WO2011108785A1 - 쯔쯔가무시 균의 감염 또는 증식 저해 활성을 가지는 펩티드 화합물 및 이를 이용한 쯔쯔가무시증 개선용 약제학적 조성물 - Google Patents
쯔쯔가무시 균의 감염 또는 증식 저해 활성을 가지는 펩티드 화합물 및 이를 이용한 쯔쯔가무시증 개선용 약제학적 조성물 Download PDFInfo
- Publication number
- WO2011108785A1 WO2011108785A1 PCT/KR2010/005379 KR2010005379W WO2011108785A1 WO 2011108785 A1 WO2011108785 A1 WO 2011108785A1 KR 2010005379 W KR2010005379 W KR 2010005379W WO 2011108785 A1 WO2011108785 A1 WO 2011108785A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- peptide compound
- seq
- amino acid
- infection
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the present invention relates to a peptide compound having an activity of inhibiting infection or proliferation of Tsutsugamushi bacteria, and a pharmaceutical composition for improving Tsutsugamushi disease using the same.
- Tsutsugamosis (scrub typhus) is caused by Orientia tsutsugamushi ( hereinafter referred to as "Tsutsugamushi” bacterium), which is an absolute intracellular parasitic bacterium.
- Tsutsugamu bacteria When a tick infected with Tsutsugamu bacteria touches a rodent or a person and bites them, the Tsutsugamu bacteria invade the human body and develop the disease.
- Tsutsugamu bacteria leads to incubation periods of 1 to 2 weeks, leading to clinical symptoms such as eschar, high fever, chills, headache, spotty rash, and lymphadenopathy.
- Tsutsuga's disease is made by clinical diagnosis by clinical symptoms, bacteriological diagnosis by isolates of causative organisms, and serological diagnosis by measuring the presence of antibodies in serum (Kim et al., 20: 105-116, 1988; Et al., Korean Journal of Microbiology 24: 281-289, 1989).
- Antibacterial drugs such as doxycycline or chloramphenicol have been used in the treatment, but recently, resistant bacteria have been reported in India and Southeast Asia.
- the present invention discloses a peptide compound that has an infection or proliferation inhibitory activity of Tsutsugamu strain, and thus can be used for the treatment of Tsutsugamu strain.
- Another object of the present invention is to provide a pharmaceutical composition for improving Tsutsugamus disease using the compound.
- the present invention relates to a peptide having an activity capable of inhibiting the infection or proliferation of Tsutsugamu bacteria of the present invention.
- TSA56 56-kDa type-specific antigen
- fibronectin which is an extracellular matrix glycoprotein of host cells. It has been shown through interactions with (Lee et al., (2008) J Infect Dis . 198 : 250-257).
- the inventors anticipated antagonistic inhibition and designed and fabricated a total of 10 peptides based on the C-terminal sequence of TSA56, which binds to the fibronectin of these peptides. After confirming the activity, as a result of measuring the inhibitory activity of the host cell infection by the synthesized peptides, it was confirmed that some of the peptides inhibit the cell infection of the Tsutsugamushi bacteria at a significant level, in particular SEQ ID NO: 4 and 5 Burn peptides most effectively inhibited bacterial infection in host cells.
- these peptides are expected to be able to inhibit the biological infection of Tsutsugamushi bacteria, and may be used as a therapeutic agent for infection control by inhibiting proliferation by infecting other cells after the biological infection of Tsutsugamushi bacteria.
- the present invention has been completed based on the results of these experiments, and the peptide compound having an activity capable of inhibiting the infection or proliferation of the Tsutsugashimi bacterium of the present invention is a peptide compound selected from (1) to (7) below or a pharmaceutical thereof As an acceptable salt.
- a peptide compound comprising the amino acid sequence of SEQ ID NO: 1 or a peptide compound having a sequence substantially similar to the amino acid sequence of SEQ ID NO: 1;
- a peptide compound comprising the amino acid sequence of SEQ ID NO: 5 or a peptide compound having a sequence substantially similar to the amino acid sequence of SEQ ID NO: 5;
- a peptide compound comprising the amino acid sequence of SEQ ID NO: 8 or a peptide compound having a sequence substantially similar to the amino acid sequence of SEQ ID NO: 8;
- a peptide compound comprising the amino acid sequence of SEQ ID NO: 10 or a peptide compound having a sequence substantially similar to the amino acid sequence of SEQ ID NO: 10;
- peptide compound refers to a compound consisting of a series of amino acid residues by which amino acids are linked by peptide bonds. Generally it consists of 10 or more and 100 or less amino acids, preferably 15 or more and 50 or less amino acids.
- the peptide compound is a concept that includes peptide derivatives and peptide analogs that have a low degree of activity and still have activity that can inhibit the infection or proliferation of Tsutsugamushi bacteria, so that some amino acids in the peptide are non-natural amino acids.
- a peptide replaced with an amino acid analog (such as when substituted with L-amino acid and methionine is substituted with a methionine analog), and at the N-terminus and / or C-terminus of the peptide, methyl, ethyl, n-propyl, It is a concept including the case where the alkyl group, such as isopropyl, the cycloalkyl group, such as cyclopentyl and cyclohexyl, and the aryl group, such as phenyl, (alpha)-naphthyl, etc. is couple
- compounds as illustrated above are bonded to a substituent on the side chain of an amino acid (eg, -OH, -SH, an amino group, an imidazolyl group, an indolyl group, a guanidino group, etc.) in a peptide compound molecule, or a sugar chain is bound.
- an amino acid eg, -OH, -SH, an amino group, an imidazolyl group, an indolyl group, a guanidino group, etc.
- each "peptide compound comprising the amino acid sequence of SEQ ID NO:” is a peptide compound having an activity capable of inhibiting the infection or proliferation of Tsutsugamus spp even though the degree of activity is low, and the N-terminal and And / or a compound in which a few amino acids are added at the C-terminus. It is generally known in the art that even if a few amino acids are added to the N-terminus and / or C-terminus of a peptide or polypeptide, the original activity of the peptide or polypeptide is often maintained.
- the number of amino acids added is 30 or less, preferably 10 or less, more preferably 5 or less. Verification and selection of whether such peptide compounds have the ability to inhibit the biological infection or proliferation of Tsutsugamu bacteria is also within the scope of ordinary skill of those skilled in the art as long as the disclosure of the present specification is referred to.
- each of "peptide compounds having sequences substantially similar to the amino acid sequence of SEQ ID NO” means a peptide compound having an activity capable of inhibiting the infection or proliferation of Tsutsugamu bacteria even though the degree of activity is low. It refers to the case where an amino acid is substituted by the other amino acid similar in structure and / or polarity to the amino acid.
- Groups of amino acids of similar structure and / or polarity are known in the art, where lysine, arginine, histidine and the like can be grouped with basic amino acids, aspart, glutamine and the like can be grouped with acidic amino acids and glycine, glutamine, serine , Threonine, tyrosine, cysteine and the like can be grouped into non-charged polar amino acids.
- alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan and the like can be grouped into non-polar amino acids, phenylalanine, tryptophan and the like can be grouped into aromatic amino acids.
- Preferred degrees of substitution here are 10% or less (i.e., substituted for at least 90% homology of the amino acid sequence), particularly when substituted with 5% or less (i.e., replaced with 95% or more homologous of the amino acid sequence). If).
- Validation and selection of peptide compounds having sequences substantially similar to those of the amino acid sequences of the respective SEQ ID Nos. Have the activity of inhibiting the biological infection or proliferation of Tsutsugamushi bacteria within the range of ordinary skill of those skilled in the art. Do.
- pharmaceutically acceptable salt means a salt that does not inhibit the activity of the peptide compound of the present invention
- organic salts commonly used in the formation of metal salts or acid addition salts for example acetate, citrate, Oleate, oxalate, glutonate, etc.
- inorganic salts such as chloride, antiacid, borate, carbonate, etc.
- Peptide compounds of the invention can be prepared genetically using synthetic DNA techniques or prepared by chemical synthesis methods.
- Genetic engineering is a technique for transforming and expressing recombinant DNA containing a gene encoding a peptide in a host cell, such a recombinant DNA promoter, activator, enhancer, operation Factor, ribosome binding site, initiation signal, stop signal, cap signal, polyadenylation signal, and the like, and host cells include bacteria such as E. coli , Saccharomyces sp. Genus yeast, insect cells, mammalian cells and the like can be used. Techniques for making recombinant DNA, transformation techniques, appropriate culture techniques for host cells, and the like are all known in the art.
- the present invention relates to a pharmaceutical composition for improving Tsutsugamussis comprising the peptide compound as described above or a pharmaceutically acceptable salt thereof as an active ingredient.
- Tsutsugamusi means a clinical symptom due to the bioinfection of Tsutsugamu bacteria, the proliferation of the Tsutsugamu bacteria in vivo, and / or the bioinfection and propagation of the Tsutsugamu bacteria.
- active ingredient alone refers to a component that can exhibit the desired activity or can itself exhibit activity with a carrier which is inactive.
- improvement is meant to include suppressing / delaying the onset of Tsutsugamusosis, preventing Tsutsugamusosis, and treating Tsutsugamus.
- the active ingredient may be included in any amount (effective amount) as long as it can exhibit the improvement activity of Tsutsugamussis according to the use, formulation, formulation purpose, etc., and the conventional effective amount may be based on the total weight of the composition. When determined to be within the range 0.001% to 15% by weight.
- the term "effective amount" refers to a mammal, such as a rodent or the like, to which the application is applied, to inhibit, alleviate or treat the clinical symptoms of Tsutsugamushi bacteria, their proliferation, and their clinical infection.
- the amount of active ingredient that can be used. Such effective amounts can be determined experimentally within the range of ordinary skill in the art.
- compositions of the present invention are mammals and humans, such as rodents, and especially humans.
- composition of the present invention may further contain an antibiotic already used for the treatment of Tsutsugamus symptom for the enhancement and enhancement of the effect of improving Tsutsugashiosis.
- antibiotics include doxycycline and chloramphenicol.
- compositions of the present invention in addition to its active ingredients, include pharmaceutically acceptable carriers, excipients, and the like, oral formulations (tablets, suspensions, granules, emulsions, capsules, syrups, liposome capsules, protenoid capsules, etc.) And parenteral formulations (such as aqueous or oily suspensions for sterile injection) and the like.
- oral formulations tablets, suspensions, granules, emulsions, capsules, syrups, liposome capsules, protenoid capsules, etc.
- parenteral formulations such as aqueous or oily suspensions for sterile injection
- pharmaceutically acceptable means that the subject of application (prescription) does not have more toxicity (sufficiently low toxicity) to which the subject of application (prescription) is adaptable without inhibiting the activity of the active ingredient.
- Examples of pharmaceutically acceptable carriers include lactose, glucose, sucrose, starch (such as corn starch, potato starch, etc.), cellulose, derivatives thereof (such as sodium carboxymethyl cellulose, ethylcellulose, etc.) malt, gelatin, talc, solids Lubricants (such as stearic acid, magnesium stearate, etc.), calcium sulfate, vegetable oils (such as peanut oil, cottonseed oil, sesame oil, olive oil, etc.), polyols (such as propylene glycol, glycerin, etc.), alginic acid, emulsifiers (such as TWEENS), wetting agents ( Sodium lauryl sulfate), colorants, flavors, stabilizers, antioxidants, preservatives, water, saline, phosphate buffer solutions and the like.
- Such a carrier may be used by selecting one or more appropriate ones according to the formulation of the pharmaceutical composition of the present invention.
- Excipients may be selected and used according to the formulation of the pharmaceutical composition of the present invention, for example, when the pharmaceutical composition of the present invention is prepared with an aqueous suspending agent, suitable excipients are sodium carboxymethyl cellulose, methyl cellulose, hydropropylmethylcellulose And suspending agents and dispersing agents such as sodium alginate and polyvinylpyrrolidone. Suitable excipients when prepared as injections include Ringer's solution, isotonic sodium chloride, and the like.
- the pharmaceutical composition of the present invention may be administered orally or parenterally.
- the daily dosage of the pharmaceutical composition of the present invention is usually 0.001 ⁇ 150 mg / kg body weight range, it can be administered once or divided into several times. However, since the dosage of the pharmaceutical composition of the present invention is determined in view of various related factors such as the route of administration, the age, sex, weight of the patient, and the severity of the patient, the dosage may limit the scope of the present invention in any aspect. It should not be understood as.
- a peptide compound having an activity of inhibiting infection or proliferation of Tsutsugamu bacteria can be commercialized and used as a pharmaceutical composition for the purpose of preventing, treating, and treating Tsutsuga's disease.
- FIG. 1A is a diagram showing the structure of the C-terminal region of TSA56 based on the peptide compound design of the present invention and a diagram showing the site from which each peptide sequence was derived.
- 1B is a result showing the binding activity (red dots) of the peptide compound of the present invention to fibronectin and the infection inhibitory activity of HeLa cells, a cervical cancer cell line of Tsutsugashimi bacteria.
- FIG. 1C is a photograph taken by immunofluorescence of the degree of proliferation of Tsutsugamus in HeLa cell host cells when the peptide compound of SEQ ID NO: 5 and the peptide peptide compound of SEQ ID NO: 9 are treated.
- TSA56 peptide (> 90% purity) consisting of 20 to 35 amino acids based on the C-terminal amino acid sequence (aa 243-349) of TSA56 was synthesized using a peptide synthesizer (PeptrEX TM , Peptron Inc., Daejeon, Korea).
- the prepared peptide sequence is shown in Table 1 below.
