WO2010078526A1 - Anti-lymphotoxin antibodies - Google Patents
Anti-lymphotoxin antibodies Download PDFInfo
- Publication number
- WO2010078526A1 WO2010078526A1 PCT/US2009/069967 US2009069967W WO2010078526A1 WO 2010078526 A1 WO2010078526 A1 WO 2010078526A1 US 2009069967 W US2009069967 W US 2009069967W WO 2010078526 A1 WO2010078526 A1 WO 2010078526A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- binding
- molecule
- light chain
- binding molecule
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/525—Tumour necrosis factor [TNF]
- C07K14/5255—Lymphotoxin [LT]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/241—Tumor Necrosis Factors
- C07K16/242—Lymphotoxin [LT]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the LT ⁇ l ⁇ 2 heterotrimer presents three different clefts (that can be designated ⁇ - ⁇ , ⁇ - ⁇ , and ⁇ - ⁇ ) and, until the instant invention, it was not clear that a single antibody could bind to the heterotrimer and block all sites of receptor binding effectively and, thereby, block biological activity completely. It is noteworthy that the instant antibodies do not bind to LToc3 (or bind to LT ⁇ 3, but not in such a way as to block TNF ⁇ receptor binding) and have improved function as compared to anti-LT ⁇ l ⁇ 2 antibodies of the prior art.
- such antibodies have an IC50 for inhibition of LT binding and/or LT-induced cytokine production of less than approximately 0.05 ug/ml. In one embodiment, such antibodies have an IC50 for inhibition of LT binding and/or LT- induced cytokine production of less than approximately 100 nM. In one embodiment, such antibodies have an IC50 for inhibition of LT binding and/or LT-induced cytokine production of less than approximately 30 nM. In one embodiment, such antibodies have an IC50 for inhibition of LT binding and/or LT-induced cytokine production of less than approximately 10 nM.
- such antibodies have an IC50 for inhibition of LT binding and/or LT-induced cytokine production of less than approximately 3 nM.
- a panel of such antibodies has been developed and the epitopes to which several of these antibodies bind have been mapped.
- the antibodies of the instant invention also bind to epitopes of LT of non-human primates, e.g., cynomologous monkeys. The structure of the the variable regions of these antibodies has also been elucidated.
- the invention pertains to an isolated binding molcule that binds to lymphotoxin (LT) and blocks LT ⁇ R-Ig binding to a cell by at least 85% or a molecule comprising an antigen binding region thereof.
- the invention pertains to an isolated binding molcule or molecule comprising an antigen binding region thereof, wherein the LT-induced biological activity is IL-8 release.
- a binding molecule of the invention blocks an LT- induced biological activity in a cell at an IC50 of less than 3 nM or a molecule comprising an antigen binding region thereof.
- the invention pertains to a binding molecule that specifically binds to an epitope of LT, wherein the binding to the LT epitope by the antibody is competitively blocked in a dose-dependent manner by the 105 antibody.
- the invention pertains to a lymphotoxin binding molecule comprising a heavy chain variable region comprising heavy chain CDRs CDRHl, CDRH2 and CDRH3 and light chain variable region comprising light chain CDRs CDRLl, CDRL2, and CDRL3, wherein the CDRs are derived from the 105 antibody.
- the subject is suffering from a disorder characterized by inflammation.
- polypeptides dipeptides, tripeptides, oligopeptides, "protein,” “amino acid chain,” or any other term used to refer to a chain or chains of two or more amino acids, are included within the definition of "polypeptide,” and the term “polypeptide” may be used instead of, or interchangeably with any of these terms.
- polypeptide is also intended to refer to the products of post-expression modifications of the polypeptide, including without limitation glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, or modification by non-naturally occurring amino acids.
- a polypeptide may be isolated or purified from a natural biological source or produced by recombinant technology, but is not necessarily translated from a designated nucleic acid sequence. It may be generated using methods known in the art, including by chemical synthesis.
- binding molecules have some degree of cross-reactivity, in that they bind related, but non-identical epitopes, e.g., epitopes with at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 65%, at least 60%, at least 55%, and at least 50% identity (as calculated using methods known in the art and described herein) to a reference epitope.
- epitopes e.g., epitopes with at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 65%, at least 60%, at least 55%, and at least 50% identity (as calculated using methods known in the art and described herein) to a reference epitope.
- one or more non-human (e.g., murine) amino acids may be present in the framework region of a binding polypeptide, e.g., a human or non-human primate framework amino acid sequence may comprise one or more amino acid back mutations in which the corresponding murine amino acid residue is present and/or may comprise one or mutations to a different amino acid residue not found in the starting murine antibody (e.g., other mutations which optimize binding or biophysical properties).
- Preferred binding molecules of the invention are less immunogenic in humans than are murine antibodies comprising the same CDRs.
- the terms "antibody” and "immunoglobulin" are used interchangeably herein.
- an Fc domain of a polypeptide may comprise a CHl domain derived from an IgGl molecule and a hinge region derived from an IgG3 molecule.
- an Fc region can comprise a hinge region derived, in part, from an IgGl molecule and, in part, from an IgG3 molecule.
- an Fc region can comprise a chimeric hinge derived, in part, from an IgGl molecule and, in part, from an IgG4 molecule.
- a dimeric Fc region of the invention may comprise one polypeptide chain.
- a dimeric Fc region of the invention may comprise two polypeptide chains, e.g., as in the case of an antibody molecule.
- CH2 domain includes the portion of a heavy chain immunoglobulin molecule that extends, e.g., from about EU positions 231-340.
- the CH2 domain is unique in that it is not closely paired with another domain. Rather, two N-linked branched carbohydrate chains are interposed between the two CH2 domains of an intact native IgG molecule.
- a binding molecule of the invention comprises a CH2 domain derived from an IgGl molecule (e.g. a human IgGl molecule).
- an altered polypeptide of the invention comprises a CH2 domain derived from an IgG4 molecule (e.g., a human IgG4 molecule).
- a polypeptide of the invention comprises a CH2 domain (EU positions 231-340), or a portion thereof.
- nucleotide or amino acid substitutions leading to conservative substitutions or changes at amino acid residues may be made (e.g., in CDR and/or framework residues). Alternatively or in addition, mutations may be made to CDR amino acid residues to optimize antigen binding using art recognized techniques.
- the binding molecules of the invention maintain the ability to bind to LT antigen.
- a "scFv linker" as used herein refers to a moiety interposed between the VL and VH domains of the scFv. scFv linkers preferably maintain the scFv molecule in a antigen binding conformation.
- an scFv linker comprises or consists of an scFv linker peptide.
- an scFv linker peptide comprises or consists of a gly-ser connecting peptide.
- an scFv linker comprises a disulfide bond.
- gly-ser connecting peptide refers to a peptide that consists of glycine and serine residues.
- An exemplary gly/ser connecting peptide comprises the amino acid sequence (GIy 4 Ser) n
- n l.
- n 2.
- n 3.
- n 4, i.e., (GIy 4 Ser) 4 .
- n 5.
- n 6.
- Another exemplary gly/ser connecting peptide comprises the amino acid sequence Ser(Gly 4 Ser) n .
- n l.
- n 2.
- n 3.
- a “linear sequence” or a “sequence” is an order of amino acids in a polypeptide in an amino to carboxyl terminal direction in which residues that neighbor each other in the sequence are contiguous in the primary structure of the polypeptide.
- the anti-LT binding molecules of the invention display improved functional properties as compared to the antibodies of the prior art.
- the anti-LT binding molecules of the invention have unique structural properties compared to the anti-LT antibodies of the prior art.
- the invention pertains to an antibody A0D9, 108, 107, 105, 9B4, A1D5, 102, or 101/103 antibody described herein (also referred to herein as LT antibodies (e.g., LT105); the CDRs of these antibodies; the variable region sequences of these antibodies; the CDR sequences of variant forms of these antibodies; the variable regions sequences of variant forms of these antibodies; and binding molecules comprising these CDRs and/or variable regions. Nucleic acid molecules encoding these binding molecules are also provided for.
- the invention pertains to mature forms of molecules lacking signal sequences. The functional and structural characteristics or the subject antibodies and other aspects of the invention are set forth in more detail below.
- LT-induced signaling (upon binding to LT ⁇ R) induces inflammatory responses and is also involved in normal development of lymphoid tissue.
- the binding molecules of the invention compete with the LT ⁇ R for binding to lymphotoxin, thereby inhibiting LT-mediated signaling and reducing the LT mediated biological response in a cell.
- a variety of assays may be used to demonstrate the blocking effects of a binding molecule of the invention. For instance, in one embodiment, the ability of a binding molecule of the invention to inhibit the binding of LT (e.g., an LT heterotrimer) to LT ⁇ R can be measured. In one embodiment, the physiological, monomeric LT ⁇ receptor (LT ⁇ R) can be used.
- the cells are washed to remove unbound LT ⁇ R-Ig, and the bound LT ⁇ R-Ig, is detected with streptavidin-PE.
- streptavidin-PE streptavidin-PE
- the invention pertains to an isolated binding molecule that binds to lymphotoxin ⁇ l ⁇ 2 and inhibits an LT ⁇ l ⁇ 2 -induced biological activity in a cell by at least about 70% (e.g., under conditions in which a reference antibody, B9,
- an isolated binding molecule of the invention pertains to an isolated binding molecule that binds to lymphotoxin ⁇ and inhibits LT ⁇ R binding to a cell by at least about 100% (or LTBR-Ig).
- the binding molecules of the invention inhibit LT binding to LT ⁇ R and/or an LT-induced biological activity at a lower concentration than the prior art antibodies.
- concentration which inhibits an LT- induced biological activity e.g., IL-8 release
- IC50 50% (IC50) of antibodies comprising the LT binding sites of the invention
- the prior art antibodies require as much as 3 orders of magnitude more antibody to achieve 50% inhibition of LT binding to LT ⁇ R (see Figures 1, 4 and 5) and some do not achieve 50% inhibition at all.
- a "theoretical IC50" may be used for comparison. In calculating the IC50 values, the antibody concentration present during the pre-incubation step with antigen (LT) was used (rather than the final concentration of antibody after addition of cells and buffer).
- the invention pertains to an isolated binding molecule that specifically binds to an epitope of LT, wherein the binding to the LT epitope by the binding molecule is competitively blocked in a dose-dependent manner by A1D5 antibody.
- amino acid 172 (P) (as set forth in SEQ ID NO: ) of LT ⁇ is critical for binding of the binding molecule.
- the invention pertains to an isolated binding molecule that specifically binds to an epitope of LT, wherein the binding to the LT epitope by the binding molecule is competitively blocked in a dose-dependent manner by the 107 antibody.
- amino acids 151 (D) and 153 (Q) of LT ⁇ are critical for binding of the binding molecule.
- the invention pertains to a lymphotoxin (LT) binding molecule comprising a heavy chain variable region comprising heavy chain CDRs CDRHl, CDRH2 and CDRH3 and light chain variable region comprising light chain CDRs CDRLl, CDRL2, and CDRL3 wherein the light and heavy chain CDRs are derived from an antibody selected from the group consisting of AOD9, 108, 107, A1D5, 102,101/103, 9B4, and 105.
- LT lymphotoxin
- the remaining 5 CDRs are derived from the A1D5, 102, the 9B4, 105 or the 101/103 antibodies or combinations thereof.
- the invention pertains to an LT binding molecule comprising a heavy chain variable region comprising heavy chain CDRs CDRHl, CDRH2 and CDRH3 and light chain variable region comprising light chain CDRs CDRLl, CDRL2, and CDRL3, wherein CDRH3 comprises the sequence G/AYYG/A.
- the remaining 5 CDRs are derived from the A0D9, the 107, 108, the 9B4 antibodies or combinations thereof.
- the invention pertains to an LT binding molecule comprising a light chain variable region comprising heavy chain CDRs CDRHl, CDRH2 and CDRH3 and light chain variable region comprising light chain CDRs CDRLl, CDRL2, and CDRL3, wherein CDRLl comprises the sequence or X1ASQDX2X3X4X5LX6 wherein X is any amino acid.
- Xi is selected from the group consisting of K or R;
- X 2 is selected from the group consisting of I or M;
- X 3 is selected from the group consisting of N or S;
- X 4 is selected from the group consisting of T or N;
- X 5 is selected from the group consisting of Y or F;
- X 6 is selected from the group consisting of N, T, or R.
- the remaining 5 CDRs are derived from the A0D9 antibody, the 108 antibody, the 107 antibody, the A1D5 antibody, or the 101/103 antibody.
- the invention pertains to an LT binding molecule comprising a light chain variable region comprising heavy chain CDRs CDRHl, CDRH2 and
- CDRs e.g., VH-CDR-3
- additional substitutions may be made in the CDR, as long as the VH comprising the VH-CDR specifically or preferentially binds to LT.
- amino acid substitutions are conservative.
- the polynucleotide or nucleic acid molecule is a DNA or RNA molecule.
- a polynucleotide comprising a nucleic acid which encodes a polypeptide normally may include a promoter and/or other transcription or translation control elements operably associated with one or more coding regions.
- a coding region for a gene product e.g., a polypeptide
- a promoter region would be operably associated with a nucleic acid encoding a polypeptide if the promoter was capable of effecting transcription of that nucleic acid.
- the promoter may be a cell- specific promoter that directs substantial transcription of the DNA only in predetermined cells.
- Other transcription control elements besides a promoter, for example enhancers, operators, repressors, and transcription termination signals, can be operably associated with the polynucleotide to direct cell-specific transcription. Suitable promoters and other transcription control regions are disclosed herein.
- DNA encoding antibodies or antibody fragments may also be derived from antibody libraries, such as phage display libraries.
