 1998, Deszcz, Seipelt et al., 2004, Deszcz and Cencic et al., 2006). None of these compounds are currently used in therapy and no clinical trials including them have been described in the literature.
Plusieurs études ont également porté sur des peptides dérivés de la séquence de la polyprotéine du RVH (US5559025, CA208221, EP0263214 et EP0263202 notamment) qui présentent une activité inhibitrice de la 2Apro virale.  Several studies have also been carried out on peptides derived from the sequence of the polyprotein of the RVH (US5559025, CA208221, EP0263214 and EP0263202 in particular) which exhibit a viral 2Apro inhibitory activity.
Aujourd'hui, les besoins thérapeutiques pour le traitement des affections liées aux Rhinovirus, ne sont pas satisfaits. Aussi, dans ce contexte, la présente invention se propose de fournir de nouveaux peptidomimétiques, utiles pour le traitement d'une infection par un Entérovirus, et en particulier par un Rhinovirus Humain. Today, the therapeutic needs for the treatment of Rhinovirus-related conditions are not met. Also, in this In this context, the present invention proposes to provide novel peptidomimetics useful for the treatment of an enterovirus infection, and in particular a human rhinovirus.
La présente invention a donc pour objet les peptides dont la partie C- terminale a la séquence LVLQTM (SEQ ID N°9), ainsi que les dérivés chimiques de tels peptides, à l'exception de la protéine RBM6 delta 6.  The subject of the present invention is therefore the peptides whose C-terminal portion has the sequence LVLQTM (SEQ ID No. 9), as well as the chemical derivatives of such peptides, with the exception of the RBM6 delta 6 protein.
L'invention a également pour objet les dérivés chimiques de tels peptides qui correspondent à des peptides dont la partie C-terminale a la séquence LVLQTM (SEQ ID N°9), mais sont substitués sur le NH2 de leur extrémité N-terminale et/ou sur leur extrémité C-terminale par modification du groupement -COOH de la méthionine. En particulier, de tels peptides peuvent être substitués sur le NH2 de leur extrémité N-terminale par un groupement acétyle, un groupement benzoyle, un groupement tosyle ou un groupement benzyloxycarbonyle (Z), et/ou sur leur extrémité C-terminale par modification du groupement -COOH de la méthionine par amidation de la fonction hydroxyle du groupement -COOH de la méthionine par un groupement NYY avec Y qui représente une chaîne alkyle, notamment de 1 à 4 atomes de carbone, ou par estérification par un groupement alkyle, notamment de 1 à 4 atomes de carbone ou encore par formation d'une fluorométhylcétone. Selon un mode de réalisation particulier, de tels peptides sont substitués sur leur extrémité C-terminale par modification du groupement -COOH de la méthionine pour former une fluorométhylcétone. The subject of the invention is also the chemical derivatives of such peptides which correspond to peptides whose C-terminal portion has the sequence LVLQTM (SEQ ID No. 9), but are substituted on the NH 2 of their N-terminal end and or on their C-terminal end by modification of the -COOH group of the methionine. In particular, such peptides may be substituted on the NH 2 of their N-terminus by an acetyl group, a benzoyl group, a tosyl group or a benzyloxycarbonyl (Z) group, and / or on their C-terminal end by modification. of the -COOH group of the methionine by amidation of the hydroxyl function of the -COOH group of the methionine with an NYY group with Y which represents an alkyl chain, in particular of 1 to 4 carbon atoms, or by esterification with an alkyl group, in particular from 1 to 4 carbon atoms or by formation of a fluoromethylketone. According to a particular embodiment, such peptides are substituted on their C-terminal end by modifying the -COOH group of the methionine to form a fluoromethylketone.
Le peptide correspondant à la séquence LVLQTM (SEQ ID N°9), ainsi que les dérivés chimiques de ce peptide, et en particulier le peptide LVLQTM (SEQ ID N°9) dont le groupe NH2 de son extrémité N-terminale est fonctionnalisé par un groupe benzyloxycarbonyle et le groupe -COOH de sa méthionine C-terminale est modifié en une fluorométhylcétone sont des exemples de peptide conformes à l'invention. The peptide corresponding to the sequence LVLQTM (SEQ ID No. 9), as well as the chemical derivatives of this peptide, and in particular the peptide LVLQTM (SEQ ID No. 9) whose NH 2 group of its N-terminal end is functionalized by a benzyloxycarbonyl group and the -COOH group of its C-terminal methionine is modified to a fluoromethylketone are examples of peptide according to the invention.
Les peptides selon l'invention présentent une séquence peptidique LVLQTM (SEQ ID N°9) C-terminale qui correspond à un pseudo-substrat de la 2Apro du RVH-2 et qui mime la séquence P1-P6 (selon la nomenclature proposée par Schechter and Berger (Schechter and Berger 1968) du demi- site de clivage de certains substrats naturels de la 2Apro. Dans le cadre de l'invention, les inventeurs ont démontré que ce motif était directement impliqué dans (Interaction avec la 2Apro du RVH-2. De plus, les inventeurs ont démontré que les peptides selon l'invention présentent un spectre d'action plus large qui s'étend à d'autres 2Apro entérovi raies, et donc plus largement aux 2Apro des entérovirus, et également aux protéases 3C, et donc possiblement à toute protéase, virale ou non virale, en particulier ayant les mêmes propriétés catalytiques. The peptides according to the invention have a C-terminal peptide sequence LVLQTM (SEQ ID No. 9) which corresponds to a pseudo-substrate of the 2Apro of the RVH-2 and which mimics the sequence P1-P6 (according to the nomenclature proposed by Schechter and Berger (Schechter and Berger 1968) of the half cleavage site of some natural substrates of 2Apro. In the context of the invention, the inventors have demonstrated that this motif was directly involved in (Interaction with 2Apro of the RVH-2 In addition, the inventors have demonstrated that the peptides according to the invention exhibit a more active spectrum. It extends to other 2Apro enteroviruses, and therefore more broadly to 2Apro enteroviruses, and also to 3C proteases, and thus possibly to any protease, viral or non-viral, in particular having the same catalytic properties.
En effet, une interaction in vitro entre ces peptides, et en particulier du peptide LVLQTM (SEQ ID N°9) de l'extrémité C-terminale de la protéine cellulaire RBM6 delta 6 avec la protéase 2A ou la protéase 3C du RVH-2 a été mise en évidence. D'autre part, il a été démontré que de tels peptides se comportent comme des inhibiteurs réversibles de l'enzyme viral in vitro ainsi que dans des cellules de mammifères. De la même manière, il a été démontré que l'extrémité C-terminale de RBM6 delta 6 présente également des propriétés inhibitrices sur la 2Apro d'ECHOvirus 6, du poliovirus et de i'enterovirus 71 ce qui permet d'envisager les peptides selon l'invention comme des inhibiteurs des 2Apro entérovirales.  Indeed, an in vitro interaction between these peptides, and in particular the LVLQTM peptide (SEQ ID No. 9) of the C-terminal end of the RBM6 delta 6 cellular protein with the protease 2A or the protease 3C of the RVH-2 has been highlighted. On the other hand, it has been demonstrated that such peptides behave as reversible inhibitors of the viral enzyme in vitro as well as in mammalian cells. In the same way, it has been demonstrated that the C-terminal end of RBM6 delta 6 also has inhibitory properties on ECHOvirus 6, poliovirus and Iterovirus 71, which makes it possible to envisage the peptides according to the invention. the invention as inhibitors of enteroviral 2Apro.
L'invention concerne également, les peptides dont là partie C-terminale correspond à la séquence LVLQTM (SEQ ID N°9) selon l'invention, ainsi que la protéine RBM6 delta 6 sous une forme isolée, qui présentent une activité inhibitrice d'une protéase virale ou cellulaire, notamment une activité inhibitrice de la protéase 2A ou 3C du rhinovirus et/ ou d'une protéase (virale ou non virale) ayant, en particulier, les mêmes propriétés catalytiques que la protéase 2A du rhinovirus.  The invention also relates to the peptides of which the C-terminal portion corresponds to the sequence LVLQTM (SEQ ID No. 9) according to the invention, as well as the RBM6 delta 6 protein in an isolated form, which exhibit inhibitory activity. a viral or cellular protease, in particular an inhibitory activity of the protease 2A or 3C of the rhinovirus and / or a protease (viral or non-viral) having, in particular, the same catalytic properties as the protease 2A rhinovirus.
Selon un autre de ses aspects, l'invention a également pour objet les peptides dont la partie C-terminale a la séquence LVLQTM (SEQ ID N°9), les dérivés chimiques de tels peptides, ainsi que la protéine RBM6 delta 6 sous une forme isolée, utilisés à des fins diagnostiques ou pour le traitement thérapeutique ou prophylactique d'une infection à Entérovirus ou pour la fabrication d'un médicament destiné au traitement thérapeutique ou prophylactique d'une infection à Entérovirus, ainsi que les compositions pharmaceutiques les comprenant, en association avec un excipient pharmaceutiquement acceptable. According to another of its aspects, the subject of the invention is also the peptides whose C-terminal part has the sequence LVLQTM (SEQ ID No. 9), the chemical derivatives of such peptides, as well as the RBM6 delta 6 protein in a isolated form, used for diagnostic purposes or for the therapeutic or prophylactic treatment of Enterovirus infection or for the manufacture of a medicament for the therapeutic or prophylactic treatment of Enterovirus infection, as well as the compositions pharmaceutical compositions comprising them, in association with a pharmaceutically acceptable excipient.
Avant de donner une description plus détaillée de l'invention, un certain nombre de définitions des termes employés pour définir l'invention va être rappelé.  Before giving a more detailed description of the invention, a number of definitions of the terms used to define the invention will be recalled.
Par « peptide », on entend tout enchaînement d'acides aminés, sans limitation supérieure de taille. Le terme peptide englobe donc les peptides de grande taille, classiquement qualifiés de protéines. Les peptides revendiqués ont une partie C-terminale bien définie et, par contre, le reste du peptide peut présenter une grande variabilité. Le terme « peptide » désigne un enchaînement de deux ou plusieurs acides aminés liés entre eux par des liaisons peptidiques ou par des liaisons peptidiques modifiées. En dehors de leur partie C-terminale correspondant à la séquence LVLQTM (SEQ ID N°9), les acides aminés présents au sein des peptides selon l'invention, à moins qu'il n'en soit spécifié autrement, peuvent être des acides aminés naturels : Leucine (Leu), Glycine (Gly), alanine (Ala), Isoleucine (Ile), Valine (val), Sérine (Ser) Thréonine (Thr), Phénylalanine (Phe), Tryptophane (Trp), Tyrosine (Tyr), Proline (pro), Cystéine (Cys), Méthionine (Met), Asparagine (Asn), Glutamine (Gin), Arginine (Arg), Lysine (Lys), Histidine (His), Acide Aspartique (Asp), Acide glutamique (Glu) qui sont de conformation L, ou bien des acides aminés non naturels, nommés acides aminés non conventionnels tels que notamment les acides aminés ci-dessous :  By "peptide" is meant any sequence of amino acids, without greater limitation of size. The term peptide therefore encompasses large peptides, classically referred to as proteins. The claimed peptides have a well-defined C-terminus and, on the other hand, the rest of the peptide can exhibit great variability. The term "peptide" refers to a sequence of two or more amino acids linked together by peptide bonds or modified peptide bonds. Apart from their C-terminal portion corresponding to the sequence LVLQTM (SEQ ID No. 9), the amino acids present in the peptides according to the invention, unless otherwise specified, may be acids natural amines: Leucine (Leu), Glycine (Gly), Alanine (Ala), Isoleucine (Ile), Valine (val), Serine (Ser) Threonine (Thr), Phenylalanine (Phe), Tryptophan (Trp), Tyrosine (Tyr ), Proline (pro), Cysteine (Cys), Methionine (Met), Asparagine (Asn), Glutamine (Gin), Arginine (Arg), Lysine (Lys), Histidine (His), Aspartic Acid (Asp), Glutamic acid (Glu) which are conformation L, or non-natural amino acids, named unconventional amino acids such as in particular the amino acids below:
Nie = L-norleucine ; Aabu = acide α-aminobutyrique ; Hphe = L- homophénylalanine ; Nva = L-norvaline ; Gabu = acide γ-aminobutyrique ; Dala = D-alanine ; Deys = D-cysteine; Dasp = acide D-aspartique; Dglu = acide D-glutamique ; Dphe = D-phénylalanine ; Dhis = D-histidine ; Dile = D-isoleucine ; Dlys = D-lysine ; Dieu = D-leucine ; Dmet = D-méthionine ; Dasn = D-asparagine ; Dpro = D-proline ; Dgln = D-glutamine ; Darg = D- arginine ; Dser = D-serine ; Dthr = D-thréonine ; Dval = D-valine ; Dtrp = D- tryptophan ; Dtyr = D-tyrosine ; Dorn = D-ornithine ; Aib = acide aminoisobutyrique ; Etg = L-éthylglycine ; Tbug = L-t-butylglycine ; Pen = pénicillamine ; Anap = a-naphthylalanine ; Chexa = cyclohexylalanine ; Cpen - cyclopentylalanine ; Cpro = aminocyclopropane carboxylate ; Norb = aminonorbornylcarboxylate ; Mala = L-a-méthylalanine ; Mcys = L-a- méthylcysteine ; Masp = acide L-a-méthylaspartique ; Mglu = acide L-α- méthylglutamique ; phe = L-a-méthylphénylalanine ; Mhis = L- - méthylhistidine ; Mile = L-a-méthylisoieucine ; Miys = L-a-méthyllysine ; Mleu = L-a-méthylleucine ; Mmet ~ L-a-méthylméthionine ; Masn = L-a- méthylasparagine ; Mpro = L- -méthylproline ; Mgln = L-a-méthylglutamine ; Marg = L-a-méthylarginine ; Mser = L-a-méthylsérine ; Mthr = L-a- méthylthréonine ; Mval = L- -méthylvaline ; Mtrp = L-a-méthyltryptophan ; Mtyr = L- -méthyltyrosine ; Morn = L-a-méthylornithine ; Mnle = L-a- méthylnorleucine ; Maabu = acide α-amino- -méthylbutyrique ; Mnva = L-a- méthylnorvaline ; Mhphe = L-a-méthylhomophénylalanine ; Metg - L-a- méthyléthylglycine ; Mgabu = acide a-méthyl-y-aminobutyrique ; Maib = acide α-méthylaminoisobutyrique ; Mtbug = L-a-méthyl4-butylglycine ; Mpen = -méthylpeniciilamine; Manap = α-méthyl- -naphthylalanine ; Mchexa = α-méthylcyclohexylalanine ; Mcpen = a-méthylcycloperitylalanine ; Dmala = D-a-méthylaianine ; Dmorn = D-a-méthylornithine ; Dmcys = D-a- méthylcystéine ; Dmasp = acide α-méthylaspartique ; Dmglu = acide D-a- méthylglutamique ; Dmphe = D-a-méthylphénylalanine ; Dmhis = D-a- méthylhistidine ; Dmile = D-a-méthylisoleucine ; Dmlys = D-a-méthyllysine ; Dmleu = D-a-méthylleucine ; Dmmet = D-a-méthylméthionine ; Dmasn = D- α-méthylasparagine ; Dmpro = D-a-méthylproline; Dmgln = D-a- méthylglutamine ; Dmarg = D-a-méthylarginine; Dmser = D-a-méthylserine ; Dmthr = D-a-méthylthréonine ; Dmval = D-a-méthylvaline ; Dmtrp = D-a- méthyltryptophan ; Dmtyr = D-a-méthyltyrosine ; Nmala = L-N- méthylalanine ; Nmcys = L-N-méthylcystéine ;Nmasp = acide L-N- méthylaspartique ; Nmglu = acide L-N-méthylglutamique ; Nmphe = L-N- méthylphénylalanine ; Nmhis = L-N-méthylhistidine ; Nmile = L-N- méthyiisoleucine ; Nmlys = L-N-méthyllysine ; Nmleu = L-N-méthylleucine ; Nmmet = L-N-méthylméthionine ; Nmasn = L-N-méthylasparagine; Nmchexa = N-méthylcyclohexylalanine ; Nmgln = L-N-méthylglutamine ; Nmarg = L- N-méthylarginine ; Nmser = L-N-méthylsérine ; Nmthr = L-N- méthylthréonine ; Nmval = L-N-méthylvaline; Nmtrp = L-N- méthyltryptophan; Nmtyr = L-N-méthyltyrosine ; Nmorn = L-N- méthylornithine ; Nmnle = L-N-méthylnorleucine ; Nmaabu - acide N-amino- -méthylbutyrique ; Nmnva = L-N-méthylnorvaline ; Nmhphe = L-N- méthylhomophénylalanine ; Nmetg = L-N-méthyléthylglycine ; Nmgabu = acide N-méthyl-y-aminobutyrique ; Nmcpen = N-méthylcyciopentylalanine ; Nmtbug = L-N-méthyl-f-butylglycine ; Nmpen = N-méthylpénicillamine ; Nmanap = N-méthyl- -naphthylalanine ; Nmaib = acide N- méthylaminoisobutyrique ; Dnmala = D-N-méthylalanine; Dnmorn = D-N- méthylornïthine ; Dnmcys = D-N-méthylcystéine ; Dnmasp = D-N- méthylaspartique acide ; Dnmglu = acide D-N-méthylg!utamique ; Dnmphe = D-N-méthylphénylalanine ; Dnmhis = D-N-méthy!histidine ; Dnmile = D-N- méthylisoleucine ; Dnmlys = D-N-méthyllysine ; Dnmleu = D-N- méthylleucine ; Dnmmet = D-N-méthy!méthionine ; Dnmasn = D-N- méthylasparagine ; Dnmpro = D-N-méthylproline ; Dnmgln = D-N- méthylglutamine ; Dnmarg = D-N-méthylarginine ; Dnmser = D-N- méthylsérine ; Dnmthr = D-N-méthylthréonine ; Dnmval = D-N-méthylvaline; Dnmtrp = D-N-méthyltryptophan ; Dnm yr = D-N-méthyltyrosine ; Nala = N- méthylglycine (sarcosine) ; Nasp = N-(carboxyméthyl)glycine ; Nglu = N-(2- carboxyéthy!)glycine ; Nphe = N-benzylglycine ; Nhhis = N- (imidazolyléthyl)glycine ; Nile = N-(l-méthylpropyl)glycine ; Nlys = N-(4- aminobutyl)glycine ; Nleu = N-(2-méthylpropyl)glycine ; Nmet = N-(2- méthylthioéthyl)glycine ; Nhser = N-(hydroxyéthyl)glycine ; Nasn = N- (carbamyiméthyl)glycine ; Ngln = N-(2 carbamyléthyl)giycine ; Nval = N-(l- méthyléthyl)glyctne ; Narg = N-(3-guanidinopropyl)glycine ; Nhtrp = N-(3- indolyléthyl)glycine ; Nhtyr = N-(phydroxyphénéthyl)glycine ; Nthr = N-(l- hydroxyéthyl)glycine ; Ncys = N-(thiométhyl)glycine ; and Nom = N-(3- aminopropyl)glycine ; Ncpro = N-cyclopropylgiycine ; Ncbut = N- cyclobutyglycine ; Nchex = N-cyclohexylglycine ; Nchep = N- cyctoheptylglycine ; Ncoct = N-cydooctylglycine ; Ncdec = N- cyclodécylglycine ; Ncund = N-cycloundécylglycine ; Ncdod = N- cyclododécylglycine ; Nbhm = N-(2,2-diphényléthyl)glycine ; Nbhe = N-(3,3- diphénylpropyl)glycine ; Nnbhm = N-(N-(2,2- diphényléthyl)carbamylméthyl)glycine ; Nnbhe = N-(N-(3,3- diphénylpropyl)carbamylméthyl)glycine ; Nbmc = l-carboxy-l-(2,2- diphényiéthylamino)cyclopropane ; et Naeg = N-(2-aminoéthyl)glycine. Nie = L-norleucine; Aabu = α-aminobutyric acid; Hphe = L-homophenylalanine; Nva = L-norvaline; Gabu = γ-aminobutyric acid; Dala = D-alanine; Deys = D-cysteine; Dasp = D-aspartic acid; Dglu = D-glutamic acid; Dphe = D-phenylalanine; Dhis = D-histidine; Dile = D-isoleucine; Dlys = D-lysine; God = D-leucine; Dmet = D-methionine; Dasn = D-asparagine; Dpro = D-proline; Dgln = D-glutamine; Darg = D-arginine; Dser = D-serine; Dthr = D-threonine; Dval = D-valine; Dtrp = D-tryptophan; Dtyr = D-tyrosine; Dorn = D-ornithine; Aib = aminoisobutyric acid; Etg = L-ethylglycine; Tbug = N-butylglycine; Pen = penicillamine; Anap = α-naphthylalanine; Chexa = cyclohexylalanine; Cpen cyclopentylalanine; Cpro = aminocyclopropane carboxylate; Norb = aminonorbornylcarboxylate; Mala = La-methylalanine; Mcys = L-methylcysteine; Masp = L-methylaspartic acid; Mglu = L-α-methylglutamic acid; phe = La-methylphenylalanine; Mhis = L- methylhistidine; Mile = La-methylisoieucine; Miys = La-methyllysine; Mleu = La-methylleucine; Mmet ~ La-methylmethionine; Masn = L-methylasparagine; Mpro = L-methylproline; Mgln = La-methylglutamine; Marg = La-methylarginine; Mser = La-methylserine; Mπr = L-methylthreonine; Mval = L-methylvaline; Mtrp = La-methyltryptophan; Mtyr = L-methyltyrosine; Morn = La-methylornithine; Mnle = L-methylnorleucine; Maabu = α-amino-methylbutyric acid; Mnva = L-methylnorvaline; Mhphe = La-methylhomophenylalanine; Metg - L-methylethylglycine; Mgabu = α-methyl-γ-aminobutyric acid; Maib = α-methylaminoisobutyric acid; Mtbug = La-methyl-4-butylglycine; Mpen = methylpeniciilamine; Manap = α-methyl-naphthylalanine; Mchexa = α-methylcyclohexylalanine; Mcpen = a-methylcycloperitylalanine; Dmala = Da-methylaianine; Dmorn = Da-methylornithine; Dyscys = D-methylcysteine; Dmasp = α-methylaspartic acid; Dmglu = D-methylglutamic acid; Dmphe = Da-methylphenylalanine; Dmhis = D-methylhistidine; Dmile = Da-methylisoleucine; Dmlys = Da-methyllysine; Dmleu = Da-methylleucine; Dmmet = Da-methylmethionine; Dmasn = D-α-methylasparagine; Dmpro = Da-methylproline; Dmgln = D-methylglutamine; Dmarg = Da-methylarginine; Dmser = Da-methylserine; Dmthr = Da-methylthreonine; Dmval = Da-methylvaline; Dmtrp = D-methyltryptophan; Dmtyr = Da-methyltyrosine; Nmala = LN-methylalanine; Nmcys = LN-methylcysteine Nmasp = LN-methylaspartic acid; Nmglu = LN-methylglutamic acid; Nmphe = LN-methylphenylalanine; Nmhis = LN-methylhistidine; Nmile = LN-methylisoleucine; Nmlys = LN-methyllysine; Nmleu = LN-methylleucine; Nmmet = LN-methylmethionine; Nmasn = LN-methylasparagine; Nmchexa = N-methylcyclohexylalanine; Nmgln = LN-methylglutamine; Nmarg = L- N-methylarginine; Nmser = LN-methylserine; Nmthr = LN-methylthreonine; Nmval = LN-methylvaline; Nmtrp = LN-methyltryptophan; Nmtyr = LN-methyltyrosine; Nmorn = LN-methylornithine; Nmnle = LN-methylnorleucine; Nmaabu - N-amino-methylbutyric acid; Nmnva = LN-methylnorvaline; Nmhphe = LN-methylhomophenylalanine; Nmetg = LN-methylethylglycine; Nmgabu = N-methyl-y-aminobutyric acid; Nmcpen = N-methylcyciopentylalanine; Nmtbug = LN-methyl-f-butylglycine; Nmpen = N-methylpenicillamine; Nmanap = N-methyl-naphthylalanine; Nmaib = N-methylaminoisobutyric acid; Dnmala = DN-methylalanine; Dnmorn = DN-methylornithine; Dnmcys = DN-methylcysteine; Dnmasp = DN-methylaspartic acid; Dnmglu = DN-methylgamic acid; Dnmphe = DN-methylphenylalanine; Dnmhis = DN-methyl Histidine; Dnmile = DN-methylisoleucine; Dnmlys = DN-methyllysine; Dnmleu = DN-methylleucine; Dnmmet = DN-methyl methionine; Dnmasn = DN-methylasparagine; Dnmpro = DN-methylproline; Dnmgln = DN-methylglutamine; Dnmarg = DN-methylarginine; Dnmser = DN-methylserine; Dnmthr = DN-methylthreonine; Dnmval = DN-methylvaline; Dnmtrp = DN-methyltryptophan; Dnm yr = DN-methyltyrosine; Nala = N-methylglycine (sarcosine); Nasp = N- (carboxymethyl) glycine; Nglu = N- (2-carboxyethyl) glycine; Nphe = N-benzylglycine; Nhhis = N- (imidazolylethyl) glycine; Nile = N- (1-methylpropyl) glycine; Nly = N- (4-aminobutyl) glycine; Nleu = N- (2-methylpropyl) glycine; Nmet = N- (2-methylthioethyl) glycine; Nhser = N- (hydroxyethyl) glycine; Nasn = N- (carbamyimethyl) glycine; Ngln = N- (2 carbamylethyl) glycine; Nval = N- (1-methylethyl) glycine; Narg = N- (3-guanidinopropyl) glycine; Nhtrp = N- (3-indolylethyl) glycine; Nhtyr = N- (phydroxyphenethyl) glycine; Nthr = N- (1-hydroxyethyl) glycine; Ncys = N- (thiomethyl) glycine; and Name = N- (3-aminopropyl) glycine; Ncpro = N-cyclopropylglycine; Ncbut = N-cyclobutyglycine; Nchex = N-cyclohexylglycine; Nchep = N-cytoheptylglycine; Nococt = N-cyclooctylglycine; Ncdec = N-cyclodecylglycine; Ncund = N-cycloundecylglycine; Ncdod = N- cyclododecylglycine; Nbhm = N- (2,2-diphenylethyl) glycine; Nbhe = N- (3,3-diphenylpropyl) glycine; Nnbhm = N- (N- (2,2-diphenylethyl) carbamylmethyl) glycine; Nnbhe = N- (N- (3,3-diphenylpropyl) carbamylmethyl) glycine; Nbmc = 1-carboxy-1- (2,2-diphenylethylamino) cyclopropane; and Naeg = N- (2-aminoethyl) glycine.