- DMEM medium containing 100 units / ml penicillin-streptomycin and 10% fetal bovine serum (FBS) from cervical cancer cell line HeLa cells (ATCC CCL-2, American Type Culture Collection) and mouse fibroblast line L929 cells (ATCC NCTC929) Incubated in a 37 ° C., 5% CO 2 incubator.
- FBS fetal bovine serum
- Tsutsugamu was isolated by modifying the Percoll gradient purification method (Tamura A, et. Al., Microbiol Immunol 1982; 26: 321-8).
- the Boryeong strain of Tsutsugashi strain was infected by incubating for 90 minutes in the cultured mouse fibrinase L929 in a carbon dioxide incubator at 34 ° C.
- the extent of infection was determined using indirect immunofluorescence technique (Cho NH, et. Al., Infect Immun 2000; 68: 594-602.).
- Tris-sucrose buffer 33 mM Tris-Cl (pH 7.4) and 250 mM sucrose. I was.
- the suspended cells are homogenized (100 stokes) using a Polytron homogenizer (Wheaton, USA), centrifuged for 200 g for 5 minutes to obtain a supernatant, and the supernatant is mixed with 40% Percoll medium (Pharmacia, Sweden) using TS buffer. 25,000 g, and centrifuged for 30 minutes to collect the Tsutsugamu bacteria layer and centrifuged again for 77,000 g, 30 minutes. The Tsutsugamu layer was collected again, washed three times with TS buffer and then resuspended in DMEM medium and stored in liquid nitrogen until use.
- Fibronectin binding activity of the TSA peptide was evaluated using ELISA according to the method of Konkel et al. (Mon Micro et al., Mol Microbiol . 57 : 1022-1035).
- peptide 1.0 ⁇ g was coated on a 96 well plate, and BSA (bovine serum albumin) was coated as a negative control. The wells were then blocked with 1% BSA for 1 hour at 25 ° C. and washed with PBS containing 0.1% w / v BSA and 0.01% v / v Tween 20. Fibronectin (1.0 ⁇ g, Sigma-Aldrich) was diluted with PBS containing 0.02% w / v BSA, added to each well and allowed to react for 3 hours.
- BSA bovine serum albumin
- the wells were then washed three times and combined with primary antibodies (mouse anti-fibronectin antibody, Chemicon, Temecular, CA, USA) and secondary antibodies (anti-mouse IgG-HRP, Sigma chemicals, St. Louis, MO, USA) I was. Finally, the reaction was performed by adding a substrate solution (TMB Substrate Solution; Endogen, Woburn, MA) and quantified by measuring the degree of binding at 492 nm.
- TMB Substrate Solution Endogen, Woburn, MA
- Tsutsugamushi In order to evaluate the inhibitory activity of TSA56 peptide against cellular infection of Tsutsugamushi bacteria, HeLa cells were treated with 50 nM TSA56, and only DMEM medium was used as a negative control. Next, Tsutsugamushi was added and reacted for 3 hours. The infected cells were then harvested using trypsin, washed three times with PBS to remove surface adherent cells, re-plated in a 12 mm cover slip on a 24 well plate and left for 24 hours, followed by immunofluorescence in Tsutsugamusi Bacteria were visualized and Tsutsugamushi bacteria grown in 100 randomly selected host cells were counted.
- FIG. 9 For reference, a photograph taken by immunofluorescence of the degree of proliferation of Tsutsugashi bacteria in host cells is shown in FIG. The photograph representatively shows the peptide of SEQ ID NO: 9 and the negative control which was found to be insignificant with the peptide of SEQ ID NO: 5 having the highest activity.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Gastroenterology & Hepatology (AREA)
- Oncology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Toxicology (AREA)
- Genetics & Genomics (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Cell Biology (AREA)
- Communicable Diseases (AREA)
- Zoology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
본 발명은 숙주세포의 감염에 관여하는 것으로 알려진 쯔쯔가무시 균의 TSA56의 C-말단 서열에 기초하여 제작되었으며, 상기 TSA56과 상호 작용하는 숙주세포의 피브로넥틴과 결합 활성을 가지고, 자궁경부암 세포주인 HeLa 세포의 감염 저해 활성을 가지는 펩티드 화합물과, 이를 이용한 쯔쯔가무시증 개선용 약제학적 조성물을 개시한다.
Description
본 발명은 쯔쯔가무시 균의 감염 또는 증식 저해 활성을 가지는 펩티드 화합물, 및 이를 이용한 쯔쯔가무시증 개선용 약제학적 조성물에 관한 것이다.
쯔쯔가무시증(scrub typhus)은 절대적 세포내 기생세균인 오리엔티아 쯔쯔가무시 균(Orientia tsutsugamushi, 이하 "쯔쯔가무시 균")이 원인균으로, 쯔쯔가무시 균에 감염된 진드기를 매개로 감염되어 발병한다.
쯔쯔가무시 균에 감염된 진드기가 설치류나 사람에 접촉하여 이들을 물게 되면 쯔쯔가무시 균에 인체로 침입하여 발병하게 되는 것이다.
러시아 동부, 일본, 중국, 말레이시아, 태국, 베트남, 호주 북부, 파키스탄, 아프카니스탄 등에서 호발하며, 이 지역의 1억 명 정도가 위험군에 속하고 매년 백만명이 발병하는 것으로 알려져 있다.
쯔쯔가무시 균에 감염되면 1~2주의 잠복기를 거쳐 가피(eschar), 고열, 오한, 두통, 반점구진성 발진, 림프절 종대 등의 임상증상이 나타난다.
쯔쯔가무시증의 진단은 임상증상에 의한 임상적 진단, 원인균 분리에 의한 세균학적 진단 그리고 혈청내 항체 유무를 측정하는 혈청학적 진단에 의해 이루어지고 있으며(김 등, 감염 20:105-116, 1988; 장 등, 대한미생물 학회지 24:281-289, 1989), 치료에는 항생제인 독시사이클린(doxycycline) 또는 클로람페니콜(chloramphenicol)이 사용되고 있으나 최근 인도, 동남아시아 지역에서 이에 대한 내성균이 보고되고 있다.
본 발명은 쯔쯔가무시 균의 감염 또는 증식 저해 활성을 가지고 있어 쯔쯔가무시 균의 치료 등에 사용될 수 있는 펩티드 화합물을 개시한다.
본 발명의 목적은 쯔쯔가무시 균의 감염 또는 증식 저해 활성을 가지는 펩티드 화합물을 제공하는 데 있다.
본 발명의 다른 목적은 상기 화합물을 이용한 쯔쯔가무시증 개선용 약제학적 조성물을 제공하는 데 있다.
본 발명의 다른 목적이나 구체적인 목적은 이하에서 제시될 것이다.
일 측면에 있어서, 본 발명의 쯔쯔가무시 균의 감염 또는 증식을 저해할 수 있는 활성을 가지는 펩티드에 관한 것이다.