- phage can be utilized to display antigen-binding domains expressed from a repertoire or combinatorial antibody library (e.g., human or murine).
- Phage expressing an antigen binding domain that binds the antigen of interest can be selected or identified with antigen, e.g., using labeled antigen or antigen bound or captured to a solid surface or bead.
- Phage used in these methods are typically filamentous phage including fd and M 13 and the VH or VL regions are usually recombinantly fused to either the phage gene III or gene VIII.
- Phage expressing an antigen binding domain that binds to an antigen of interest i.e., an LT polypeptide or a fragment thereof
- an antigen of interest i.e., an LT polypeptide or a fragment thereof
- can be selected or identified with antigen e.g., using labeled antigen or antigen bound or captured to a solid surface or bead.
- Human antibodies can also be produced using transgenic mice which are incapable of expressing functional endogenous immunoglobulins, but which can express human immunoglobulin genes.
- the human heavy and light chain immunoglobulin gene complexes may be introduced randomly or by homologous recombination into mouse embryonic stem cells.
- the human variable region, constant region, and diversity region may be introduced into mouse embryonic stem cells in addition to the human heavy and light chain genes.
- the mouse heavy and light chain immunoglobulin genes may be rendered non-functional separately or simultaneously with the introduction of human immunoglobulin loci by homologous recombination. In particular, homozygous deletion of the JH region prevents endogenous antibody production.
- the stabilized scFv molecules of the invention comprise at least one disulfide bond which links an amino acid in the VL domain with an amino acid in the VH domain.
- Cysteine residues are necessary to provide disulfide bonds.
- Disulfide bonds can be included in an scFv molecule of the invention, e.g., to connect FR4 of VL and FR2 of VH or to connect FR2 of VL and FR4 of VH.
- Exemplary positions for disulfide bonding include: 43, 44, 45, 46, 47, 103, 104, 105, and 106 of VH and 42, 43, 44, 45, 46, 98, 99, 100, and 101 of VL, Kabat numbering.
- a stabilized scFv molecule of the invention comprises an scFv linker having the amino acid sequence (GIy 4 Ser) 4 interposed between a V H domain and a V L domain, wherein the V H and V L domains are linked by a disulfide bond between an amino acid in the V H at amino acid position 44 and an amino acid in the V L at amino acid position 100.
- the stabilized scFv molecules of the invention comprise one or more (e.g. 2, 3, 4, 5, or more) stabilizing mutations within a variable domain (VH or VL) of the scFv.
- Exemplary single- domain antibodies employed in the binding molecules of the invention include, for example, the Camelid heavy chain variable domain (about 118 to 136 amino acid residues) as described in Hamers-Casterman, et al., Nature 363:446-448 (1993), and Dumoulin, et al., Protein Science 11:500-515 (2002). Multimers of single-domain antibodies are also within the scope of the invention.
- Other single domain antibodies include shark antibodies (e.g., shark Ig-NARs).
- VHH variable regions The main differences between camelid VHH variable regions and those derived from conventional antibodies (VH) include (a) more hydrophobic amino acids in the light chain contact surface of VH as compared to the corresponding region in VHH, (b) a longer CDR3 in VHH, and (c) the frequent occurrence of a disulfide bond between CDRl and CDR3 in VHH.
- Methods for making single domain binding molecules are described in US Patent Nos 6.005,079 and 6,765,087, both of which are incorporated herein by reference.
- the binding molecules of the invention are minibodies or comprise minibodies.
- Minibodies can be made using methods described in the art (see e.g., US patent 5,837,821 or WO 94/09817A1).
- a minibody is a binding molecule that comprises only 2 complementarity determining regions (CDRs) of a naturally or non-naturally (e.g., mutagenized) occurring heavy chain variable domain or light chain variable domain, or combination thereof.
- CDRs complementarity determining regions
- An example of such a minibody is described by Pessi et al., Nature 362:367-369 (1993).
- Another exemplary minibody comprises a scFv molecule that is linked or fused to a CH3 domain or a complete Fc region. Multimers of minibodies are also within the scope of the invention.
- a "fragment" in reference to a binding molecule refers to an antigen-binding fragment, i.e., a portion of the binding which specifically binds to the antigen.
- a binding molecule of the invention is an antibody fragment or comprises such a fragment.
- Antibody fragments that recognize specific epitopes may be generated by known techniques. For example, Fab and F(ab') 2 fragments may be produced recombinantly or by proteolytic cleavage of immunoglobulin molecules, using enzymes such as papain (to produce Fab fragments) or pepsin (to produce F(ab') 2 fragments). F(ab') 2 fragments contain the variable region, the light chain constant region and the CHl domain of the heavy chain.
- F. Multivalent Minibodies contain the variable region, the light chain constant region and the CHl domain of the heavy chain.
- bispecific C-scFv tetravalent minibodies where the first and second scFv fragments of a first heavy chain portion of a bispecific tetravalent minibody bind the same target LT molecule, at least one of the first and second scFv fragments of the second heavy chain portion of the bispecific tetravalent minibody may bind the same or different LT target molecule.
- the multispecific binding molecules of the invention comprise at least one scFv (e.g. 2, 3, or 4 scFvs, e.g., stabilized scFvs) linked to the C- terminus of an antibody heavy chain, wherein the scFv and antibody have different binding specificities.
- the multispecific binding molecules of the invention comprise at least one scFv (e.g. 2, 3, or 4 scFvs, e.g., stabilized scFvs) linked to the N-terminus of an antibody heavy chain, wherein the scFv and antibody have different binding specificities.
- the multispecific binding molecules of the invention comprise at least one scFv (e.g.
- the multispecific binding molecules of the invention comprise at least one scFv (e.g., 2, 3, or 4 scFvs or stabilized scFvs) linked to the N-terminus of the antibody heavy chain or light chain and at least one scFv (e.g., 2, 3, or 4 scFvs or stabilized scFvs) linked to the C-terminus of the heavy chain, wherein the scFvs have different binding specificity.
- the binding molecules of the invention are multispecific diabodies.
- the multispecific binding molecules of the invention are bispecific diabodies, with each arm of the diabody comprising tandem scFv fragments. In preferred embodiments, at least one of the scFv fragments is stabilized.
- a bispecific diabody may comprise a first arm with a first binding specificity and a second arm with a second binding specificity.
- each arm of the diabody may comprise a first scFv fragment with a first binding specificity and a second scFv fragment with a second binding specificity.
- a multispecific diabody can be directly fused to a complete Fc region or an Fc portion (e.g. a CH3 domain).
- binding molecule fragments of the invention may be made to be multispecific.
- Multispecific binding molecules of the invention include bispecific Fab2 or multispecific (e.g. trispecific) Fab3 molecules.
- a multispecific binding molecule fragment may comprise chemically conjugated multimers (e.g. dimers, trimers, or tetramers) of Fab or scFv molecules having different specificities.
- the multispecific binding molecules of the invention are scFv2 tetravalent antibodies with each heavy chain portion of the scFv2 tetravalent antibody containing an scFv molecule.
- at least one of the scFv molecules are stabilized.
- the scFv fragments may be linked to the N-termini of a variable region of the heavy chain portions (e.g. N H SCFV2 tetravalent antibodies or N L scFv2 tetravalent antibodies).
- the scFv fragments may be linked to the C- termini of the heavy chain portions of the scFv2 tetravalent antibody.
- Each heavy chain portion of the scFv2 tetravalent antibody may have variable regions and scFv fragments that bind the same or different target LT molecule or epitope.
- the scFv fragment and variable region of a first heavy chain portion of a scFc2 tetravalent antibody bind the same target molecule or epitope
- at least one of the first and second scFv fragments of the second heavy chain portion of the bispecific tetravalent minibody binds a different target molecule or epitope.
- Tandem variable domain binding molecules may comprise two or more of heavy or light chains and are of higher order valency (e.g., bivalent or tetravalent). Methods for making tandem variable domain binding molecules are known in the art, see e.g. WO 2007/024715.
- At least one of the binding molecules of the invention may comprise one or more modifications.
- Modified forms of LT binding molecules of the invention can be made from whole precursor or parent antibodies using techniques known in the art.
- the present invention also provides binding molecule that comprise, consist essentially of, or consist of, variants (including derivatives) of binding moieties (e.g., the VH regions and/or VL regions of an antibody molecule) described herein, which binding moieties immuno specifically bind to an LT polypeptide.
- binding moieties e.g., the VH regions and/or VL regions of an antibody molecule
- Standard techniques known to those of skill in the art can be used to introduce mutations in the nucleotide sequence encoding an LT binding molecule, include, but are not limited to, site-directed mutagenesis and PCR-mediated mutagenesis which result in amino acid substitutions.
- An LT binding molecule of the invention can be composed of amino acids joined to each other by peptide bonds or modified peptide bonds, i.e., peptide isosteres, and may contain amino acids other than the 20 gene-encoded amino acids.
- LT-specfic binding molecules may be modified by natural processes, such as posttranslational processing, or by chemical modification techniques which are well known in the art. Such modifications are well described in basic texts and in more detailed monographs, as well as in a voluminous research literature. Modifications can occur anywhere in the LT-specific binding molecule, including the peptide backbone, the amino acid side- chains and the amino or carboxyl termini, or on moieties such as carbohydrates.
- Modifications include acetylation, acylation, ADP- ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphotidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent cross-links, formation of cysteine, formation of pyroglutamate, formylation, gamma-carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristoylation, oxidation, pegylation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquitination.
- CTLA-4 Lisley et al, J. Exp. Med. 174:561-569 (1991)
- CD22 Stamenkovic et al, Cell 6(5:1133-1144 (1991)
- TNF receptor Ashkenazi et al, Proc. Natl. Acad. ScL USA SS:10535-10539 (1991); Lesslauer et al, Eur. J. Immunol. 27:2883-2886 (1991); and Peppel et al, J. Exp. Med. 774:1483-1489 (1991)
- IgE receptor a Roshkenazi et al, Proc. Natl. Acad. ScL USA SS:10535-10539 (1991); Lesslauer et al, Eur. J. Immunol. 27:2883-2886 (1991); and Peppel et al, J. Exp. Med. 774:1483-1489 (1991)
- IgE receptor a Rosh
- the enzyme which is bound to the LT binding molecule will react with an appropriate substrate, preferably a chromogenic substrate, in such a manner as to produce a chemical moiety which can be detected, for example, by spectrophotometric, fluorimetric or by visual means.
- compositions may comprise binding molecules coupled to drugs or prodrugs.
- Still other embodiments of the present invention comprise the use of binding molecules conjugated to specific biotoxins or their cytotoxic fragments such as ricin, gelonin, Pseudomonas exotoxin or diphtheria toxin.
- the selection of which conjugated or unconjugated binding molecule to use will depend on the type and stage of cancer, use of adjunct treatment ⁇ e.g., chemotherapy or external radiation) and patient condition. It will be appreciated that one skilled in the art could readily make such a selection in view of the teachings herein.
- compatible metal chelators are ethylenediaminetetraacetic acid (EDTA), diethylenetriaminepentaacetic acid (DPTA), 1,4,8,11-tetraazatetradecane, 1,4,8,11- tetraazatetradecane-1,4,8,11-tetraacetic acid, l-oxa-4,7,12,15-tetraazaheptadecane- 4,7,12,15-tetraacetic acid, or the like. Cyclohexyl-DTPA or CHX-DTPA is particularly preferred and is exemplified extensively below. Still other compatible chelators, including those yet to be discovered, may easily be discerned by a skilled artisan and are clearly within the scope of the present invention.
- CDRs non-human complementarity determining regions
- a binding molecule (e.g., an antibody) of the invention or portion thereof may be chimeric.
- a chimeric binding molecule is a binding molecule in which different portions of the binding molecule are derived from different animal species, such as antibodies having a variable region derived from a murine monoclonal antibody and a human immunoglobulin constant region.
- Methods for producing chimeric binding moleculs are known in the art. See, e.g., Morrison, Science 229:1202 (1985); Oi et al., BioTechniques 4:214 (1986); Gillies et al., J. Immunol. Methods 725:191-202 (1989); U.S. Pat. Nos.
- Humanized binding molecules are binding molecules having a binding specificity from a non-human species, i.e., having one or more complementarity determining regions (CDRs) from the non-human species antibody, and framework regions from a human immunoglobulin molecule.
- CDRs complementarity determining regions
- framework residues in the human framework regions will be mutated, e.g., substituted with the corresponding residue from the CDR donor antibody to alter, preferably improve, antigen binding.
- These framework substitutions are identified by methods well known in the art, e.g., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions. (See, e.g., Queen et al., U.S. Pat. No.
- Antibodies can be humanized using a variety of techniques known in the art including, for example, CDR-grafting (EP 239,400; PCT publication WO 91/09967; U.S. Pat. Nos. 5,225,539; 5,530,101; and 5,585,089), veneering or resurfacing (EP 592,106; EP 519,596; Padlan, Molecular Immunology 2S(4/5):489-498 (1991); Studnicka et al., Protein Engineering 7(6):805-814 (1994); Roguska.
- De-immunization can also be used to decrease the immunogenicity of a binding molecule.
- the term "de-immunization” includes alteration of an binding molecule to modify T cell epitopes (see, e.g., WO9852976A1, WO0034317A2).
- VH and VL sequences from the starting antibody may be analyzed and a human T cell epitope "map" from each V region showing the location of epitopes in relation to complementarity-determining regions (CDRs) and other key residues within the sequence.
- CDRs complementarity-determining regions
- VH and VL sequences are designed comprising combinations of amino acid substitutions and these sequences are subsequently incorporated into a range of binding polypeptides, e.g., LT-specific antibodies or immuno specific fragments thereof for use in the diagnostic and treatment methods disclosed herein, which are then tested for function.