Dans le cadre de l'invention, le terme général « acide aminé » désigne donc les acides aminés naturels et les acides aminés non naturels, nommés acides aminés non conventionnels.  In the context of the invention, the general term "amino acid" therefore refers to natural amino acids and non-natural amino acids, called unconventional amino acids.
Par « acide aminé non conventionnel dérivé d'un acide aminé naturel », on entend un aminoacide appartenant à la liste ci-dessus dont le nom comporte le nom de l'acide aminé naturel dont il est le dérivé.  By "unconventional amino acid derived from a natural amino acid" is meant an amino acid belonging to the above list whose name includes the name of the natural amino acid from which it is derived.
Par « dérivé chimique » des peptides selon l'invention, on entend des peptides qui comportent un ou plusieurs groupements additionnels qui ne sont naturellement pas présents sur des séquences peptidiques. En particulier, l'acide aminé extrême en N-terminale et/ou la méthionine en C- terminale pourra(ont) être fonctionnalisé(s), avec, par exemple, l'une des fonctions ci-dessous. De tels groupements ont, par exemple, pour fonction d'améliorer leur solubilité ou leur demi-vie en milieu biologique (tel que, par exemple, le groupement Z - -C(0)OBz avec Bz = benzyle qui permet au peptide de mieux franchir la membrane plasmique des cellules), ou encore de réduire leur toxicité ou des effets secondaires indésirables, ou encore de former une liaison covalente irréversible avec leur protéine cible (tel que, par exemple, le groupement fmk - fluorométhylcétone qui peut former un lien covalent avec la cystéine catalytique du centre actif d'un enzyme) pour notamment effectuer des études c stallographiques. Egalement, de façon à améliorer leur résistance à la dégradation in vivo, les peptides selon l'invention peuvent être sous forme protégée. Compte tenu de l'application des peptides selon l'invention, la forme de protection doit évidemment être une forme biologiquement compatible et doit être, de préférence, compatible avec une utilisation en prophylatique et en thérapeutique. De nombreuses formes de protection biologiquement compatibles, bien connues de l'homme de l'art, peuvent être envisagées. A titre d'exemple, on peut citer Pacylation ou l'acétylation de l'extrémité amino-terminale, ou l'amidation ou l'estérification de l'extrémité carboxy-terminale du peptide. Ainsi, les peptides selon l'invention pourront être substitués sur leur extrémité N-terminale par un groupement acétyle, un groupement benzoyle, un groupement tosyle ou un groupement benzyloxycarbonyle (Z), ou sur leur extrémité C-terminale par amidation de la fonction hydroxyle du groupement -COOH de la méthionine par un groupement NYY avec Y qui représente une chaîne alkyle, notamment de 1 à 4 atomes de carbone, ou par estérification par un groupement alkyle, notamment de 1 à 4 atomes de carbone. Il est également possible que les deux extrémités du peptide soient protégées. Par conséquent, les dérivés chimiques des peptides peuvent ne pas comprendre exactement la séquence LVLQTM (SEQ ID N°9), mais une séquence LVLQTM dans laquelle un seul ou au moins un acide aminé a été fonctionnalisé, en particulier avec une fonction ci-dessus mentionnée. The term "chemical derivative" of the peptides according to the invention is understood to mean peptides which comprise one or more additional groups which are not naturally present on peptide sequences. In particular, the extreme N-terminal amino acid and / or C-terminal methionine may be functionalized, with, for example, one of the functions below. Such groups have, for example, the function of improving their solubility or their half-life in a biological medium (such as, for example, the group Z - -C (O) OBz with Bz = benzyl which allows the peptide to be better to cross the plasma membrane of cells), or to reduce their toxicity or undesirable side effects, or to form an irreversible covalent bond with their target protein (such as, for example, the group fmk-fluoromethylketone which can form a covalent bond with the catalytic cysteine of the active center of an enzyme) in particular to carry out stallographic studies. Also, in order to improve their resistance to degradation in vivo, the peptides according to the invention can be in protected form. In view of the application of the peptides according to the invention, the form of protection must obviously be a biologically compatible form and must preferably be compatible with prophylactic and therapeutic use. Many biologically compatible forms of protection, well known to those skilled in the art, can be envisaged. By way of example, mention may be made of Pacylation or acetylation of the amino-terminus, or amidation or esterification of the carboxy-terminus of the peptide. Thus, the peptides according to the invention may be substituted on their N-terminal end with an acetyl group, a benzoyl group, a tosyl group or a benzyloxycarbonyl (Z) group, or on their C-terminus by amidation of the hydroxyl function. of the -COOH group of the methionine with a group YYY with Y which represents an alkyl chain, in particular of 1 to 4 carbon atoms, or by esterification with an alkyl group, in particular of 1 to 4 carbon atoms. It is also possible that both ends of the peptide are protected. Therefore, the chemical derivatives of the peptides may not exactly comprise the sequence LVLQTM (SEQ ID NO: 9), but an LVLQTM sequence in which only one or at least one amino acid has been functionalized, in particular with a function above mentioned.
Dans le cadre de l'invention, les peptides ou protéines naturel(le)s sont, de préférence, utilisé(e)s sous une forme isolée. Par peptide ou protéine « purifié » ou « isolé », on entend que le peptide ou la protéine en question est obtenu sous une forme substantiellement exempte de macromolécules du même type. C'est-à-dire que de préférence, le peptide ou la protéine en question représente au moins 75% en masse, préférentiellement au moins 85% en masse, et plus préférentiellement au moins 95% en masse, voire plus de 98% en masse des macromolécules biologiques présentes du même type (mais de l'eau, des tampons ou des molécules de faibles masses moléculaires, notamment inférieurs à 1000 daltons peuvent être présentes). Les procédés de purification sont connus de l'homme du métier. Une protéine d'origine naturelle peut, par exemple, être purifiée à partir de lysats ■ et extraits cellulaires, du surnageant du milieu de culture, par des méthodes utilisées individuellement ou en combinaison, telles que le fractionnement, les méthodes de chromatographie, les techniques d'immunoaffinité à l'aide d'anticorps mono ou polyclonaux spécifiques, etc In the context of the invention, the natural peptides or proteins (Ie) are preferably used in an isolated form. By "purified" or "isolated" peptide or protein is meant that the peptide or protein in question is obtained in a form substantially free of macromolecules of the same type. That is to say, preferably, the peptide or the protein in question represents at least 75% by weight, preferably at least 85% by weight, and more preferably at least 95% by weight, or even more than 98% by weight. mass of biological macromolecules present of the same type (but water, buffers or molecules of low molecular weight, especially less than 1000 daltons may be present). Purification methods are known to those skilled in the art. A naturally occurring protein can, for example, be purified from lysates ■ and cell extracts, the supernatant of the culture medium by methods used individually or in combination, such as fractionation, chromatography methods, techniques immunoaffinity using specific mono or polyclonal antibodies, etc.
Dans le cadre de l'invention, les peptides peuvent présenter n'importe quelle taille, mais comprennent au moins les 6 acides aminés SEQ ID N°9 LVLQTM (IMH.2->COOH) tels que définis dans le cadre de l'invention. Lorsque plus de 6 acides aminés sont présents au sein des peptides selon l'invention, la liaison à la séquence LVLQTM se fait via la première Leucine. Chacun des acides aminés présents au sein des peptides selon l'invention peut être un acide aminé naturel ou non conventionnel. Les peptides selon l'invention comportent, par exemple, de 6 à 1000 acides aminés. Néanmoins, lorsque les peptides selon l'invention devront être administrés dans une composition pharmaceutique, en fonction de la nature de cette composition, il pourra être avantageux que leur taille ne dépasse pas 50, voire 20 amino-acides. Selon un mode de réalisation particulier, ces peptides correspondront à des peptides artificiels. C'est-à-dire qu'ils ne correspondront pas à la séquence entière d'une protéine biologique. Par « protéine biologique », on entend toute protéine présente à l'état naturel et produite naturellement par un organisme vivant, et notamment la protéine RBM6 delta 6 de séquence : MWGDSRPANR TGPFRGSQEE RFAPGWNRDY PPPPLKSHAQ ERHSGNFPGR DSLPFDFQGH SGPPFANVEE HSFSYGARDG PHGDYRGGEG PGHDFRGGDF SSSDFQSRDS SQLDFRGRDI HSGDFRDREG PPMDYRGGDG TSMDYRGREA PHMNYRDRDA HAVDFRGRDA PPSDFRGRGT YDLDFRGRDG SHADFRGRDL SDLDFRAREQ SRSDFRNRDV SDLDFRDKDG TQVDFRGRGS GTTDLDFRDR DTPHSDFRGR HRSRTDQDFR GREMGSCMEF KDREMPPVDP NILDYIQPST QDREHSGMNV NRREESTHDH TIERPAFGIQ KGEFEHSETR EGETQGVAFE HESPADFQNS QSPVQDQDKS QLSGREEQSS DAGLFKEEGG LDFLGRQDTD YRSMEYRDVD HRLPGSQMFG YGQSKSFPEG KTARDAQRDL QDQDYRTGPS EEKPSRLIRL SGVPEDATKE EILNAFRTPD GMPVKNLQLK EYNTGNSNDP GQRSYPGVCI KPGFLVLQTM (SEQ ID N°l) dont la séquence ADN a été soumise le 9 octobre 2007 dans GenBank et porte la référence FU56542). In the context of the invention, the peptides may be of any size, but comprise at least the 6 amino acids SEQ ID No. 9 LVLQTM (IMH.2-> COOH) as defined in the context of the invention. When more than 6 amino acids are present in the peptides according to the invention, the binding to the LVLQTM sequence is via the first Leucine. Each of the amino acids present in the peptides according to the invention may be a natural or unconventional amino acid. The peptides according to the invention comprise, for example, from 6 to 1000 amino acids. Nevertheless, when the peptides according to the invention will have to be administered in a pharmaceutical composition, depending on the nature of this composition, it may be advantageous that their size does not exceed 50 or 20 amino acids. According to a particular embodiment, these peptides will correspond to artificial peptides. That is, they will not match the entire sequence of a biological protein. By "biological protein" is meant any protein naturally occurring and naturally produced by a living organism, and especially the RBM6 delta 6 protein of sequence: MWGDSRPANR TGPFRGSQEE RFAPGWNRDY PPPPLKSHAQ ERHSGNFPGR DSLPFDFQGH SGPPFANVEE HSFSYGARDG PHGDYRGGEG PGHDFRGGDF SSSDFQSRDS SQLDFRGRDI HSGDFRDREG PPMDYRGGDG TSMDYRGREA PHMNYRDRDA HAVDFRGRDA PPSDFRGRGT YDLDFRGRDG SHADFRGRDL SDLDFRAREQ SRSDFRNRDV SDLDFRDKDG TQVDFRGRGS GTTDLDFRDR DTPHSDFRGR HRSRTDQDFR GREMGSCMEF KDREMPPVDP NILDYIQPST QDREHSGMNV NRREESTHDH TIERPAFGIQ KGEFEHSETR EGETQGVAFE HESPADFQNS QSPVQDQDKS QLSGREEQSS DAGLFKEEGG LDFLGRQDTD YRSMEYRDVD HRLPGSQMFG YGQSKSFPEG KTARDAQRDL QDQDYRTGPS EEKPSRLIRL SGVPEDATKE EILNAFRTPD GMPVKNLQLK EYNTGNSNDP GQRSYPGVCI KPGFLVLQTM (SEQ ID NO: l) in which the DNA sequence has been submitted October 9, 2007 in GenBank and reference FU56542).
Par « activité inhibitrice d'une protéase», on entend une activité inhibitrice minimale de 50% sur au moins un test de référence pour mesurer l'activité inhibitrice sur ladite protéase. Pour la protéase 2A du Rhinovirus 2, on pourra prendre comme test de référence un test d'hydrolyse du substrat colorimétrique TRPIITTA (SEQ ID N°18)-pNa, et notamment le test décrit dans les exemples ci-après. Le terme « traitement » désigne toute mesure thérapeutique prophylactique ou suppressive d'une maladie ou désordre conduisant à un effet clinique souhaitable ou à tout effet bénéfique, incluant notamment la suppression ou la diminution de un ou plusieurs symptômes, la régression, le ralentissement ou la cessation de la progression du virus ou du désordre qui y est associé. By "inhibitory activity of a protease" is meant a minimum inhibitory activity of 50% on at least one reference test for measuring the inhibitory activity on said protease. For the protease 2A of Rhinovirus 2, a test of hydrolysis of the colorimetric substrate TRPIITTA (SEQ ID No. 18) -pNa, and in particular the test described in the examples below, may be used as a reference test. The term "treatment" means any prophylactic or suppressive therapeutic measure of a disease or disorder leading to a desirable clinical effect or any beneficial effect, including in particular the suppression or decrease of one or more symptoms, regression, slowing or cessation of the progression of the virus or the disorder associated with it.
Par « quantité thérapeutiquement efficace », on désigne toute quantité d'une composition qui améliore un ou plusieurs des paramètres caractéristiques de l'affection virale traitée.  By "therapeutically effective amount" is meant any amount of a composition that improves one or more of the characteristic parameters of the viral condition being treated.
Certains modes de mise en œuvre de l'invention vont maintenant être décrits de manière plus précise.  Some embodiments of the invention will now be described in more detail.
L'invention a notamment pour objet une famille plus spécifique de peptides tels que précédemment définis. Notamment, l'invention concerne les peptides qui correspondent à la séquence LVLQT (SEQ ID N°9), ainsi que les dérivés chimiques de tels peptides.  The invention particularly relates to a more specific family of peptides as previously defined. In particular, the invention relates to the peptides which correspond to the sequence LVLQT (SEQ ID No. 9), as well as the chemical derivatives of such peptides.
Dans les différents peptides selon l'invention, la présence d'une méthionine en position extrême C-terminale favorise l'interaction du peptide avec la protéase ciblée. C'est ce qui a été démontré dans la publication de (Deszcz, Cencic et al. 2006), pour la protéase 2Apro du RVH où le composé zVAD.fmk, un inhibiteur de caspases capable d'inhiber à la fois l'activité des 2Apro du RVH et CBV4 in vitro et la réplication de ces virus, a été modifié par ajout d'un groupement méthyl ester sur l'aspartate ou remplacement du résidu aspartate par une méthionine en position PI dans zVAD.fmk et a permis de limiter l'action de ce composé sur les protéases 2A et, ainsi, augmenter sa spécificité vis-à-vis des protéases virales.  In the different peptides according to the invention, the presence of a methionine C-terminal extreme promotes the interaction of the peptide with the targeted protease. This has been demonstrated in the publication of (Deszcz, Cencic et al., 2006), for the 2Apro protease of the RVH where the compound zVAD.fmk, a caspase inhibitor capable of inhibiting both the activity of the 2Apro of the in vitro RVH and CBV4 and the replication of these viruses, was modified by addition of a methyl ester group on aspartate or replacement of the aspartate residue by a methionine in the PI position in zVAD.fmk and allowed to limit the action of this compound on proteases 2A and thus increase its specificity with respect to viral proteases.
Les peptides selon l'invention peuvent être obtenus par protéolyse ou de manière synthétique, par voie chimique. En particulier, les peptides selon l'invention peuvent être obtenus par synthèse chimique en phase solide ou en phase homogène liquide, ou bien par synthèse enzymatique, ou par génie génétique, selon les techniques bien connues de l'homme de l'art.  The peptides according to the invention can be obtained by proteolysis or synthetically, chemically. In particular, the peptides according to the invention can be obtained by solid phase or liquid homogeneous chemical synthesis, or by enzymatic synthesis, or by genetic engineering, according to techniques well known to those skilled in the art.
Les peptides selon l'invention, mais également la protéine RBM6 delta 6 dont la fonction biologique n'avait pas encore été identifiée, sont particulièrement intéressants sur les plans prophylactique et thérapeutique, pour le traitement des infections à Entérovirus, chez les mammifères et, en particulier chez l'homme, et en particulier des infections à Rhinovirus humains, tels que le RVH-2, des infections à Echovirus tel que TECHO-6, ou encore des infections à poliovirus, des infections à coxsackievirus et des infections causées par l'entérovirus 71 dont l'activité de la protéase 2A est aussi inhibée par le motif LVLQTM (SEQ ID N°9). Les peptides selon l'invention et la protéine RBM6 delta 6 isolée pourront donc être utilisés en tant que médicaments pour le traitement de rhumes, otites, sinusites, ou encore de paralysies flasques aiguës, méningites aseptiques, syndrome pieds-mains-bouche, maladies respiratoires, cardiopathies aiguës ou chroniques, diarrhées, pancréatites, atteintes oculaires, encéphalites. Ils pourront également être utilisés pour diagnostiquer les entérovirus présents dans des prélèvements biologiques. The peptides according to the invention, but also the RBM6 delta 6 protein whose biological function had not yet been identified, are of particular interest for prophylactic and therapeutic purposes, for the treatment of enterovirus infections, in mammals and, in particular, in humans, and in particular human rhinovirus infections, such as RVH-2, with Echovirus infections such as TECHO-6, or poliovirus infections, coxsackievirus infections, and enterovirus 71 infections whose protease 2A activity is also inhibited by the LVLQTM motif (SEQ ID NO: 9). The peptides according to the invention and the isolated RBM6 delta 6 protein can therefore be used as medicaments for the treatment of colds, otitis, sinusitis, or acute flaccid paralysis, aseptic meningitis, hand-foot-and-mouth syndrome, respiratory diseases. , acute or chronic heart disease, diarrhea, pancreatitis, ocular involvement, encephalitis. They can also be used to diagnose enteroviruses present in biological samples.
La présente invention a également pour objet l'utilisation d'un peptide selon l'invention pour le diagnostic in vitro d'un Entérovirus, et notamment d'un Rhinovirus Humain tel que le RVH-2, ou d'un ECHOvirus ou d'un Poliovirus ou de l'Entérovirus 71. En particulier, le peptide est utilisé pour la détection d'une protéase, et en particulier de la protéase 2A ou 3C, de l'Entérovirus à diagnostiquer. La détection pourra être effectuée dans tout type de prélèvement biologique, selon des techniques bien connues de l'homme de l'art.  The subject of the present invention is also the use of a peptide according to the invention for the in vitro diagnosis of an enterovirus, and in particular of a human rhinovirus such as RVH-2, or of an echovirus or of In particular, the peptide is used for the detection of a protease, and in particular protease 2A or 3C, of the Enterovirus to be diagnosed. The detection may be carried out in any type of biological sample, according to techniques well known to those skilled in the art.
Plus généralement, les peptides selon l'invention et la protéine RBM6 delta 6 isolée pourront être utilisés pour inhiber une protéase virale ou une protéase cellulaire telles que l'élastase, les chymotrypsine-like proteases et les caspases (Skern, Sommergruber et al. 1991). En effet, la protéase 2A des Entérovirus est une cystéine protéase dont l'activité peut être modulée par des inhibiteurs connus de protéases cellulaires. Ainsi, la P2A du RVH-14 et du poliovirus de type 1 est inhibée par des inhibiteurs spécifiques de l'élastase (Molla, Hellen et al. 1993). Bien entendu, les peptides selon l'invention et la protéine RBM6 delta 6 isolée pourront être utilisés pour inhiber des protéases virales ou non virales, autres que les protéases 2A et 3C des Entérovirus, si ces protéases présentent des propriétés catalytiques proches de la 2Apro virale et en particulier les protéases à cystéine. Une des applications est l'utilisation d'un peptide selon l'invention ou de la protéine RBM6 delta 6 dans la préparation de lysats cellulaires, notamment pour compléter des cocktails d'inhibiteurs de protéases. More generally, the peptides according to the invention and the isolated RBM6 delta 6 protein may be used to inhibit a viral protease or a cellular protease such as elastase, chymotrypsin-like proteases and caspases (Skern, Sommergruber et al., 1991 ). In fact, enterovirus protease 2A is a cysteine protease whose activity can be modulated by known inhibitors of cellular proteases. Thus, the P2A of RVH-14 and type 1 poliovirus is inhibited by specific elastase inhibitors (Molla, Hellen et al., 1993). Of course, the peptides according to the invention and the isolated RBM6 delta 6 protein may be used to inhibit viral or non-viral proteases, other than enteric virus proteases 2A and 3C, if these proteases have catalytic properties close to 2Apro viral and in particular cysteine proteases. One of the applications is the use of a peptide according to the invention or of the RBM6 delta 6 protein in the preparation of cell lysates, in particular to supplement cocktails of protease inhibitors.
Néanmoins, selon un de ses aspects essentiels, l'invention concerne les peptides selon l'invention, ainsi que la protéine RBM6 delta 6 isolée, pour leur utilisation en tant que médicaments, ainsi que les compositions pharmaceutiques contenant l'un des peptides selon l'invention o.u la protéine RBM6 delta 6 isolée, en association avec au moins un excipient pharmaceutique convenable.  Nevertheless, according to one of its essential aspects, the invention relates to the peptides according to the invention, as well as the isolated RBM6 delta 6 protein, for their use as medicaments, as well as the pharmaceutical compositions containing one of the peptides according to the invention. invention or the isolated RBM6 delta 6 protein, in combination with at least one suitable pharmaceutical excipient.