본 발명자들은 이전에 쯔쯔가무시 균의 숙주세포의 감염이 쯔쯔가무시 균의 세포막 단백질(outer membrane protein)인 56-kDa type-specific antigen(이하 “TSA56”으로 약칭)과 숙주세포의 세포 외 기질 당단백질인 피브로넥틴과의 상호작용을 통하여 이루어진다는 사실을 밝힌 바 있다(Lee et al., (2008) J Infect Dis. 198: 250-257).
본 발명자들은 이러한 이전의 연구 결과에 기초하여, 길항적 저해 작용(competitive inhibition)을 기대하고, TSA56의 C-말단 서열을 기초로 하여 총 10개의 펩티드를 설계·제작하였으며, 이들 펩티드의 피브로넥틴과 결합 활성을 확인한 후, 합성된 펩티드에 의한 쯔쯔가무시 균의 숙주세포 감염 저해 활성을 측정한 결과, 일부의 펩티드가 유의수준으로 쯔쯔가무시 균의 세포 감염을 저해함을 확인할 수 있었으며, 특히 서열번호 4번과 5번 펩타이드가 가장 효과적으로 세균의 숙주세포내 감염을 억제하였다.
따라서 이들 펩티드는 쯔쯔가무시 균의 생체 감염을 저해할 수 있을 것으로 판단 되며, 쯔쯔가무시 균의 생체 감염 후 다른 세포를 감염하여 증식하는 것을 억제함으로서 감염 제어를 위한 치료제로 사용될 수 있을 것으로 판단된다.
본 발명은 이러한 실험 결과에 기초하여 완성된 것으로서, 본 발명의 쯔쯔가무시 균의 감염 또는 증식을 저해할 수 있는 활성을 가지는 펩티드 화합물은 아래의 (1) 내지 (7) 중에서 선택된 펩티드 화합물 또는 그것의 약학적으로 허용 가능한 염을 말한다.
(1) 서열번호 1의 아미노산 서열을 포함하는 펩티드 화합물 또는 서열번호 1의 아미노산 서열과 실질적으로 유사한 서열을 가지는 펩티드 화합물;
(2) 서열번호 2의 아미노산 서열을 포함하는 펩티드 화합물 또는 서열번호 2의 아미노산 서열과 실질적으로 유사한 서열을 가지는 펩티드 화합물;
(3) 서열번호 3의 아미노산 서열을 포함하는 펩티드 화합물 또는 서열번호 3의 아미노산 서열과 실질적으로 유사한 서열을 가지는 펩티드 화합물;
(4) 서열번호 4의 아미노산 서열을 포함하는 펩티드 화합물 또는 서열번호 4의 아미노산 서열과 실질적으로 유사한 서열을 가지는 펩티드 화합물;
(5) 서열번호 5의 아미노산 서열을 포함하는 펩티드 화합물 또는 서열번호 5의 아미노산 서열과 실질적으로 유사한 서열을 가지는 펩티드 화합물;
(6) 서열번호 8의 아미노산 서열을 포함하는 펩티드 화합물 또는 서열번호 8의 아미노산 서열과 실질적으로 유사한 서열을 가지는 펩티드 화합물;
(7) 서열번호 10의 아미노산 서열을 포함하는 펩티드 화합물 또는 서열번호 10의 아미노산 서열과 실질적으로 유사한 서열을 가지는 펩티드 화합물;
본 명세서에서, “펩티드 화합물”이란 아미노산이 펩티드 결합에 의하여 연결됨으로써 일련의 아미노산 잔기로 이루어진 화합물을 의미한다. 일반적으로 10개 이상 100개 이하의 아미노산으로 이루어지며 바람직하게는 15개 이상 50개 이하의 아미노산으로 이루어진다. 상기 펩티드 화합물은 활성의 정도는 낮더라도 여전히 쯔쯔가무시 균의 감염 또는 증식을 저해할 수 있는 활성을 가지는 펩티드 유도체 및 펩티드 유사체를 포함하는 개념이며, 따라서 펩티드 중의 일부 아미노산이 비천연(non-natural) 아미노산 또는 아미노산 유사체로 대체된 펩티드(예컨대 L-아미노산으로 치환된 경우와 메티오닌이 메티오닌 유사체로 치환된 경우 등)와, 펩티드의 N-말단 및/또는 C-말단에, 메틸, 에틸, n-프로필, 이소프로필 등의 알킬기, 시클로펜틸, 시클로헥실 등의 시클로알킬기, 페닐, α-나프틸 등과 같은 아릴기 등이 결합된 경우를 포함하는 개념이다. 나아가 펩티드 화합물 분자 내의 아미노산의 측쇄 상의 치환기(예컨대, -OH, -SH, 아미노기, 이미다졸릴기, 인돌릴기, 구아니디노기 등)에 상기 예시한 바의 화합물 등이 결합되거나 당쇄가 결합된 경우를 포함한다. 이러한 펩티드 유도체 또는 유사체가 쯔쯔가무시 균의 감염 또는 증식을 저해할 수 있는 활성을 가지는가의 검증·선별은 본 발명의 아래 실험예에 개시된 방법에 따라 당업자의 통상의 능력 범위 내에서 가능하다.
또 본 명세서에서, 각 “서열번호의 아미노산 서열을 포함하는 펩티드 화합물”이란 활성의 정도는 낮더라도 쯔쯔가무시 균의 감염 또는 증식을 저해할 수 있는 활성을 가지는 펩티드 화합물로서 그 펩티드 화합물의 N-말단 및/또는 C-말단에 소수의 아미노산이 부가된 화합물을 말한다. 일반적으로 펩티드 또는 폴리펩티드의 N-말단 및/또는 C-말단에 소수의 아미노산이 부가되더라도 그 펩티드 또는 폴리펩티드의 본래의 활성의 유지되는 경우가 많다는 것이 당업계에서 알려져 있다. 부가되는 아미노산의 수는 30개 이하, 바람직하게는 10개 이하, 더 바람직하게는 5개 이하이다. 이러한 펩티드 화합물이 쯔쯔가무시 균의 생체 감염 또는 생체 내에서의 증식을 저해할 수 있는 활성을 가지는가의 검증·선별도 본 명세서의 개시 내용을 참조하는 한 당업자의 통상의 능력 범위에 속한다.