- binding polypeptides e.g., LT-specific antibodies or immuno specific fragments thereof for use in the diagnostic and treatment methods disclosed herein, which are then tested for function.
- LT-specific antibodies or immuno specific fragments thereof for use in the diagnostic and treatment methods disclosed herein, which are then tested for function.
- Complete heavy and light chain genes comprising modified V and human C regions are then cloned into expression vectors and the subsequent plasmids introduced into cell lines for the production of whole antibody.
- the antibodies are then compared in appropriate biochemical and biological assays, and the optimal variant is identified.
- a binding molecule of the invention is a humanized antibody or comprises a humanized antibody variable region having an acceptor human framework or substantially human acceptor framework.
- An "acceptor human framework” for the purposes herein is a framework comprising the amino acid sequence of a VL or VH framework derived from a human immunoglobulin framework, or from a human consensus framework.
- An acceptor human framework "derived from” a human immunoglobulin framework or human consensus framework may comprise the same amino acid sequence thereof, or may contain certain amino acid sequence changes.
- the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
- a "human consensus framework” is a framework that represents the most commonly occurring amino acid residue in a selection of human immunoglobulin VL or VH framework sequences. Generally, the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences. Human germline sequences or germline seqeuences with some consensus sequence (e.g., FR4) may be considered as well.
- acceptor framework sequences for the light and heavy chains are identified having high similarity to the murine starting antibody sequences in canonical, interface and veneer zone residues. CDR sequences are excluded when determining similarity to germline sequences. In one embodiment, acceptor sequences have the same length CDRs if (except CDR-H3); and require a minimum number of backmutations.
- acceptor frameworks that are more distant from stable consensus classes are chosen in order to improve the physico-chemical properties of humanized designs.
- human germline sequence huL6 for the 105 antibody, human germline sequence huL6
- human gil3004688 may be used as the acceptor frameworks for light and heavy chains respectively.
- a humanized 105 light chain is made comprising a backmuation at amino acid position 1 (E- >D; i.e., E to D).
- a backmutation at amio acid position 21 (L- >I) is made.
- a backmutation at amino acid position 68 (G- >R) is made.
- a backmutation at amino acid position 86 (Y- >F) is made.
- a first version of the humanized light chain is made comprising a backmuation at position 1.
- a second version of the 105 light chain is made comprising a backmutation at position 1, 21, and 86.
- HO graft EVOLVESGGGLVOPGGSLRLSCAASGYSITSGYYWNWVROAPGKGLEWISYISYDGSNNYNPSLKNRFTIS RDSAKNSLYLHMHSLRAEDTAVYYCARDAYSYGMDYWGQGTTVTVSS
- a binding molecule of the invention comprises the light chain of the 105 antibody version 0 or the CDRs thereof.
- a binding molecule of the invention comprises the heavy chain of the 105 antibody version 1 or the CDRs thereof.
- a binding molecule of the invention comprises the light chain of the 105 antibody version 0 or the CDRs thereof in combination with the heavy chain of the 105 antibody version 1 or the CDRs thereof:
- a binding molecule of the invention comprises the light chain of the 105 antibody version 12 or 13 or the CDRs thereof. In another embodiment, a binding molecule of the invention comprises the heavy chain of the 105 antibody version 1 or the CDRs thereof. In another embodiment, a binding molecule of the invention comprises the light chain of the 105 antibody version 12 or 13 or the CDRs thereof in combination with the heavy chain of the 105 antibody version 1 or the CDRs thereof:
- human germline sequence huA3 (with consensus HUMKV2 FR4) and human germline sequence huVH3-ll (with consensus HUMHV3 FR4) are used.
- a reshaped light chain of humanized LT 102 (huLT102) includs a germline huA3 framework, consensus human KV2 FR4, nad LT102 L CDRs.
- V2 is a canonical residue supporting CDR-Ll.
- Exemplary humanized LT 102 light chain sequence is described below (for details regarding backmutation see above).
- the humanized light chain of LT102 included: Germline huA3 framework // consensus human KV2 FR4 // LT102 L CDRs. Backmutations are in lowercase bold font. CDRs, including Chothia definition, are underlined.
- the four different versions of the humanized LT 102 heavy chain are described below
- the humanized heavy chain of LT102 included: Germline huVH3-l 1 framework // consensus human HV3 FR4 // LT102 H CDRs.
- Backmutations described below in Hl, H2, H3, and H4 are in lowercase, bold font.
- CDRs, including Chothia definition, are underlined.
- a humanized 102 heavy chain is made comprising a backmuation at amino acid position 24 (A— >V). In one embodiment, a humanized 102 heavy chain is made comprising a backmuation at amino acid position 73 (N- >Y). In one embodiment, a humanized 102 heavy chain is made comprising a backmuation at amino acid position 3 (Q- >K). In one embodiment, a humanized 102 heavy chain is made comprising a backmuation at amino acid position K— >T). In one embodiment, a humanized 102 heavy chain is made comprising a backmuation at amino acid position 77 S ⁇ N).
- a first version of the humanized 102 heavy chain is made comprising a backmuation at position 24.
- a second version of the 102 heavy chain is made comprising a backmutation at position 24, 1, and 73.
- a third version of the 102 heavy chain is made comprising a backmuation at position 24, 1, 73, and 3.
- a fourth version of the 102 heavy chain is made comprising a backmuation at position 24, 1, 73, 3, 75, and 77.
- LT binding molecules of the invention may comprise a constant region which mediates one or more effector functions.
- binding of the Cl component of complement to an antibody constant region may activate the complement system thereby causing complement dependent cytotoxicity of target cells.
- Activation of complement is important in the opsonisation and lysis of cell pathogens.
- the activation of complement also stimulates the inflammatory response and may also be involved in autoimmune hypersensitivity.
- antibodies bind to receptors on various cells via the Fc region, with an Fc receptor binding site on the antibody Fc region binding to a Fc receptor (FcR) on a cell.
- FcR Fc receptor
- Fc receptors which are specific for different classes of antibody, including IgG (gamma receptors), IgE (epsilon receptors), IgA (alpha receptors) and IgM (mu receptors). Binding of antibody to Fc receptors on cell surfaces triggers a number of important and diverse biological responses including engulfment and destruction of antibody-coated particles, clearance of immune complexes, lysis of antibody-coated target cells by killer cells (called antibody-dependent cell-mediated cytotoxicity, or ADCC), release of inflammatory mediators, placental transfer and control of immunoglobulin production.
- ADCC antibody-dependent cell-mediated cytotoxicity
- Certain embodiments of the invention include LT binding molecules in which at least one amino acid in one or more of the constant region domains has been deleted or otherwise altered so as to provide desired biochemical characteristics such as: reduced effector function(s), increased effector function(s), improved ability to non-covalently dimerize, increased ability to localize at the site of a tumor, reduced serum half-life, or increased serum half-life when compared with a whole, unaltered antibody of approximately the same immunogenicity.
- certain binding molecules for use in the diagnostic and treatment methods described herein are domain deleted antibodies which comprise a polypeptide chain similar to an immunoglobulin heavy chain, but which lack at least a portion of one or more heavy chain domains. For instance, in certain antibodies, one entire domain of the constant region of the modified antibody will be deleted, for example, all or part of the CH2 domain will be deleted.
- an anti-LT binding site may be fused to an Fc portion.
- the Fc portion may be a wild- type Fc portion derived from an antibody molecule.
- the Fc portion may be mutated to change (e.g., increase or decrease) effector function using techniques known in the art. For example, the deletion or inactivation (through point mutations or other means) of a constant region domain may reduce Fc receptor binding of the circulating modified binding molecule thereby increasing tumor localization. In other cases it may be that constant region modifications consistent with the instant invention moderate complement binding and thus reduce the serum half life and nonspecific association of a conjugated cytotoxin.
- an Fc domain employed in a binding polypeptide of the invention is an Fc variant.
- the term "Fc variant” refers to an Fc domain having at least one amino acid substitution relative to the wild-type Fc domain from which said Fc domain is derived.
- the Fc variant of said human IgGl Fc domain comprises at least one amino acid substitution relative to the wild-type Fc domain, e.g, designed to alter effetor function or half- life of the binding molecule.
- the binding polypeptides of the invention may employ any art-recognized Fc variant which is known to impart an improvement (e.g., reduction or enhancement) in effector function and/or FcR binding.
- Said Fc variants may include, for example, any one of the amino acid substitutions disclosed in International PCT Publications WO88/07089A1, WO96/14339A1, WO98/05787A1, WO98/23289A1, WO99/51642A1, WO99/58572A1, WO00/09560A2, WO00/32767A1, WO00/42072A2, WO02/44215A2, WO02/060919A2, WO03/074569A2, WO04/016750A2, WO04/029207A2, WO04/035752A2, WO04/063351A2, WO04/074455A2, WO04/099249A2, WO05/040217A2, WO05/070963A1, WO
- a binding polypeptide of the invention comprising an Fc variant polypeptide comprising an amino acid substitution which alters the antigen- independent effector functions of the antibody, in particular the circulating half- life of the antibody.
- Such binding polypeptides exhibit either increased or decreased binding to FcRn when compared to binding polypeptides lacking these substitutions, therefore, have an increased or decreased half-life in serum, respectively.
- Fc variants with improved affinity for FcRn are anticipated to have longer serum half-lives, and such molecules have useful applications in methods of treating mammals where long half-life of the administered polypeptide is desired, e.g., to treat a chronic disease or disorder.
- Fc variants with decreased FcRn binding affinity are expected to have shorter half-lives, and such molecules are also useful, for example, for administration to a mammal where a shortened circulation time may be advantageous, e.g. for in vivo diagnostic imaging or in situations where the starting polypeptide has toxic side effects when present in the circulation for prolonged periods.
- Fc variants with decreased FcRn binding affinity are also less likely to cross the placenta and, thus, are also useful in the treatment of diseases or disorders in pregnant women.
- other applications in which reduced FcRn binding affinity may be desired include those applications in which localization the brain, kidney, and/or liver is desired.
- a binding polypeptide of the invention having altered FcRn binding affinity comprises an Fc domain having one or more amino acid substitutions within the 15 A FcRn "contact zone.”
- 15 A FcRn "contact zone” includes residues at the following positions 243-261, 275-280, 282-293, 302-319, 336- 348, 367, 369, 372-389, 391, 393, 408, 424, 425-440 (EU numbering).
- a binding polypeptide of the invention having altered FcRn binding affinity comprises an Fc domain having one or more amino acid substitutions at any one of the following positions: 256, 277-281, 283-288, 303-309, 313, 338, 342, 376, 381, 384, 385, 387, 434, and 438.
- Exemplary amino acid substitutions which altered FcRn binding activity are disclosed in International PCT Publication No. WO05/047327 which is incorporated by reference herein.
- certain binding molecules for use in the diagnostic and treatment methods described herein have a constant region, e.g., an IgG4 heavy chain constant region, which is altered to reduce or eliminate glycosylation.
- a binding polypeptide of the invention may also comprise an Fc variant comprising an amino acid substitution which alters the glycosylation of the binding polypeptide.
- said Fc variant may have reduced glycosylation (e.g., N- or O-linked glycosylation) or may comprise an altered glycoform of the wild-type Fc domain (e.g., a low fucose or fucose-free glycan).
- Such low fucose or afucosylated forms of molecules may be made using alternative cell lines known in the art to produce such altered forms.
- the Fc variant is afucosylated.
- agly binding molecules e.g. "agly” antibodies
- agly binding molecules may have an improved safety and stability profile in vivo.
- Exemplary agly binding molecules comprise an aglycosylated Fc region of an IgG4 antibody ("IgG4.P") which is devoid of Fc-effector function thereby eliminating the potential for Fc mediated toxicity to the normal vital organs that express LT.
- IgG4.P Iglycosylated Fc region of an IgG4 antibody
- agly binding molecules of the invention may comprise the IgG4.P or IgG4PE constant region as known in the art.
- DNA typically plasmid DNA
- DNA may be isolated from the cells using techniques known in the art, restriction mapped and sequenced in accordance with standard, well known techniques set forth in detail, e.g., in the foregoing references relating to recombinant DNA techniques.
- the DNA may be synthetic according to the present invention at any point during the isolation process or subsequent analysis.
- the polynucleotides encoding the LT binding molecules are typically inserted in an expression vector for introduction into host cells that may be used to produce the desired quantity of LT binding molecule.
- a binding molecule e.g., a heavy or light chain of an antibody which binds to a target molecule described herein, e.g., LT
- an expression vector containing a polynucleotide that encodes the binding molecule Once a polynucleotide encoding a binding molecule (or a chain or portion thereof) of the invention has been obtained, the vector for the production of the binding molecule may be produced by recombinant DNA technology using techniques well known in the art. Thus, methods for preparing a protein by expressing a polynucleotide containing a binding molecule encoding nucleotide sequence are described herein.
- the monomers are antibody light and heavy chains, the light chain is advantageously placed before the heavy chain to avoid an excess of toxic free heavy chain (Proudfoot, Nature 322:52 (1986); Kohler, Proc. Natl. Acad. ScL USA 77:2197 (1980)).
- the coding sequences for the monomers of a binding molecule may comprise cDNA or genomic DNA.
- vector or "expression vector” is used herein to mean vectors used in accordance with the present invention as a vehicle for introducing into and expressing a desired gene in a host cell. As known to those skilled in the art, such vectors may easily be selected from the group consisting of plasmids, phages, viruses and retroviruses.
- vectors compatible with the instant invention will comprise a selection marker, appropriate restriction sites to facilitate cloning of the desired gene and the ability to enter and/or replicate in eukaryotic or prokaryotic cells.