Par excipient pharmaceutique convenable ou acceptable, on entend tout composé ou véhicule entrant dans une composition pharmaceutique qui ne provoque pas ou quasiment pas de réactions secondaires et qui permet, par exemple, de faciliter l'administration des peptides selon l'invention, d'augmenter leur durée de vie et/ou lèur efficacité dans l'organisme, d'augmenter leur solubilité, ou encore d'améliorer leur conservation. Ces excipients pharmaceutiquement acceptables sont bien connus de l'homme du métier et seront adaptés, par ce dernier, en fonction de la nature et du mode d'administration des peptides selon l'invention. Le peptide peut, par exemple, être solubilisé dans un ou plusieurs solvants pharmaceutiquement acceptables, classiquement utilisés par l'homme du métier, comme, par exemple, l'eau, le glycérol, Péthanol, le propylène glycol, le butylène glycol, le dipropylène glycol, les diglycols éthoxylés ou propoxylés, les polyols cycliques, la vaseline, une huile végétale et tout mélange de ces solvants. Le peptide peut également être formulé dans un vecteur pharmaceutique, comme les liposomes, ou adsorbé sur des polymères organiques poudreux, des supports minéraux comme les talcs et bentonites, et plus généralement solubilisé dans, ou fixé sur, tout vecteur pharmaceutiquement acceptable.  By suitable or acceptable pharmaceutical excipient is meant any compound or vehicle entering a pharmaceutical composition which does not cause or almost no side reactions and which makes it possible, for example, to facilitate the administration of the peptides according to the invention, to increase their life and / or efficiency in the body, to increase their solubility, or to improve their conservation. These pharmaceutically acceptable excipients are well known to those skilled in the art and will be adapted by the latter, depending on the nature and mode of administration of the peptides according to the invention. The peptide may, for example, be solubilized in one or more pharmaceutically acceptable solvents, conventionally used by those skilled in the art, such as, for example, water, glycerol, ethanol, propylene glycol, butylene glycol, dipropylene glycol, ethoxylated or propoxylated diglycols, cyclic polyols, petrolatum, a vegetable oil and any mixture of these solvents. The peptide may also be formulated in a pharmaceutical vector, such as liposomes, or adsorbed onto powdery organic polymers, inorganic carriers such as talcs and bentonites, and more generally solubilized in, or attached to, any pharmaceutically acceptable carrier.
Les peptides selon l'invention pourront, par exemple, être administrés par voie orale, sublinguale, sous-cutanée, intramusculaire, intra-veineuse, topique, intratrachéale, intranasale, transdermique, rectale ou intraoculaire. Leurs modes d'administration, posologies et formes galéniques optimaux seront déterminés selon les critères généralement pris en compte dans l'établissement d'un traitement adapté à un patient comme par exemple l'âge ou le poids corporel du patient, la gravité de son état général, la tolérance au traitement et les effets secondaires constatés. Le peptide sera présent au sein de la composition, en une quantité thérapeutiquemertt efficace. Par exemple, un peptide selon l'invention pourra être présent dans les compositions de l'invention à une concentration comprise entre 0,0005 et 500 ppm (parties par million, poids/poids) environ, et préférentiellement à une concentration comprise entre 0,01 et 5 ppm environ par rapport au poids total de la composition finale. Un peptide selon l'invention peut être utilisé seul ou bien en association avec au moins un autre agent actif, dans une composition pharmaceutique. Les peptides selon l'invention pourront notamment être utilisés en association avec un inhibiteur de protéases déjà connu et/ou avec un composé en cours d'évaluation. L'invention a donc également pour objet les compositions pharmaceutiques contenant de telles associations. The peptides according to the invention may, for example, be administered orally, sublingually, subcutaneously, intramuscularly, intravenously, topically, intratracheally, intranasally, transdermally, rectally or intraocularly. Their modes of administration, dosages and optimal dosage forms will be determined according to the criteria generally taken into account in the establishment of a treatment adapted to a patient such as, for example, the age or body weight of the patient, the severity of his condition. general, tolerance to treatment and the observed side effects. The peptide will be present within the composition in a therapeutically effective amount. For example, a peptide according to the invention may be present in the compositions of the invention at a concentration of between approximately 0.0005 and 500 ppm (parts per million, weight / weight), and preferably at a concentration of between 0, About 1 and 5 ppm based on the total weight of the final composition. A peptide according to the invention may be used alone or in combination with at least one other active agent, in a pharmaceutical composition. The peptides according to the invention may in particular be used in combination with an already known protease inhibitor and / or with a compound under evaluation. The invention therefore also relates to pharmaceutical compositions containing such combinations.
D'autres aspects et avantages de l'invention seront mieux compris au vu des exemples ci-après qui permettent d'illustrer l'invention, mais n'ont aucun caractère limitatif. Ces exemples se réfèrent aux figures annexées :  Other aspects and advantages of the invention will be better understood from the following examples which illustrate the invention, but are not limiting in nature. These examples refer to the appended figures:
La Figure 1 présente un alignement des extrémités C-terminales des peptides identifiés en double hybride. Le motif séquentiel commun L-X-L-X- T/N-Z (où X est un acide aminé quelconque et Z un acide aminé hydrophobe) est présenté et aligné avec les résidus P6-P1 de différents sites de clivage connus de la 2Apro.  Figure 1 shows an alignment of the C-terminal ends of the peptides identified in double hybrid. The common sequence unit L-X-L-X-T / N-Z (where X is any amino acid and Z is a hydrophobic amino acid) is shown and aligned with the P6-P1 residues of various known cleavage sites of 2Apro.
Les Figures 2A et 2B présentent des expériences de reconstitution d'un site de clivage complet de la 2Apro du RVH-2 à partir des peptides IKL TL (SEQ ID N°2), LSLVTL (SEQ ID N°3), FRLTTL (SEQ ID N°4), LCLHTC (SEQ ID N°5), LFLYTC (SEQ ID N°6), LYIYTV (SEQ ID N°7), LKLQTV (SEQ ID N°8), LVLQTM (SEQ ID N°9), LRLKNL (SEQ ID NUO) et LRLRNL (SEQ ID N°ll). Des luciférases recombinantes contenant les sites hybrides IKLVTL(SEQ ID N°2)-GPSDM(SEQ ID N°15) ou LSLVTL(SEQ ID N°3)-GPSDM(SEQ ID N°15) ou FRLTTL(SEQ ID N°4)-GPSDM(SEQ ID N°15) ou LCLHTC(SEQ ID N°5)-GPSDM(SEQ ID N°15) ou LFLYTC(SEQ ID N°6)-GPSDM(SEQ ID N°15) ou LYIYTV(SEQ ID N°7)-GPSDM(SEQ ID N°15) ou LKLQTV(SEQ ID N°8)-GPSDM(SEQ ID N°15) ou LVLQTM(SEQ ID N°9)-GPSDM(SEQ ID N°15) ou LRLKNL(SEQ ID N°10)-GPSD (SEQ ID N°15) ou LRLRNL(SEQ ID N°11)-GPSDM(SEQ ID N°15) ou ΡΙΠΤΑ- GPSDM (SEQ ID N°16) ont été synthétisées dans un système de transcription/traduction in vitro (Figure 2A) et incubées avec de la 2Apro- (His)6 du RVH-2 recombinante. Après ajout de luciférine, l'activité des différentes luciférases a été mesurée par chimioluminescence (Figure 2B). FIGS. 2A and 2B show replenishment experiments of a complete cleavage site of 2Apro of RVH-2 from peptides IKL TL (SEQ ID No. 2), LSLVTL (SEQ ID No. 3), FRLTTL (SEQ ID NO: 4), LCLHTC (SEQ ID NO: 5), LFLYTC (SEQ ID NO: 6), LYIYTV (SEQ ID NO: 7), LKLQTV (SEQ ID NO: 8), LVLQTM (SEQ ID NO: 9) , LRLKNL (SEQ ID NUO) and LRLRNL (SEQ ID NO: 11). Recombinant luciferases containing the hybrid sites IKLVTL (SEQ ID No. 2) -GPSDM (SEQ ID No. 15) or LSLVTL (SEQ ID No. No. 3) -GPSDM (SEQ ID No. 15) or FRLTTL (SEQ ID No. 4) -GPSDM (SEQ ID No. 15) or LCLHTC (SEQ ID No. 5) -GPSDM (SEQ ID No. 15) or LFLYTC (SEQ ID NO: 6) -GPSDM (SEQ ID NO: 15) or LYIYTV (SEQ ID NO: 7) -GPSDM (SEQ ID NO: 15) or LKLQTV (SEQ ID NO: 8) -GPSDM (SEQ ID NO 15) or LVLQTM (SEQ ID NO: 9) -GPSDM (SEQ ID NO: 15) or LRLKNL (SEQ ID NO: 10) -GPSD (SEQ ID NO: 15) or LRLRNL (SEQ ID NO: 11) -GPSDM (SEQ ID No. 15) or ΡΙΠΤΑ-GPSDM (SEQ ID No. 16) were synthesized in an in vitro transcription / translation system (FIG. 2A) and incubated with recombinant RVH-2 2Apro- (His) 6 . After addition of luciferin, the activity of the different luciferases was measured by chemiluminescence (FIG. 2B).
La Figure 3 présente les résultats d'expériences dites de « pull-down » conduites en présence de la 2Apro du RVH-2 et du peptide LVLQTM (SEQ ID N°9). Des lysats bactériens contenant les protéines Streptag-SUMO, Streptag-SUMO-SEQ ID N°9 ou RVH-2 2Apro-(His)6 ont été mélangés deux à deux et soumis à une chromatographie d'affinité sur billes magnétiques recouvertes de-Strep-Tactin. Les complexes fixés ont été séparés sur gel d'acrylamide SDS-PAGE et colorés au Bleu de Coomassie. Figure 3 shows the results of so-called "pull-down" experiments conducted in the presence of 2Apro of RVH-2 and peptide LVLQTM (SEQ ID No. 9). Bacterial lysates containing the Streptag-SUMO, Streptag-SUMO-SEQ ID No. 9 or RVH-2 2Apro- (His) 6 proteins were mixed in pairs and subjected to Strep-coated magnetic beads affinity chromatography. -Tactin. The fixed complexes were separated on SDS-PAGE acrylamide gel and stained with Coomassie Blue.
piste 1 : Streptag-SUMO et RVH-2 2Apro-(His)6 lane 1: Streptag-SUMO and RVH-2 2Apro- (His) 6
piste 2 : Streptag-SUMO-LVLQTM et RVH-2 2Apro-(His)6 lane 2: Streptag-SUMO-LVLQTM and RVH-2 2Apro- (His) 6
piste 3 : 2Apro-(His)6 du RVH-2 purifiée sur billes de Nickel. Lane 3: 2Apro- (His) 6 of RVH-2 purified on Nickel beads.
Les Figures 4A, 4B et 4C présentent des expériences de reconstitution d'un site de clivage complet de la 2Apro du RVH-2 ou d'ECHO 6 à partir du peptide LVLQTM (SEQ ID N°9). Des luciférases recombinantes (61 kDa) contenant les sites hybrides LVLQTM-GPSDM (SEQ ID N°14) (Figure 4A), LQTM-GPSDM (SEQ ID N°19) (Figure 4B) ou ΡΙΠΤΑ-GPSDM (SEQ ID N°16) (Figure 4C) ont été synthétisées dans un système de transcription/traduction in vitro en présence de 35S-méthionine et incubées avec de la 2Apro-(His)6 du RVH-2 ou la 2Apro-(His)6 d'ECHO 6 recombinantes. Des prélèvements du milieu d'incubation ont été effectués aux temps 15, 30 et 45 minutes puis les protéines ont été séparées par SDS- PAGE et analysées par fluorographie. La Figure 5 présente les pourcentages d'inhibition du peptide StrepTag-SUMO- SEQ ID N°9 sur l'activité de clivage de la 2Apro du RVH-2 in vitro. Le, clivage du substrat colorimétrique TRPI1TTA(SEQ ID N°18)-p- nitroanilide (25 μΜ) spécifique de la 2Apro du RVH-2 a été mesuré in vitro en présence de différentes concentrations de la protéine Streptag-SUMO contenant ou non le peptide LVLQTM (SEQ ID N°9). Les mesures d'absorbance ont été effectuées en continue pendant 10 min à 405 nm et la vitesse initiale de chaque réaction a été déterminée. Le pourcentage d'inhibition pour une concentration donnée de protéine Streptag-SUMO ou StrepTag-SUMO-SEQ ID N°9 a été calculé en faisant le rapport des vitesses initiales de réaction déterminées en présence et en l'absence de la protéine. Les valeurs de pourcentage d'inhibition données résultent de la moyenne des valeurs obtenues à partir de 3 expériences indépendantes. Les écart-types sont également représentés. Figures 4A, 4B and 4C show replenishment experiments of a complete cleavage site of 2Apro of RVH-2 or ECHO 6 from the LVLQTM peptide (SEQ ID NO: 9). Recombinant luciferases (61 kDa) containing the hybrid sites LVLQTM-GPSDM (SEQ ID No. 14) (FIG. 4A), LQTM-GPSDM (SEQ ID No. 19) (FIG. 4B) or ΡΙΠΤΑ-GPSDM (SEQ ID No. 16) ) (Figure 4C) were synthesized in a transcription / translation in vitro in the presence of 35 S-methionine and incubated with 2Apro- (His) 6 of the RVH-2 or 2Apro- (His) 6 ECHO 6 recombinants. Samples of the incubation medium were taken at times 15, 30 and 45 minutes, then the proteins were separated by SDS-PAGE and analyzed by fluorography. Figure 5 shows the percent inhibition of StrepTag-SUMO-SEQ ID NO: 9 peptide on the cleavage activity of 2Apro of RVH-2 in vitro. The cleavage of the RVH-2 2Apro-specific TRPI1TTA (SEQ ID No.18) -p-nitroanilide (25 μΜ) colorimetric substrate was measured in vitro in the presence of different concentrations of Streptag-SUMO protein, whether or not containing the peptide LVLQTM (SEQ ID NO: 9). Absorbance measurements were made continuously for 10 min at 405 nm and the initial rate of each reaction was determined. The percent inhibition for a given concentration of Streptag-SUMO protein or StrepTag-SUMO-SEQ ID NO: 9 was calculated by reporting the determined initial reaction rates in the presence and absence of the protein. The percent inhibition values given are the average of the values obtained from 3 independent experiments. Standard deviations are also represented.
La Figure 6 présente l'inhibition in ceiiu/o àe l'activité eIF-4Gase de la Figure 6 shows the inhibition in this case of the eIF-4Gase activity of the
2Apro du RVH-2 par le peptide LVLQTM (SEQ ID N°9). Le clivage du facteur cellulaire eIF-4G (220 kDa) a été étudié dans des cellules A549 surexprimant RBM6 delta 6274-520 et/ou RVH-2 2Apro pendant 48h. Dans chaque cas, des extraits protéiques ont été préparés pour être analysés ensuite par SDS- PAGE et transférés sur membrane de nitrocellulose. Les échantillons ont été alors incubés avec un anticorps polyclonal de lapin anti-eIF-4G puis un anticorps secondaire anti-lapin couplé à la peroxydase. Le contrôle correspond à des cellules A549 mises en présence du produit de transfection seul. 2Apro of the RVH-2 by the peptide LVLQTM (SEQ ID No. 9). Cleavage of eIF-4G cell factor (220 kDa) was studied in A549 cells overexpressing RBM6 delta 6274-520 and / or RVH-2 2Apro for 48h. In each case, protein extracts were prepared for further analysis by SDS-PAGE and transferred to nitrocellulose membrane. The samples were then incubated with rabbit anti-eIF-4G polyclonal antibody and then a peroxidase-coupled secondary anti-rabbit antibody. The control corresponds to A549 cells placed in the presence of the transfection product alone.
La Figure 7 présente l'inhibition de l'infection de cellules A549 surexprimant RBM6 delta 6274-520 par le RVH-2 (Figure 7A), le RVH-14 (Figure 7B) ou l'EV68 (Figure 7C). Des cellules A549 surexprimant transitoirement les protéines RBM6 delta 6274-520, RBM6 delta 6274-514 ou SUMO utilisée ici à titre de témoin négatif ont été infectées par le RVH-2, le RVH-14 ou l'EV68 à une MOI de 1 pendant 20h. L'effet antiviral a été déterminé par la mesure de la DICT50 (dose infectieuse 50 % en culture de tissu sensible). La Figure 8 présente les différents groupes de virus membres du genre entérovirus. Les sérotypes sur lesquels l'efficacité du peptide LVLQTM a été démontrée sont entourés. Figure 9A : Modèle d'inhibition irréversible de la 2Apro du RVH-2 par le peptide zLVLQTM.fmk par formation d'une liaison covalente entre le peptide et la cystéine catalytique de la protéase. Figure 7 shows the inhibition of infection of A549 cells overexpressing RBM6 delta 6274-520 by RVH-2 (Figure 7A), RVH-14 (Figure 7B) or EV68 (Figure 7C). A549 cells transiently overexpressing the RBM6 delta 6274-520, RBM6 delta 6274-514 or SUMO proteins used here as a negative control were infected with RVH-2, RVH-14 or EV68 at a MOI of 1 20h. The antiviral effect was determined by the measurement of TCID50 (infectious dose 50% in sensitive tissue culture). Figure 8 shows the different groups of viruses belonging to the enterovirus genus. The serotypes on which the efficacy of the LVLQTM peptide has been demonstrated are surrounded. Figure 9A: Irreversible inhibition model of 2Apro of the RVH-2 by the peptide zLVLQTM.fmk by formation of a covalent bond between the peptide and the catalytic cysteine of the protease.
Figure 9B : Le clivage du substrat colorimétrique TRPIITTA(SEQ ID N°18)- p-nitroanilïde (25 μΜ) spécifique de la 2Apro du RVH-2 a été mesuré in vitro en présence de différentes concentrations du peptide zLVLQTM.fmk. Les mesures d'absorbance ont été effectuées en continue à 405 nm pendant 10 min et la vitesse initiale de chaque réaction a été déterminée. Le pourcentage d'inhibition pour une concentration donnée de peptide zLVLQTM.fmk a été calculé en faisant le rapport des vitesses initiales de réaction déterminées en présence et en l'absence de peptide. Les valeurs de pourcentage d'inhibition données résultent de la moyenne des valeurs obtenues à partir de 3 expériences indépendantes. Les écart-types sont également représentés.  FIG. 9B: The cleavage of the TRPIITTA (SEQ ID No. 18) - p-nitroanilide (25 μΜ) color specific substrate of the 2Apro of the RVH-2 was measured in vitro in the presence of different concentrations of the zLVLQTM.fmk peptide. Absorbance measurements were made continuously at 405 nm for 10 minutes and the initial rate of each reaction was determined. The percentage inhibition for a given concentration of zLVLQTM.fmk peptide was calculated by reporting the determined initial reaction rates in the presence and absence of peptide. The percent inhibition values given are the average of the values obtained from 3 independent experiments. Standard deviations are also represented.
Figure 9C : Des cellules A549 ont été traitées avec le DMSO (contrôle) ou 100 μΜ et 200 μΜ de peptide zLVLQTM.fmk pendant 1 h puis transfectées avec un ARN messager codant pour la 2Apro du RVH-2 ou du RVH-14 ou de ECHO-6 ou du poliovirus ou de l'EVr71 ou un ARN contrôle pendant 2 h. Les cellules ont ensuite été transfectées pendant 3 h avec un ARNm coiffé ou un ARNm présentant un 1RES en 5' tous deux codant pour la luciférase Renilla. Le premier possède la région 5'UTR de l'ARN de la β-Globine tandis que le second présente la région 5'UTR de l'ARN du virus de l'encéphalomyocardite. Les cellules ont été lysées et l'activité luciférase a été mesurée par luminométrie. Les valeurs d'activité luciférase résultent de la moyenne des valeurs obtenues à partir de 3 expériences indépendantes. Les écart-types sont également représentés.  FIG. 9C: A549 cells were treated with DMSO (control) or 100 μl and 200 μl of peptide zLVLQTM.fmk for 1 h and then transfected with a messenger RNA coding for 2Apro of RVH-2 or RVH-14 or of ECHO-6 or poliovirus or EVr71 or control RNA for 2 h. Cells were then transfected for 3 h with either capped mRNA or IRNA-encoding mRNA encoding Renilla luciferase. The first has the 5'UTR region of the β-Globin RNA while the second has the 5'UTR region of the encephalomyocarditis virus RNA. Cells were lysed and luciferase activity was measured by luminometry. The luciferase activity values result from the average values obtained from 3 independent experiments. Standard deviations are also represented.
Figure 9D : Des cellules A549 ont été traitées avec le DMSO (contrôle) ou 100 μΜ et 200 μΜ de peptide zLVLQTM.fmk pendant 1 h puis transfectées avec un ARN messager codant pour la 2Apro du PV-1 ou de l'EV-ou un ARN contrôle pendant 2 h. Les cellules ont ensuite été transfectées pendant 3 h avec un ARNm coiffé ou un ARNm présentant un 1RES en 5' tous deux codant pour la luciférase Renilla. Le premier possède la région 5'UTR de TARN de la β-Globine tandis que le second présente la région 5'UTR de l'ARN du virus de l'encéphalomyocardite. Les cellules ont été lysées et l'activité luciférase a été mesurée par luminométrie. Les valeurs d'activité luciférase résultent de la moyenne des valeurs obtenues à partir de 3 expériences indépendantes. Les écart-types sont également représentés. FIG. 9D: A549 cells were treated with DMSO (control) or 100 μl and 200 μl of peptide zLVLQTM.fmk for 1 h and then transfected with messenger RNA encoding 2Apro of PV-1 or EV-or control RNA for 2 h. Cells were then transfected for 3 h with either capped mRNA or IRNA-encoding mRNA encoding Renilla luciferase. The former has the 5'UTR region of the β-Globin RNA while the latter has the 5'UTR region of the encephalomyocarditis virus RNA. Cells were lysed and luciferase activity was measured by luminometry. The luciferase activity values result from the average values obtained from 3 independent experiments. Standard deviations are also represented.
Figure 9E : Des cellules A549 ont été infectées par le RVH-2 ou le RVH-14 à une MOI de 1 et traitées avec le peptide zLVLQTM.fmk à une concentration de 100 μΜ ou 200 μΜ pendant 12h. L'effet antiviral a été déterminé par la mesure de la DICT50 dans le surnageant des cellules infectées. Figure 9E: A549 cells were infected with RVH-2 or RVH-14 at a MOI of 1 and treated with peptide zLVLQTM.fmk at a concentration of 100 μΜ or 200 μΜ for 12 h. The antiviral effect was determined by measuring TCID 50 in the supernatant of the infected cells.
FIGURE 9F : Des cellules A549 ont été traitées avec différentes concentrations de zLVLQTM.fmk pendant 24h. La viabilité des cellules ainsi traitées a été mesurée par un test MTT. FIGURE 9F: A549 cells were treated with different concentrations of zLVLQTM.fmk for 24 hours. The viability of the cells thus treated was measured by an MTT test.
La Figure 10 présente l'effet inhibiteur in vivo du peptide zLVLQTM(SEQ ID N°9).fmk sur la réplication du RVH-2 dans les poumons de souris. Des souris femelles Balb/c de 6 semaines ont infectées par voie intranasale avec 105 pfu de RVH-2 et traitées avec 20 μΜ, 200 μΜ ou 500 μΜ de zLVLQTM.fmk. Les souris ont été sacrifiées aux temps 24h, 48h ou 120h après infection et leurs poumons ont été récoltés puis broyés. L'effet antiviral a été déterminé par la mesure de la DICT50 dans le broyât de poumons des souris infectées. Figure 10 shows the in vivo inhibitory effect of zLVLQTM peptide (SEQ ID NO: 9) .fmk on the replication of RVH-2 in mouse lungs. 6 week old Balb / c female mice intranasally infected with 10 5 pfu of RVH-2 and treated with 20 μM, 200 μM or 500 μM zLVLQTM.fmk. The mice were sacrificed at 24, 48 or 120 hours after infection and their lungs were harvested and ground. The antiviral effect was determined by the measurement of TCID50 in the crushed lungs of infected mice.
La Figure 11 présente l'effet inhibiteur du peptide zLVLQTM(SEQ ID Figure 11 shows the inhibitory effect of zLVLQTM peptide (SEQ ID