또 본 명세서에서, 각 “서열번호의 아미노산 서열과 실질적으로 유사한 서열을 가지는 펩티드 화합물”이란 활성의 정도는 낮더라도 쯔쯔가무시 균의 감염 또는 증식을 저해할 수 있는 활성을 가지는 펩티드 화합물로서 그 펩티드의 일부 아미노산이 그 아미노산과 구조 및/또는 극성이 유사한 다른 아미노산으로 치환된 경우를 말한다. 구조 및/또는 극성이 유사한 아미노산 그룹은 당업계에 공지되어 있는데, 리신, 아르기닌, 히스티딘 등은 염기성 아미노산으로 그룹화될 수 있고, 아스파르트, 글루타민 등은 산성 아미노산으로 그룹화될 수 있으며, 글리신, 글루타민, 세린, 트레오닌, 티로신, 시스테인 등은 비-전하 극성 아미노산으로 그룹화 될 수 있다. 또한 알라닌, 발린, 류신, 이소류신, 프롤린, 페닐알라닌, 메티오닌, 트립토판 등은 비-극성 아미노산으로 그룹화될 있고, 페닐알라닌, 트립토판 등은 방향성 아미노산으로 그룹화될 수 있다. 여기서 바람직한 치환의 정도는 10% 이하(즉 90% 이상 아미노산 서열의 상동성을 가지도록 치환된 경우), 특히 5% 이하로 치환되는 경우(즉 95% 이상 아미노산 서열의 상동성을 가지도록 치환된 경우)이다. 이러한 각 서열번호의 아미노산 서열과 실질적으로 유사한 서열을 가지는 펩티드 화합물이 쯔쯔가무시 균의 생체 감염 또는 생체 내에서의 증식을 저해할 수 있는 활성을 가지는가의 검증·선별도 당업자의 통상의 능력 범위 내에서 가능하다.
또한 본 명세서에서, “약학적으로 허용 가능한 염”이란 본 발명의 펩티드 화합물의 활성을 저해하지 않는 염을 의미하며, 통상 금속염이나 산부가염의 형성에 일반적으로 사용되는 유기염(예컨대 초산염, 구연산염, 올레산염, 옥살산염, 글루톤산염 등)이나 무기염(예컨대 염화염, 항산염, 붕산염, 탄산염 등)이 사용될 수 있다.
본 발명의 펩티드 화합물은 제조합 DNA 기술을 이용하여 유전공학적으로 제조되거나 화학적 합성 방법으로 제조될 수 있다.
유전공학적인 제조 방법은 펩티드를 코딩하는 유전자가 포함된 재조합 DNA를 숙주세포에 형질전환시켜 발현시키는 기술인데, 이러한 재조합 DNA는 숙주세포에서 발현될 수 있도록 프로모터, 활성인자(activator), 인핸서, 작동인자(operator), 리보솜 결합 부위, 개시 신호, 정지 신호, 캡 신호(cap signal), 폴리아데닐화 신호, 등을 포함하며, 숙주세포는 E. coli 등의 박테리아, 사카로미세스(Saccharomyces sp.) 속 효모, 곤충 세포, 포유동물 세포 등이 사용될 수 있다. 재조합 DNA의 제작 기술, 형질전환 기술, 숙주세포의 적절한 배양 기술은 등은 모두 당업계에 공지되어 있다.
화학적 합성 방법도 당업계에 잘 공지되어 있는데, 예컨대 고체상 합성 기술, 용액상 합성 기술, 효소 합성법 등을 사용할 수 있으며 구체적인 것은 문헌[Stewart J.M. and Young J.D. (1984) “Solid Phase Peptide Synthesis, 2nd edition”], 문헌[Bodanzsky M. and Bodanzsky A. (1984) “The practice of Peptide Synthesis”], 문헌[Lloyd-Williams, P., Albericio, F. and Giralt, E. (1997) “Chemical Approaches to the Synthesis of Peptides and Proteins”], 문헌[Kullmann W. (1980) “Proteases as catalysts for enzymic syntheses of opioid Peptides” J.Biol.Chem. 255, 8234-8238] 등을 참조할 수 있다. 이러한 화학적 합성 기술은 아미노산의 수가 적은 소형 펩티드의 제작에 특히 유용할 것이다.
다른 측면에 있어서, 본 발명은 전술한 바의 펩티드 화합물 또는 그것의 약학적으로 허용 가능한 염을 유효성분으로 포함하는 쯔쯔가무시증 개선용 약제학적 조성물에 관한 것이다.
본 명세서에서, “쯔쯔가무시증”이란 쯔쯔가무시 균의 생체 감염, 쯔쯔가무시 균의 생체 내에서의 증식, 및/또는 쯔쯔가무시 균의 생체 감염·증식에 따른 임상적 증상을 포함하는 의미이다.
본 명세서에서, “유효성분”이란 단독으로 목적하는 활성을 나타내거나 또는 그 자체는 활성이 없는 담체와 함께 활성을 나타낼 수 있는 성분을 의미한다.
본 명세서에서, “개선”이란 쯔쯔가무시증의 발병 억제/지연, 쯔쯔가무시증의 예방, 및 쯔쯔가무시증의 치료를 포함하는 의미이다.
본 발명의 조성물에서 상기 유효성분은 용도, 제형, 배합 목적 등에 따라 쯔쯔가무시증의 개선 활성을 나타낼 수 있는 한 임의의 양(유효량)으로 포함할 수 있는데, 통상적인 유효량은 조성물 전체 중량을 기준으로 할 때 0.001 중량 % 내지 15 중량 % 범위 내에서 결정될 것이다. 여기서 "유효량"이란 그 적용 대상인 설치류 등의 포유동물 바람직하게는 사람에게서, 쯔쯔가무시 균의 생체 감염, 그것의 생체 증식, 그것의 생체 감염·증식에 따른 임상적 증상을 억제, 완화 또는 치료를 유도할 수 있는 유효성분의 양을 말한다. 이러한 유효량은 당업자의 통상의 능력 범위 내에서 실험적으로 결정될 수 있다.
본 발명의 조성물이 적용(처방)될 수 있는 대상은 설치류 등의 포유동물 및 사람이며, 특히 사람인 경우가 바람직하다.
본 발명의 조성물은 쯔쯔가무시증 개선 효과의 상승·보강을 위하여 이미 쯔쯔가무시증의 치료에 사용되는 추가로 항생제를 포함할 수 있다. 그러한 항생제로서 대표적으로는 독시사이클린 (doxycycline)과 클로람페니콜 (chloramphenicol)을 예시할 수 있다.
본 발명의 약제학적 조성물은 그것의 유효성분 이외에 약제학적으로 허용되는 담체, 부형제 등을 포함하여, 경구용 제형(정제, 현탁액, 과립, 에멀젼, 캡슐, 시럽, 리포좀 캡슐, 프로테노이드 캡슐 등) 및 비경구형 제형(멸균 주사용 수성 또는 유성 현탁액 등) 등으로 제조될 수 있다. 리포좀 캡슐화 또는 프로테노이드 캡슐화의 제형과 관련해서는 특히 미국 특허 제4,925,673호, 미국 특허 제5,013,556호 등을 참조할 수 있다.
상기에서 "약제학적으로 허용되는" 의미는 유효성분의 활성을 억제하지 않으면서 적용(처방) 대상이 적응 가능한 이상의 독성(충분히 낮은 독성)을 지니지 않는다 의미이다.