- the selectable marker gene can either be directly linked to the DNA sequences to be expressed, or introduced into the same cell by cotransformation. Additional elements may also be needed for optimal synthesis of mRNA. These elements may include signal sequences, splice signals, as well as transcriptional promoters, enhancers, and termination signals.
- the cloned variable region genes are inserted into an expression vector along with the heavy and light chain constant region genes (preferably human) synthetic as discussed above. In one embodiment, this is effected using a proprietary expression vector of Biogen IDEC, Inc., referred to as NEOSPLA (disclosed in U.S. patent 6,159,730).
- This vector contains the cytomegalovirus promoter/enhancer, the mouse beta globin major promoter, the SV40 origin of replication, the bovine growth hormone polyadenylation sequence, neomycin phosphotransferase exon 1 and exon 2, the dihydrofolate reductase gene and leader sequence.
- This vector has been found to result in very high level expression of antibodies upon incorporation of variable and constant region genes, transfection in CHO cells, followed by selection in G418 containing medium and methotrexate amplification.
- any expression vector which is capable of eliciting expression in eukaryotic cells may be used in the present invention.
- Suitable vectors include, but are not limited to plasmids pcDNA3, pHCMV/Zeo, pCR3.1, pEFl/His, pIND/GS, pRc/HCMV2, pSV40/Zeo2, pTRACER-HCMV, pUB6/V5-His, pVAXl , and pZeoSV2 (available from Invitrogen, San Diego, CA), and plasmid pCI (available from Promega, Madison, WI).
- screening large numbers of transformed cells for those which express suitably high levels if immunoglobulin heavy and light chains is routine experimentation which can be carried out, for example, by robotic systems. Vector systems are also taught in U.S. Pat. Nos.
- the expression vector may be introduced into an appropriate host cell.
- Introduction of the plasmid into the host cell can be accomplished by various techniques well known to those of skill in the art. These include, but are not limited to, transfection (including electrophoresis and electroporation), protoplast fusion, calcium phosphate precipitation, cell fusion with enveloped DNA, microinjection, and infection with intact virus. See, Ridgway, A. A. G. "Mammalian Expression Vectors" Vectors, Rodriguez and Denhardt, Eds., Butterworths, Boston, Mass., Chapter 24.2, pp. 470-472 (1988).
- plasmid introduction into the host is via electroporation.
- the host cells harboring the expression construct are grown under conditions appropriate to the production of the binding molecule, and assayed for binding molecule synthesis.
- Exemplary assay techniques include enzyme- linked immunosorbent assay (ELISA), radioimmunoassay (RIA), or fluorescence- activated cell sorter analysis (FACS), immunohistochemistry and the like.
- the expression vector is transferred to a host cell by conventional techniques and the transfected cells are then cultured by conventional techniques to produce a binding moleucle for use in the methods described herein.
- the invention includes host cells containing a polynucleotide encoding a binding molecule of the invention, or a monomer or chain thereof, operably linked to a heterologous promoter.
- vectors which separately encode binding molecule chains may be co-expressed in the host cell for expression of the entire binding molecule, as detailed below.
- host cells refers to cells which harbor vectors constructed using recombinant DNA techniques and encoding at least one heterologous gene.
- the terms “cell” and “cell culture” are used interchangeably to denote the source of binding molecule unless it is clearly specified otherwise.
- recovery of polypeptide from the “cells” may mean either from spun down whole cells, or from the cell culture containing both the medium and the suspended cells.
- host-expression vector systems may be utilized to express binding molecules for use in the methods described herein.
- Such host-expression systems represent vehicles by which the coding sequences of interest may be produced and subsequently purified, but also represent cells which may, when transformed or transfected with the appropriate nucleotide coding sequences, express an antibody molecule of the invention in situ.
- These include but are not limited to microorganisms such as bacteria (e.g., E. coli, B.
- subtilis transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing binding molecule coding sequences; yeast (e.g., Saccharomyces, Pichia) transformed with recombinant yeast expression vectors containing binding molecule coding sequences; insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus) containing binding molecule coding sequences; plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid) containing binding molecule coding sequences; or mammalian cell systems (e.g., COS, CHO, BLK, 293, 3T3 cells) harboring recombinant expression constructs containing promoters derived from the genome of mammalian cells (e.g., metallothione
- bacterial cells such as Escherichia coli, and more preferably, eukaryotic cells, especially for the expression of whole recombinant binding moleculea, are used for the expression of a recombinant binding molecule.
- mammalian cells such as Chinese hamster ovary cells (CHO) in conjunction with a vector such as the major intermediate early gene promoter element from human cytomegalovirus is an effective expression system for antibodies and other binding molecules (Foecking et al., Gene 45:101 (1986); Cockett et al., Bio/Technology 8:2 (1990)).
- cell lines which stably express the binding molecule may be engineered.
- host cells can be transformed with DNA controlled by appropriate expression control elements (e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.), and a selectable marker.
- appropriate expression control elements e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.
- engineered cells may be allowed to grow for 1-2 days in an enriched media, and then are switched to a selective media.
- the selectable marker in the recombinant plasmid confers resistance to the selection and allows cells to stably integrate the plasmid into their chromosomes and grow to form foci which in turn can be cloned and expanded into cell lines.
- This method may advantageously be used to engineer cell lines which stably express the binding molecule.
- a number of selection systems may be used, including but not limited to the herpes simplex virus thymidine kinase (Wigler et al., Cell 11:223 (1977)), hypoxanthine-guanine phosphoribosyltransferase (Szybalska & Szybalski, Proc. Natl. Acad.
- dhfr which confers resistance to methotrexate (Wigler et al., Natl. Acad. ScL USA 77:357 (1980); O'Hare et al., Proc. Natl. Acad.
- tissue culture conditions include homogeneous suspension culture, e.g. in an airlift reactor or in a continuous stirrer reactor, or immobilized or entrapped cell culture, e.g. in hollow fibers, microcapsules, on agarose microbeads or ceramic cartridges.
- This plasmid already contains the TRPl gene which provides a selection marker for a mutant strain of yeast lacking the ability to grow in tryptophan, for example ATCC No. 44076 or PEP4-1 (Jones, Genetics 85:12 (1977)).
- the presence of the trpl lesion as a characteristic of the yeast host cell genome then provides an effective environment for detecting transformation by growth in the absence of tryptophan.
- a binding molecule of the invention may be purified by any method known in the art for purification of a binding molecule, for example, by chromatography (e.g., ion exchange, affinity, particularly by affinity for the specific antigen after Protein A, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins.
- chromatography e.g., ion exchange, affinity, particularly by affinity for the specific antigen after Protein A, and sizing column chromatography
- centrifugation e.g. antibodies
- One embodiment of the present invention provides methods for treating a subject that would benefit from administration of an anti-LT binding molecule the method comprising, consisting essentially of, or consisting of administering to the animal an effective amount of a binding molecule or composition of the invention described herein.
- Early RA includes, for example, juvenile-onset RA, juvenile idiopathic arthritis (JIA), orjuvenile RA (JRA).
- a binding molecule of the invention is used to treat incipient rheumatoid arthritis.
- Patients with "incipient RA” have early polyarthritis that does not fully meet ACR criteria for a diagnosis of RA, but is associated with the presence of RA-specific prognostic biomarkers such as anti-CCP and shared epitope. They include patients with positive anti- CCP antibodies who present with polyarthritis, but do not yet have a diagnosis of RA, and are at high risk for going on to develop bonafide ACR criteria RA (95% probability).
- “Joint damage” is used in the broadest sense and refers to damage or partial or complete destruction to any part of one or more joints, including the connective tissue and cartilage, where damage includes structural and/or functional damage of any cause, and may or may not cause joint pain/arthalgia. It includes, without limitation, joint damage associated with or resulting from inflammatory joint disease as well as noninflammatory joint disease. This damage may be caused by any condition, such as an autoimmune disease, especially arthritis, and most especially RA.
- Exemplary such conditions include acute and chronic arthritis, RA including juvenile-onset RA, juvenile idiopathic arthritis (JIA), orjuvenile RA (JRA), and stages such as rheumatoid synovitis, gout or gouty arthritis, acute immunological arthritis, chronic inflammatory arthritis, degenerative arthritis, type II collagen-induced arthritis, infectious arthritis, septic arthritis, Lyme arthritis, proliferative arthritis, psoriatic arthritis, Still's disease, vertebral arthritis, osteoarthritis, arthritis chronica progrediente, arthritis deformans, polyarthritis chronica primaria, reactive arthritis, menopausal arthritis, estrogen-depletion arthritis, and ankylosing spondylitis/rheumatoid spondylitis), rheumatic autoimmune disease other than RA, and significant systemic involvement secondary to RA (including but not limited to vasculitis, pulmonary fibrosis or Felty's syndrome).
- RA acute and chronic arthritis
- RA
- joints are points of contact between elements of a skeleton (of a vertebrate such as an animal) with the parts that surround and support it and include, but are not limited to, for example, hips, joints between the vertebrae of the spine, joints between the spine and pelvis (sacroiliac joints), joints where the tendons and ligaments attach to bones, joints between the ribs and spine, shoulders, knees, feet, elbows, hands, fingers, ankles, and toes, but especially joints in the hands and feet.
- the subject has never been previously treated with drug(s), such as immunosuppressive agent(s), to treat the disorder, and in a particular embodiment has never been previously treated with a TNF antagonist.
- the subject has been previously treated with drug(s) to treat the disorder, including with a TNF antagonist.
- LT-specific binding molecules to a subject in need thereof are well known to or are readily determined by those skilled in the art.
- the route of administration of the binding molecule may be, for example, oral, parenteral, by inhalation or topical.
- parenteral as used herein includes, e.g., intravenous, intraarterial, intraperitoneal, intramuscular, subcutaneous, rectal or vaginal administration. While all these forms of administration are clearly contemplated as being within the scope of the invention, a form for administration would be a solution for injection, in particular for intravenous or intraarterial injection or drip.
- a suitable pharmaceutical composition for injection may comprise a buffer (e.g.
- binding molecules can be delivered directly to the site of the adverse cellular population thereby increasing the exposure of the diseased tissue to the therapeutic agent.
- Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions.
- non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate.
- Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
- pharmaceutically acceptable carriers include, but are not limited to, 0.01-0. IM and preferably 0.05M phosphate buffer or 0.8% saline.
- Intravenous vehicles include sodium phosphate solutions, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils.
- Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers, such as those based on Ringer's dextrose, and the like. Preservatives and other additives may also be present such as for example, antimicrobials, antioxidants, chelating agents, and inert gases and the like.
- compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
- the composition must be sterile and should be fluid to the extent that easy syringability exists. It should be stable under the conditions of manufacture and storage and will preferably be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
- the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- a coating such as lecithin
- surfactants Suitable formulations for use in the therapeutic methods disclosed herein are described in Remington's Pharmaceutical Sciences, Mack Publishing Co., 16th ed. (1980).
- Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal and the like.
- isotonic agents for example, sugars, polyalcohols, such as mannitol, sorbitol, or sodium chloride in the composition.
- Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
- the preparations for injections are processed, filled into containers such as ampoules, bags, bottles, syringes or vials, and sealed under aseptic conditions according to methods known in the art. Further, the preparations may be packaged and sold in the form of a kit such as those described in co-pending U. S. S. N. 09/259,337 (US-2002-0102208 Al), which is incorporated herein by reference in its entirety. Such articles of manufacture will preferably have labels or package inserts indicating that the associated compositions are useful for treating a subject suffering from, or predisposed to autoimmune or neoplastic disorders.
- An exemplary treatment entails administration in multiple dosages over a prolonged period, for example, of at least six months. Additional exemplary treatment regimes entail administration once per every two weeks or once a month or once every 3 to 6 months. Exemplary dosage schedules include 1-10 mg/kg or 15 mg/kg on consecutive days, 30 mg/kg on alternate days or 60 mg/kg weekly. In some methods, two or more monoclonal antibodies with different binding specificities are administered simultaneously, in which case the dosage of each antibody administered falls within the ranges indicated.
- LT- specific binding molecule disclosed herein can be administered on multiple occasions. Intervals between single dosages can be weekly, monthly or yearly. Intervals can also be irregular as indicated by measuring blood levels of target polypeptide or target molecule in the patient. In some methods, dosage is adjusted to achieve a plasma polypeptide concentration of 1-1000 ⁇ g/ml and in some methods 25- 300 ⁇ g/ml. Alternatively, binding molecules can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half- life of the antibody in the patient. The half-life of a binding molecule can also be prolonged via fusion to a stable polypeptide or moiety, e.g., albumin or PEG.
- a stable polypeptide or moiety e.g., albumin or PEG.
- compositions comprising antibodies or a cocktail thereof are administered to a patient not already in the disease state or in a pre-disease state to enhance the patient's resistance. Such an amount is defined to be a "prophylactic effective dose.”
- prophylactic effective dose the precise amounts again depend upon the patient' s state of health and general immunity, but generally range from 0.1 to 25 mg per dose, especially 0.5 to 2.5 mg per dose.
- a relatively low dosage is administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives.
- a relatively high dosage e.g., from about 1 to 400 mg/kg of binding molecule, e.g., antibody per dose, with dosages of from 5 to 25 mg being more commonly used for radioimmunoconjugates and higher doses for cytotoxin- drug conjugated molecules
- the patent can be administered a prophylactic regime.
- a subject can be treated with a nucleic acid molecule encoding an LT-specific antibody or immuno specific fragment thereof (e.g., in a vector).
- Doses for nucleic acids encoding polypeptides range from about 10 ng to 1 g, 100 ng to 100 mg, 1 ⁇ g to 10 mg, or 30-300 ⁇ g DNA per patient.