N°9).fmk sur l'activité de la 3C protéase du RVH. L'activité de la 3C protéase (0,01 u,*) a été testée en présence d'une protéine contrôle (68 kDa) avec ou sans zLVLQTM(SEQ ID N°9).fmk (50μΜ) pendant 16 h à 4°C. Les produits de digestion obtenus de 42 kDa et 26 kDa respectivement (indiqués par une flèche) ont été séparés par SDS-PAGE et colorés au bleu de Coomassie R250. 1) Identification de partenaires de la protéase 2 A du RVH-2 par la technique du double-hybride chez la levure, afin dldentifier de nouveaux inhibiteurs ciblant cet enzyme No. 9) .fmk on the activity of the 3C protease of RVH. The activity of 3C protease (0.01 μ, *) was tested in the presence of a control protein (68 kDa) with or without zLVLQTM (SEQ ID NO: 9) .fmk (50 μΜ) for 16 hr. ° C. The resulting digests of 42 kDa and 26 kDa respectively (indicated by an arrow) were separated by SDS-PAGE and stained with Coomassie Blue R250. 1) Identification of protease 2 A partners of RVH-2 by the yeast double-hybrid technique, in order to identify new inhibitors targeting this enzyme
La protéine de fusion LexA-RVH-2 2Apro a été utilisée comme appât pour cribler une banque d'ADNc de placenta humain. Pour cela, la séquence codant pour la P2A du RVH-2 The LexA-RVH-2 2Apro fusion protein was used as a bait to screen a human placenta cDNA library. For this, the coding sequence for the P2A of the RVH-2
(MGPSDMYVHVGNLIYRNLHLFNSEMHESILVSYSSDLIIYRTNTVGDDYIPSCDCTQ ATYYC KH KN RYFPITVTS H DWYEIQ ES E YYPKHIQYN LLIG EG PCEPG DCGGKLLCKH GVIGIVTAGGDNAFIDLRHFHCAEEQ, SEQ ID N°12) a été synthétisée en optimisant les codons en usage dans la levure et clonée dans le vecteur pB27 en fusion à LexA. Cette construction a été séquencée et utilisée comme appât pour cribler une banque de cDNAs de placenta humain insérés dans le vecteur P6 (Vojtek and Hollenberg 1995). (MGPSDMYVHVGNLIYRNLHLFNSEMHESILVSYSSDLIIYRTNTVGDDYIPSCDCTQ ATYYC KH KN RYFPITVTS H DWYEIQ ES E YYPKHIQYN llig EG PCEPG DCGGKLLCKH GVIGIVTAGGDNAFIDLRHFHCAEEQ, SEQ ID NO: 12) was synthesized by optimizing the codon usage in yeast and cloned into the vector PB27 molten LexA. This construct was sequenced and used as a bait to screen a library of human placenta cDNAs inserted into the P6 vector (Vojtek and Hollenberg 1995).
Le criblage à haut débit de 53,1 millions de clones selon l'approche décrite par Fromont-Racine et al. (Fromont-Racine, Rain et al. 1997) a permis de sélectionner 51 partenaires potentiels. Pour chacun d'entre eux, l'ADNc a été amplifié par PCR et séquencé aux extrémités 5' et 3' pour identifier le gène correspondant dans la base de données GenBank (NCBI). Un indice de confiance PBS (pour Predicted Biological Score) a été attribué à chacune des interactions identifiées (Formstecher, Aresta et al. 2005). Cet indice reflète la réalité biologique des interactions détectées par cette technique (Rain, Selig et al. 2001; Wojcik, Boneca et al. 2002). Parmi les 51 clones isolés, deux présentaient un PBS significatif. Ces derniers codaient pour l'extrémité C-terminale (résidus 274 à 520) de la protéine cellulaire RBM6 delta 6 (GenBank : FU56542) qui résulte de l'épissage alternatif du pré-ARNm RBM6 (Timmer, Terpstra et al. 1999). L'alignement de l'extrémité C-terminale de chacun de ces 51 peptides a permis d'en isoler 10 différents (dont un correspondait à l'extrémité de RBM6 delta 6, LVLQTM, SEQ ID N°9) qui avaient en commun à leur extrémité C-terminale le motif peptidique X1-X2-X3-X4-X5-X6 dans lequel : - Xi et X3, identiques ou différents, sont Leu ou Ile, High throughput screening of 53.1 million clones according to the approach described by Fromont-Racine et al. (Fromont-Racine, Rain et al 1997) identified 51 potential partners. For each of them, the cDNA was amplified by PCR and sequenced at the 5 'and 3' ends to identify the corresponding gene in the GenBank database (NCBI). A PBS (Predicted Biological Score) confidence index was assigned to each of the identified interactions (Formstecher, Aresta et al., 2005). This index reflects the biological reality of the interactions detected by this technique (Rain, Selig and others 2001, Wojcik, Boneca et al., 2002). Of the 51 isolated clones, two had significant PBS. The latter coded for the C-terminal end (residues 274 to 520) of the RBM6 delta 6 cellular protein (GenBank: FU56542) that results from the alternative splicing of the RBM6 pre-mRNA (Timmer, Terpstra et al., 1999). The alignment of the C-terminus of each of these 51 peptides made it possible to isolate 10 different ones (one of which corresponded to the end of RBM6 delta 6, LVLQTM, SEQ ID No. 9) which had in common at their C-terminal end, the peptide motif X1-X2-X3-X4-X5-X6 in which: Xi and X3, which are identical or different, are Leu or Ile,
- X2 et X4, identiques ou différents, sont un acide aminé quelconque,  X2 and X4, which are identical or different, are any amino acid,
- X5 est Asn ou Thr, et X 5 is Asn or Thr, and
- Xô est un acide aminé hydrophobe. X 6 is a hydrophobic amino acid.
Les 10 peptides sont les suivants IKLVTL (SEQ ID N°2), LSLVTL (SEQ The peptides are IKLVTL (SEQ ID NO: 2), LSLVTL (SEQ
ID N°3), FRLTTL (SEQ ID N°4), LCLHTC (SEQ ID N°5), LFLYTC (SEQ ID N°6), LYIYTV (SEQ ID N°7), LKLQTV (SEQ ID N°8), LVLQTM (SEQ ID N°9), LRLKNL (SEQ ID N°10) et LRLRNL (SEQ ID N°ll). La Figure 1 présente les séquences peptidiques complètes des clones isolés comprenant les dits peptides. ID NO: 3), FRLTTL (SEQ ID NO: 4), LCLHTC (SEQ ID NO: 5), LFLYTC (SEQ ID NO: 6), LYIYTV (SEQ ID NO: 7), LKLQTV (SEQ ID NO: 8) , LVLQTM (SEQ ID NO: 9), LRLKNL (SEQ ID NO: 10) and LRLRNL (SEQ ID NO: 11). Figure 1 shows the complete peptide sequences of isolated clones comprising said peptides.
Dans la nomenclature internationale, le site de clivage entre les résidus PI et Ρ d'un substrat de protéase est représenté de la manière suivante (Schechter and Berger 1968) :  In the international nomenclature, the cleavage site between PI and résidus residues of a protease substrate is represented as follows (Schechter and Berger 1968):
NH2-P5-P4-P3-P2-Pl-Pl'-P2'-P3'-P4'-P5'-COOH.  NH2-P5-P4-P3-P2-Pl-Pl'-P2'-P3'-P4'-P5'-COOH.
Le motif X X2-X3-X4-X5-X6 tel que défini dans le cadre de l'invention mime en partie le demi-site de clivage P4-P1 présenté Figure 1 (P4LXTXPI) de plusieurs substrats naturels connus des 2Apro des entérovirus. De plus, les motifs P3QTM i et P4LQTP2 de RBM6 delta 6 sont identiques à ceux retrouvés aux mêmes positions au niveau des sites de clivage par RVH-2 2Apro de PABP1 (Poly A Binding Protein) et de la jonction VPl-2Apro de la polyprotéine du RVH-62 respectivement, comme le montre la Figure 1. The moiety X X2-X3-X4-X5-X6 as defined in the context of the invention mimics in part the half-site of P4-P1 cleavage presented in Figure 1 (P 4 LXTXPI) of several known natural substrates of 2Apro enteroviruses. In addition, the motifs P 3QTM i and P4LQT P2 of RBM6 delta 6 are identical to those found at the same positions at the RVH-2 2Apro cleavage sites of PABP1 (Poly A Binding Protein) and the VP1-2Apro junction of the polyprotein of RVH-62 respectively, as shown in Figure 1.
2) Reconstitution d'un site de clivage complet de la 2Apro du RVH-2 à partir des peptides SE ID N°2 à 11 2) Reconstitution of a complete cleavage site of 2Apro of RVH-2 from SE peptides Nos. 2 to 11
L'hypothèse que les peptides IKLVTL (SEQ ID N°2), LSLVTL (SEQ ID The hypothesis that the peptides IKLVTL (SEQ ID NO: 2), LSLVTL (SEQ ID
N°3), FRLTTL (SEQ ID N°4), LCLHTC (SEQ ID N°5), LFLYTC (SEQ ID N°6), LYIYTV (SEQ ID N°7), LKLQTV (SEQ ID N°8), LVLQTM (SEQ ID N°9), LRLKNL (SEQ ID N°10) et LRLRNL (SEQ ID N°ll), miment un demi-site de clivage de substrats connus de la protéase 2A du RVH-2 a été vérifiée dans une série d'expériences où un site hybride du type (SEQ ID N°X)-GPSDM(SEQ ID N°15) (X étant compris entre 2 et 11) a été synthétisé. Ce site contient en positions P6-P1 le peptide IKLVTL (SEQ ID N°2) ou LSLVTL (SEQ ID N°3) ou FRLTTL (SEQ ID N°4) ou LCLHTC (SEQ ID N°5) ou LFLYTC (SEQ ID N°6) ou LYIYTV (SEQ ID N°7) ou LKLQTV (SEQ ID N°8) ou LVLQTM (SEQ ID N°9) ou LRLKNL (SEQ ID N°10) ou LRLRNL (SEQ ID N°ll) et en positions Pl'-P5' la séquence GPSDM (SEQ ID N°15) correspondant aux résidus trouvés dans le site de clivage VP1-P2A (ΡΙΠΤΑ-GPSDM, SEQ ID N°16) de la 2Apro de la polyprotéine du RVH-2. La séquence LVLQTM - GPSDM (SEQ ID N°14) est un exemple de telles séquences. No. 3), FRLTTL (SEQ ID NO: 4), LCLHTC (SEQ ID NO: 5), LFLYTC (SEQ ID NO: 6), LYIYTV (SEQ ID NO: 7), LKLQTV (SEQ ID NO: 8), LVLQTM (SEQ ID NO: 9), LRLKNL (SEQ ID NO: 10) and LRLRNL (SEQ ID NO: 11), mimic a half-cleavage site of known substrates of RVH-2 protease 2A was verified in a series of experiments where a hybrid site of the type (SEQ ID No. X) -GPSDM (SEQ ID No. 15) (X being between 2 and 11) was synthesized. This site contains at the P6-P1 positions the peptide IKLVTL (SEQ ID No. 2) or LSLVTL (SEQ ID No. 3) or FRLTTL (SEQ ID No. 4) or LCLHTC (SEQ ID No. 5) or LFLYTC (SEQ ID No. 6) or LYIYTV (SEQ ID No. 7) or LKLQTV (SEQ ID NO: 8) or LVLQTM (SEQ ID NO: 9) or LRLKNL (SEQ ID NO: 10) or LRLRNL (SEQ ID NO: 11) and in positions PL'-P5 'the sequence GPSDM (SEQ ID N 15) corresponding to residues found in the cleavage site VP1-P2A (ΡΙΠΤΑ-GPSDM, SEQ ID No. 16) of 2Apro of the polyprotein of RVH-2. The sequence LVLQTM - GPSDM (SEQ ID No. 14) is an example of such sequences.
Les séquences nucléotidîques codant pour IKLVTL(SEQ ID N°2)- GPSDM(SEQ ID N°15) ou LSLVTL(SEQ ID N°3)-GPSDM(SEQ ID N°15) ou FRLTTL(SEQ ID N°4)-GPSDM(SEQ ID N°15) ou LCLHTC(SEQ ID N°5)- GPSDM(SEQ ID N°15) ou LFLYTC(SEQ ID N°6)-GPSDM(SEQ ID N°15) ou LYIYTV(SEQ ID N°7)-GPSDM(SEQ ID N°15) ou LKLQTV(SEQ ID N°8)- GPSDM(SEQ ID N°15) ou LVLQTM(SEQ ID N°9)-GPSDM(SEQ ID N°15) ou LRLKNL(SEQ ID N°10)-GPSDM(SEQ ID N°15) OU LRLRNL(SEQ ID N°11)-GPSDM(SEQ ID N°15) OU ΡΙΠΤΑ-GPSDM (SEQ ID N°16) sont insérées entre les sites Nhel et BgîII d'une séquence nucléotidique codant pour un peptide reliant les domaines N et C-terminaux d'une luciférase recombinante dans le vecteur pGloSensor™-10F (Promega). Les protéines correspondantes sont synthétisées dans un système de transcription/traduction in vitro (Promega) (Figure 2A). Le tout est incubé 2h à 25°C.  The nucleotide sequences encoding IKLVTL (SEQ ID No. 2) - GPSDM (SEQ ID No. 15) or LSLVTL (SEQ ID No. 3) -GPSDM (SEQ ID No. 15) or FRLTTL (SEQ ID No. 4) - GPSDM (SEQ ID No. 15) or LCLHTC (SEQ ID No. 5) - GPSDM (SEQ ID No. 15) or LFLYTC (SEQ ID No. 6) -GPSDM (SEQ ID No. 15) or LYIYTV (SEQ ID N ° 7) -GPSDM (SEQ ID NO: 15) or LKLQTV (SEQ ID NO: 8) - GPSDM (SEQ ID NO: 15) or LVLQTM (SEQ ID NO: 9) -GPSDM (SEQ ID NO: 15) or LRLKNL (SEQ ID NO: 10) -GPSDM (SEQ ID NO: 15) OR LRLRNL (SEQ ID NO: 11) -GPSDM (SEQ ID NO: 15) OR ΡΙΠΤΑ-GPSDM (SEQ ID NO: 16) are inserted between the sites Nhe I and BglII of a nucleotide sequence coding for a peptide linking the N and C-terminal domains of a recombinant luciferase in the pGloSensor ™ -10F vector (Promega). The corresponding proteins are synthesized in an in vitro transcription / translation system (Promega) (Figure 2A). The whole is incubated for 2 hours at 25 ° C.
Parallèlement, la protéase 2A du RVH-2 est clonée dans le vecteur pSCodonl.2 (Eurogentec) entre les sites de restriction Ndel et Xhol en fusion avec une étiquette (His)e du côté C-terminal. Ce plasmide est utilisé pour transformer une souche E.coli B de type SE1 [F-, CmR, ompT, Ion, hsdSB(rB- , mB-), gai, dcm, DE3 (lad, T7polymerase sous le contrôle du promoteur PlacUVS), ccdB+]. La 2Apro du RVH-2 a été produite en cultivant les bactéries dans un milieu d'auto-induction ZYP-5052 (Studier 2005) à 37°C pendant 5-6 heures sous agitation, puis à 20°C pendant 16 à 18 heures. Les cellules sont lysées avec du BugBuster (Novagen), centrifugées à 40000g pendant 15 min et le surnageant de centrifugation obtenu est soumis à une chromatographie d'affinité sur résine de nickel (HIS-SelectTM HF Nickel resin, Sigma). La 2Apro purifiée à près de 95% est dialysée contre un tampon D (lOOmM Tris-HCI, pH 7.5, 200 mM NaCI, 4 mM DTT) et concentrée sur colonne Vivaspin (Sartorius Stedium Biotech). Elle est stockée à -20°C dans le tampon D contenant 50% de glycérol. In parallel, the protease 2A of the RVH-2 is cloned in the vector pSCodon1.2 (Eurogentec) between the NdeI and XhoI restriction sites in fusion with a label (His) e on the C-terminal side. This plasmid is used to transform an E.coli B strain of SE1 type [F-, CmR, ompT, Ion, hsdSB (rB-, mB-), gal, dcm, DE3 (lad, T7polymerase under the control of the PlacUVS promoter). , ccdB +]. 2Apro of RVH-2 was produced by culturing the bacteria in a ZYP-5052 self-induction medium (Studier 2005) at 37 ° C for 5-6 hours with shaking, then at 20 ° C for 16-18 hours. . The cells are lysed with BugBuster (Novagen), centrifuged at 40000g for 15 min and the centrifugation supernatant obtained is subjected to Nickel resin affinity chromatography (HIS-Select ™ HF Nickel resin, Sigma). The 95% purified 2Apro is dialyzed against a D buffer (100 mM Tris-HCl, pH 7.5, 200 mM NaCl, 4 mM DTT) and concentrated on a Vivaspin (Sartorius Stedium Biotech) column. It is stored at -20 ° C. in buffer D containing 50% glycerol.
Les différentes iuciférases recombinantes synthétisées précédemment (13 pL) et contenant les sites IKLVTL(SEQ ID N°2)-GPSDM(SEQ ID N°15) ou LSLVTL(SEQ ID N°3)-GPSDM(SEQ ID N°15) ou FRLTTL(SEQ ID N°4)- GPSDM(SEQ ID N°15) ou LCLHTC(SEQ ID N°5)-GPSDM(SEQ ID N°15) ou LFLYTC(SEQ ID N°6)-GPSDM(SEQ ID N°15) ou LYIYTV(SEQ ID N°7)- GPSDM(SEQ ID N°15) ou LKLQTV(SEQ ID N°8)-GPSDM(SEQ ID N°15) ou LVLQTMCSEQ ID N°9)-GPSDM(SEQ ID N°15) ou LRLKNL(SEQ ID N°10)-GPSDM(SEQ ID N°15) ou LRLRNL(SEQ ID N°11)-GPSDM(SEQ ID N°15) ou ΡΙΠΤΑ-GPSDM (SEQ ID N°16) sont incubées pendant 45 min à 30°C en présence de 2 pg de RVH-2 2Apro(His)e recombinante et 13 pL de tampon de réaction 2X (lOOmM HEPES/NaOH, pH 7.9, 200 mM NaCI, 2 mM EDTA, lOmM DTT). Chaque mélange est ensuite dilué au 10e dans de l'eau. 100 pL de chaque dilution est alors mélangé à 100 pL de luciférine, substrat de la luciférase. Chaque mélange est ainsi déposé dans un puits d'une plaque 96 puits et l'activité de la luciférase est mesurée par chimioluminescence (Figure 2B). The various recombinant iuciferases synthesized previously (13 μL) and containing the sites IKLVTL (SEQ ID No. 2) -GPSDM (SEQ ID No. 15) or LSLVTL (SEQ ID No. 3) -GPSDM (SEQ ID No. 15) or FRLTTL (SEQ ID NO: 4) - GPSDM (SEQ ID NO: 15) or LCLHTC (SEQ ID NO: 5) -GPSDM (SEQ ID NO: 15) or LFLYTC (SEQ ID NO: 6) -GPSDM (SEQ ID N ° 15) or LYIYTV (SEQ ID NO: 7) - GPSDM (SEQ ID NO: 15) or LKLQTV (SEQ ID NO: 8) -GPSDM (SEQ ID NO: 15) or LVLQTMCSEQ ID NO: 9) -GPSDM (SEQ ID NO. ID NO: 15) or LRLKNL (SEQ ID NO: 10) -GPSDM (SEQ ID NO: 15) or LRLRNL (SEQ ID NO: 11) -GPSDM (SEQ ID NO: 15) or ΡΙΠΤΑ-GPSDM (SEQ ID NO: 16) are incubated for 45 min at 30 ° C in the presence of 2 μg of recombinant RVH-2 2Apro (His) e and 13 μl of 2X reaction buffer (100 mM HEPES / NaOH, pH 7.9, 200 mM NaCl, 2 mM EDTA 10mM DTT). Each mixture is then diluted 10- fold in water. 100 μl of each dilution is then mixed with 100 μl of luciferin, substrate of luciferase. Each mixture is thus deposited in a well of a 96-well plate and the luciferase activity is measured by chemiluminescence (FIG. 2B).
La Figure 2B montre que tous les peptides [IKLVTL (SEQ ID N°2), LSLVTL (SEQ ID N°3), FRLTTL (SEQ ID N°4), LCLHTC (SEQ ID N°5), LFLYTC (SEQ ID N°6), LYIYTV (SEQ ID N°7), LKLQTV (SEQ ID N°8), LVLQTM (SEQ ID Ne9), LRLKNL (SEQ ID N°10) et LRLRNL (SEQ ID N°ll)] sont reconnus par la protéase 2A du RVH-2 puisque tous les sites hybrides (IKLVTL(SEQ ID N°2)-GPSDM(SEQ ID N°15), LSLVTL(SEQ ID N°3)-GPSDM(SEQ ID N°15), FRLTTL(SEQ ID N°4)-GPSDM(SEQ ID N°15), LCLHTC(SEQ ID N°5)-GPSDM(SEQ ID N°15), LFLYTC(SEQ ID N°6)-GPSDM(SEQ ID N°15), LYIYTV(SEQ ID N°7)-GPSDM(SEQ ID N°15), LKLQTV(SEQ ID N°8)-GPSDM(SEQ ID N°15), LVLQTM (SEQ ID N°9)-GPSDM(SEQ ID N°15), LRLKNLfSEQ ID N°10)-GPSDM(SEQ ID N°15) et LRLRNL(SEQ ID N°11)-GPSDM(SEQ ID N°15)) sont clivés par la protéase. Dans cette expérience le site LVLQTM-GPSDM (SEQ ID N°14) présente l'affinité la plus forte pour la protéase 2A du RVH-2. Ainsi, ces résultats démontrent que les peptides IKLVTL (SEQ ID N°2), LSLVTL (SEQ ID N°3), FRLTTL (SEQ ID N°4), LCLHTC (SEQ ID N°5), LFLYTC (SEQ ID N°6), LYIYTV (SEQ ID N°7), LKLQTV (SEQ ID N°8), LVLQTM (SEQ ID N°9), LRLKNL (SEQ ID N°10) et LRLRNL (SEQ ID °ll) se comportent comme d'authentiques demi-sites de clivage P6-P1 de la 2Apro du RVH-2, présentant donc de ce fait les caractéristiques d'inhibiteurs potentiels de la 2Apro. De plus, comme le peptide LVLQTM (SEQ ID N°9) de RBM6 delta 6 présente la plus forte affinité pour la 2Apro du RVH-2, il a été sélectionné dans le cadre de l'invention. Figure 2B shows that all peptides [IKLVTL (SEQ ID NO: 2), LSLVTL (SEQ ID NO: 3), FRLTTL (SEQ ID NO: 4), LCLHTC (SEQ ID NO: 5), LFLYTC (SEQ ID NO. 6), LYIYTV (SEQ ID NO: 7), LKLQTV (SEQ ID NO: 8), LVLQTM (SEQ ID NO : 9), LRLKNL (SEQ ID NO: 10) and LRLRNL (SEQ ID NO: 11) are recognized by RVH-2 protease 2A since all hybrid sites (IKLVTL (SEQ ID NO: 2) -GPSDM (SEQ ID NO: 15), LSLVTL (SEQ ID NO: 3) -GPSDM (SEQ ID NO: 15) , FRLTTL (SEQ ID NO: 4) -GPSDM (SEQ ID NO: 15), LCLHTC (SEQ ID NO: 5) -GPSDM (SEQ ID NO: 15), LFLYTC (SEQ ID NO: 6) -GPSDM (SEQ ID No. 15), LYIYTV (SEQ ID NO: 7) -GPSDM (SEQ ID NO: 15), LKLQTV (SEQ ID NO: 8) -GPSDM (SEQ ID NO: 15), LVLQTM (SEQ ID NO: 9) - GPSDM (SEQ ID NO: 15), LRLKNLFSEQ ID NO: 10) -GPSDM (SEQ ID No. 15) and LRLRNL (SEQ ID NO: 11) -GPSDM (SEQ ID NO: 15)) are cleaved by the protease. In this experiment the LVLQTM-GPSDM site (SEQ ID No. 14) has the strongest affinity for RVH-2 protease 2A. Thus, these results demonstrate that the peptides IKLVTL (SEQ ID NO: 2), LSLVTL (SEQ ID NO: 3), FRLTTL (SEQ ID NO: 4), LCLHTC (SEQ ID NO: 5), LFLYTC (SEQ ID NO. 6), LYIYTV (SEQ ID NO: 7), LKLQTV (SEQ ID NO: 8), LVLQTM (SEQ ID NO: 9), LRLKNL (SEQ ID NO: 10) and LRLRNL (SEQ ID # 11) behave as Therefore, authentic P6-P1 half-cleavage sites of 2Apro of RVH-2, thus presenting the characteristics of potential inhibitors of 2Apro. In addition, since the peptide LVLQTM (SEQ ID No. 9) of RBM6 delta 6 has the highest affinity for 2Apro of RVH-2, it has been selected in the context of the invention.
3) Le peptide LVLQTM, SEQ ID N°9 de la protéine RBM6 delta 6 interagit in vitro avec la protéase 2 A du RVH-2 3) The peptide LVLQTM, SEQ ID No. 9 of the RBM6 delta 6 protein interacts in vitro with the RVH-2 protease 2 A
Le peptide LVLQTM, SEQ ID N°9 de RBM6 delta 6 a été choisi afin de valider in vitro dans des expériences de type « pull-down », les résultats obtenus précédemment in vivo dans la levure.  The peptide LVLQTM, SEQ ID No. 9 of RBM6 delta 6 was chosen in order to validate in vitro in "pull-down" experiments, the results obtained previously in vivo in yeast.
La protéase 2A du RVH-2 est clonée dans le vecteur de surexpression pSCodonl.2 (Eurogentec) entre les sites de restriction Ndel et Xhol et en fusion avec une étiquette (His)6 du côté C-terminal. La séquence nucléotidique codant pour le motif LVLQTM, SEQ ID N°9 est clonée dans le vecteur pET-SUMO (Invitrogen), entre deux sites de restriction Bsal, en phase à l'extrémité C-terminale de la protéine SUMO. L'étiquette Streptag WSHPQFEK (SEQ ID N°13) est ajoutée du côté N-terminal de la protéine fusion SUMO- SEQ ID N°9. Cette construction est transférée dans le vecteur pSCodonl.2. De la même manière, un plasmide pSCodonl.2[streptag-SUMO] est construit pour servir de contrôle dans les expériences décrites ci-après. Protease 2A RVH-2 is cloned into the vector pSCodonl.2 overexpression (Eurogentec) between the restriction sites NdeI and XhoI and fused with a tag (His) 6 C-terminal side. The nucleotide sequence encoding the LVLQTM motif, SEQ ID No. 9 is cloned into the pET-SUMO vector (Invitrogen), between two Bsal restriction sites, in phase at the C-terminus of the SUMO protein. The Streptag WSHPQFEK tag (SEQ ID NO: 13) is added on the N-terminal side of the SUMO-SEQ ID No. 9 fusion protein. This construct is transferred into the vector pSCodon1.2. Similarly, a pSCodon1.2 [streptag-SUMO] plasmid is constructed to serve as a control in the experiments described hereinafter.
Ces plasmides sont utilisés pour transformer la souche E.coli B de type SE1 [F-, CmR, ompT, Ion, hsdSB(rB-, mB-), gai, dcm, DE3 (lad, T7polymerase sous le contrôle du promoteur PlacUVS), ccdB+] et produire les protéines exprimées par chacune de ces constructions. Pour cela, les bactéries sont mises en culture dans un milieu d'auto-induction ZYP-5052 (Studier 2005) à. 37°C pendant 5-6 heures sous agitation. Elles sont ensuite transférées à 20°C pendant 16 à 18 heures. Les cellules sont lysées avec un mélange de détergents (BugBuster, Novagen). Les lysats ainsi obtenus, sont rassemblés deux à deux (StrepTag-SUMO-SEQ ID N°9 et RVH-2 2Apro- (His)6 ou StrepTag-SUMO et RVH-2 2Apro-(His)6) et soumis à une chromatographie d'affinité sur billes magnétiques recouvertes de Strep- Tactin (Qiagen) pendant une heure. Les complexes protéiques fixés aux billes après plusieurs lavages sont séparés sur gel d'acrylamide SDS-PAGE et colorés par du Coomassie Brillant Blue R250. These plasmids are used to transform E. coli strain SE1 [F-, CmR, ompT, Ion, hsdSB (rB-, mB-), gal, dcm, DE3 (lad, T7polymerase under the control of PlacUVS promoter). , ccdB +] and produce the proteins expressed by each of these constructs. For this, Bacteria are cultured in a ZYP-5052 (Studier 2005) self-induction medium at. 37 ° C for 5-6 hours with stirring. They are then transferred to 20 ° C for 16 to 18 hours. The cells are lysed with a mixture of detergents (BugBuster, Novagen). The lysates thus obtained are collected in pairs (StrepTag-SUMO-SEQ ID No. 9 and RVH-2 2Apro- (His) 6 or StrepTag-SUMO and RVH-2 2Apro- (His) 6 ) and subjected to chromatography. of affinity on magnetic beads coated with Strep-Tactin (Qiagen) for one hour. Protein complexes attached to the beads after several washes are separated on SDS-PAGE acrylamide gel and stained with Coomassie Brillant Blue R250.
De cette façon, il a été démontré que RVH-2 2Apro-(His)6 co-élue avec StrepTag-SUMO-SEQ ID N°9 mais pas avec StrepTag-SUMO, comme la montre la Figure 3, en comparant les pistes Streptag-SUMO+ RVH-2 2Apro et Streptag-SUMO-LVLQTM+RVH-2 2Apro. Ainsi, le motif SEQ ID N°9 est nécessaire et suffisant pour interagir in vitro avec la protéase 2A du RVH-2, ce qui confirme les résultats obtenus en double-hybride.  In this way, it has been demonstrated that RVH-2 2Apro- (His) 6 co-eluted with StrepTag-SUMO-SEQ ID No. 9 but not with StrepTag-SUMO, as shown in Figure 3, by comparing Streptag tracks. -SUMO + RVH-2 2Apro and Streptag-SUMO-LVLQTM + RVH-2 2Apro. Thus, the SEQ ID No. 9 motif is necessary and sufficient to interact in vitro with the protease 2A of the RVH-2, which confirms the results obtained in double-hybrid.