약제학적으로 허용되는 담체의 예로서는 락토스, 글루코스, 슈크로스, 전분(예컨대 옥수수 전분, 감자 전분 등), 셀룰로오스, 그것의 유도체(예컨대 나트륨 카르복시메틸 셀룰로오스, 에틸셀룰로오스, 등) 맥아, 젤라틴, 탈크, 고체 윤활제(예컨대 스테아르산, 스테아르산 마그네슘 등), 황산 칼슘, 식물성 기름(예컨대 땅콩 기름, 면실유, 참기름, 올리브유 등), 폴리올(예컨대 프로필렌 글리콜, 글리세린 등), 알긴산, 유화제(예컨대 TWEENS), 습윤제(예컨대 라우릴 황산 나트륨), 착색제, 풍미제, 안정화제, 항산화제, 보존제, 물, 식염수, 인산염 완충 용액 등을 들 수 있다. 이러한 담체는 본 발명의 약제학적 조성물의 제형에 따라 적당한 것을 하나 이상 선택하여 사용할 수 있다.
부형제도 본 발명의 약제학적 조성물의 제형에 따라 적합한 것을 선택하여 사용할 수 있는데, 예컨대 본 발명의 약제학적 조성물이 수성 현탁제로 제조될 경우에 적합한 부형제로서는 나트륨 카르복시메틸 셀룰로오스, 메틸 셀룰로오스, 히드로프로필메틸셀룰로오스, 알긴산 나트륨, 폴리비닐피롤리돈 등의 현탁제나 분산제 등을 들 수 있다. 주사액으로 제조되는 경우 적합한 부형제로서는 링거액, 등장 염화나트륨 등을 들 수 있다.
본 발명의 약제학적 조성물은 경구 또는 비경구로 투여될 수 있다.
본 발명의 약제학적 조성물은 그 1일 투여량이 통상 0.001 ~ 150 mg/kg 체중 범위이고, 1회 또는 수회로 나누어 투여할 수 있다. 그러나, 본 발명의 약제학적 조성물의 투여량은 투여 경로, 환자의 연령, 성별, 체중, 환자의 중증도 등의 여러 관련 인자에 비추어 결정되는 것이므로 상기 투여량은 어떠한 측면으로든 본 발명의 범위를 제한하는 것으로 이해되어서는 아니 된다.
전술한 바와 같이, 본 발명에 따르면 쯔쯔가무시 균의 감염 또는 증식 저해 활성을 가지는 펩티드 화합물을 제공할 수 있다. 이 펩티드 화합물은 쯔쯔가무시증 예방, 치료 등의 목적으로 약제학적 조성물로 제품화되어 사용될 수 있다.
도 1의 A는 본 발명의 펩티드 화합물 설계에 기초가 된 TSA56의 C-말단 부위의 구조를 나타내는 그림과 각 펩타이드 서열이 유래한 부위를 표시한 그림이다.
도 1의 B는 본 발명의 펩티드 화합물의 피브로넥틴에 대한 결합 활성(red dots)과, 쯔쯔가무시 균의 자궁경부암 세포주인 HeLa 세포의 감염 저해 활성을 보여주는 결과이다.
도 1의 C는 서열번호 5의 펩티드 화합물과 서열번호 9의 펩티드 펩티드 화합물이 처리될 경우 HeLa 세포 숙주세포에서의 쯔쯔가무시 균의 증식 정도를 면역형광법을 사용하여 촬영한 사진이다.
이하 본 발명을 실시예 및 실험예를 참조하여 설명한다. 그러나 본 발명의 범위가 이러한 실시예 및 실험에에 한정되는 것은 아니다.
<실시예>
펩티드 화합물의 제작
도 1의 A에서 보여지는 바와 같이, TSA56의 C-말단 아미노산 서열(aa 243-349)에 기초하여 20개 내지 35개의 아미노산으로 구성된 TSA56 펩티드((>90% purity)를 펩티드 합성기(PeptrEXTM, Peptron Inc., Daejeon, Korea)를 이용하여 제작하였다.
제작된 펩티드의 서열은 아래의 [표 1]과 같다.
표 1
| SEQ ID NO. | Amino acids no. | Residues |
| 1 | AA 232-261 | FAIHNHEQWRSLVVGLAALSNANKPSASPV |
| 2 | AA 252-281 | NANKPSASPVKVLSDKIIQIYSDIKPFADI |
| 3 | AA 282-301 | AGINVPDTGLPNSASIEQIQ |
| 4 | AA 292-321 | PNSASIEQIQSKIQELGDTLEELRDSFDGY |
| 5 | AA 312-341 | EELRDSFDGYINNAFVNQIHLNFVMPPQAQ |
| 6 | AA 334-363 | FVMPPQAQQQQGQGQQQQAQATAQEAVAAA |
| 7 | AA 353-382 | QATAQEAVAAAAVRLLNGSDQIAQLYKDLV |
| 8 | AA 373-402 | QIAQLYKDLVKLQRHAGIRKAMEKLAAQQE |
| 9 | AA 393-422 | AMEKLAAQQEEDAKNQGKGDCKQQQGASEK |
| 10 | AA 413-442 | CKQQQGASEKSKEGKVKETEFDLSMVVGQV |
<실험예>
TSA56 펩티드의 쯔쯔가무시증 개선 활성
<실험예 1> 세포 배양
자궁경부암 세포주 HeLa cells(ATCC CCL-2, American Type Culture Collection)과 마우스 섬유아세포주 L929 cells (ATCC NCTC929)를 100 units/ml penicillin-streptomycin과 10% fetal bovine serum (FBS)이 함유된 DMEM배지를 사용하여 37 ℃, 5% CO2 항온기 (incubator)에서 배양하였다.
<실험예 2> 쯔쯔가무시 균의 준비
쯔쯔가무시 균을 Percoll gradient purification method(Tamura A, et. al., Microbiol Immunol 1982; 26:321-8)을 변형하여 분리하였다.
쯔쯔가무시 균의 보령 균주를 상기 배양된 마우스 섬유아세주 L929에 34℃ 조건의 이산화탄소 배양기에서 90분 동안 방치시켜 감염시켰다. 감염 정도를 간접면역형광기술(Cho NH, et. al., Infect Immun 2000; 68:594-602.)을 이용하여 결정하였다.
감염율이 90% 이상이 되었을 때 6000g, 20분 동안 원심분리하여 세포를 수거하고 펠릿을 6.5 mL의 TS 완충액(Tris-sucrose buffer)(33 mM Tris-Cl (pH 7.4) and 250 mM sucrose)에 현탁시켰다. 현탁된 세포를 Polytron homogenizer (Wheaton, USA)를 이용하여 균질화(100 stokes)시킨 후 200g, 5분 동안 원심분리하여 상등액을 얻고 그 상등액을 TS 완충액을 이용 40% Percoll medium(Pharmacia, Sweden)과 혼합하고 25,000g, 30분 동안 원심분리시켜 쯔쯔가무시 균 층을 수거하고 77,000g, 30분 동안 다시 원심분리시켰다. 쯔쯔가무시 층을 다시 수거하고 TS 버퍼로 3번 세척한 후에 DMEM 배지에 재현탁시키고 사용 전까지 액체질소에 보관하였다.