- Doses for infectious viral vectors vary from 10-100, or more, virions per dose.
- Therapeutic agents can be administered by parenteral, topical, intravenous, oral, subcutaneous, intraarterial, intracranial, intraperitoneal, intranasal or intramuscular means for prophylactic and/or therapeutic treatment.
- agents are injected directly into a particular tissue where LTbR-expressing cells have accumulated, for example intracranial injection. Intramuscular injection or intravenous infusion are preferred for administration of antibody.
- particular therapeutic antibodies are injected directly into the cranium.
- antibodies are administered as a sustained release composition or device, such as a MedipadTM device.
- LT binding molecules can optionally be administered in combination with other agents that are effective in treating the disorder or condition in need of treatment (e.g., prophylactic or therapeutic).
- LT-specific binding molecules of the present invention may be administered to a human or other animal in accordance with the aforementioned methods of treatment in an amount sufficient to produce a therapeutic or prophylactic effect.
- the LT-specific antibodies binding molecules of the present invention can be administered to such human or other animal in a conventional dosage form prepared by combining the antibody of the invention with a conventional pharmaceutically acceptable carrier or diluent according to known techniques. It will be recognized by one of skill in the art that the form and character of the pharmaceutically acceptable carrier or diluent is dictated by the amount of active ingredient with which it is to be combined, the route of administration and other well- known variables. Those skilled in the art will further appreciate that a cocktail comprising one or more species of binding molecules according to the present invention may prove to be particularly effective.
- mAbs Mouse monoclonal antibodies directed against a human lymphotoxin (LT) were prepared by injecting mice with LT ⁇ l ⁇ 2 present on beads. LT ⁇ l ⁇ 2 was linked to beads using art recognized techniques (using anti-myc antibody or via CnBr fixation to the bead surface).
- Total cellular RNA from murine hybridoma cells was prepared using a Qiagen RNeasy mini kit following the manufacturer's recommended protocol.
- cDNAs encoding the variable regions of the heavy and light chains were cloned by RT-PCR from total cellular RNA, using random hexamers for priming of first strand cDNA.
- a cocktail of degenerate forward primers hybridizing to multiple murine immunoglobulin gene family signal sequences and a single back primer specific for the 5' end of the murine constant domain was used Clontech Advantage 2 Polymerase mix following the manufacturer's recommended protocol.
- PCR products were gel- purified and subcloned into Invitrogen's pCR2. ITOPO vector using their TOPO cloning kit following the manufacturer's recommended protocol. Inserts from multiple independent subclones were sequenced to establish a consensus sequence. Deduced mature immunoglobulin N-termini were consistent with those determined by Edman degradation from the hybridoma.
- the A0D9 light chain is a murine subgroup V kappa light chain. Shown below is the DNA sequence of the mature light chain variable domain
- MRAPAQFFGFLLLWFPGIKC (SEQ ID NO : ) ) :
- the A1D5 heavy chain is a murine subgroup I(B) heavy chain.
- the A1D5 light chain is a murine subgroup V kappa light chain.
- Antibodies LTlOl (P1G4.4) and LT103 (P1G9.1) were found to be identical. Shown below is the LTlOl and LT103 mature heavy chain variable domain protein sequence, with CDRs underlined:
- the heavy chain of antibodies LTlOl and LT 103 are a murine subgroup H(B ) heavy chain.
- LT 102 P1G8.2 mature heavy chain variable domain protein sequence, with CDRs underlined:
- CTGTCTCTGC A (SEQ ID NO : ) Shown below is the LT102 mature light chain variable domain protein sequence, with CDRs underlined:
- the LT102 light chain is a murine subgroup II kappa light chain.
- the LT105 heavy chain is a murine subgroup I(A) heavy chain.
- the LT105 light chain is a murine subgroup III kappa light chain.
- METDTLLLWVLLLWVPGSTG (SEQ ID NO: )): 1 ATGGAGACAG ACACACTCCT GCTATGGGTG CTGCTGCTCT GGGTTCCAGG
- LT107 a murine subgroup I(B) heavy chain. Note the potential N-linked glycosylation site in FRl that is shown in bold above.
- the heavy chains of LT107 and LT108 are 93.4% identical at the protein level, and
- the heavy chain of antibody 9B4 is a murine subgroup I(B) heavy chain.
- the IL-8 release assay was used to determine the functional activity of the anti-LT antibodies described in Example 1.
- the IL-8 release assay is based on the secretion of IL-8, which is observed after soluble recombinant human lymphotoxin ⁇ l ⁇ 2 binds to cell surface lymphotoxin beta receptor on A375 cells (human melanoma cell line).
- the IL-8 release assay measures the ability of an antibody to block this IL-8 secretion by binding to soluble lymphotoxin ⁇ l ⁇ 2, preventing it from binding to the lymphotoxin beta receptor.
- the IL-8 that is secreted into the media supernatant is then measured with an ELISA assay.
- the antibody was diluted to the appropriate concentrations and incubated with soluble recombinant human lymphotoxin ⁇ l ⁇ 2 (170ng/ml) for 1 hour at room temperature in a 96- well microtiter plate.
- concentration of lymphotoxin ⁇ l ⁇ 2 was optimized by titration experiments that determined the maximum amount of IL-8 release.
- the mean fluorescence intensity is plotted versus antibody concentrations, and an IC50 is determined from a 4-parameter curve fit of the data.
- a number of mAbs identified had greater than 90% potency in an 11-23 assay, including LT105, 9B4 LT102, Al. D5, and A0D9.
- mAbs LT102 and LT105 had greater than 98% blockade in an 11-23 assay.
- LT102 and LT105 exhibited superior potency in an 11-23 blocking assay relative to anti-LT antibodies B9 (see US Patent No. 5,925,351), C37, and B27 (C37 and B27 are both described in Browning et al. (1995) J Immunol 154:33).
- a summary of the data are shown in Table 4:
- LT105, 9B4 and A1D5 also bound to LT from cynomolgus macaques (Macaca fascicularis) as did LT102 on a low plateau.
- a summary of the cross-reactivity assessment for some of the anti-LT mAbs is described below in Table 5. It is noteworthy that certain of the prior art antibodies did not bind to Cyno LT (e.g., B9).
- LT102, LT105, 9B4, LT9B4, LT107, A1D5, A0D9 all bound epitopes distinct from anti-LT antibodies B9, C37, and B27.
- LT102 bound cyno LT with a lower plateau relative to human LT.
- critical contact point(s) for LT102 were likely in the non- homologous region between cyno and human LT.
- variant forms of human LT ⁇ were designed in this region based on molecular modelling, including the following amino acid substitutions: D151R/Q153R; R193A/R194A; D151R/Q153R/ R193A/R194A; PLK(96, 97, 98)WMS; TTK(106, 107, 108)ASQ; TTK(106, 107, 108)AWQ; FA(231, 232) YR; T114R; DAE(121, 122, 123)PTH; and P172R.
- the results showed that LTBR-Fc (positive control) at concentrations of both
- Antibody LT 105 was found to bind to cyno LT but not murine LT. This result suggested that critical contact point(s) for LT105 were likely in the nonhomologous region between cyno and murine LT. Mutant forms of human LT were designed within this region (based on the likelihood of interacting with LTBR).
- Variant forms of human LT were designed based on molecular modelling, including the following amino acid substitutions: D151R/Q153R; R193A/R194A; D151R/Q153R/R193A/R194A; PLK(96, 97, 98)WMS; TTK(106, 107, 108)ASQ; TTK(106, 107, 108)AWQ; FA(231, 232) YR; T114R; DAE(121, 122, 123)PTH; and P172R.
- the results showed that LTBR-Fc (positive control) at concentrations of both
- LTa, D50N and Y108F mutations define the sides of the ⁇ / ⁇ clefts.
- LTB mutations that block LT105 binding align closely to the Y108F site.
- LT102, LT105, and B9 are murine anti-human LTalb2 (mlgGl) antibodies (BIIB, no cross to murine LT).
- BBF6 is a hamster anti-murine LTalb2 antibody (BIIB, no cross to human LT).
- Murine LTBR-mlgGl was used as a positive control for blockade of LT-LTBR interactions (shown to bind human LT with a ⁇ 2X lower affinity than for murine LT).
- MOPC-21 is a murine IgGl antibody used as an isotype control antibody.
- isotype control MOPC-21
- mLTBR-mlgGl positive control
- BBF6 B9
- LT102 LT102
- HISTOLOGICAL ANALYSES PNAd/MECA79 (HEV): Lymph node tissue was fixed in 10% neutral buffered formalin for 24 hours and stored in paraffin blocks. 3um sections were cut, deparaffinized and antigen retrival (Dako) was performed.
- Mayer's hematoxylin (Sigma) nuclear counterstain was the final step before slides were serially dehydrated in 95% and 100% alcohol and stored with Permount coverslips.
- Sialoadhesin/MOMA-1 lOum sections were cut from spleen tissue frozen in OCT with methylbutane and stored at -80oC. Slides were fixed in acetone, rehydrated in Ix TBS and endogenous peroxidase block and Fc block (BSA) were performed. Sections were stained with a rat anti-mouse MOMA-I FITC primary antibody (l:100)(Serotec). Anti- FITC-AP secondary antibody (Roche) was used prior to development with an AP Substrate Kit (Vector). Sections were covered using Crystal Mount and allowed to air dry at room temperature overnight.
- mice To investigate the functional activity of the anti-human LT ⁇ l ⁇ 2 mAbs, LT102 and LT105 with regard to the historical mAb, B9, NOD-scid IL2rynull mice engrafted with CD34+ human cord blood cells were used. These mice support the development of many components of a functional human immune system. In particular, chimeric mice have been successfully reconstituted and demonstrate MECA-79+ HEVs in peripheral lymph nodes and a sialoadhesin/MOMA-l+ ring of macrophages in the spleen. Such structures are LT-LT ⁇ R dependent and, thus, can be used as a readout of the activity of administered anti-LT antibodies
- High endothelial venules are specialized structures that assist cell entry into the lymph nodes. Developmement and maintenance of these structures have been shown to depend on LT ⁇ R expression. Histological analysis showed HEVs could be reduced with the blockade of human LT ⁇ l ⁇ 2. In the chimeric model, HEVs were similarly demonstrated to be present in wild type mice (C57BL/6) and huSCID mice injected with MOPC-21 ( Figures 3A,B), although in reduced frequency, but similarly depend on LTBR signaling as they were lost with LT ⁇ R- Ig treatment (huSCID mice injected with mLTBR-mlgGl) ( Figure 3C).
- Heavy chain 1 DVQLQESGPG LVKPSQSLSL TCSVTGYSIT SGY YWNWIRQF PGNKLEGMGY
- variable light chain is a member of murine subgroup Kappa 3 (89% identity in 111 amino acid overlap; CDR-L3 is 1 residue shorter than usual) and likely originated from murine mu21-5 germline (94% identity in 99 amino acid overlap), as shown below.
- variable heavy chain is a member of murine subgroup Heavy IA (81% identity in 117 amino acid overlap; CDR-Hl and CDR- H2 are each 1 residue shorter than usual) and likely originated from murine VH36-60 germline (81% identity in 97 amino acid overlap), as shown below.
- Y muVH3-60 1 EVQLQESGPSLVKPSQTLSLTCSVTGDSITSDY- WNWIRKFPGNKLEYMGYISYSGSTYY 59
- variable light chain corresponds to human subgroup Kappa 4 (67% identity in 111 amino acid overlap; CDR-Ll is 2 residues shorter than usual) and is the closest to human B3 germline (66% identity in 99 amino acid overlap), as shown below.
- variable heavy chain corresponds to human subgroup Heavy 2 (69% identity in 114 amino acid overlap; CDR-Hl is 1 residue shorter than usual; CDR-H2 is 3 residues shorter than usual) and is the closest to human VH4-28 germline (68% identity in 98 amino acid overlap), as shown below.
- Human germline sequence huL6 (with consensus human KV3 FR4) and human gil3004688 were selected from multiple candidates as the acceptor frameworks for light and heavy chains respectively (see sequences described below). Acceptor frameworks that were more distant from stable KV3 and HV3 consensus classes were chosen in order to improve the physico-chemical properties of humanized designs. >LT105L
- VLTQSPASLAVSLGQRAT I SCRASESVDNYGI SFMHWYQQKPGQPPKLLI YRASNLESGIPARFSGSGSG SRTDFTLTINPVETDDVATFYCQQSNKDPYTFGGGTKLEIK
- the three different versions of the humanized LT105 light chain are described below
- the humanized light chain of LT105 included: Germline huL6 framework // consensus human KV4 FR4 // LT105 L CDRs.
- Backmutations described below in Ll, L2, and L3 are in lowercase, bold font.
- CDRs, including Chothia definition, are underlined.
- the four different versions of the humanized LT 105 heavy chain are described below
- the humanized heavy chain of LT105 included: gil3004688 framework // LT105 H CDRs.
- Backmutations described below in Hl, H2, H3, and H4 are in lowercase, bold font.
- CDRs, including Chothia definition, are underlined.
- CDRs complementarity determining regions
- variable light and heavy chains were compared with the consensus (Kabat et al, 1991) and germline sequences (Matsuda et al, 1998, Brensing-Kuppers et al, 1997) for murine and human subgroups using BLAST program andto query a database comprising consensus and germline sequences. CDRs were excluded from the sequences for comparisons to germline.
- variable light chain of LT 102 is a member of murine subgroup Kappa 2 (94% identity in 112 amino acid overlap) and likely originated from murine mucrl germline (97% identity in 100 amino acid overlap).
- a comparison between the VL of LT102 and mucrl is shown below.