4) Le peptide L VLQTM-GPSDM, SEQ ID N°14 est aussi clivé par la 2Apro d'ECHOvirus ô 4) Peptide L VLQTM-GPSDM, SEQ ID No. 14 is also cleaved by the 2Apro of ECHOvirus O
Selon la même stratégie que celle décrite précédemment, la coupure du site LVLQTM-GPSDM (SEQ ID N°14) par la 2Apro d'ECHOvirus 6 (MGAFGQQSGAVYVG YRVV RHLATHTDWQ CVWEDY RDLLVSTTTAHGCDπ ARCHCTSGVYFCASRN HYPWFEGPGLVEVQESEYYPKRYQSHVLLAAGLSEPGDC GGILRCEHGVIGIVTMEGWGFADVRDLLWLEDDAMEQLEHHHHHH, SEQ ID N°17), un autre membre du genre entérovirus, a été étudiée.  According to the same strategy as described above, cleavage site LVLQTM-GPSDM (SEQ ID NO: 14) by the 2Apro echovirus 6 (MGAFGQQSGAVYVG YRVV RHLATHTDWQ CVWEDY RDLLVSTTTAHGCDπ ARCHCTSGVYFCASRN HYPWFEGPGLVEVQESEYYPKRYQSHVLLAAGLSEPGDC GGILRCEHGVIGIVTMEGWGFADVRDLLWLEDDAMEQLEHHHHHH, SEQ ID NO: 17), another member of the enterovirus type, has been studied.
Pour se faire, les séquences nucléotidiques codant pour LVLQTM- GPSDM (SEQ ID N°14) ou LQTM-GPSDM ou ΡΙΠΤΑ-GPSDM (SEQ ID N°16) sont insérées entre les sites Nhel et BglII d'une séquence nucléotidique codant pour un peptide reliant les domaines N et C-terminaux d'une luciférase recombinante dans le vecteur pGloSensor™-10F (Promega). Les protéines correspondantes sont synthétisées dans un système de transcription/traduction in vitro en présence de [35S]-méthionine cette fois-ci (TNT SP6 High Yield Wheat Germ Master Mix, Promega). Le tout est incubé 2h à 25°C. To do this, the nucleotide sequences coding for LVLQTM-GPSDM (SEQ ID No. 14) or LQTM-GPSDM or ΡΙΠΤΑ-GPSDM (SEQ ID No. 16) are inserted between the NheI and BglII sites of a nucleotide sequence coding for a peptide linking the N and C-terminal domains of a recombinant luciferase in the pGloSensor ™ -10F vector (Promega). The corresponding proteins are synthesized in an in vitro transcription / translation system in the presence of [ 35 S] methionine this time (TNT SP6 High Yield Wheat Germ Master Mix, Promega). The whole is incubated for 2 hours at 25 ° C.
Parallèlement, la protéase 2A du RVH-2 est clonée dans le vecteur pSCodonl.2 (Eurogentec) entre les sites de restriction Ndel et Xhol en fusion avec une étiquette (His)e du côté C-terminal. Ce plasmide est utilisé pour transformer une souche Eco// B de type SE1 [F-, CmR, ompT, Ion, hsdSBfrB- , mB-}, gai, dcm, DE3 (lad, T7polymerase sous le contrôle du promoteur PlacUVS), ccdB+]. La 2Apro du RVH-2 a été produite en cultivant les bactéries dans un milieu d'auto-induction ZYP-5052 (Studier 2005) à 37°C pendant 5-6 heures sous agitation, puis à 20°C pendant 16 à 18 heures. Les cellules sont lysées avec du BugBuster (Novagen), centrifugées à 40000g pendant 15 min et le surnageant de centrifugation obtenu est soumis à une chromatographie d'affinité sur résine de nickel (HIS-SelectT HF Nickel resin, Sigma). La 2Apro purifiée à près de 95% est dialysée contre un tampon D (lOOmM Tris-HCI, pH 7.5, 200 mM NaCI, 4 mM DTT) et concentrée sur colonne Vivaspin (Sartorius Stedium Biotech). Elle est stockée à -20°C dans le tampon D contenant 50% de glycérol. De la même façon, la 2Apro de ECHO 6 est clonée dans le vecteur pSCodonl.2 (Eurogentec) entre les sites de restriction Ndel et Xhol en fusion avec une étiquette (His)6 du côté C- terminal. Ce plasmide est utilisé pour transformer une souche Eco// B de type SE1 et produire la 2Apro d'ECHO 6 selon les conditions de culture et de purification décrites ci-dessus. In parallel, the protease 2A of the RVH-2 is cloned in the vector pSCodon1.2 (Eurogentec) between the NdeI and XhoI restriction sites in fusion with a label (His) e on the C-terminal side. This plasmid is used to transform an EcoH type strain SE1 [F-, CmR, ompT, Ion, hsdSBfrB-, mB-], gal, dcm, DE3 (lad, T7polymerase under the control of the PlacUVS promoter), ccdB + ]. 2Apro of RVH-2 was produced by culturing the bacteria in a ZYP-5052 self-induction medium (Studier 2005) at 37 ° C for 5-6 hours with shaking, then at 20 ° C for 16-18 hours. . The cells are lysed with BugBuster (Novagen), centrifuged at 40000g for 15 min and the centrifugation supernatant obtained is subjected to a nickel resin affinity chromatography (HIS-Select ™ HF Nickel resin, Sigma). The 95% purified 2Apro is dialyzed against a D buffer (100 mM Tris-HCl, pH 7.5, 200 mM NaCl, 4 mM DTT) and concentrated on a Vivaspin (Sartorius Stedium Biotech) column. It is stored at -20 ° C. in buffer D containing 50% glycerol. Similarly, the 2Apro ECHO 6 is cloned into the vector pSCodonl.2 (Eurogentec) between the restriction sites NdeI and XhoI fused with a tag (His) 6 C-terminal side. This plasmid is used to transform an SE1 type Eco // B strain and produce ECHO 6 2Apro according to the culture and purification conditions described above.
Les luciférases radioactives (13 μί) synthétisées précédemment et contenant les sites de coupure LVLQTM-GPSDM (SEQ ID N°14) ou LQTM- GPSDM ou PIITTA-GPSDM (SEQ ID N°16) sont incubées pendant 45 min à 30°C en présence de 2 μς de RVH-2 2Apro(His)e recombinante ou 2 μg de 2Apro(His)6 d'ECHO 6 purifiée et 13 μί de tampon de réaction 2X (lOOmM HEPES/NaOH, pH 7.9, 200 mM NaCI, 2 mM EDTA, lOmM DTT). Des aliquots du mélange de réaction sont prélevés 15 min, 30 min et 45 min après le début de l'incubation. Les protéines sont séparées par SDS-PAGE et analysées par fluorographie (Figure 4). La Figure 4A montre qu'en présence de la protéase 2A du RVH-2, la luciférase contenant le site LVLQTM-GPSDM (SEQ ID N°14 - 61 kDa) est clivée en deux fragments de 25 kDa et 36 kDa dans les 15 premières minutes de la réaction avec la même efficacité que celle observée pour le site naturel de clivage ΡΙΠΤΑ-GPSDM (SEQ ID N°16). The radioactive luciferases (13 μl) synthesized previously and containing the LVLQTM-GPSDM (SEQ ID No. 14) or LQTM-GPSDM or PIITTA-GPSDM (SEQ ID No. 16) cleavage sites are incubated for 45 min at 30 ° C. presence of 2 μl of recombinant RVH-2 2Apro (His) e or 2 μg of 2Apro (His) 6 of purified ECHO 6 and 13 μl of 2X reaction buffer (100 mM HEPES / NaOH, pH 7.9, 200 mM NaCl, 2 mM EDTA, 10mM DTT). Aliquots of the reaction mixture are taken 15 min, 30 min and 45 min after the start of incubation. Proteins are separated by SDS-PAGE and analyzed by fluorography (Figure 4). Figure 4A shows that in the presence of RVH-2 protease 2A, luciferase containing the LVLQTM-GPSDM site (SEQ ID NO: 14 - 61 kDa) is cleaved into two fragments of 25 kDa and 36 kDa in the first 15 minutes of the reaction with the same efficiency as that observed for the natural cleavage site ΡΙΠΤΑ-GPSDM (SEQ ID No. 16).
La Figure 4A montre également que la 2Apro d'ECHO 6 présente sensiblement les mêmes caractéristiques de clivage du substrat LVLQTM- GPSDM (SEQ ID N°14) que la 2Apro du RVH-2 avec une digestion complète du site en moins de 15 min. Ceci démontre que le motif LVLQTM (SEQ ID N°9) est aussi reconnu comme un authentique demi-site de clivage par la 2Apro d'ECHO 6. Comme cette dernière présente une forte homologie de séquence avec les 2Apro d'autres entérovirus (Poliovirus, Coxsackievirus), il est tout à fait envisageable d'appliquer ces résultats à l'ensemble des 2Apro des Entérovirus.  Figure 4A also shows that ECHO 6A 2Apro has substantially the same cleavage characteristics of the LVLQTM-GPSDM substrate (SEQ ID No. 14) as the RVH-2 2Apro with complete digestion of the site in less than 15 min. This demonstrates that the LVLQTM motif (SEQ ID No. 9) is also recognized as an authentic half-site cleavage by 2Apro of ECHO 6. As the latter has a strong sequence homology with 2Apro other enteroviruses (Poliovirus , Coxsackievirus), it is quite possible to apply these results to all 2Apro enteroviruses.
De plus, la Figure 4B montre que la 2Apro du RVH-2 clive également le substrat LQTM-GPSDM (SEQ ID N°19). Cependant, la digestion complète de ce site n'est observée qu'au bout de 30 min d'incubation avec la 2Apro contrairement au site LVLQTM-GPSDM (SEQ ID N°14) qui est digéré de façon complète dans les quinze premières minutes d'incubation. Ceci démontre que le motif LVLQTM (SEQ ID N°9) présente une plus forte affinité que la séquence LQTM pour la 2Apro du RVH-2. Le même type de résultat est observé pour la 2Apro d'ECHOô. Ainsi, le peptide LVLQTM (SEQ ID N°9) est utilisé dans le cadre de l'invention . 5) Le peptide LVLQTM inhibe l'activité de clivage de la 2Apro du RVH-2 in vitro  In addition, Figure 4B shows that RVH-2 2Apro also cleaves the LQTM-GPSDM substrate (SEQ ID NO: 19). However, the complete digestion of this site is observed only after 30 min of incubation with 2Apro unlike the site LVLQTM-GPSDM (SEQ ID No. 14) which is fully digested in the first fifteen minutes of incubation. 'incubation. This demonstrates that the LVLQTM motif (SEQ ID No. 9) has a higher affinity than the LQTM sequence for the 2Apro of RVH-2. The same type of result is observed for ECHOô 2Apro. Thus, the peptide LVLQTM (SEQ ID No. 9) is used in the context of the invention. 5) The peptide LVLQTM inhibits the cleavage activity of 2Apro of RVH-2 in vitro
L'hydrolyse du substrat colorimétrique TRPIITTA(SEQ ID N°18)-p- nitroanilide (SEQ ID N°18-pNA) spécifique de la 2Apro du RVH-2 a été mesurée in vitro en présence de la protéine Streptag-SUMO fusionnée ou non au peptide LVLQTM (SEQ ID N°9). Ce substrat contient les résidus P6- SEQ ID N°18-P1 du site de coupure VPl-2Apro de la polyprotéine du rhinovirus 2. Le clivage de ce peptide entre l'alanine à la position PI et le pNA libère la p-nitroaniline de couleur jaune dont l'absorbance est mesurée à 405 nm (Wang, Sommergruber et al. 1997). The hydrolysis of the colorimetric substrate TRPIITTA (SEQ ID NO: 18) -p-nitroanilide (SEQ ID No. 18-pNA) specific for 2Apro of RVH-2 was measured in vitro in the presence of the fused Streptag-SUMO protein or no to the LVLQTM peptide (SEQ ID No. 9). This substrate contains the residues P6-SEQ ID No. 18-P1 of the cleavage site VP1-2Apro of the polyprotein of rhinovirus 2. The cleavage of this peptide between alanine at the position PI and the pNA liberates the yellow p-nitroaniline whose absorbance is measured at 405 nm (Wang, Sommergruber et al., 1997).
Le test d'activité est effectué à 25°C dans un volume final de 1 mL avec un tampon contenant 100 mM de NaCI, 50 mM d'HEPES/IMaOH pH8, 1 mM d'EDTA et 10 mM de DTT. Différentes concentrations des protéines recombinantes StrepTag-SUMO- SEQ ID N°9 ou StrepTag-SUMO sont préincubées avec 0,2 μΜ de 2Apro du RVH-2 pendant 5 min. Puis 25 μΜ de substrat sont ajoutés pour initier la réaction. Les mesures d'absorbance sont effectuées en continue à 405 nm pendant 10 min pour déterminer la vitesse initiale de chaque réaction. Le pourcentage d'inhibition pour une concentration donnée de peptide StrepTag-SUMO- SEQ ID N 9 a été calculé en faisant le rapport des vitesses initiales de réaction déterminées en présence et en l'absence de peptide. Les valeurs de pourcentage d'inhibition données à la Figure 5 résultent de la moyenne des valeurs obtenues à partir de 3 expériences indépendantes. Les écart-types sont également représentés.  The activity test is carried out at 25 ° C in a final volume of 1 mL with a buffer containing 100 mM NaCl, 50 mM HEPES / IMaOH pH8, 1 mM EDTA and 10 mM DTT. Different concentrations of the StrepTag-SUMO-SEQ ID No. 9 or StrepTag-SUMO recombinant proteins are preincubated with 0.2 μl of 2Apro of the RVH-2 for 5 min. 25 μl of substrate are then added to initiate the reaction. Absorbance measurements are made continuously at 405 nm for 10 minutes to determine the initial rate of each reaction. The percent inhibition for a given StrepTag-SUMO-SEQ ID No. 9 peptide concentration was calculated by reporting the determined initial reaction rates in the presence and absence of peptide. The percentage inhibition values given in Figure 5 result from the average of the values obtained from 3 independent experiments. Standard deviations are also represented.
En présence de 25 μΜ de substrat et 25 μΜ de protéine StrepTag- SUMO- SEQ ID N°9, la vitesse initiale de la réaction de clivage est réduite de 80% par rapport au témoin sans peptide. La protéine Streptag-SUMO n'a pas d'effet sur la réaction. Ainsi, ces résultats indiquent donc que le motif LVLQTM (SEQ ID N°9) inhibe spécifiquement et significativement le clivage de SEQ ID N°18-pNA par la 2Apro du RVH-2 in vitro.  In the presence of 25 μl of substrate and 25 μl of StrepTag-SUMO-SEQ ID No. 9 protein, the initial rate of the cleavage reaction is reduced by 80% relative to the control without peptide. The Streptag-SUMO protein has no effect on the reaction. Thus, these results thus indicate that the LVLQTM motif (SEQ ID No. 9) specifically and significantly inhibits the cleavage of SEQ ID No. 18-pNA by 2Apro of RVH-2 in vitro.
En conclusion, les résultats présentés précédemment montrent que : In conclusion, the results presented above show that:
(i) la protéine cellulaire RBM6 delta 6 possède un motif C-terminal LVLQTM (SEQ ID N°9) nécessaire et suffisant pour interagir avec la 2Apro du RVH-2, (i) RBM6 delta 6 cellular protein has a C-terminal motif LVLQTM (SEQ ID NO: 9) necessary and sufficient to interact with 2Apro of RVH-2,
(ii) ce motif mime la séquence des résidus aux positions P6-P1 du site de clivage par la 2Apro de la polyprotéine du RVH et inhibe l'activité de clivage de cet enzyme,  (ii) this motif mimics the residue sequence at the P6-P1 positions of the 2Apro cleavage site of the RVH polyprotein and inhibits the cleavage activity of this enzyme,
(iii) ce motif représente un pseudo-substrat de la 2Apro du RVH-2 mais aussi de la 2Apro d'ECHO 6, ce dernier enzyme étant homologue aux 2Apro d'autres membres du même genre entérovirus (Coxsackievirus, Poliovirus), (iv) La valeur de l'ICSO de 10 μΜ mesurée pour le peptide LVLQTM (SEQ ID N°9) est bien inférieure à celle décrite (600 μ ) pour ies 2 octapeptides ARGKLQTF et RGFMLSTL inhibiteurs de la 2Apro du poliovirus (Ventoso, Barco et al. 1999). (iii) this motif represents a pseudo-substrate of 2Apro of RVH-2 but also of 2Apro of ECHO 6, the latter enzyme being homologous to 2Apro of other members of the same genus Enterovirus (Coxsackievirus, Poliovirus), (iv) The 10 μM ICSO value measured for the LVLQTM peptide (SEQ ID NO: 9) is much lower than that described (600 μ) for the 2 octapeptides ARGKLQTF and RGFMLSTL inhibitors of poliovirus 2Apro (Ventoso, Barco et al., 1999).
6) La surproduction de la protéine tronquée RBM6 de/ta 627 -520 dans des cellules A549 inhibe l'activité de clivage de la 2Apro du RVH-2 6) Overproduction of the truncated RBM6 protein from / ta 627-520 in A549 cells inhibits the cleavage activity of 2Apro of the RVH-2
Afin de valider in cellulo les résultats obtenus précédemment in vitro, la protéine tronquée RBM6 delta 6274-520 identifiée en double hybride chez la levure a été surexprimée dans des cellules A549 (épithélium pulmonaire humain) et les effets de ce fragment sur le clivage de eIF-4G (activité elF- In order to validate in vitro the previously obtained in vitro results, the truncated RBM6 delta protein 6274-520 identified as a double hybrid in yeast was overexpressed in A549 cells (human lung epithelium) and the effects of this fragment on eIF cleavage. -4G (activity elF-
4Gase) par la 2Apro du RVH-2 ont été étudiés. 4Gase) by the 2Apro of RVH-2 were studied.
Dans cette étude, les cellules A549 sont maintenues en culture dans un milieu DMEM (milieu modifié Dulbecco, BioWhittaker) complémenté avec 10% (v/v) de sérum de veau f tal, 2 mM de L-glutamine, 100 U/mL de pénicilline et 100 pg/mL de streptomycine, dans un incubateur à 37°C et dans une atmosphère saturée en humidité contenant 5 % de CO2. À confluence, les cellules sont détachées du support par traitement à la trypsiiie-EDTA et réensemencées, dans une fiole de culture contenant 15 mL de milieu frais. La veille de la transfection, les cellules A549 sont ensemencées dans des boîtes de culture 6 cm (Corning) pour atteindre 80% de confluence au moment de la transfection.  In this study, A549 cells are maintained in culture in DMEM medium (Dulbecco modified medium, BioWhittaker) supplemented with 10% (v / v) fetal calf serum, 2 mM L-glutamine, 100 U / mL of penicillin and 100 μg / ml streptomycin, in an incubator at 37 ° C and in a saturated humidity atmosphere containing 5% CO2. At confluence, the cells are detached from the support by trypsin-EDTA treatment and reseeded in a culture flask containing 15 ml of fresh medium. On the day before transfection, A549 cells are seeded in 6 cm culture dishes (Corning) to reach 80% confluency at the time of transfection.
Les vecteurs pCiNeo[2xStreptag-RBM6 delta 6274-520] et/ou p3xFlag[3xFlag-RVH-2 2Apro] sont transfectés en utilisant les réactifs NanoJuice (Novagen) selon les recommandations du fabricant. Un contrôle The vectors pCiNeo [2xStreptag-RBM6 delta 6274-520] and / or p3xFlag [3xFlag-RVH-2 2Apro] are transfected using the NanoJuice reagents (Novagen) according to the manufacturer's recommendations. Control
« produits de transfection seuls » est effectué. "Transfection products alone" is performed.
1. le milieu avec sérum (milieu complet) des cellules est remplacé par un milieu sans sérum (2 mM de L-glutamine, 100 U/mL de pénicilline et 100 μg/mL de streptomycine) avant la transfection  1. medium with serum (complete medium) cells is replaced with serum-free medium (2 mM L-glutamine, 100 U / mL penicillin and 100 μg / mL streptomycin) prior to transfection
2. pour chaque boîte 6 cm, 300 μί de milieu sans sérum sont mélangés à 3 pL de « transfection core reagent » et 4,5 pL de « transfection booster » 3. incubation 5 min à température ambiante 4. ajout de 5 ς de pQNeo[2xStreptag-RBM6 delta 6274-520] et 3 ug de pCiNeo[2xStreptag] ou 5 pg de p3xFlag[3xFlag-RVH-2 2Apro] et 3 pg de pGNeo[2xStreptag] ou 5 pg de p3xFlag[3xFlag-RVH-2 2Apro] et 3 pg de pCiNeo[2xStreptag-RBM6 delta 6274-520] 2. for each 6 cm dish, 300 μί of serum-free medium are mixed with 3 μl of "core reagent transfection" and 4.5 μl of "booster transfection". Incubation for 5 min at room temperature 4. Add 5 μl of pQNeo [2xStreptag-RBM6 delta 6274-520] and 3 μg of pCiNeo [2xStreptag] or 5 μg of p3xFlag [3xFlag-RVH-2 2Apro] and 3 μg of pGNeo [2xStreptag] or 5 μg of p3xFlag [3xFlag-RVH-2 2Apro] and 3 μg of pCiNeo [2xStreptag-RBM6 delta 6274-520]
5. incubation 15 min à température ambiante  5. incubation 15 min at room temperature
6. ajout du mélange de transfection aux cellules  6. adding the transfection mixture to the cells
7. incubation des cellules pendant 4h à 37°C dans une atmosphère saturée eh humidité contenant 5 % de C02 7. incubation of the cells for 4h at 37 ° C in a saturated humidity atmosphere containing 5% C0 2
8. le milieu sans sérum est remplacé par du milieu complet  8. the serum-free medium is replaced by complete medium
9. les cellules sont incubées à 37°C dans une atmosphère saturée en humidité contenant 5 % de C02 pendant 48h 9. the cells are incubated at 37 ° C in a saturated humidity atmosphere containing 5% C0 2 for 48 hours
Les protéines cellulaires sont extraites après 48h de transfection selon le protocole suivant :  The cellular proteins are extracted after 48 hours of transfection according to the following protocol:
1. le milieu de culture est aspiré  1. the culture medium is sucked
2. les cellules sont rincées 2 fois au PBS IX froid  2. the cells are rinsed twice with cold IX PBS
3. les cellules sont incubées 15 min dans la glace avec la solution de lyse Mammalian Protein Extraction Reagent (Pierce) supplémentée avec un cocktail d'inhibiteurs de protéases (Complète protease inhibitor Cocktail, Roche) (100 pL par boîte).  3. The cells are incubated for 15 min in ice with Mammalian Protein Extraction Reagent lysis solution (Pierce) supplemented with a cocktail of protease inhibitors (Complete protease inhibitor Cocktail, Roche) (100 μL per dish).
4. le tout est récolté dans un eppendorf 1,5 mL et centrifugé 15 min 4. the whole is harvested in a 1.5 mL eppendorf and centrifuged 15 min
15000 x g à 4°C 15000 x g at 4 ° C
5. le surnageant est transféré dans un nouvel eppendorf  5. the supernatant is transferred to a new eppendorf
La concentration des protéines ainsi extraites est déterminée en utilisant la solution The Better Bradford Assay Kit (Pierce). 60 pg de protéines de chaque échantillon sont mélangés à du Laemmli 6X, chauffés 5 min à 100°C puis déposés pour analyse sur gel d'acrylamide 6%. Après migration à 90 V pendant environ 2h, les protéines sont transférées sur une membrane de nitrocellulose pendant lh30 à 400 mA. La membrane est ensuite saturée avec du lait 5% (dilué dans du TBS IX) pendant lh à température ambiante puis incubée sur la nuit à 4°C avec un anticorps anti- eIF-4G (polyclona! de lapin) dilué au 1000e dans la solution de saturation. La membrane est incubée lh à température ambiante avec un anticorps anti- lapin couplé à la peroxydase (GE Healthcare) dilué au 2000e dans la solution de saturation. La membrane est lavée 4 fois 20 min avec du TBS-tween (0,1%) puis soumise à analyse. Les solutions 1 et 2 du kit Pierce ECL Détection sont utilisées selon les instructions fournies et les films (Amersham hyperfilm, GE Healthcare) sont utilisés pour détecter le signal. The concentration of the proteins thus extracted is determined using the solution The Better Bradford Assay Kit (Pierce). 60 μg of protein from each sample are mixed with Laemmli 6X, heated for 5 min at 100 ° C. and then deposited for analysis on 6% acrylamide gel. After migration at 90 V for about 2 hours, the proteins are transferred to a nitrocellulose membrane for 1h30 to 400 mA. The membrane is then saturated with 5% milk (diluted in IX TBS) for lh at room temperature then incubated overnight at 4 ° C with an anti- eIF-4G (polyclona! Rabbit) diluted in 1000th the saturation solution. The membrane is incubated for one hour at room temperature with an anti-human rabbit antibody coupled to peroxidase (GE Healthcare) diluted 2000 e in the saturation solution. The membrane is washed 4 times 20 min with TBS-tween (0.1%) and then subjected to analysis. Solutions 1 and 2 of the Pierce ECL Detection kit are used according to the instructions provided and the films (Amersham hyperfilm, GE Healthcare) are used to detect the signal.
Lorsque RBM6 delta 6274-520 qui contient le peptide LVLQTM (SEQ ID N°9) et la 2Apro du RVH-2 sont co-exprimées dans les cellules A549, l'activité eIF-4Gase de la 2Apro est inhibée, comme le montre la Figure 6, en comparant les pistes RVH-2 2Apro et RVH-2 2Apro + RBM6 delta 6274-520.  When RBM6 delta 6274-520 which contains peptide LVLQTM (SEQ ID NO: 9) and 2Apro of RVH-2 are coexpressed in A549 cells, the eIF-4Gase activity of 2Apro is inhibited, as shown in FIG. Figure 6, comparing runways RVH-2 2Apro and RVH-2 2Apro + RBM6 delta 6274-520.