<실험예 3> TSA56 펩티드의 쯔쯔가무시증 개선 활성 실험
<실험예 3-1> TSA56 펩티드의 피브로넥틴에 대한 결합 활성 측정 실험
Konkel 등의 방법(Konkel et al., Mol Microbiol. 57: 1022-1035)에 따라 TSA 펩티드의 피브로넥틴 결합 활성을 ELISA를 사용하여 평가하였다.
구체적으로 96 웰 플레이트에 1.0μg의 펩티드를 코팅시키고 음성대조군으로는 BSA(bovine serum albumin)를 코팅시켰다. 다음 웰을 1% BSA로 25 oC에서 1시간 동안 블록킹시키고 0.1% w/v BSA와 0.01% v/v Tween 20를 함유하는 PBS로 세척하였다. 피브로넥틴(1.0 μg, Sigma-Aldrich)를 0.02% w/v BSA를 함유하는 PBS로 희석하여 각 웰에 첨가한 후 3시간 동안 반응시켰다.
이어서 웰을 세 번 세척하고 1차 항체(mouse anti-fibronectin antibody, Chemicon, Temecular, CA, USA) 및 2차 항체(anti-mouse IgG-HRP, Sigma chemicals, St. Louis, MO, USA)를 결합시켰다. 마지막으로 기질 용액(TMB Substrate Solution; Endogen, Woburn, MA)을 첨가하여 반응시키고 결합 정도를 492nm에서 발색 정도로 측정하여 정량하였다.
결과를 도 1의 B(red dots)에 나타내었다. 도 1을 참조하여 보면, 서열번호 4의 펩티드와 서열번호 5의 펩티드의 피브로넥틴에 대한 결합 활성이 가장 높음을 보여준다.
<실험예 3-2> 쯔쯔가무시 균의 세포 감염에 대한 TSA56 펩티드의 저해 활성 측정 실험
쯔쯔가무시 균의 세포 감염에 대한 TSA56 펩티드의 저해 활성을 평가하기 위하여, HeLa cells를 50 nM TSA56로 처리하였고, DMEM 배지만을 처리한 것을 음성 대조군으로 사용하였다. 다음 쯔쯔가무시 균을 첨가하여 3시간 동안 반응시켰다. 그리고 나서 트립신을 사용하여 감염 세포를 수거하고, PBS로 세 번 세척하여 표면 부착 세포를 제거하고 24 웰 플레이트의 12mm 커버 슬립에 re-plate하고 24시간 동안 방치한 후, 면역형광법으로 숙주세포 내의 쯔쯔가무시 균을 가시화시키고, 무작위로 선택된 100개의 숙주세포에서 증식한 쯔쯔가무시 균을 계수하였다.
결과를 도 1의 B에 나타내었는데, 도 1의 B를 참조하여 보면 TSA56 펩티드의 피브로넥틴의 결합 활성능이 높을수록 쯔쯔가무시 균의 감염 억제능이 높은 경향을 보이며, 서열번호 1, 2, 3, 4, 5, 8, 10의 펩티드들이 통계학적으로 유의성 있게 쯔쯔가무시 균의 세포 감염을 저해하는 활성을 나타내었으며, 특히 서열번호 4번과 5번의 펩타이드가 가장 효과적으로 세균 감염을 저해하는 결과를 보인다.
참고로 숙주세포에서의 쯔쯔가무시 균의 증식 정도를 면역형광법을 사용하여 촬영한 사진을 도 1의 C에 나타내었다. 사진은 활성이 가장 우수한 서열번호 5의 펩티드와 유의성이 없는 것으로 나타난 서열번호 9의 펩티드 그리고 음성 대조군을 대표적으로 게재하였다.
통계처리
통계 분석은 s t-test(SigmaPlot, Jandel, San Rafael, CA, USA)를 사용하였고 결과는 평균±표준편차로 제시하였다. 통계적 유의성은 P < 0.05 수준에서 검증하였다.
Claims (10)
- 쯔쯔가무시 균의 생체 감염 또는 생체 내에서의 증식을 저해할 수 있는 활성을 가지는 아래의 (1) 및 (2) 중에서 선택된 펩티드 화합물 또는 그것의 약학적으로 허용 가능한 염.(1) 서열번호 1의 아미노산 서열을 포함하는 펩티드 화합물; 및(2) 서열번호 1의 아미노산 서열과 실질적으로 유사한 서열을 가지는 펩티드 화합물
- 쯔쯔가무시 균의 생체 감염 또는 생체 내에서의 증식을 저해할 수 있는 활성을 가지는 아래의 (1) 및 (2) 중에서 선택된 펩티드 화합물 또는 그것의 약학적으로 허용 가능한 염.(1) 서열번호 2의 아미노산 서열을 포함하는 펩티드 화합물; 및(2) 서열번호 2의 아미노산 서열과 실질적으로 유사한 서열을 가지는 펩티드 화합물.
- 쯔쯔가무시 균의 생체 감염 또는 생체 내에서의 증식을 저해할 수 있는 활성을 가지는 아래의 (1) 및 (2) 중에서 선택된 펩티드 화합물 또는 그것의 약학적으로 허용 가능한 염.(1) 서열번호 3의 아미노산 서열을 포함하는 펩티드 화합물; 및(2) 서열번호 3의 아미노산 서열과 실질적으로 유사한 서열을 가지는 펩티드 화합물.
- 쯔쯔가무시 균의 생체 감염 또는 생체 내에서의 증식을 저해할 수 있는 활성을 가지는 아래의 (1) 및 (2) 중에서 선택된 펩티드 화합물 또는 그것의 약학적으로 허용 가능한 염.(1) 서열번호 4의 아미노산 서열을 포함하는 펩티드 화합물; 및(2) 서열번호 4의 아미노산 서열과 실질적으로 유사한 서열을 가지는 펩티드 화합물.
- 쯔쯔가무시 균의 생체 감염 또는 생체 내에서의 증식을 저해할 수 있는 활성을 가지는 아래의 (1) 및 (2) 중에서 선택된 펩티드 화합물 또는 그것의 약학적으로 허용 가능한 염.(1) 서열번호 5의 아미노산 서열을 포함하는 펩티드 화합물; 및(2) 서열번호 5의 아미노산 서열과 실질적으로 유사한 서열을 가지는 펩티드 화합물
- 쯔쯔가무시 균의 생체 감염 또는 생체 내에서의 증식을 저해할 수 있는 활성을 가지는 아래의 (1) 및 (2) 중에서 선택된 펩티드 화합물 또는 그것의 약학적으로 허용 가능한 염.(1) 서열번호 8의 아미노산 서열을 포함하는 펩티드 화합물; 및(2) 서열번호 8의 아미노산 서열과 실질적으로 유사한 서열을 가지는 펩티드 화합물
- 쯔쯔가무시 균의 생체 감염 또는 생체 내에서의 증식을 저해할 수 있는 활성을 가지는 아래의 (1) 및 (2) 중에서 선택된 펩티드 화합물 또는 그것의 약학적으로 허용 가능한 염.(1) 서열번호 10의 아미노산 서열을 포함하는 펩티드 화합물; 및(2) 서열번호 10의 아미노산 서열과 실질적으로 유사한 서열을 가지는 펩티드 화합물
- 제1항 내지 제7항 중 어느 한 항 기재의 펩티드 화합물 또는 그것의 약학적으로 허용 가능한 염을 유효성분으로 포함하는 쯔쯔가무시증 개선용 약학적 조성물.