- variable heavy chain is a member of murine subgroup Heavy 3D (80% identity in 118 amino acid overlap) and likely originated from murine VH37.1 germline (86% identity in 98 amino acid overlap).
- a comparison between the VH of LT102 and VH37.1 is shown below.
- variable light chain corresponds to human subgroup Kappa 2 (77% identity in 112 amino acid overlap) and is the closest to human A3 germline (76% identity in 100 amino acid overlap).
- VL of LT 102 and huA3 A comparison of the VL of LT 102 and huA3 is shown below.
- variable heavy chain corresponds to human subgroup Heavy 3 (72% identity in 117 amino acid overlap) and is the closest to human VH3-21 germline (73% identity in 98 amino acid overlap).
- VH of LT102 and huVH3-21 A comparison of the VH of LT102 and huVH3-21 is shown below. >huVH3-21
- LT 102 For the humanization of LT 102, a model of the LT 102 variable regions was built based on the crystal structure PDB ID ICLZ for the light and heavy chains, using Modeler, SCWRL sidechain placement, and brief minimization in vacuum with the Gromos96 43bl parameter set. ICLZ has 1 extra residue in CDR-H3.
- Human germline sequence huA3 (with consensus HUMKV2 FR4) and human germline sequence huVH3-ll (with consensus HUMHV3 FR4) were selected from multiple candidates as the acceptor frameworks for light and heavy chains respectively. Sequences are described below.
- germline huA3 differs from LT102 L at 3 canonical residues (L 2, 27b, 51), and germline huVH3-
- variable light reshaped chain One version of the variable light reshaped chain was designed, and four versions of the variable heavy reshaped chain was designed, in addition to the light and heavy CDR graft sequences.
- the first version contains the fewest backmutations and the next versions contain more backmutations (i.e. they are the least
- the murine Al 13 was substituted by Sl 13 (present in human HV FR4) in all versions of the heavy chain, and was not analyzed as a backmutation. Numbering is according to the Kabat scheme.
- LT012 each included germline huVH3-ll framework, consensus human HV3 FR4, and LT102 H CDRs. Humanization designs for LTl 02
- the four different versions of the humanized LT 102 heavy chain are described below
- the humanized heavy chain of LT102 included: Germline huVH3-l 1 framework // consensus human HV3 FR4 // LT102 H CDRs.
- Backmutations described below in Hl, H2, H3, and H4 are in lowercase, bold font.
- CDRs, including Chothia definition, are underlined.
- L12 in combination with Hl also showed no precipitate at 100 mg/ml
- L13 in combination with Hl showed no precipitate at 48 mg/ml.
- Additional heavy chain versions were also made, including HIl and H14.
- Biacore chip preparation All experiments were performed using a Biacore 3000 instrument.
- the anti-Flag antibody M2 was immobilized on a CM5 sensorchip using the Biacore Amine Coupling kit according to manufacturer's instructions. Briefly, antibody was diluted to 50 ⁇ g/ml in 10 mM acetate, pH 5.0 and 30 ⁇ l was injected over chip surfaces that had been activated with a 30 ⁇ l injection of 1:1 N-hydroxsuccinimide (NHS): l-Ethyl-3(3- dimethylaminopropyl)-carbodiimide hydrochloride (EDC). Excess free amine groups were then capped with a 50 ⁇ l injection of 1 M Ethanolamine.
- NHS N-hydroxsuccinimide
- EDC l-Ethyl-3(3- dimethylaminopropyl)-carbodiimide hydrochloride
- Typical immobilization level was 4000- 6000 RU. All samples were prepared in assay buffer (10 mM HEPES pH 7.0 + 150 mM NaCl + 0.05% detergent p-20 + 0.05% BSA). This same buffer was used as the running buffer during sample analysis. For immobilizations this same buffer without BSA was used. Biacore binding assays. Soluble Flag-tagged LTocl ⁇ 2 was diluted in assay buffer to 200 nM and injected over the M2 derivatized surface, or an underivatized surface as a background control, at a flow rate of 25 ⁇ l/min. The surface was allowed to stabilize for 2 minutes while buffer flowed over the surface at 25 ⁇ l/min. A saturating concentration of competitor (i.e. 8 ⁇ M LT ⁇ R-Ig, 2 ⁇ M antibody LT105, 4 ⁇ M antibody B9, 4 ⁇ M antibody LT102 or 2 ⁇ M antibody
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Public Health (AREA)
- Engineering & Computer Science (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- General Chemical & Material Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Diabetes (AREA)
- Gastroenterology & Hepatology (AREA)
- Rheumatology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Urology & Nephrology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Pain & Pain Management (AREA)
- Biomedical Technology (AREA)
- Dermatology (AREA)
- Heart & Thoracic Surgery (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Physical Education & Sports Medicine (AREA)
- Cardiology (AREA)
- Vascular Medicine (AREA)
- Obesity (AREA)
- Hematology (AREA)
- Endocrinology (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN2009801577460A CN102341411A (zh) | 2008-12-31 | 2009-12-31 | 抗-淋巴细胞毒素抗体 |
| US13/141,297 US20120003235A1 (en) | 2008-12-31 | 2009-12-31 | Anti-lymphotoxin antibodies |
| AU2009334498A AU2009334498A1 (en) | 2008-12-31 | 2009-12-31 | Anti-lymphotoxin antibodies |
| CA2748757A CA2748757A1 (en) | 2008-12-31 | 2009-12-31 | Anti-lymphotoxin antibodies |
| EP09796593A EP2382238A1 (en) | 2008-12-31 | 2009-12-31 | Anti-lymphotoxin antibodies |
| JP2011544632A JP2012514458A (ja) | 2008-12-31 | 2009-12-31 | 抗リンホトキシン抗体 |
| US13/830,500 US20140079716A1 (en) | 2008-12-31 | 2013-03-14 | Anti-lymphotoxin antibodies |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US14218208P | 2008-12-31 | 2008-12-31 | |
| US61/142,182 | 2008-12-31 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/141,297 A-371-Of-International US20120003235A1 (en) | 2008-12-31 | 2009-12-31 | Anti-lymphotoxin antibodies |
| US13/830,500 Continuation US20140079716A1 (en) | 2008-12-31 | 2013-03-14 | Anti-lymphotoxin antibodies |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2010078526A1 true WO2010078526A1 (en) | 2010-07-08 |
Family
ID=42077903
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2009/069967 Ceased WO2010078526A1 (en) | 2008-12-31 | 2009-12-31 | Anti-lymphotoxin antibodies |
Country Status (7)
| Country | Link |
|---|---|
| US (2) | US20120003235A1 (https=) |
| EP (1) | EP2382238A1 (https=) |
| JP (1) | JP2012514458A (https=) |
| CN (1) | CN102341411A (https=) |
| AU (1) | AU2009334498A1 (https=) |
| CA (1) | CA2748757A1 (https=) |
| WO (1) | WO2010078526A1 (https=) |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013006490A3 (en) * | 2011-07-01 | 2014-05-08 | Cellerant Therapeutics, Inc. | Antibodies that specifically bind to tim3 |
| WO2015127140A2 (en) | 2014-02-19 | 2015-08-27 | Jody Berry | Marburg monoclonal antibodies |
| WO2018013797A1 (en) | 2016-07-13 | 2018-01-18 | President And Fellows Of Harvard College | Antigen-presenting cell-mimetic scaffolds and methods for making and using the same |
| WO2018089305A1 (en) * | 2016-11-08 | 2018-05-17 | University Of Miami | Anti-secretogranin iii (scg3) antibodies and uses thereof |
| EP3763388A1 (en) * | 2011-02-18 | 2021-01-13 | AbbVie Stemcentrx LLC | Novel modulators and methods of use |
| WO2023076511A1 (en) | 2021-10-28 | 2023-05-04 | Lyell Immunopharma, Inc. | Methods of generating cells |
| WO2024077174A1 (en) | 2022-10-05 | 2024-04-11 | Lyell Immunopharma, Inc. | Methods for culturing nr4a-deficient cells |
| WO2025217398A1 (en) | 2024-04-10 | 2025-10-16 | Lyell Immunopharma, Inc. | Methods for culturing cells with improved culture medium |
| WO2026006604A1 (en) | 2024-06-26 | 2026-01-02 | Lyell Immunopharma, Inc. | Feeder cell replacement |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014110243A1 (en) * | 2013-01-09 | 2014-07-17 | The Regents Of The University Of Colorado, A Body Corporate | Method for treating pulmonary hypertension |
| US10759859B2 (en) | 2016-01-14 | 2020-09-01 | Bps Bioscience, Inc. | Anti-PD-1 antibodies and uses thereof |
Citations (148)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4444887A (en) | 1979-12-10 | 1984-04-24 | Sloan-Kettering Institute | Process for making human antibody producing B-lymphocytes |
| US4474893A (en) | 1981-07-01 | 1984-10-02 | The University of Texas System Cancer Center | Recombinant monoclonal antibodies |
| EP0125023A1 (en) | 1983-04-08 | 1984-11-14 | Genentech, Inc. | Recombinant immunoglobulin preparations, methods for their preparation, DNA sequences, expression vectors and recombinant host cells therefor |
| EP0171496A2 (en) | 1984-08-15 | 1986-02-19 | Research Development Corporation of Japan | Process for the production of a chimera monoclonal antibody |
| EP0173494A2 (en) | 1984-08-27 | 1986-03-05 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric receptors by DNA splicing and expression |
| WO1986001533A1 (en) | 1984-09-03 | 1986-03-13 | Celltech Limited | Production of chimeric antibodies |
| EP0184187A2 (en) | 1984-12-04 | 1986-06-11 | Teijin Limited | Mouse-human chimaeric immunoglobulin heavy chain, and chimaeric DNA encoding it |
| WO1986005807A1 (en) | 1985-04-01 | 1986-10-09 | Celltech Limited | Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| US4694778A (en) | 1984-05-04 | 1987-09-22 | Anicon, Inc. | Chemical vapor deposition wafer boat |
| EP0239400A2 (en) | 1986-03-27 | 1987-09-30 | Medical Research Council | Recombinant antibodies and methods for their production |
| US4714681A (en) | 1981-07-01 | 1987-12-22 | The Board Of Reagents, The University Of Texas System Cancer Center | Quadroma cells and trioma cells and methods for the production of same |
| US4716111A (en) | 1982-08-11 | 1987-12-29 | Trustees Of Boston University | Process for producing human antibodies |
| US4741900A (en) | 1982-11-16 | 1988-05-03 | Cytogen Corporation | Antibody-metal ion complexes |
| WO1988007089A1 (en) | 1987-03-18 | 1988-09-22 | Medical Research Council | Altered antibodies |
| WO1989001036A1 (en) | 1987-07-23 | 1989-02-09 | Celltech Limited | Recombinant dna expression vectors |
| US4816397A (en) | 1983-03-25 | 1989-03-28 | Celltech, Limited | Multichain polypeptides or proteins and processes for their production |
| WO1989002922A1 (en) | 1987-10-02 | 1989-04-06 | Genentech, Inc. | Adheson variants |
| US4831175A (en) | 1986-09-05 | 1989-05-16 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Backbone polysubstituted chelates for forming a metal chelate-protein conjugate |
| EP0335263A2 (en) * | 1988-03-29 | 1989-10-04 | Takeda Chemical Industries, Ltd. | Anti-human lymphotoxin monoclonal antibody, hybridoma for production thereof, anti-human lymphotoxin-C-terminal peptide antibody and method for detecting human lymphotoxin thereby |
| WO1989012624A2 (en) | 1988-06-14 | 1989-12-28 | Cetus Corporation | Coupling agents and sterically hindered disulfide linked conjugates prepared therefrom |
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| US4925648A (en) | 1988-07-29 | 1990-05-15 | Immunomedics, Inc. | Detection and treatment of infectious and inflammatory lesions |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| EP0396387A2 (en) | 1989-05-05 | 1990-11-07 | Research Development Foundation | A novel antibody delivery system for biological response modifiers |
| WO1991000360A1 (en) | 1989-06-29 | 1991-01-10 | Medarex, Inc. | Bispecific reagents for aids therapy |
| WO1991009967A1 (en) | 1989-12-21 | 1991-07-11 | Celltech Limited | Humanised antibodies |
| WO1991010737A1 (en) | 1990-01-11 | 1991-07-25 | Molecular Affinities Corporation | Production of antibodies using gene libraries |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| WO1991014438A1 (en) | 1990-03-20 | 1991-10-03 | The Trustees Of Columbia University In The City Of New York | Chimeric antibodies with receptor binding ligands in place of their constant region |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5099069A (en) | 1986-09-05 | 1992-03-24 | Gansow Otto A | Backbone polysubstituted chelates for forming a metal chelate-protein conjugate |
| WO1992005793A1 (en) | 1990-10-05 | 1992-04-16 | Medarex, Inc. | Targeted immunostimulation with bispecific reagents |
| US5116964A (en) | 1989-02-23 | 1992-05-26 | Genentech, Inc. | Hybrid immunoglobulins |
| WO1992008802A1 (en) | 1990-10-29 | 1992-05-29 | Cetus Oncology Corporation | Bispecific antibodies, method of production, and uses thereof |
| WO1992008495A1 (en) | 1990-11-09 | 1992-05-29 | Abbott Biotech, Inc. | Cytokine immunoconjugates |
| US5122464A (en) | 1986-01-23 | 1992-06-16 | Celltech Limited, A British Company | Method for dominant selection in eucaryotic cells |
| US5124471A (en) | 1990-03-26 | 1992-06-23 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Bifunctional dtpa-type ligand |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| WO1992022324A1 (en) | 1991-06-14 | 1992-12-23 | Xoma Corporation | Microbially-produced antibody fragments and their conjugates |