7) L'expression du fragment C-terminal de RBM6 delta 6 (RBM6 delta 6274-520,) inhibe l'infection des cellules A549 par le RVH-2, le RVH-14 et ΙΈν- 68 7) The expression of the C-terminal fragment of RBM6 delta 6 (RBM6 delta 6274-520,) inhibits the infection of A549 cells by RVH-2, RVH-14 and ΙΈν- 68
Après avoir démontré que la forme tronquée RB 6 delta 6274-S20 contenant à son extrémité C^terminale la séquence LVLQTM (SEQ ID N°9), inhibe l'activité eIF-4Gase de la 2Apro du RVH-2 in cellulo, l'effet inhibiteur potentiel de ce fragment sur le cycle infectieux du RVH-2 dans les cellules A549 a été étudié.  After having demonstrated that the truncated RB 6 delta 6274-S20 form containing at its C-terminus the sequence LVLQTM (SEQ ID No. 9), inhibits the eIF-4Gase activity of 2Apro of RVH-2 in cellulo, the Potential inhibitory effect of this fragment on the infectious cycle of RVH-2 in A549 cells was studied.
Dans cette étude, des cellules A549 sont maintenues en culture dans du milieu DMEM (milieu modifié Dulbecco, BioWhittaker) complémenté avec 10% (v/v) de sérum de veau fœtal, 2 mM de L-glutamine, 100 U/mL de pénicilline et 100 pg/mL de streptomycine. L'incubation est réalisée à 37°C dans une atmosphère saturée en humidité contenant 5 % de CO2. A confluence, les cellules sont détachées du support par traitement à la trypsine-EDTA et réensemencées dans une fiole de culture contenant 15 mL de milieu frais. La veille de la transfection, les cellules A549 sont ensemencées dans des plaques 6-puits pour atteindre 80% de confluence au moment de la transfection.  In this study, A549 cells are maintained in culture in DMEM medium (Dulbecco modified medium, BioWhittaker) supplemented with 10% (v / v) fetal calf serum, 2 mM L-glutamine, 100 U / mL penicillin and 100 μg / mL streptomycin. Incubation is performed at 37 ° C in a saturated humidity atmosphere containing 5% CO 2. At confluence, the cells are detached from the support by treatment with trypsin-EDTA and reseeded in a culture flask containing 15 ml of fresh medium. On the day before transfection, A549 cells are seeded in 6-well plates to reach 80% confluency at the time of transfection.
Les vecteurs d'expression pCiNeo[2xStreptag-RBM6 delta 6274-520] ou pCiNeo[2xStreptag-RBM6 delta 627 -514] ou pCDNA3[Streptag-SUMO] sont transfectés en utilisant les réactifs NanoJuice (Novagen) selon les recommandations du fabricant. RBM6 delta 6274-514 correspond à la forme tronquée RBM6 delta 6274-520 identifiée en double hybride sans la séquence C- terminale LVLQTM (SEQ ID N°9). SUMO est une protéine utilisée ici à titre de témoin. Expression vectors pCiNeo [2xStreptag-RBM6 delta 6274-520] or pCiNeo [2xStreptag-RBM6 delta 627 -514] or pCDNA3 [Streptag-SUMO] are transfected using the NanoJuice reagents (Novagen) according to the manufacturer's recommendations. RBM6 delta 6274-514 corresponds to the form truncated RBM6 delta 6274-520 identified in double hybrid without the C-terminal sequence LVLQTM (SEQ ID No. 9). SUMO is a protein used here as a control.
1. le milieu avec sérum (milieu complet) des cellules est remplacé par un milieu sans sérum (2 mM de L-glutamine, 100 U/mL de pénicilline et 100 pg/mL de streptomycine) avant la transfection  1. medium with serum (complete medium) cells is replaced with serum-free medium (2 mM L-glutamine, 100 U / mL penicillin and 100 μg / mL streptomycin) prior to transfection
2. pour chaque puits d'une plaque 6-puits, 200 μL de milieu sans sérum sont mélangés à 2 pL de « transfection core reagent » et 3 pL de « transfection booster »  2. for each well of a 6-well plate, 200 μl of serum-free medium are mixed with 2 μl of "core reagent transfection" and 3 μl of "booster transfection".
3. incubation 5 min à température ambiante  3. incubation for 5 min at room temperature
4. ajout de 4 pg de pCiNeo[2xStreptag-RBM6 delta 6274-520] ou 4 pg de pCiNeo[Streptag-RBM6 delta 6274-514] ou 4 pg de pCDNA3[Streptag-SUMO] 4. addition of 4 μg of pCiNeo [2xStreptag-RBM6 delta 6274-520] or 4 μg of pCiNeo [Streptag-RBM6 delta 6274-514] or 4 μg of pCDNA3 [Streptag-SUMO]
5. incubation 15 min à température ambiante 5. incubation 15 min at room temperature
6. ajout du mélange de transfection aux cellules  6. adding the transfection mixture to the cells
7. incubation des cellules pendant 4h à 37°C dans une atmosphère saturée en humidité contenant 5 % de CO2 7. incubation of the cells for 4h at 37 ° C in a saturated humidity atmosphere containing 5% CO 2
8. le milieu sans sérum est remplacé par du milieu complet  8. the serum-free medium is replaced by complete medium
9. les cellules sont incubées à 37°C dans une atmosphère saturée en humidité contenant 5 % de CO2 pendant 24h 9. cells are incubated at 37 ° C in a saturated humidity atmosphere containing 5% CO 2 for 24 hours
Les cellules sont infectées par le RVH-2 à une MOI 1 après 24h de transfection selon le protocole suivant : The cells are infected with RVH-2 at a MOI 1 after 24 hours of transfection according to the following protocol:
1. le milieu de culture est aspiré  1. the culture medium is sucked
2. les cellules sont rincées une fois avec du milieu DMEM 2% sérum, 2 mM de L-glutamine, 100 U/mL de pénicilline et 100 pg/mL de streptomycine 2. the cells are rinsed once with DMEM medium 2% serum, 2 mM L-glutamine, 100 U / mL penicillin and 100 μg / mL streptomycin
3. les cellules sont inoculées avec le virus et 1,5 mL de milieu DMEM 2% sérum sont ajoutés 3. the cells are inoculated with the virus and 1.5 ml of DMEM medium 2% serum are added
4. les cellules ainsi inoculées sont incubées à 34°C pendant 20h Le surnageant des cellules infectées est prélevé 20h après infection par le RVH-2. Les surnageants sont titrés sur des cellules MRC5 et la DICTSO est déterminée par la méthode de Reed et Muench (Reed LJ. 1938) selon le protocole suivant : 4. The cells thus inoculated are incubated at 34 ° C. for 20 hours. The supernatant of the infected cells is removed 20 hours after infection with RVH-2. Supernatants are titrated on MRC5 cells and DICTSO is determined by the method of Reed and Muench (Reed LJ, 1938) according to the following protocol:
1. Les cellules MRC5 sont maintenues en culture dans du milieu EMEM 1. The MRC5 cells are maintained in culture in EMEM medium
2% sérum, 2 m de L-glutamine, 100 U/mL de pénicilline, 100 ug/mL de streptomycine et 2% hepes 1M et ensemencées dans des plaques 24 puits 5 jours avant inoculation avec le RVH-2. Elles sont confluentes le jour de l'infection. 2% serum, 2 m L-glutamine, 100 U / mL penicillin, 100 μg / mL streptomycin and 2% 1M hepes and seeded in 24-well plates 5 days before inoculation with RVH-2. They are confluent on the day of infection.
2. Le jour de l'infection, huit dilutions de raison 10, de 10"1 à 10"8 sont réalisées pour chaque échantillon de façon à inoculer 100 pL de chaque dilution sur 6 puits par plaque 24 puits. 2. The day of infection, eight-fold dilutions of 10, 10 "1-10" 8 are made for each sample so as to inoculate 100 ul of each dilution on 6-well by 24-well plate.
3. Le milieu de survie des cellules (1,4 mL) est changé avant distribution des suspensions virales sur plaque.  3. The cell survival medium (1.4 mL) is changed before distribution of plaque viral suspensions.
4. 100 pL de suspension virale non diluée sont distribués sur 6 cupules de plaques 24 puits.  4. 100 μl undiluted viral suspension is distributed on 6 wells of 24-well plates.
5. De la même façon, 100 pL de chaque dilution de virus sont distribués sur 6 cupules de plaques 24 puits. Plusieurs témoins sans virus sont également réalisés.  5. In the same way, 100 μl of each virus dilution is distributed over 6 wells of 24-well plates. Several virus-free cookies are also made.
6. Les plaques sont incubées à 34°C pendant 5 jours.  6. The plates are incubated at 34 ° C for 5 days.
7. Le 5e jour, la DICT50 est calculée selon la méthode de Reed et Muench. 7. On Day 5, the TCID 50 is calculated according to the method of Reed and Muench.
Cette expérience a été répétée 3 fois. This experiment was repeated 3 times.
La Figure 7A montre que dans les cellules surexprimant RBM6 delta 6274-520 (fragment qui contient à son extrémité C-terminale le peptide LVLQTM, SEQ ID N°9), le titre viral atteint 105'5 DICT50/mL alors que pour les cellules surexprimant la protéine témoin (SUMO), le titre obtenu de 107,5 DICTso/mL, est environ 100 fois plus élevé. RBM6 delta 6274-520 réduit la production des virus RVH-2 dans les cellules A549. Dans les cellules surexprimant RBM6 delta 6274-514 (fragment qui ne contient pas à son extrémité C-terminale le peptide LVLQTM, SEQ ID N°9), le titre viral obtenu de 107'3 DICTso/mL démontre que la séquence LVLQTM (SEQ ID N°9) située à l'extrémité C-terminale de RBM6 delta 6274-520 est responsable de la baisse de production virale dans les cellules A549. Figure 7A shows that in cells overexpressing RBM6 delta 6274-520 (fragment which contains at its C-terminal end the peptide LVLQTM, SEQ ID No. 9), the viral titer reaches 10 5 5 TCID 50 / mL whereas for cells overexpressing the control protein (SUMO), the resulting titre of 7.5 TCID 50 / ml, is approximately 100-fold higher. RBM6 delta 6274-520 reduces the production of RVH-2 viruses in A549 cells. In cells overexpressing RBM6 delta 6274-514 (a fragment which does not contain at the C-terminal end the peptide LVLQTM, SEQ ID No. 9), the viral titre obtained from 10 7 ' 3 TCID50 / mL demonstrates that the LVLQTM sequence ( SEQ ID No. 9) located at the C-terminus of RBM6 delta 6274-520 is responsible for the decrease in viral production in A549 cells.
Les mêmes expériences réalisées avec les virus RVH-14 (Figure 7B) ou EV-68 (Figure 7C) montrent que RBM6 delta 6274-520 réduit significativement la réplication de ces virus dans des cellules A549 alors que dans des cellules surexprimant RBM6 delta 6274-514 , le titre viral est le même que dans les essais contrôles. L'ensemble de ces résultats démontre que la séquence LVLQTM (SEQ ID N°9) située à l'extrémité C-terminale de RBM6 delta 6274-520 inhibe la production virale non seulement du RVH-2 mais également du RVH-14 et de l'EV-68 dans les cellules À549. The same experiments carried out with the RVH-14 (Figure 7B) or EV-68 (Figure 7C) viruses show that RBM6 delta 6274-520 significantly reduces the replication of these viruses in A549 cells whereas in cells overexpressing RBM6 delta 6274- 514, the viral title is the same as in the control trials. All these results demonstrate that the sequence LVLQTM (SEQ ID No. 9) located at the C-terminus of RBM6 delta 6274-520 inhibits the viral production not only of RVH-2 but also of RVH-14 and EV-68 in A549 cells.
En conclusion, il a été démontré que la séquence en amino acides LVLQTM (SEQ ID N°9) située à l'extrémité C-terminale de la protéine RBM6 delta 6 inhibe in vitro les protéases 2A du RVH-2 et de ECHO-6 et diminue sensiblement l'infection des cellules A549 par les virus RVH-2, RVH-14 et EV68. Ainsi, le peptide LVLQTM (SEQ ID N°9), représente un inhibiteur de différents membres du genre entérovirus et présente donc un large spectre d'action (Figure 8). In conclusion, it has been demonstrated that the amino acid sequence LVLQTM (SEQ ID No. 9) located at the C-terminus of the RBM6 delta 6 protein inhibits in vitro the RVH-2 and ECHO-6 proteases 2A. and substantially decreases infection of A549 cells by RVH-2, RVH-14 and EV68. Thus, the peptide LVLQTM (SEQ ID No. 9) represents an inhibitor of different members of the enterovirus genus and therefore has a broad spectrum of action (FIG. 8).
8) Synthèse d'un dérivé chimique du peptide LVLQTM (SEQ ID N°9) 8) Synthesis of a Chemical Derivative of the LVLQTM Peptide (SEQ ID No. 9)
La figure 5 montre que l'inhibition de l'activité de la 2Apro du RVH-2 par le peptide LVLQTM (SEQ ID N°9) n'est pas totale puisque ce peptide se fixe de manière réversible dans le site actif de la protéase. Pour rendre cette fixation irréversible, le peptide LVLQTM a été modifié en lui ajoutant un groupement fluorométhylcétone (fmk) à son extrémité C-terminale (ce groupement étant connu pour former un lien covalent avec la cystéine catalytique des protéases à cystéine) et un groupement benzyloxycarbonyl (z) à son extrémité N-terminale qui lui confère une meilleure perméabilité cellulaire. Ainsi le peptide zLVLQTM(SEQ ID N°9).fmk (Figure 9A) a été synthétisé et testé selon les méthodes expérimentales décrites précédemment. FIG. 5 shows that the inhibition of the activity of 2Apro of the RVH-2 by the peptide LVLQTM (SEQ ID No. 9) is not complete since this peptide reversibly binds to the active site of the protease . To render this binding irreversible, the LVLQTM peptide was modified by adding a fluoromethylketone group (fmk) at its C-terminus (this group being known to form a covalent link with the catalytic cysteine of cysteine proteases) and a benzyloxycarbonyl group. (z) at its N-terminus which gives it a better cell permeability. Thus the peptide zLVLQTM (SEQ ID No. 9) .fmk (FIG. 9A) was synthesized and tested according to the experimental methods described above.
8.1) Le peptide zLVLQTM(SEQ ID N°9).fmk est un inhibiteur irréversible de la protéase 2A du RVH-2 8.1) zLVLQTM peptide (SEQ ID NO: 9) .fmk is an irreversible inhibitor of RVH-2 protease 2A
L'hydrolyse du substrat colorimétrique TRPIITTA(SEQ ID N°18)-p- nitroanilide (SEQ ID N°18-pNA) spécifique de la 2Apro du RVH-2 a été mesurée in vitro en présence du peptide zLVLQTM(SEQ ID N°9).fmk.  The hydrolysis of the colorimetric substrate TRPIITTA (SEQ ID NO: 18) -p-nitroanilide (SEQ ID No. 18-pNA) specific for 2Apro of RVH-2 was measured in vitro in the presence of the peptide zLVLQTM (SEQ ID No. 9) .fmk.
Le test d'activité est effectué à 25°C dans un volume final de 1 mL avec un tampon contenant 100 mM de NaCI, 50 mM d'HEPES/NaOH pH8, 1 mM d'EDTA et 10 mM de DTT. Différentes concentrations de zLVLQTM(SEQ ID Ne9).fmk sont pré-incubées avec 0,2 μΜ de 2Apro du RVH-2 pendant 5 min. Puis 25 μΜ de substrat sont ajoutés pour initier la réaction. Les mesures d'absorbance sont effectuées en continue à 405 nm pendant 10 min pour déterminer la vitesse initiale de chaque réaction. Le pourcentage d'inhibition pour une concentration donnée de peptide zLVLQTM(SEQ ID N°9).fmk a été calculé en faisant le rapport des vitesses initiales de réaction déterminées en présence et en l'absence de peptide. Les valeurs de pourcentage d'inhibition données à la Figure 9B résultent de la moyenne des valeurs obtenues à partir de 3 expériences indépendantes. Les écart- types sont également représentés. The activity test is carried out at 25 ° C in a final volume of 1 mL with a buffer containing 100 mM NaCl, 50 mM HEPES / NaOH pH8, 1 mM EDTA and 10 mM DTT. Different concentrations of zLVLQTM (SEQ ID NO : 9) .fmk are preincubated with 0.2 μl of 2Apro RVH-2 for 5 min. 25 μl of substrate are then added to initiate the reaction. Absorbance measurements are made continuously at 405 nm for 10 minutes to determine the initial rate of each reaction. The percent inhibition for a given concentration of zLVLQTM peptide (SEQ ID NO: 9) .fmk was calculated by reporting the determined initial reaction rates in the presence and absence of peptide. The percentage inhibition values given in Figure 9B result from the average of the values obtained from 3 independent experiments. The standard deviations are also represented.
En présence de 25 μΜ de substrat et 1,5 μΜ de zLVLQTM(SEQ ID Np9).fmk, l'activité de la 2Apro est complètement inhibée. De plus, la constante d'inhibition (Ki) mesurée est de 0,3 μΜ. A titre de comparaison, cette valeur est de 10 μΜ pour le StrepTag-SUMO- SEQ ID N°9 (Figure 5) et de 5,6 μΜ et 7,7 μΜ respectivement pour le zVAD.fmk et le zIETD.fmk, des inhibiteurs connus de la protéase 2A du RVH-2 (Sommergruber, Ahorn et al. 1992; Deszcz, Seipelt et al. 2004) ce qui démontre le fort potentiel inhibiteur du peptide zLVLQTM(SEQ ID N°9).fmk. 8.2) Le peptide zLVLQTM(SEQ ID N°9).fmk inhibe l'activité eIF-4Gase de la 2Apro du RVH-2, du RVH-14, d'ECHO-6, du PV et de l'EV-71 dans des cellules A549 In the presence of 25 μΜ substrate and 1.5 μΜ of zLVLQTM (SEQ ID NO: 9) .fmk, 2Apro activity is completely inhibited. In addition, the inhibition constant (Ki) measured is 0.3 μΜ. For comparison, this value is 10 μΜ for StrepTag-SUMO-SEQ ID No. 9 (Figure 5) and 5.6 μΜ and 7.7 μΜ for zVAD.fmk and zIETD.fmk, respectively. known inhibitors of RVH-2 protease 2A (Sommergruber, Ahorn et al., 1992, Deszcz, Seipelt et al., 2004) demonstrating the strong inhibitory potential of zLVLQTM peptide (SEQ ID NO: 9) .fmk. 8.2) The zLVLQTM peptide (SEQ ID NO: 9) .fmk inhibits the eIF-4Gase activity of RVH-2, RVH-14, ECHO-6, PV and EV-71 2Apro in A549 cells
Après avoir démontré que le peptide zLVLQTM(SEQ ID Nc9).fmk inhibe l'activité de la 2Apro du RVH-2 in vitro, son effet inhibiteur sur l'activité eIF-4Gase des 2Apro entérovirales a été mesuré dans des cellules A549. Ce test est basé sur le clivage du facteur d'initiation de la traduction des ARNm coiffés eIF-4G par les 2Apro entérovirales. Having demonstrated that the zLVLQTM peptide (SEQ ID NO 9 c) .fmk inhibits the activity of the 2Apro the RVH-2 in vitro, its inhibitory effect on eIF-4Gase 2Apro enteroviral activity was measured in A549 cells . This test is based on the cleavage of the translation initiation factor of eIF-4G capped mRNAs by enteroviral 2Apro.
Les cellules A549 sont maintenues en culture dans du milieu DMEM (milieu modifié Dulbecco, BioWhittaker) complémenté avec 10% (v/v) de sérum de veau fœtal, 2 mM de L-glutamine, 100 U/mL de pénicilline et 100 pg/mL de streptomycine. L'incubation est réalisée à 37°C dans une atmosphère saturée en humidité contenant 5 % de CÔ2. A confluence, les cellules sont détachées du support par traitement à la trypsine-EDTA et réensemencées dans une fiole de culture contenant 15 mL de milieu frais. La veille de la transfection, les cellules A549 sont ensemencées dans des plaques 48-puits pour atteindre 80% de confluence au moment de la transfection. A549 cells are maintained in culture in DMEM medium (Dulbecco modified medium, BioWhittaker) supplemented with 10% (v / v) fetal calf serum, 2 mM L-glutamine, 100 U / ml penicillin and 100 μg / ml. mL of streptomycin. Incubation is carried out at 37 ° C in a saturated humidity atmosphere containing 5% CO 2 . At confluence, the cells are detached from the support by treatment with trypsin-EDTA and reseeded in a culture flask containing 15 ml of fresh medium. On the day before transfection, A549 cells are seeded in 48-well plates to reach 80% confluency at the time of transfection.
Le lendemain, les cellules sont traitées avec 100 μΜ ou 200 μΜ de zLVLQTM(SEQ ID N°9).fmk pendant 1 h puis transfectées (TransIT, Mirus) avec les ARNm codant pour la 2Apro du RVH-2, du RVH-14, de ECHO-6, du PV ou de l'EV-71 pendant 2 h. Les cellules ont ensuite été transfectées (TransIT, Mirus) pendant 3 h avec un ARNm coiffé ou un ARNm présentant un 1RES en 5' tous deux codant pour la luciférase Renilla. Le premier possède la région 5'UTR de l'ARN de la β-Globine tandis que le second présente la région 5'UTR de l'ARN du virus de l'encéphalomyocardite.  The next day, the cells are treated with 100 μl or 200 μl of zLVLQTM (SEQ ID No. 9). Fmk for 1 h and then transfected (TransIT, Mirus) with mRNAs coding for 2Apro of RVH-2, RVH-14 , ECHO-6, PV or EV-71 for 2 hours. The cells were then transfected (TransIT, Mirus) for 3 h with capped mRNA or mRNA exhibiting a 5 'IRR encoding Renilla luciferase. The first has the 5'UTR region of the β-Globin RNA while the second has the 5'UTR region of the encephalomyocarditis virus RNA.
L'activité luciférase a été mesurée en utilisant le kit Renilla Luciférase Assay System de Promega :  Luciferase activity was measured using the Promega Renilla Luciferase Assay System Kit:
-les cellules ont été lysées avec 50 μΙ de tampon de iyse IX par puits -agitation 15 min à température ambiante  the cells were lysed with 50 μl of IX iysis buffer per well and stirred for 15 min at room temperature.
-l'activité luciférase est mesurée par luminométrie sur 20 μΙ de lysat en présence de 50 μΙ de substrat IX fourni dans le kit. La figure 9C montre qu'en présence de la protéase 2A du RVH-2, du RVH-14 ou de l'ECHO-6, l'activité de la Renilla luciférase dont l'ARNm est coiffé diminue par rapport à la situation contrôle (GFP), au profit de la traduction et de l'activité de la Renilla luciférase dont l'ARNm présente un 1RES en 5'. Ceci est dû au clivage du facteur d'initiation de la traduction elF- 4G, nécessaire à la traduction des ARNm coiffés. Les protéases entérovirales testées semblent donc actives dans ce système. En présence de 100 μΜ et 200 μΜ de zLVLQTM(SEQ ID N°9).fmk, l'effet des 2Apro est inhibé. Le peptide zLVLQTM(SEQ ID N°9).fmk inhibe donc l'activité de la 2Apro du RVH-2, du RVH-14 et de l'ECHO-6 dans un système cellulaire. the luciferase activity is measured by luminometry over 20 μl of lysate in the presence of 50 μl of IX substrate provided in the kit. FIG. 9C shows that in the presence of protease 2A of RVH-2, RVH-14 or ECHO-6, the activity of Renilla luciferase whose mRNA is capped decreases with respect to the control situation ( GFP), in favor of the translation and the activity of Renilla luciferase, the mRNA of which has an IRES in 5 '. This is due to the cleavage of the translation initiation factor elF-4G, necessary for the translation of the capped mRNAs. The enteroviral proteases tested therefore seem to be active in this system. In the presence of 100 μΜ and 200 μΜ of zLVLQTM (SEQ ID No. 9) .fmk, the effect of 2Apro is inhibited. The peptide zLVLQTM (SEQ ID No. 9) .fmk therefore inhibits the activity of 2Apro of RVH-2, RVH-14 and ECHO-6 in a cellular system.
La figure 9D montre que le zLVLQTM(SEQ ID N°9).fmk agit de la même manière sur la 2Apro du poliovirus et de l'EV-71 démontrant son large spectre d'action vis-à-vis 2Apro entérovirales.  Figure 9D shows that zLVLQTM (SEQ ID NO: 9) .fmk acts in the same way on poliovirus 2Apro and EV-71 demonstrating its broad spectrum of action against 2Apro enteroviruses.
8.3) Le peptide zLVLQTM(SEQ ID N°9).fmk inhibe la réplication du RVH-2 dans des cellules A549  8.3) zLVLQTM peptide (SEQ ID NO: 9) .fmk inhibits replication of RVH-2 in A549 cells