- 제8항에 있어서,상기 조성물은 항생제를 추가로 포함하는 것을 특징으로 하는 쯔쯔가무시증 개선용 약학적 조성물.
- 제8항에 있어서,상기 항생제는 독시사이클린 또는 클로람페니콜인 것을 특징으로 하는 쯔쯔가무시증 개선용 약학적 조성물.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR10-2010-0019756 | 2010-03-05 | ||
| KR1020100019756A KR101209344B1 (ko) | 2010-03-05 | 2010-03-05 | 쯔쯔가무시 균의 감염 또는 증식 저해 활성을 가지는 펩티드 화합물 및 이를 이용한 쯔쯔가무시증 개선용 약제학적 조성물 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2011108785A1 true WO2011108785A1 (ko) | 2011-09-09 |
Family
ID=44542406
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/KR2010/005379 Ceased WO2011108785A1 (ko) | 2010-03-05 | 2010-08-16 | 쯔쯔가무시 균의 감염 또는 증식 저해 활성을 가지는 펩티드 화합물 및 이를 이용한 쯔쯔가무시증 개선용 약제학적 조성물 |
Country Status (2)
| Country | Link |
|---|---|
| KR (1) | KR101209344B1 (ko) |
| WO (1) | WO2011108785A1 (ko) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2015167029A1 (ko) * | 2014-04-28 | 2015-11-05 | 서울대학교산학협력단 | 오리엔티아 쯔쯔가무시 균에 대한 백신 조성물 |
-
2010
- 2010-03-05 KR KR1020100019756A patent/KR101209344B1/ko active Active
- 2010-08-16 WO PCT/KR2010/005379 patent/WO2011108785A1/ko not_active Ceased
Non-Patent Citations (4)
| Title |
|---|
| GUSTAVO VALBUENA ET AL.: "Infection of the endothelium by members of the order Rickettsiales.", THROMBOSIS AND HAEMOSTASIS, vol. 102, no. 6, 2009, pages 1071 - 1079 * |
| JUNG-HEE LEE ET AL.: "Fibronectin facilitates the invasion ofOrientia tsutsugamushi into host cells through interaction with a 56-kDa type-specific antigen.", THE JOURNAL OF INFECTIOUS DISEASES : OFFICIAL PUBLICATION OF THE INFECTIOUS DISEASES SOCIETY OF AMERICA, vol. 198, no. 2, 2008, pages 250 - 257 * |
| NAM-HYUK CHO ET AL.: "The Orientia tsutsugamushi genome reveals massive proliferation of conjugative type IV secretion system and host-cell interaction genes.", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 104, no. 19, 2007, pages 7981 - 7986 * |
| S.Y. SEONG ET AL.: "Neutralization epitopes on the antigenic domain II of the Orientia tsutsugamushi 56-kDa protein revealed by monoclonal antibodies.", VACCINE, vol. 19, 2001, pages 2 - 9 * |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2015167029A1 (ko) * | 2014-04-28 | 2015-11-05 | 서울대학교산학협력단 | 오리엔티아 쯔쯔가무시 균에 대한 백신 조성물 |
Also Published As
| Publication number | Publication date |
|---|---|
| KR20110100759A (ko) | 2011-09-15 |
| KR101209344B1 (ko) | 2012-12-06 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| KR101184833B1 (ko) | Hcg 절편들을 포함하는 점막 및 경구 투여용 조성물 | |
| EP2030980A1 (en) | Mutants of lactoferrin | |
| JP2014508164A (ja) | 細胞内損傷の治療のための組成物および方法 | |
| JP2005535619A (ja) | 免疫寛容を誘導するための物質および方法 | |
| AU2003250892A1 (en) | Use of alanyl-aminopeptidase inhibitors and pharmaceutical compositions containing said inhibitors | |
| US20250144186A1 (en) | Novel therapeutic uses of gardnerella endolysins | |
| CA3182341A1 (en) | Compositions comprising enzymes and probiotics, and methods for preventing or treating macular degeneration | |
| US7745390B2 (en) | Antimicrobial peptides | |
| JP2025505758A5 (ko) | ||
| WO1995003067A1 (en) | Pharmaceutical with immunomodulating activity | |
| US5955508A (en) | Method for the enhancement of lymphocyte activity against opportunistic microbial pathogens | |
| WO2011108785A1 (ko) | 쯔쯔가무시 균의 감염 또는 증식 저해 활성을 가지는 펩티드 화합물 및 이를 이용한 쯔쯔가무시증 개선용 약제학적 조성물 | |
| JP2024508205A (ja) | 多剤耐性病原体に対する抗菌活性を有するペプチド実体 | |
| JP4932731B2 (ja) | シグナルペプチド、核酸分子及び治療方法 | |
| RU2327454C2 (ru) | Средства для превентивной терапии после острого инсульта | |
| US7723467B2 (en) | Antimicrobial compounds | |
| US20030125249A1 (en) | Synthetic peptides that inhibit leukocyte superoxide anion production and/or attract leukocytes | |
| US12594258B2 (en) | Inhibitors of MHC-I Nef downmodulation for treating HIV | |
| US20120177672A1 (en) | Therapeutic peptides, polypeptides and nucleic acid sequences | |
| KR101443233B1 (ko) | 황색포도상구균 감염 치료용 의약을 제조하기 위한 활성 성분으로서의 trap 자체의 용도 | |
| JP2008533126A (ja) | 新たなハイブリッドオリゴマー、それらの製造方法およびそれらを含有する医薬組成物 | |
| EP2850098B1 (en) | COMPOSITIONS WHICH REGULATE THE EPITHELIAL BRUSH BORDER Na+/H+ EXCHANGER NHE3 AND THEIR METHODS OF USE IN GASTROINTESTINAL DISEASE | |
| WO2017048029A1 (ko) | 클라바스피린 펩타이드 유사체를 유효성분으로 함유하는 항염증용 조성물 | |
| Puri et al. | Derivatives of human β-Casein fragments (54–59) exhibit highly potent immunosuppressant activity | |
| BR102024014610A2 (pt) | Peptídeo, conjunto de peptídeos, composição, usos de pelo menos um peptídeo, método para prevenir e/ou tratar infecção e kit |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 10847083 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 10847083 Country of ref document: EP Kind code of ref document: A1 |