| WO1993011236A1 (en) | 1991-12-02 | 1993-06-10 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5225538A (en) | 1989-02-23 | 1993-07-06 | Genentech, Inc. | Lymphocyte homing receptor/immunoglobulin fusion proteins |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| WO1993017715A1 (en) | 1992-03-05 | 1993-09-16 | Board Of Regents, The University Of Texas System | Diagnostic and/or therapeutic agents, targeted to neovascular endothelial cells |
| US5246692A (en) | 1986-09-05 | 1993-09-21 | The United States Of America As Represented By The Secretary Of Health And Human Services | Backbone polysubstituted chelates for forming a metal chelate-protein conjugate |
| US5258498A (en) | 1987-05-21 | 1993-11-02 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
| EP0368684B1 (en) | 1988-11-11 | 1994-03-09 | Medical Research Council | Cloning immunoglobulin variable domain sequences. |
| EP0592106A1 (en) | 1992-09-09 | 1994-04-13 | Immunogen Inc | Resurfacing of rodent antibodies |
| WO1994009817A1 (en) | 1992-11-04 | 1994-05-11 | City Of Hope | Novel antibody construct |
| US5314995A (en) | 1990-01-22 | 1994-05-24 | Oncogen | Therapeutic interleukin-2-antibody based fusion proteins |
| US5413923A (en) | 1989-07-25 | 1995-05-09 | Cell Genesys, Inc. | Homologous recombination for universal donor cells and chimeric mammalian hosts |
| WO1995015982A2 (en) | 1993-12-08 | 1995-06-15 | Genzyme Corporation | Process for generating specific antibodies |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1995020401A1 (en) | 1994-01-31 | 1995-08-03 | Trustees Of Boston University | Polyclonal antibody libraries |
| US5516637A (en) | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
| WO1996014339A1 (en) | 1994-11-05 | 1996-05-17 | The Wellcome Foundation Limited | Antibodies |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| WO1996033735A1 (en) | 1995-04-27 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5573920A (en) | 1991-04-26 | 1996-11-12 | Surface Active Limited | Antibodies, and methods for their use |
| US5589369A (en) | 1992-02-11 | 1996-12-31 | Cell Genesys Inc. | Cells homozygous for disrupted target loci |
| US5591669A (en) | 1988-12-05 | 1997-01-07 | Genpharm International, Inc. | Transgenic mice depleted in a mature lymphocytic cell-type |
| US5601819A (en) | 1988-08-11 | 1997-02-11 | The General Hospital Corporation | Bispecific antibodies for selective immune regulation and for selective immune cell binding |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5658570A (en) | 1991-07-25 | 1997-08-19 | Idec Pharmaceuticals Corporation | Recombinant antibodies for human therapy |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5698426A (en) | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
| WO1998005787A1 (en) | 1996-08-02 | 1998-02-12 | Bristol-Myers Squibb Company | A method for inhibiting immunoglobulin-induced toxicity resulting from the use of immunoglobulins in therapy and in vivo diagnosis |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5736137A (en) | 1992-11-13 | 1998-04-07 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human B lymphocyte restricted differentiation antigen for treatment of B cell lymphoma |
| US5739277A (en) | 1995-04-14 | 1998-04-14 | Genentech Inc. | Altered polypeptides with increased half-life |
| WO1998016654A1 (en) | 1996-10-11 | 1998-04-23 | Japan Tobacco, Inc. | Production of a multimeric protein by cell fusion method |
| US5750753A (en) | 1996-01-24 | 1998-05-12 | Chisso Corporation | Method for manufacturing acryloxypropysilane |
| US5756096A (en) | 1991-07-25 | 1998-05-26 | Idec Pharmaceuticals Corporation | Recombinant antibodies for human therapy |
| WO1998023289A1 (en) | 1996-11-27 | 1998-06-04 | The General Hospital Corporation | MODULATION OF IgG BINDING TO FcRn |
| WO1998024893A2 (en) | 1996-12-03 | 1998-06-11 | Abgenix, Inc. | TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM |
| US5780225A (en) | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
| US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
| US5811524A (en) | 1995-06-07 | 1998-09-22 | Idec Pharmaceuticals Corporation | Neutralizing high affinity human monoclonal antibodies specific to RSV F-protein and methods for their manufacture and therapeutic use thereof |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5821047A (en) | 1990-12-03 | 1998-10-13 | Genentech, Inc. | Monovalent phage display |
| WO1998046645A2 (en) | 1997-04-14 | 1998-10-22 | Micromet Gesellschaft Für Biomedizinische Forschung Mbh | Method for the production of antihuman antigen receptors and uses thereof |
| US5834250A (en) | 1988-10-28 | 1998-11-10 | Genentech, Inc. | Method for identifying active domains and amino acid residues in polypeptides and hormone variants |
| WO1998050433A2 (en) | 1997-05-05 | 1998-11-12 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
| WO1998052976A1 (en) | 1997-05-21 | 1998-11-26 | Biovation Limited | Method for the production of non-immunogenic proteins |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5892019A (en) | 1987-07-15 | 1999-04-06 | The United States Of America, As Represented By The Department Of Health And Human Services | Production of a single-gene-encoded immunoglobulin |
| US5925351A (en) | 1995-07-21 | 1999-07-20 | Biogen, Inc. | Soluble lymphotoxin-β receptors and anti-lymphotoxin receptor and ligand antibodies as therapeutic agents for the treatment of immunological disease |
| WO1999051642A1 (en) | 1998-04-02 | 1999-10-14 | Genentech, Inc. | Antibody variants and fragments thereof |
| WO1999058572A1 (en) | 1998-05-08 | 1999-11-18 | Cambridge University Technical Services Limited | Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis |
| US6005079A (en) | 1992-08-21 | 1999-12-21 | Vrije Universiteit Brussels | Immunoglobulins devoid of light chains |
| WO2000009560A2 (en) | 1998-08-17 | 2000-02-24 | Abgenix, Inc. | Generation of modified molecules with increased serum half-lives |
| WO2000032767A1 (en) | 1998-12-03 | 2000-06-08 | MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. | RECOMBINANT SOLUBLE Fc RECEPTORS |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO2000034317A2 (en) | 1998-12-08 | 2000-06-15 | Biovation Limited | Method for reducing immunogenicity of proteins |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6096871A (en) | 1995-04-14 | 2000-08-01 | Genentech, Inc. | Polypeptides altered to contain an epitope from the Fc region of an IgG molecule for increased half-life |
| WO2000044788A1 (en) | 1999-01-28 | 2000-08-03 | Idec Pharmaceuticals Corporation | Production of tetravalent antibodies |
| US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6159730A (en) | 1992-11-13 | 2000-12-12 | Idec Pharmaceutical Corporation | Impaired dominant selectable marker sequence and intronic insertion strategies for enhancement of expression of gene product and expression vector systems comprising same |
| US6190370B1 (en) | 1997-07-25 | 2001-02-20 | Arrow International, Inc. | Devices, systems and methods for determining proper placement of epidural catheters |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| US6193980B1 (en) | 1995-12-06 | 2001-02-27 | Cambridge University Technical Services, Limited | Replication defective herpes simplex virus comprising heterologous inserts |
| US6242195B1 (en) | 1998-04-02 | 2001-06-05 | Genentech, Inc. | Methods for determining binding of an analyte to a receptor |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| WO2002044215A2 (en) | 2000-12-01 | 2002-06-06 | Cockbain, Julian | Hybrid antibodies |
| US6407213B1 (en) | 1991-06-14 | 2002-06-18 | Genentech, Inc. | Method for making humanized antibodies |
| US6413777B1 (en) | 1997-03-14 | 2002-07-02 | Idec Pharmaceuticals Corp. | Method for integrating genes at specific sites in mammalian cells via homologous recombination and vectors for accomplishing the same |
| US6420140B1 (en) | 1996-10-11 | 2002-07-16 | Abgenix, Inc. | Production of multimeric protein by cell fusion method |
| US20020102208A1 (en) | 1999-03-01 | 2002-08-01 | Paul Chinn | Radiolabeling kit and binding assay |
| WO2002060919A2 (en) | 2000-12-12 | 2002-08-08 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
| WO2002060955A2 (en) | 2001-01-29 | 2002-08-08 | Idec Pharmaceuticals Corporation | Modified antibodies and methods of use |
| US20020123057A1 (en) | 2000-11-17 | 2002-09-05 | University Of Rochester | In vitro methods of producing and identifying immunoglobulin molecules in eukaryotic cells |
| US6458592B1 (en) | 1995-03-29 | 2002-10-01 | Abgenix, Inc. | Production of antibodies using cre-mediated site-specific recombination |
| WO2002096948A2 (en) | 2001-01-29 | 2002-12-05 | Idec Pharmaceuticals Corporation | Engineered tetravalent antibodies and methods of use |
| US6528624B1 (en) | 1998-04-02 | 2003-03-04 | Genentech, Inc. | Polypeptide variants |
| US20030157641A1 (en) | 2001-11-16 | 2003-08-21 | Idec Pharmaceuticals Corporation | Polycistronic expression of antibodies |
| WO2003074569A2 (en) | 2002-03-01 | 2003-09-12 | Immunomedics, Inc. | Bispecific antibody point mutations for enhancing rate of clearance |
| US20030207346A1 (en) | 1997-05-02 | 2003-11-06 | William R. Arathoon | Method for making multispecific antibodies having heteromultimeric and common components |
| WO2004002431A2 (en) * | 2002-07-01 | 2004-01-08 | Biogen, Inc. | Humanized anti-lymphotoyin beta receptor antibodies |
| WO2004016750A2 (en) | 2002-08-14 | 2004-02-26 | Macrogenics, Inc. | FcϜRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF |
| WO2004029207A2 (en) | 2002-09-27 | 2004-04-08 | Xencor Inc. | Optimized fc variants and methods for their generation |
| WO2004035752A2 (en) | 2002-10-15 | 2004-04-29 | Protein Design Labs, Inc. | ALTERATION OF FcRn BINDING AFFINITIES OR SERUM HALF-LIVES OF ANTIBODIES BY MUTAGENESIS |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6765087B1 (en) | 1992-08-21 | 2004-07-20 | Vrije Universiteit Brussel | Immunoglobulins devoid of light chains |
| WO2004063351A2 (en) | 2003-01-09 | 2004-07-29 | Macrogenics, Inc. | IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME |
| WO2004074455A2 (en) | 2003-02-20 | 2004-09-02 | Applied Molecular Evolution | Fc REGION VARIANTS |
| WO2004099249A2 (en) | 2003-05-02 | 2004-11-18 | Xencor, Inc. | Optimized fc variants and methods for their generation |
| WO2005018572A2 (en) | 2003-08-22 | 2005-03-03 | Biogen Idec Ma Inc. | Improved antibodies having altered effector function and methods for making the same |
| WO2005040217A2 (en) | 2003-10-17 | 2005-05-06 | Cambridge University Technical Services Limited | Antibodies having a mutated amino acid residue at position 268 (ch2 region) in constant regions |
| WO2005047327A2 (en) | 2003-11-12 | 2005-05-26 | Biogen Idec Ma Inc. | NEONATAL Fc RECEPTOR (FcRn)-BINDING POLYPEPTIDE VARIANTS, DIMERIC Fc BINDING PROTEINS AND METHODS RELATED THERETO |
| WO2005070963A1 (en) | 2004-01-12 | 2005-08-04 | Applied Molecular Evolution, Inc | Fc region variants |
| WO2005077981A2 (en) | 2003-12-22 | 2005-08-25 | Xencor, Inc. | Fc POLYPEPTIDES WITH NOVEL Fc LIGAND BINDING SITES |
| WO2005092925A2 (en) | 2004-03-24 | 2005-10-06 | Xencor, Inc. | Immunoglobulin variants outside the fc region |
| WO2005123780A2 (en) | 2004-04-09 | 2005-12-29 | Protein Design Labs, Inc. | Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis |
| WO2006019447A1 (en) | 2004-07-15 | 2006-02-23 | Xencor, Inc. | Optimized fc variants |
| WO2006047350A2 (en) | 2004-10-21 | 2006-05-04 | Xencor, Inc. | IgG IMMUNOGLOBULIN VARIANTS WITH OPTIMIZED EFFECTOR FUNCTION |
| WO2006085967A2 (en) | 2004-07-09 | 2006-08-17 | Xencor, Inc. | OPTIMIZED ANTI-CD20 MONOCONAL ANTIBODIES HAVING Fc VARIANTS |
| WO2007024715A2 (en) | 2005-08-19 | 2007-03-01 | Abbott Laboratories | Dual variable domain immunoglobin and uses thereof |
| US8602269B2 (en) | 2009-09-14 | 2013-12-10 | Guala Dispensing S.P.A. | Trigger sprayer |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6312691B1 (en) * | 1996-01-26 | 2001-11-06 | Jeffrey L. Browning | Lymphotoxin-α/β complexes and anti-lympotoxin-β receptor antibodies as anti-tumor agents |
| CA2467633C (en) * | 2001-12-03 | 2012-03-27 | Abgenix, Inc. | Antibody categorization based on binding characteristics |
| AR038568A1 (es) * | 2002-02-20 | 2005-01-19 | Hoffmann La Roche | Anticuerpos anti-a beta y su uso |
| HN2004000285A (es) * | 2003-08-04 | 2006-04-27 | Pfizer Prod Inc | ANTICUERPOS DIRIGIDOS A c-MET |
| US20050282233A1 (en) * | 2004-03-05 | 2005-12-22 | Ludwig Institute For Cancer Research | Multivalent antibody materials and methods for VEGF/PDGF family of growth factors |
-
2009
- 2009-12-31 JP JP2011544632A patent/JP2012514458A/ja active Pending
- 2009-12-31 AU AU2009334498A patent/AU2009334498A1/en not_active Abandoned
- 2009-12-31 CN CN2009801577460A patent/CN102341411A/zh active Pending
- 2009-12-31 WO PCT/US2009/069967 patent/WO2010078526A1/en not_active Ceased
- 2009-12-31 US US13/141,297 patent/US20120003235A1/en not_active Abandoned
- 2009-12-31 CA CA2748757A patent/CA2748757A1/en not_active Abandoned
- 2009-12-31 EP EP09796593A patent/EP2382238A1/en not_active Withdrawn
-
2013
- 2013-03-14 US US13/830,500 patent/US20140079716A1/en not_active Abandoned