Après avoir démontré que le peptide zLVLQTM(SEQ ID Nô9).fmk inhibe l'activité de la 2Apro du RVH-2 in vitro, l'effet inhibiteur potentiel de ce peptide sur le cycle infectieux du RVH-2 dans des cellules A549 a été étudié. Having demonstrated that the zLVLQTM peptide (SEQ ID No. 9) .fmk inhibits the activity of the 2Apro the RVH-2 in vitro, the potential inhibitory effect of this peptide on the infectious cycle of the RVH-2 in A549 cells has been studied.
Dans cette étude, des cellules A549 sont maintenues en culture dans du milieu DMEM (milieu modifié Dulbecco, BioWhittaker) complémenté avec 10% (v/v) de sérum de veau fœtal, 2 mM de L-glutamine, 100 U/mL de pénicilline et 100 pg/mL de streptomycine. L'incubation est réalisée à 37°C dans une atmosphère saturée en humidité contenant 5 % de C02. A confluence, les cellules sont détachées du support par traitement à la trypsine-EDTA et réensemencées dans une fiole de culture contenant 15 mL de milieu frais. La veille de la transfection, les cellules A549 sont ensemencées dans des plaques 6-puits pour atteindre 80% de confluence au moment de la transfection. Le lendemain, les cellules sont infectées par le RVH-2 ou le RVH-14 à une MOI de 1 et traitées avec le zLVLQTM(SEQ ID N°9).fmk à 100 μΜ et 200 μΜ : 1. le milieu de culture est aspiré In this study, A549 cells are maintained in culture in DMEM medium (Dulbecco modified medium, BioWhittaker) supplemented with 10% (v / v) fetal calf serum, 2 mM L-glutamine, 100 U / mL penicillin and 100 μg / mL streptomycin. Incubation is performed at 37 ° C in a saturated humidity atmosphere containing 5% CO 2 . At confluence, the cells are detached from the support by treatment with trypsin-EDTA and reseeded in a culture flask containing 15 ml of fresh medium. On the day before transfection, A549 cells are seeded in 6-well plates to reach 80% confluency at the time of transfection. The next day, the cells are infected with RVH-2 or RVH-14 at a MOI of 1 and treated with zLVLQTM (SEQ ID No. 9) .fmk at 100 μM and 200 μM: 1. the culture medium is sucked
2. les cellules sont rincées une fois avec du milieu DMEM 2% sérum, 2 mM de L-glutamine, 100 U/mL de pénicilline et 100 pg/mL de streptomycine 2. the cells are rinsed once with DMEM medium 2% serum, 2 mM L-glutamine, 100 U / mL penicillin and 100 μg / mL streptomycin
3. les cellules sont inoculées avec un mélange de virus et de peptide zLVLQTM.fmk 3. the cells are inoculated with a mixture of virus and peptide zLVLQTM.fmk
4. les cellules ainsi inoculées sont incubées à 34°C pendant 12h  4. The cells thus inoculated are incubated at 34 ° C. for 12 hours.
Le surnageant des cellules infectées est prélevé 12h après infection par le RVH-2 ou le RVH-14. Les surnageants sont titrés sur des cellules MRC5 et la DICT50 est déterminée par la méthode de Reed et Muench (Reed LJ. 1938) selon le protocole suivant : The supernatant of the infected cells is removed 12 hours after infection with RVH-2 or RVH-14. Supernatants are titrated on MRC5 cells and TCID50 is determined by the method of Reed and Muench (Reed LJ, 1938) according to the following protocol:
8. Les cellules MRC5 sont maintenues en culture dans du milieu EMEM 8. The MRC5 cells are maintained in culture in EMEM medium
7% sérum, 2 mM de L-glutamine, 100 U/mL de pénicilline, 100 pg/mL de streptomycine et 2% hepes 1M et ensemencées dans des plaques 24 puits 5 jours avant inoculation avec le RVH-2. Elles sont confluentes le jour de l'infection. 7% serum, 2 mM L-glutamine, 100 U / mL penicillin, 100 μg / mL streptomycin and 2% 1M hepes and seeded in 24-well plates 5 days before inoculation with RVH-2. They are confluent on the day of infection.
9. Le jour de l'infection, huit dilutions de raison 10, de 10"1 à 10"8 sont réalisées pour chaque échantillon de façon à inoculer 100 pL de chaque dilution sur 6 puits par plaque 24 puits. 9. The day of infection, eight-fold dilutions of 10, 10 "1-10" 8 are made for each sample so as to inoculate 100 ul of each dilution on 6-well by 24-well plate.
10. Le milieu de survie des cellules (1,4 mL) est changé avant distribution des suspensions virales sur plaque.  10. The cell survival medium (1.4 mL) is changed before distribution of plaque viral suspensions.
11. 100 pL de suspension virale non diluée sont distribués sur 6 cupules de plaques 24 puits.  11. 100 μl undiluted viral suspension is distributed on 6 wells of 24-well plates.
12. De la même façon, 100 pL de chaque dilution de virus sont distribués sur 6 cupules de plaques 24 puits. Plusieurs témoins sans virus sont également réalisés.  12. Similarly, 100 μl of each virus dilution is distributed over 6 wells of 24-well plates. Several virus-free cookies are also made.
13. Les plaques sont incubées à 34°C pendant 5 jours.  13. The plates are incubated at 34 ° C for 5 days.
14. Le 5e jour, la DICT50 est calculée selon la méthode de Reed et Muench. 14. On day 5, the TCID 50 is calculated according to the method of Reed and Muench.
Cette expérience a été répétée 3 fois. Dans les cellules traitées avec 200 μΜ de peptide zLVLQTM.fmk, le titre viral est plus de 100 fois plus faible que dans les cellules en présence de DMSO uniquement. Le peptide zLVLQTM(SEQ ID N°9).fmk inhibe de manière dose dépendante la réplication du RVH-2 et du RVH-14 dans les cellules A549 (Figure 9 E). This experiment was repeated 3 times. In cells treated with 200 μl peptide zLVLQTM.fmk, the viral titer is more than 100-fold lower than in cells in the presence of DMSO only. ZLVLQTM peptide (SEQ ID NO: 9) .fmk inhibits dose dependently replication of RVH-2 and RVH-14 in A549 cells (Figure 9 E).
8.4) Test de viabilité des cellules A549 en présence du zLVLQTM(SEQ ID N°9).fmk 8.4) Viability test of A549 cells in the presence of zLVLQTM (SEQ ID No. 9) .fmk
La viabilité des cellules A549 en présence de différentes concentrations du zLVLQTM(SEQ ID IM°9).fmk a été déterminée par un test MTT (3-(4,5- dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide).  The viability of A549 cells in the presence of different concentrations of zLVLQTM (SEQ ID NO: 9) .fmk was determined by an MTT test (3- (4,5-dimethylthiazol-2-yl) -2,5-diphenyltetrazolium bromide) .
Les cellules A549 sont maintenues en culture dans du milieu DMEM (milieu modifié Dulbecco, BioWhittaker) complémenté avec 10% (v/v) de sérum de veau f tal, 2 mM de L-glutamine, 100 U/mL de pénicilline et 100 pg/mL de streptomycine. L'incubation est réalisée à 37°C dans une atmosphère saturée en humidité contenant 5 % de CO2. A confluence, les cellules sont détachées du support par traitement à la trypsine-EDTA et réensemencées dans une fiole de culture contenant 15 mL de milieu frais. La veille du traitement, les cellules A549 sont ensemencées dans des plaques 96-puits pour atteindre 90% de confluence au moment de la transfection. A549 cells are maintained in culture in DMEM medium (Dulbecco modified medium, BioWhittaker) supplemented with 10% (v / v) fetal calf serum, 2 mM L-glutamine, 100 U / mL penicillin and 100 μg / ml of streptomycin. Incubation is performed at 37 ° C in a saturated humidity atmosphere containing 5% CO 2 . At confluence, the cells are detached from the support by treatment with trypsin-EDTA and reseeded in a culture flask containing 15 ml of fresh medium. On the day before treatment, A549 cells were seeded in 96-well plates to reach 90% confluency at the time of transfection.
Le lendemain, les cellules sont traitées avec du DMSO ou différentes concentrations de zLVLQTM(SEQ ID IM°9).fmk pendant 24h. Les cellules ainsi traitées sont alors mises en présence de 30 μΙ de MTT (5 mg/ml, Sigma) préalablement chauffé à 37°C pendant 3h. Le surnageant des cellules est ensuite aspiré, 150 μΙ de DMSO sont ajoutés par puits et l'absorbance à 540 nm est mesurée. Le pourcentage de viabilité cellulaire est calculé par rapport aux cellules traitées au DMSO. Cette expérience est répétée au moins 3 fois. La Figure 9F montre que le zLVLQTM(SEQ ID N°9).fmk n'est pas toxique lorsque sa concentration est inférieure à 400 μΜ. 9) Le peptide zLVLQTM(SEQ ID °9).f )k inhibe la répiication du RVH- 2 in vivo chez la souris The next day, the cells are treated with DMSO or different concentrations of zLVLQTM (SEQ ID No. 9) .fmk for 24 hours. The cells thus treated are then brought into contact with 30 μΙ of MTT (5 mg / ml, Sigma) preheated at 37 ° C. for 3 h. The supernatant of the cells is then aspirated, 150 μl of DMSO are added per well and the absorbance at 540 nm is measured. The percentage of cell viability is calculated relative to DMSO-treated cells. This experiment is repeated at least 3 times. Figure 9F shows that zLVLQTM (SEQ ID No. 9) .fmk is not toxic when its concentration is less than 400 μΜ. 9) The peptide zLVLQTM (SEQ ID No. 9) .f) k inhibits the replication of RVH-2 in vivo in mice
Les effets du peptide zLVLQTM(SEQ ID N°9).fmk sur la répiication du RVH-2 ont ensuite été évalués in vivo chez la souris.  The effects of zLVLQTM peptide (SEQ ID NO: 9) .fmk on the replication of RVH-2 were then evaluated in vivo in mice.
1. Des souris femelles Balb/c de 6 semaines sont anesthésiées avec 50 μΙ de ketamine (520 L Rompun 2%, 1,53 mL Imalgene 1000, qsp 20mL eau). Elles sont infectées par voie intranasale avec 105 pfu de RVH-2 contenu dans 25 pL de milieu EMEM 2% sérum puis traitées par voie intranasale avec 20 μΜ, 200 μΜ ou 500 μ de zLVLQTM.fmk contenu dans 25 pL de DMSO. Un contrôle DMSO seul est réalisé. 1. Six week old female Balb / c mice are anesthetized with 50 μl of ketamine (520 L Rompun 2%, 1.53 ml Imalgene 1000, qs 20 ml water). They were infected intranasally with 10 5 pfu of RVH-2 contained in 25 uL of EMEM 2% serum and then treated intranasally with 20 μΜ, 200 μΜ or 500 μ of zLVLQTM.fmk contained in 25 uL of DMSO. Only DMSO control is performed.
2. Le poids des souris infectées et traitées est mesuré tous les jours (Figure 10A).  2. The weight of infected and treated mice is measured daily (Figure 10A).
2. Les souris sont sacrifiées 24h, 48h ou 120h post-infection et les poumons sont prélevés puis broyés dans 500 pL de milieu EMEM. Les souris sacrifiées 120h post-infection reçoivent une deuxième injection de DMSO ou 20 μΜ, 200 μΜ ou 500 μΜ de zLVLQTM(SEQ ID N°9).fmk 48h post- infection.  2. The mice are sacrificed 24h, 48h or 120h post-infection and the lungs are removed and then ground in 500 μl of EMEM medium. Mice sacrificed 120h post-infection receive a second injection of DMSO or 20 μΜ, 200 μΜ or 500 μΜ of zLVLQTM (SEQ ID No. 9) .fmk 48h post-infection.
3. Les lysats ainsi obtenus sont centrifugés à 15 000 rpm pendant 15 min à 4°C  3. The lysates thus obtained are centrifuged at 15,000 rpm for 15 min at 4 ° C.
4. Les surnageants des lysats sont récupérés et titrés sur cellules MRC5. La DICT50 est déterminée par la méthode de Reed et Muench (Reed LJ. 1938).  4. The supernatants of the lysates are recovered and titrated on MRC5 cells. TCID50 is determined by the method of Reed and Muench (Reed LJ, 1938).
La Figure ÎOA montre que le poids des souris infectées par du RVH-2 puis traitées avec le peptide zLVLQTM(SEQ ID N°9).fmk ou le DMSO seul ne varie que de 5 à 10 % au cours de l'infection ce qui montre que le peptide zLVLQTM(SEQ ID N°9).fmk présente une faible toxicité in vivo aux concentrations testées. De plus, le titre viral diminue près de 30 fois dans les poumons de souris traitées avec les doses les plus faibles de peptide (20μΜ) et ce dès 24h post-infection (Figure 10B). Cette diminution qui est dépendante de la dose de peptide employée montre que le composé zLVLQTM(SEQ ID N°9).fmk inhibe donc la réplication du RVH in vivo. Figure 10A shows that the weight of the mice infected with RVH-2 and then treated with the peptide zLVLQTM (SEQ ID No. 9) .fmk or DMSO alone varies only 5 to 10% during the infection which shows that the peptide zLVLQTM (SEQ ID No. 9) .fmk has low toxicity in vivo at the concentrations tested. In addition, the viral titer decreases nearly 30-fold in the lungs of mice treated with the lowest doses of peptide (20μΜ) and this from 24h post-infection (Figure 10B). This decrease which is Depending on the dose of peptide used, the compound zLVLQTM (SEQ ID No. 9) .fmk thus inhibits the replication of RVH in vivo.
10) Le peptide zL VLQTM(SEQ ID N°9).fmk inhibe l'activité de la protéase 3C 10) The zL VLQTM peptide (SEQ ID NO: 9) .fmk inhibits the activity of the 3C protease
Les effets du zLVLQTMfSEQ ID N°9).fmk sur l'activité de la 3C protéase ont été évalués en utilisant le kit « 3C-Express » de Expedeon. Ce kit est composé de la 3Cpro du Rhinovirus purifiée (47kDa) et d'une protéine substrat fusionnée à la GST (68kDa) contenant le site de clivage LEVLFQ-GP (SEQ ID N°2D). Le substrat est ainsi clivé entre les résidus Gln/Gly par la protéase 3C en deux fragments de 42 et 26 kDa. The effects of zLVLQTMfSEQ ID No. 9) .fmk on 3C protease activity were evaluated using Expedeon's "3C-Express" kit. This kit is composed of purified Rhinovirus 3Cpro (47kDa) and a GST-fused substrate protein (68kDa) containing the LEVLFQ-GP cleavage site (SEQ ID No. 2D). The substrate is thus cleaved between the Gln / Gly residues by the 3C protease in two fragments of 42 and 26 kDa.
Chaque réaction a été réalisée dans un tampon contenant 25 mM Tris pH 8, 150 mM NaCI, 14 mM B mercaptoéthanol. La protéase 3C (0,01U) a été mise en présence de 1 μς de substrat et de 50 μΜ de zLVLQTMfSEQ ID N°9).fmk dans un volume final de 20 μΙ pendant 16 h à 4°C.  Each reaction was carried out in a buffer containing 25 mM Tris pH 8, 150 mM NaCl, 14 mM B mercaptoethanol. Protease 3C (0.01U) was placed in the presence of 1 μς of substrate and 50 μl of zLVLQTMfSEQ ID No. 9) .fmk in a final volume of 20 μΙ for 16 h at 4 ° C.
Les protéines ont été séparées sur gel d'acrylamide SDS-PAGE et colorées au Bleu de Coomassie R250. La Figure 11 montre qu'en présence de la protéase 3C, le substrat est clivé en deux fragments de 42 kDa et 26 kDa. Ce clivage est inhibé en présence de 50 μΜ de zLVLQTMfSEQ ID N°9).fmk.  Proteins were separated on SDS-PAGE acrylamide gel and stained with Coomassie Blue R250. Figure 11 shows that in the presence of protease 3C, the substrate is cleaved into two fragments of 42 kDa and 26 kDa. This cleavage is inhibited in the presence of 50 μl of zLVLQTMfSEQ ID No. 9) .fmk.
Deszcz, L., R. Cencic, et al. (2006). "An antiviral peptide inhibitor that is active against picornavirus 2A proteinases but not cellular caspases." J Virol 80(19): 9619-9627. Deszcz, L., R. Cencic, et al. (2006). "An antiviral peptide inhibitor that is active against picornavirus 2A proteinases but not cellular caspases." J Virol 80 (19): 9619-9627.
Deszcz, L, J. Seipelt, et al. (2004). "Antiviral activity of caspase inhibitors: effect on picornaviral 2A proteinase." FEBS Lett 560(1-3): 51-55. Formstecher, E., S. Aresta, et al. (2005). "Protëin interaction mapping: a Deszcz, L., J. Seipelt, et al. (2004). "Antiviral activity of caspase inhibitors: effect on picornaviral 2A proteinase." FEBS Lett 560 (1-3): 51-55. Formstecher, E., S. Aresta, et al. (2005). "Protein interaction mapping: a
Drosophila case study." Génome Res 15(3): 376-384. Drosophila case study. Genome Res 15 (3): 376-384.
Fromont-Racine, M., J. C. Rain, et ai. (1997). "Toward a functional analysis of the yeast génome through exhaustive two-hybrid screens." NatFromont-Racine, M., J.C. Rain, et al. (1997). "Toward a functional analysis of the yeast genome through exhaustive two-hybrid screens." Nat
Genêt 16(3): 277-282. Hayden, F. G., J. K. Albrecht, et al. (1986). "Prévention of natural colds by contact prophylaxis with intranasal alpha 2-interferon." N Enql J Med 314(2): 71-75. Broom 16 (3): 277-282. Hayden, FG, JK Albrecht, et al. (1986). "Prevention of natural colds by contact prophylaxis with intranasal alpha 2-interferon." N Enql J Med 314 (2): 71-75.
Ho, M., E. R. Chen, et al. (1999). "An épidémie of enterovirus 71 infection in Taiwan. Taiwan Enterovirus Epidémie Working Group." N Enal 3 Med Ho, M., E. R. Chen, et al. (1999). "An epidemic of enterovirus 71 infection in Taiwan." Taiwan Enterovirus Epidemic Working Group. N Enal 3 Med
341(13): 929-935. 341 (13): 929-935.
Kairis, B., P. Sauter, et al. (2009). "[When an enterovirus émerges]." Pathol Kairis, B., P. Sauter, et al. (2009). "[When an enterovirus emerges]." Pathol
Biol (Paris) 57(3): 258-267. Biol (Paris) 57 (3): 258-267.
Liu, C. C, H. W. Tseng, et al. (2000). "An outbreak of enterovirus 71 infection in Taiwan, 1998: epidemiologic and clinical manifestations." JLiu, C. C., H. W. Tseng, et al. (2000). "An outbreak of enterovirus 71 infection in Taiwan, 1998: epidemiologic and clinical manifestations." J
Clin Virol 17(1): 23-30. Clin Virol 17 (1): 23-30.
Molla, A., C. U. Hellen, et al. (1993). "Inhibition of proteolytic activity of poliovirus and rhinovirus 2A proteinases by elastase-specific inhibitors." J Virol 67(8): 4688-4695. Molla, A., C. U. Hellen, et al. (1993). "Inhibition of proteolytic activity of poliovirus and rhinovirus 2A proteinases by elastase-specific inhibitors." J Virol 67 (8): 4688-4695.
Nicholson, K. G., J. Kent, et al. (1993). "Respiratory viruses and exacerbations of asthma in adults." BMJ 307(6910): 982-986. Nicholson, K.G., J. Kent, et al. (1993). "Respiratory viruses and exacerbations of asthma in adults." BMJ 307 (6910): 982-986.
Pitkaranta, A., E. Arruda, et al. (1997). "Détection of rhinovirus in sinus brushings of patients with acute community-acquired sinusitis by reverse transcription-PCR." J Clin Microbiol 35(7): 1791-1793. Pitkaranta, A., Arruda, E., et al. (1997). "Detection of rhinovirus in sinus brushings of patients with acute community-acquired sinusitis by reverse transcription-PCR." J Clin Microbiol 35 (7): 1791-1793.
Pitkaranta, A., A. Virolainen, et al. (1998). "Détection of rhinovirus, respiratory syncytial virus, and coronavirus infections in acute otitis média by reverse transcriptase polymerase chain reaction." Pediatrics 102(2 Pt 1): 291-295. Pitkaranta, A., A. Virolainen, et al. (1998). "Detection of rhinovirus, respiratory syncytial virus, and coronavirus infections in acute otitis media by reverse transcriptase polymerase chain reaction." Pediatrics 102 (2 Pt 1): 291-295.
Rain, 3. C, L. Selig, et al. (2001). 'The protein-protein interaction map of Helicobacter pylori." Nature 409(6817): 211-215. Rain, 3. C., L. Selig, et al. (2001). The protein-protein interaction map of Helicobacter pylori. Nature 409 (6817): 211-215.
Reed LJ., H. M. (1938). "a simple method of estimating 50 per cent end- points." Am J Ηνα 27: 493-497.  Reed LJ, H.M. (1938). "a simple method of estimating 50 percent end points." Am J Ηνα 27: 493-497.
Schechter, I. and A. Berger (1968). "On the active site of proteases. 3. Schechter, I. and A. Berger (1968). On the active site of proteases 3.
Mapping the active site of papain; spécifie peptide inhibitors of papain." Bidchem Biophvs Res Commun 32(5): 898-902.  Mapping the active site of papain; Specifies peptide inhibitors of papain. "Bidchem Biophvs Res Commun 32 (5): 898-902.
Skern, T., W. Sommergruber, et al. (1991). "Substrate requirements of a human rhinoviral 2A proteinase." Virology 181(1): 46-54. Sommergruber, W., H. Ahorn, et al. (1992). "Cleavage specificity on synthetic peptide substrates of human rhinovirus 2 proteinase 2A." JSkern, T., W. Sommergruber, et al. (1991). "Substrate requirements of a human rhinoviral 2A proteinase." Virology 181 (1): 46-54. Sommergruber, W., Ahorn, H., et al. (1992). "Cleavage specificity on synthetic peptide substrates of human rhinovirus 2 proteinase 2A." J
Biol Chem 267(31): 22639-22644. Biol Chem 267 (31): 22639-22644.
Sperber, S. J., P. A. Levine, et al. (1989). "Ineffectiveness of recombinant interferon-beta serine nasal drops for prophylaxis of natural colds." JSperber, S.J., P.A. Levine, et al. (1989). "Ineffectiveness of recombinant interferon-beta nasal serine drops for prophylaxis of natural colds." J
Infect Dis 160(4): 700-705. Infect Dis 160 (4): 700-705.
Studier, F. W. (2005). "Protein production by auto-induction in high density shaking cultures." Protein Expr Purif 41(1): 207-234. Studier, F. W. (2005). "Protein production by auto-induction in high density shaking cultures." Protein Expr Purif 41 (1): 207-234.
Timmer, T., P. Terpstra, et al. (1999). "A comparison of genomic structures and expression patterns of two closely related flanking gènes in a critical lung cancer région at 3p21.3." Eur J Hum Genêt 7(4): 478-486. Turner, R. B. (2001). "The treatment of rhinovirus infections: progress and potential." Antiviral Res 49(1): 1-14. Timmer, T., P. Terpstra, et al. (1999). "A comparison of genomic structures and expression patterns of two closely related flanking genes in a critical lung cancer region at 3p21.3." Eur J Hum Broom 7 (4): 478-486. Turner, R. B. (2001). "The treatment of rhinovirus infections: progress and potential." Antiviral Res 49 (1): 1-14.
Turner, R. B., M. T. Wecker, et al. (1999). "Efficacy of tremacamra, a soluble intercellular adhésion molécule 1, for expérimental rhinovirus infection: a randomized ciinical trial." JAMA 281(19): 1797-1804. Turner, R. B., M. T. Wecker, et al. (1999). "Efficacy of tremacamra, a soluble intercellular adhesion molecule 1, for experimental rhinovirus infection: a randomized ciinical trial." JAMA 281 (19): 1797-1804.
Ventoso, I., A. Barco, et al. (1999). "Genetic sélection of poliovirus 2Apro- binding peptides." J Virol 73(1): 814-818. Ventoso, I., A. Barco, et al. (1999). "Genetic selection of poliovirus 2Apro- binding peptides." J Virol 73 (1): 814-818.
Vojtek, A. B. and S. M. Hollenberg (1995). "Ras-Raf interaction: two-hybrid analysis." Methods Enzvmol 255: 331-342. Vojtek, A. B. and S. M. Hollenberg (1995). "Ras-Raf interaction: two-hybrid analysis." Methods Enzymol 255: 331-342.
Wang, Q. M., R. B. Johnson, et al. (1998). "Dual inhibition of human rhinovirus 2A and 3C proteases by homophthalimides." Antimicrob Wang, Q.M., R.B. Johnson, et al. (1998). "Dual inhibition of human rhinovirus 2A and 3C proteases by homophthalimides." Antimicrob
Agents Chemother 42f4): 916-920. Agents Chemother 42f4): 916-920.
Wang, Q. M., W. Sommergruber, et al. (1997). "Cleavage specificity of human rhinovirus-2 2A protease for peptide substrates." BiochemWang, Q.M., W. Sommergruber, et al. (1997). "Cleavage specificity of human rhinovirus-2 2A protease for peptide substrates." Biochem
Bioohvs Res Commun 235(3): 562-566. Bioohvs Res Common 235 (3): 562-566.
Wojcik, J., I. G. Boneca, et al. (2002). "Prédiction, assessment and validation of protein interaction maps in bacteria." J Mol Biol 323(4): 763-770. Wojcik, J., I.G. Boneca, et al. (2002). "Prediction, assessment and validation of protein interaction maps in bacteria." J Mol Biol 323 (4): 763-770.

Claims

REVENDICATIONS
1 - Peptides dont la partie C-terminale correspond à la séquence  1 - Peptides whose C-terminal part corresponds to the sequence
LVLQTM (SEQ ID N°9), ainsi que les dérivés chimiques de tels peptides, à l'exception de la protéine RBM6 delta 6. LVLQTM (SEQ ID No. 9), as well as the chemical derivatives of such peptides, with the exception of the RBM6 delta 6 protein.
2 - Peptides selon l'une des revendications précédentes caractérisés en ce qu'ils sont substitués sur le NH2 de leur extrémité N-terminale et/ou sur leur extrémité C-terminale par modification du groupement -COOH de la méthionine. 2 - Peptides according to one of the preceding claims characterized in that they are substituted on the NH 2 of their N-terminal and / or on their C-terminal end by modification of the -COOH group of methionine.
3 - Peptides selon l'une des revendications précédentes caractérisés en ce qu'ils sont substitués sur le NH2 de leur extrémité N-terminale par un groupement acétyle, un groupement benzoyle, un groupement tosyle ou un groupement benzyloxycarbonyle (Z), et/ou sur leur extrémité C-terminale par modification du groupement -COOH de la méthionine par amidation de la fonction hydroxyle du groupement -COOH de la méthionine par un groupement NYY avec Y qui représente une chaîne alkyle, notamment de 1 à 4 atomes de carbone, ou par estérification par un groupement alkyle, notamment de 1 à 4 atomes de carbone ou encore par formation d'une fluorométhylcétone.  3 - Peptides according to one of the preceding claims characterized in that they are substituted on the NH 2 of their N-terminus by an acetyl group, a benzoyl group, a tosyl group or a benzyloxycarbonyl (Z) group, and / or on their C-terminal end by modifying the -COOH group of the methionine by amidation of the hydroxyl function of the -COOH group of methionine with a group NYY with Y which represents an alkyl chain, in particular of 1 to 4 carbon atoms, or by esterification with an alkyl group, especially from 1 to 4 carbon atoms, or else by formation of a fluoromethylketone.
4 - Peptides selon l'une des revendications précédentes caractérisés en ce qu'ils sont substitués sur leur extrémité C-terminale par modification du groupement -COOH en une fluorométhylcétone.  4 - Peptides according to one of the preceding claims characterized in that they are substituted on their C-terminal end by modification of the group -COOH into a fluoromethylketone.
5 - Peptides selon l'une des revendications précédentes caractérisés en ce qu'ils comportent dé 6 à 1000 acides aminés.  5 - Peptides according to one of the preceding claims characterized in that they contain from 6 to 1000 amino acids.
6 - Peptides selon l'une des revendications précédentes caractérisés en ce que leur taille ne dépasse pas 50, voire 20 amino-acides.  6 - Peptides according to one of the preceding claims characterized in that their size does not exceed 50 or 20 amino acids.
7 - Peptide selon l'une des revendications précédentes caractérisé en ce qu'il correspond à la séquence LVLQTM (SEQ ID N°9), ainsi que les dérivés chimiques de ce peptide.  7 - Peptide according to one of the preceding claims characterized in that it corresponds to the sequence LVLQTM (SEQ ID No. 9), as well as the chemical derivatives of this peptide.
8 - Peptide selon Tune des revendications précédentes caractérisé en ce qu'il correspond au peptide LVLQTM (SEQ ID N°9) dont le groupe NH2 de son extrémité N-terminaie est fonctionnalisé par un groupe benzyloxycarbonyle et le groupe -COOH de sa méthionine C-terminale est modifié en une fluorométhylcétone. 8 - Peptide according to one of the preceding claims characterized in that it corresponds to the peptide LVLQTM (SEQ ID No. 9) whose NH 2 group of its N-terminaie end is functionalized by a group benzyloxycarbonyl and the -COOH group of its C-terminal methionine is modified to a fluoromethylketone.
9 - Peptide choisi parmi les peptides selon l'une des revendications précédentes ou la protéine RBM6 delta 6 isolée, pour son utilisation dans le traitement thérapeutique ou prophylactique d'une infection causée par un Enterovirus.  9 - A peptide selected from the peptides according to one of the preceding claims or the isolated RBM6 delta 6 protein for its use in the therapeutic or prophylactic treatment of an infection caused by an Enterovirus.
10 - Peptide selon l'une des revendications 1 à 9, en tant que médicament pour le traitement thérapeutique ou prophylactique d'une affection choisie parmi les rhumes, otites, sinusites, paralysies flasques aiguës, méningites aseptiques, syndrome pieds-mains-bouche, maladies respiratoires, cardiopathies aiguës ou chroniques, diarrhées, pancréatites, - atteintes oculaires et encéphalites.  10 - Peptide according to one of claims 1 to 9, as a medicament for the therapeutic or prophylactic treatment of a condition selected from colds, otitis, sinusitis, acute flaccid paralysis, aseptic meningitis, foot-hand-mouth syndrome, respiratory diseases, acute or chronic heart diseases, diarrhea, pancreatitis, ocular lesions and encephalitis.
11 - Peptide selon l'une des revendications 1 à 9, pour son utilisation dans le traitement thérapeutique ou prophylactique des Entérovirus, et notamment d'une infection causée par un Rhinovirus Humain tel que le RVH- 2, ou un ECHOvirus ou un Poliovirus ou de l'Entérovirus 71.  11 - The peptide according to one of claims 1 to 9, for its use in the therapeutic or prophylactic treatment of enteroviruses, and in particular of an infection caused by a human rhinovirus such as RVH-2, or an ECHOvirus or a poliovirus or Enterovirus 71.
12 - Peptide selon l'une des revendications 1 à 11 caractérisé en ce qu'il présente une activité inhibitrice d'une protéase cellulaire ou virale.  12 - Peptide according to one of claims 1 to 11 characterized in that it has an inhibitory activity of a cellular or viral protease.
13 - Peptide selon la revendication 12 caractérise en ce qu'il présente une activité inhibitrice de la protéase 2A du Rhinovirus Humain, et en particulier du RVH-2.  13 - Peptide according to claim 12 characterized in that it has an inhibitory activity of the human rhinovirus 2A protease, and in particular of RVH-2.
14 - Peptide selon la revendication 12 caractérisé en ce qu'il présente une activité inhibitrice d'une protéase cellulaire ou virale, autre que la protéase 2A du rhinovirus.  14 - Peptide according to claim 12 characterized in that it has an inhibitory activity of a cellular or viral protease, other than protease 2A rhinovirus.
15 - Composition pharmaceutique comprenant un peptide choisi parmi les peptides selon l'une des revendications 1 à 14, en association avec un excipient pharmaceutiquement acceptable.  - A pharmaceutical composition comprising a peptide selected from the peptides according to one of claims 1 to 14, in association with a pharmaceutically acceptable excipient.
16 - Composition selon la revendication 15 pour le traitement d'une infection causée par un Entérovirus, et en particulier un Rhinovirus ou l'ECHOvirus ou le Poliovirus ou l'Entérovirus 71.  16 - Composition according to claim 15 for the treatment of an infection caused by enterovirus, and in particular a rhinovirus or ECHOvirus or poliovirus or Enterovirus 71.
17 - Utilisation d'un peptide selon l'une des revendications 1 à 8 et 12 à 14, pour la préparation de lysats cellulaires. 18 - Utilisation d'un peptide selon l'une des revendications 1 à 14 pour le diagnostic in vitro d'un Entérovirus, et notamment d'un Rhinovirus Humain tel que le RVH-2, ou d'un ECHOvirus ou d'un Poliovirus ou de l'Entérovirus 71. 17 - Use of a peptide according to one of claims 1 to 8 and 12 to 14 for the preparation of cell lysates. 18 - Use of a peptide according to one of claims 1 to 14 for the in vitro diagnosis of enterovirus, and in particular of a human rhinovirus such as RVH-2, or an ECHOvirus or a poliovirus or Enterovirus 71.
19 - Utilisation selon la revendication 18 caractérisée en ce que le peptide est utilisé pour la détection d'une protéase, et en particulier de la protéase 2A ou 3C, de l'Entérovirus à diagnostiquer.  19 - The use according to claim 18 characterized in that the peptide is used for the detection of a protease, and in particular protease 2A or 3C, enterovirus to be diagnosed.
PCT/FR2011/050927 2010-05-11 2011-04-21 Peptides with antiprotease activity WO2011141658A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
FR1053678A FR2959992A1 (en) 2010-05-11 2010-05-11 PEPTIDES WITH ANTIPROTEASE ACTIVITY
FR1053678 2010-05-11

Publications (1)

Publication Number Publication Date
WO2011141658A1 true WO2011141658A1 (en) 2011-11-17

Family

ID=43063802

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/FR2011/050927 WO2011141658A1 (en) 2010-05-11 2011-04-21 Peptides with antiprotease activity

Country Status (2)

Country Link
FR (1) FR2959992A1 (en)
WO (1) WO2011141658A1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN103088007A (en) * 2013-01-28 2013-05-08 厦门大学 Crystal structure of enterovirus 71 type 2A protease and application of crystal structure in drug design
CN108663523A (en) * 2017-03-31 2018-10-16 复旦大学 It can be used for diagnosing the kit of human enterovirus 71 infection

Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA208221A (en) 1921-02-01 Baxter Buzzaird Raleigh Coin lock mechanism
EP0263214A1 (en) 1986-10-10 1988-04-13 E.I. Du Pont De Nemours And Company Tetrapeptide methyl ketone inhibitors of viral proteases
EP0263202A1 (en) 1986-10-06 1988-04-13 E.I. Du Pont De Nemours And Company Inhibition of viral protease activity by peptide halomethyl ketones
EP0387231A2 (en) * 1989-03-08 1990-09-12 Washington University Novel inhibitors of retroviral protease
WO1992022570A1 (en) * 1991-06-14 1992-12-23 Chiron Corporation Inhibitors of picornavirus proteases
US5559025A (en) 1991-11-06 1996-09-24 Boehringer Ingelheim International Gmbh Expression of mature proteinase 2A, the partial purification thereof and preparation of substrates having an inhibitory effect
WO1998006743A1 (en) * 1996-08-13 1998-02-19 Commonwealth Scientific And Industrial Research Organisation Acylated peptide cytolytic peptide inhibitors
WO2004069864A1 (en) * 2003-01-07 2004-08-19 Biomerieux Polypeptides f' of the hepatitis c virus, epitopes, and the diagnostic and therapeutic applications thereof

Patent Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA208221A (en) 1921-02-01 Baxter Buzzaird Raleigh Coin lock mechanism
EP0263202A1 (en) 1986-10-06 1988-04-13 E.I. Du Pont De Nemours And Company Inhibition of viral protease activity by peptide halomethyl ketones
EP0263214A1 (en) 1986-10-10 1988-04-13 E.I. Du Pont De Nemours And Company Tetrapeptide methyl ketone inhibitors of viral proteases
EP0387231A2 (en) * 1989-03-08 1990-09-12 Washington University Novel inhibitors of retroviral protease
WO1992022570A1 (en) * 1991-06-14 1992-12-23 Chiron Corporation Inhibitors of picornavirus proteases
US5559025A (en) 1991-11-06 1996-09-24 Boehringer Ingelheim International Gmbh Expression of mature proteinase 2A, the partial purification thereof and preparation of substrates having an inhibitory effect
WO1998006743A1 (en) * 1996-08-13 1998-02-19 Commonwealth Scientific And Industrial Research Organisation Acylated peptide cytolytic peptide inhibitors
WO2004069864A1 (en) * 2003-01-07 2004-08-19 Biomerieux Polypeptides f' of the hepatitis c virus, epitopes, and the diagnostic and therapeutic applications thereof

Non-Patent Citations (31)

* Cited by examiner, † Cited by third party
Title
C. BADORFF ET AL: "Enteroviral Protease 2A Directly Cleaves Dystrophin and Is Inhibited by a Dystrophin-based Substrate Analogue", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 275, no. 15, 6 April 2000 (2000-04-06), pages 11191 - 11197, XP055007471, ISSN: 0021-9258, DOI: 10.1074/jbc.275.15.11191 *
DESZCZ LUIZA ET AL: "An antiviral peptide inhibitor that is active against picornavirus 2A proteinases but not cellular caspases", JOURNAL OF VIROLOGY, THE AMERICAN SOCIETY FOR MICROBIOLOGY, US, vol. 80, no. 19, 1 October 2006 (2006-10-01), pages 9619 - 9627, XP002492722, ISSN: 0022-538X, DOI: 10.1128/JVI.00612-06 *
DESZCZ, L., J. SEIPELT: "Antiviral activity of caspase inhibitors: effect on picornaviral 2A proteinase", FEBS LETT, vol. 560, no. 1-3, 2004, pages 51 - 55, XP004492490, DOI: doi:10.1016/S0014-5793(04)00069-9
DESZCZ, L., R. CENCIC ET AL.: "An antiviral peptide inhibitor that is active against picornavirus 2A proteinases but not cellular caspases", J VIROL, vol. 80, no. 19, 2006, pages 9619 - 9627, XP002492722, DOI: doi:10.1128/JVI.00612-06
FORMSTECHER, E., S. ARESTA ET AL.: "Protein interaction mapping: a Drosophila case study", GENOME RES, vol. 15, no. 3, 2005, pages 376 - 384
FROMONT-RACINE, M., J. C. RAIN ET AL.: "Toward a functional analysis of the yeast genome through exhaustive two-hybrid screens", NAT GENET, vol. 16, no. 3, 1997, pages 277 - 282, XP000770741, DOI: doi:10.1038/ng0797-277
HAYDEN, F. G., J. K. ALBRECHT ET AL.: "Prevention of natural colds by contact prophylaxis with intranasal alpha 2-interferon", N ENGL J MED, vol. 314, no. 2, 1986, pages 71 - 75
HO, M., E. R. CHEN ET AL.: "An epidemic of enterovirus 71 infection in Taiwan. Taiwan Enterovirus Epidemic Working Group", N ENGL J MED, vol. 341, no. 13, 1999, pages 929 - 935
KAIRIS, B., P. SAUTER ET AL.: "When an enterovirus emerges", PATHOL BIOL (PARIS), vol. 57, no. 3, 2009, pages 258 - 267
LIU, C. C., H. W. TSENG ET AL.: "An outbreak of enterovirus 71 infection in Taiwan, 1998: epidemiologic and clinical manifestations", J CLIN VIROL, vol. 17, no. 1, 2000, pages 23 - 30, XP027400757
MOLLA, A., C. U. HELLEN ET AL.: "Inhibition of proteolytic activity of poliovirus and rhinovirus 2A proteinases by elastase-specific inhibitors", J VIROL, vol. 67, no. 8, 1993, pages 4688 - 4695, XP009007047
NICHOLSON, K. G., J. KENT ET AL.: "Respiratory viruses and exacerbations of asthma in adults", BM3, vol. 307, no. 6910, 1993, pages 982 - 986
PITKARANTA, A., A. VIROLAINEN ET AL.: "Detection of rhinovirus, respiratory syncytial virus, and coronavirus infections in acute otitis media by reverse transcriptase polymerase chain reaction", PEDIATRICS, vol. 102, 1998, pages 291 - 295
PITKARANTA, A., E. ARRUDA ET AL.: "Detection of rhinovirus in sinus brushings of patients with acute community-acquired sinusitis by reverse transcription-PCR", J CLIN MICROBIOL, vol. 35, no. 7, 1997, pages 1791 - 1793
RAIN, J. C., L. SELIG ET AL.: "The protein-protein interaction map of Helicobacter pylori", NATURE, vol. 409, no. 6817, 2001, pages 211 - 215, XP002243081, DOI: doi:10.1038/35051615
REED L.J., H. M.: "a simple method of estimating 50 per cent end- points", AM J HYG, vol. 27, 1938, pages 493 - 497
SCHECHTER, I., A. BERGER: "On the active site of proteases. 3. Mapping the active site of papain; specific peptide inhibitors of papain", BIOCHEM BIOPHYS RES COMMUN, vol. 32, no. 5, 1968, pages 898 - 902, XP024776883, DOI: doi:10.1016/0006-291X(68)90326-4
SKERN, T., W. SOMMERGRUBER ET AL.: "Substrate requirements of a human rhinoviral 2A proteinase", VIROLOGY, vol. 181, no. 1, 1991, pages 46 - 54, XP023057023, DOI: doi:10.1016/0042-6822(91)90468-Q
SOMMERGRUBER, W., H. AHORN ET AL.: "Cleavage specificity on synthetic peptide substrates of human rhinovirus 2 proteinase 2A", J BIOL CHEM, vol. 267, no. 31, 1992, pages 22639 - 22644, XP001084052
SPERBER, S. J., P. A. LEVINE: "Ineffectiveness of recombinant interferon-beta serine nasal drops for prophylaxis of natural cold", J INFECT DIS, vol. 160, no. 4, 1989, pages 700 - 705
STUDIER, F. W.: "Protein production by auto-induction in high density shaking cultures", PROTEIN EXPR PURIF, vol. 41, no. 1, 2005, pages 207 - 234, XP027430000, DOI: doi:10.1016/j.pep.2005.01.016
TIMMER, T., P. TERPSTRA ET AL.: "A comparison of genomic structures and expression patterns of two closely. related flanking genes in a criticallung cancer region at 3p21.3", EUR J HUM GENET, vol. 7, no. 4, 1999, pages 478 - 486, XP055007917, DOI: doi:10.1038/sj.ejhg.5200334
TINEKE TIMMER ET AL: "A comparison of genomic structures and expression patterns of two closely related flanking genes in a critical lung cancer region at 3p21.3", EUROPEAN JOURNAL OF HUMAN GENETICS, vol. 7, no. 4, 1 May 1999 (1999-05-01), pages 478 - 486, XP055007917, ISSN: 1018-4813, DOI: 10.1038/sj.ejhg.5200334 *
TURNER, R. B., M. T. WECKER ET AL.: "Efficacy of tremacamra, a soluble intercellular adhesion molecule 1, for experimental rhinovirus infection: a randomized clinical trial", JAMA, vol. 281, no. 19, 1999, pages 1797 - 1804
TURNER, R. B.: "The treatment of rhinovirus infections: progress and potential", ANTIVIRAL RES, vol. 49, no. 1, 2001, pages 1 - 14, XP002470301, DOI: doi:10.1016/S0166-3542(00)00135-2
VENTOSO ET AL: "Genetic selection of poliovirus 2Apro-binding peptides.", JOURNAL OF VIROLOGY, vol. 73, no. 1, 1 January 1999 (1999-01-01), pages 814 - 818, XP055007542, ISSN: 0022-538X *
VENTOSO, I., A. BARCO ET AL.: "Genetic selection of poliovirus 2Apro- binding peptides", J VIROL, vol. 73, no. 1, 1999, pages 814 - 818, XP055007542
VOJTEK, A. B., S. M. HOLLENBERG: "Ras-Raf interaction: two-hybrid analysis", METHODS ENZYMOL, vol. 255, 1995, pages 331 - 342
WANG, Q. M., R. B. JOHNSON ET AL.: "Dual inhibition of human rhinovirus 2A and 3C proteases by homophthalimides", ANTIMICROB AGENTS CHEMOTHER, vol. 42, no. 4, 1998, pages 916 - 920
WANG, Q. M., W. SOMMERGRUBER ET AL.: "Cleavage specificity of human rhinovirus-2 2A protease for peptide substrates", BIOCHEM BIOPHYS RES COMMUN, vol. 235, no. 3, 1997, pages 562 - 566
WOJCIK, J., I. G. BONECA ET AL.: "Prediction, assessment and validation of protein interaction maps in bacteria", J MOL BIOL, vol. 323, no. 4, 2002, pages 763 - 770, XP004449927, DOI: doi:10.1016/S0022-2836(02)01009-4

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN103088007A (en) * 2013-01-28 2013-05-08 厦门大学 Crystal structure of enterovirus 71 type 2A protease and application of crystal structure in drug design
CN103088007B (en) * 2013-01-28 2015-05-13 厦门大学 Crystal structure of enterovirus 71 type 2A protease and application of crystal structure in drug design
CN108663523A (en) * 2017-03-31 2018-10-16 复旦大学 It can be used for diagnosing the kit of human enterovirus 71 infection

Also Published As

Publication number Publication date
FR2959992A1 (en) 2011-11-18

Similar Documents

Publication Publication Date Title
US10040836B2 (en) Peptides for the treatment of neurodegenerative diseases
Kafaie et al. Mapping of nucleocapsid residues important for HIV-1 genomic RNA dimerization and packaging
JP2003514765A (en) Novel transducing molecules and methods of use
US20040161846A1 (en) Method of expression and agents identified thereby
CN111643656B (en) Broad-spectrum coronavirus membrane fusion inhibitor and application thereof in resisting AIDS virus
CN114736272B (en) Method for optimizing virus membrane fusion inhibitor, broad-spectrum anti-coronavirus lipopeptide and application
WO2009067191A2 (en) Methods and compositions for the treatment of hepatitis c virus (hcv) infection
WO2022202816A1 (en) Peptide and peptide-containing composition
Devaux et al. An update on angiotensin-converting enzyme 2 structure/functions, polymorphism, and duplicitous nature in the pathophysiology of coronavirus disease 2019: Implications for vascular and coagulation disease associated with severe acute respiratory syndrome coronavirus infection
WO2011141658A1 (en) Peptides with antiprotease activity
CA2561163A1 (en) Stabilised tat antigen and the use thereof for anti-hiv vaccination
CN111867616A (en) NTCP inhibitors
CN102816215A (en) Smallish polypeptide capable of inhibiting HIV and medicinal use thereof
AU710221B2 (en) Therapeutic compositions
CN111574588B (en) Polypeptide and application thereof in resisting Ebola virus
Yeung et al. Recent developments in the virology and antiviral research of severe acute respiratory syndrome coronavirus
CN116585484B (en) Polypeptide coupled small molecule compound and antiviral application thereof
US20040043949A1 (en) Therapeutic system targeting pathogen proteases and uses thereof
US20230416707A1 (en) Long-acting dnase
AU711646B2 (en) Novel receptor ligands and genetic sequences encoding same
KR20230110281A (en) Modified uricase and uses thereof
CN115974974A (en) Polypeptide compound with anti-inflammatory activity and preparation method and application thereof
JP2006223173A (en) NMT1-SPECIFIC siRNA
WO2002062979A2 (en) Enzyme
JP2010047508A (en) Protease inhibitor and medicine containing the same

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11731444

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 11731444

Country of ref document: EP

Kind code of ref document: A1