Patent Citations (174)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4444887A (en) | 1979-12-10 | 1984-04-24 | Sloan-Kettering Institute | Process for making human antibody producing B-lymphocytes |
| US4474893A (en) | 1981-07-01 | 1984-10-02 | The University of Texas System Cancer Center | Recombinant monoclonal antibodies |
| US4714681A (en) | 1981-07-01 | 1987-12-22 | The Board Of Reagents, The University Of Texas System Cancer Center | Quadroma cells and trioma cells and methods for the production of same |
| US4716111A (en) | 1982-08-11 | 1987-12-29 | Trustees Of Boston University | Process for producing human antibodies |
| US4741900A (en) | 1982-11-16 | 1988-05-03 | Cytogen Corporation | Antibody-metal ion complexes |
| US4816397A (en) | 1983-03-25 | 1989-03-28 | Celltech, Limited | Multichain polypeptides or proteins and processes for their production |
| EP0125023A1 (en) | 1983-04-08 | 1984-11-14 | Genentech, Inc. | Recombinant immunoglobulin preparations, methods for their preparation, DNA sequences, expression vectors and recombinant host cells therefor |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4694778A (en) | 1984-05-04 | 1987-09-22 | Anicon, Inc. | Chemical vapor deposition wafer boat |
| EP0171496A2 (en) | 1984-08-15 | 1986-02-19 | Research Development Corporation of Japan | Process for the production of a chimera monoclonal antibody |
| US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
| EP0173494A2 (en) | 1984-08-27 | 1986-03-05 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric receptors by DNA splicing and expression |
| WO1986001533A1 (en) | 1984-09-03 | 1986-03-13 | Celltech Limited | Production of chimeric antibodies |
| EP0184187A2 (en) | 1984-12-04 | 1986-06-11 | Teijin Limited | Mouse-human chimaeric immunoglobulin heavy chain, and chimaeric DNA encoding it |
| WO1986005807A1 (en) | 1985-04-01 | 1986-10-09 | Celltech Limited | Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same |
| US5122464A (en) | 1986-01-23 | 1992-06-16 | Celltech Limited, A British Company | Method for dominant selection in eucaryotic cells |
| US4683195B1 (https=) | 1986-01-30 | 1990-11-27 | Cetus Corp | |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| EP0239400A2 (en) | 1986-03-27 | 1987-09-30 | Medical Research Council | Recombinant antibodies and methods for their production |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US4831175A (en) | 1986-09-05 | 1989-05-16 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Backbone polysubstituted chelates for forming a metal chelate-protein conjugate |
| US5099069A (en) | 1986-09-05 | 1992-03-24 | Gansow Otto A | Backbone polysubstituted chelates for forming a metal chelate-protein conjugate |
| US5246692A (en) | 1986-09-05 | 1993-09-21 | The United States Of America As Represented By The Secretary Of Health And Human Services | Backbone polysubstituted chelates for forming a metal chelate-protein conjugate |
| WO1988007089A1 (en) | 1987-03-18 | 1988-09-22 | Medical Research Council | Altered antibodies |
| US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
| US5258498A (en) | 1987-05-21 | 1993-11-02 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
| US5892019A (en) | 1987-07-15 | 1999-04-06 | The United States Of America, As Represented By The Department Of Health And Human Services | Production of a single-gene-encoded immunoglobulin |
| WO1989001036A1 (en) | 1987-07-23 | 1989-02-09 | Celltech Limited | Recombinant dna expression vectors |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| WO1989002922A1 (en) | 1987-10-02 | 1989-04-06 | Genentech, Inc. | Adheson variants |
| EP0314317A1 (en) | 1987-10-02 | 1989-05-03 | Genentech, Inc. | Adheson variants, nucleic acid encoding them and compositions comprising them |
| EP0335263A2 (en) * | 1988-03-29 | 1989-10-04 | Takeda Chemical Industries, Ltd. | Anti-human lymphotoxin monoclonal antibody, hybridoma for production thereof, anti-human lymphotoxin-C-terminal peptide antibody and method for detecting human lymphotoxin thereby |
| WO1989012624A2 (en) | 1988-06-14 | 1989-12-28 | Cetus Corporation | Coupling agents and sterically hindered disulfide linked conjugates prepared therefrom |
| US4925648A (en) | 1988-07-29 | 1990-05-15 | Immunomedics, Inc. | Detection and treatment of infectious and inflammatory lesions |
| US5601819A (en) | 1988-08-11 | 1997-02-11 | The General Hospital Corporation | Bispecific antibodies for selective immune regulation and for selective immune cell binding |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5403484A (en) | 1988-09-02 | 1995-04-04 | Protein Engineering Corporation | Viruses expressing chimeric binding proteins |
| US5571698A (en) | 1988-09-02 | 1996-11-05 | Protein Engineering Corporation | Directed evolution of novel binding proteins |
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| US5834250A (en) | 1988-10-28 | 1998-11-10 | Genentech, Inc. | Method for identifying active domains and amino acid residues in polypeptides and hormone variants |
| EP0368684B1 (en) | 1988-11-11 | 1994-03-09 | Medical Research Council | Cloning immunoglobulin variable domain sequences. |
| US5591669A (en) | 1988-12-05 | 1997-01-07 | Genpharm International, Inc. | Transgenic mice depleted in a mature lymphocytic cell-type |
| US6180370B1 (en) | 1988-12-28 | 2001-01-30 | Protein Design Labs, Inc. | Humanized immunoglobulins and methods of making the same |
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693761A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Polynucleotides encoding improved humanized immunoglobulins |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5116964A (en) | 1989-02-23 | 1992-05-26 | Genentech, Inc. | Hybrid immunoglobulins |
| US5225538A (en) | 1989-02-23 | 1993-07-06 | Genentech, Inc. | Lymphocyte homing receptor/immunoglobulin fusion proteins |
| EP0396387A2 (en) | 1989-05-05 | 1990-11-07 | Research Development Foundation | A novel antibody delivery system for biological response modifiers |
| WO1991000360A1 (en) | 1989-06-29 | 1991-01-10 | Medarex, Inc. | Bispecific reagents for aids therapy |
| US5413923A (en) | 1989-07-25 | 1995-05-09 | Cell Genesys, Inc. | Homologous recombination for universal donor cells and chimeric mammalian hosts |
| WO1991009967A1 (en) | 1989-12-21 | 1991-07-11 | Celltech Limited | Humanised antibodies |
| WO1991010737A1 (en) | 1990-01-11 | 1991-07-25 | Molecular Affinities Corporation | Production of antibodies using gene libraries |
| US5780225A (en) | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| US5939598A (en) | 1990-01-12 | 1999-08-17 | Abgenix, Inc. | Method of making transgenic mice lacking endogenous heavy chains |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5314995A (en) | 1990-01-22 | 1994-05-24 | Oncogen | Therapeutic interleukin-2-antibody based fusion proteins |
| WO1991014438A1 (en) | 1990-03-20 | 1991-10-03 | The Trustees Of Columbia University In The City Of New York | Chimeric antibodies with receptor binding ligands in place of their constant region |
| US5124471A (en) | 1990-03-26 | 1992-06-23 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Bifunctional dtpa-type ligand |
| US5286850A (en) | 1990-03-26 | 1994-02-15 | The United States Of America As Represented By The Department Of Health And Human Services | Antibody DTPA-type ligand conjugates |
| US5434287A (en) | 1990-03-26 | 1995-07-18 | The United States Of America As Represented By The Department Of Health And Human Services | Bifunctional DTPA-type ligand |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5698426A (en) | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
| WO1992005793A1 (en) | 1990-10-05 | 1992-04-16 | Medarex, Inc. | Targeted immunostimulation with bispecific reagents |
| WO1992008802A1 (en) | 1990-10-29 | 1992-05-29 | Cetus Oncology Corporation | Bispecific antibodies, method of production, and uses thereof |
| WO1992008495A1 (en) | 1990-11-09 | 1992-05-29 | Abbott Biotech, Inc. | Cytokine immunoconjugates |
| US5821047A (en) | 1990-12-03 | 1998-10-13 | Genentech, Inc. | Monovalent phage display |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| US5658727A (en) | 1991-04-10 | 1997-08-19 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| US5573920A (en) | 1991-04-26 | 1996-11-12 | Surface Active Limited | Antibodies, and methods for their use |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| WO1992022324A1 (en) | 1991-06-14 | 1992-12-23 | Xoma Corporation | Microbially-produced antibody fragments and their conjugates |
| US6407213B1 (en) | 1991-06-14 | 2002-06-18 | Genentech, Inc. | Method for making humanized antibodies |
| US5658570A (en) | 1991-07-25 | 1997-08-19 | Idec Pharmaceuticals Corporation | Recombinant antibodies for human therapy |
| US5756096A (en) | 1991-07-25 | 1998-05-26 | Idec Pharmaceuticals Corporation | Recombinant antibodies for human therapy |
| US5693780A (en) | 1991-07-25 | 1997-12-02 | Idec Pharmaceuticals Corporation | Recombinant antibodies for human therapy |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| WO1993011236A1 (en) | 1991-12-02 | 1993-06-10 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5589369A (en) | 1992-02-11 | 1996-12-31 | Cell Genesys Inc. | Cells homozygous for disrupted target loci |
| WO1993017715A1 (en) | 1992-03-05 | 1993-09-16 | Board Of Regents, The University Of Texas System | Diagnostic and/or therapeutic agents, targeted to neovascular endothelial cells |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US6765087B1 (en) | 1992-08-21 | 2004-07-20 | Vrije Universiteit Brussel | Immunoglobulins devoid of light chains |
| US6005079A (en) | 1992-08-21 | 1999-12-21 | Vrije Universiteit Brussels | Immunoglobulins devoid of light chains |
| EP0592106A1 (en) | 1992-09-09 | 1994-04-13 | Immunogen Inc | Resurfacing of rodent antibodies |
| US5837821A (en) | 1992-11-04 | 1998-11-17 | City Of Hope | Antibody construct |
| WO1994009817A1 (en) | 1992-11-04 | 1994-05-11 | City Of Hope | Novel antibody construct |
| US6159730A (en) | 1992-11-13 | 2000-12-12 | Idec Pharmaceutical Corporation | Impaired dominant selectable marker sequence and intronic insertion strategies for enhancement of expression of gene product and expression vector systems comprising same |
| US5736137A (en) | 1992-11-13 | 1998-04-07 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human B lymphocyte restricted differentiation antigen for treatment of B cell lymphoma |
| WO1995015982A2 (en) | 1993-12-08 | 1995-06-15 | Genzyme Corporation | Process for generating specific antibodies |
| WO1995020401A1 (en) | 1994-01-31 | 1995-08-03 | Trustees Of Boston University | Polyclonal antibody libraries |
| US5516637A (en) | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
| WO1996014339A1 (en) | 1994-11-05 | 1996-05-17 | The Wellcome Foundation Limited | Antibodies |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5821333A (en) | 1995-03-01 | 1998-10-13 | Genetech, Inc. | Method for making heteromultimeric polypeptides |
| US20020155537A1 (en) | 1995-03-01 | 2002-10-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5807706A (en) | 1995-03-01 | 1998-09-15 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US6458592B1 (en) | 1995-03-29 | 2002-10-01 | Abgenix, Inc. | Production of antibodies using cre-mediated site-specific recombination |
| US6998253B1 (en) | 1995-04-14 | 2006-02-14 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5739277A (en) | 1995-04-14 | 1998-04-14 | Genentech Inc. | Altered polypeptides with increased half-life |
| US6096871A (en) | 1995-04-14 | 2000-08-01 | Genentech, Inc. | Polypeptides altered to contain an epitope from the Fc region of an IgG molecule for increased half-life |
| US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
| WO1996033735A1 (en) | 1995-04-27 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5811524A (en) | 1995-06-07 | 1998-09-22 | Idec Pharmaceuticals Corporation | Neutralizing high affinity human monoclonal antibodies specific to RSV F-protein and methods for their manufacture and therapeutic use thereof |
| US5925351A (en) | 1995-07-21 | 1999-07-20 | Biogen, Inc. | Soluble lymphotoxin-β receptors and anti-lymphotoxin receptor and ligand antibodies as therapeutic agents for the treatment of immunological disease |
| EP1488799A2 (en) * | 1995-07-21 | 2004-12-22 | Biogen, Inc. | Soluble lymphotosin-Beta receptors and anti-lymphotoxin receptor and ligand antibodies as therapeutic agents for the treatment of immunological disease |
| US6193980B1 (en) | 1995-12-06 | 2001-02-27 | Cambridge University Technical Services, Limited | Replication defective herpes simplex virus comprising heterologous inserts |
| US5750753A (en) | 1996-01-24 | 1998-05-12 | Chisso Corporation | Method for manufacturing acryloxypropysilane |
| WO1998005787A1 (en) | 1996-08-02 | 1998-02-12 | Bristol-Myers Squibb Company | A method for inhibiting immunoglobulin-induced toxicity resulting from the use of immunoglobulins in therapy and in vivo diagnosis |
| WO1998016654A1 (en) | 1996-10-11 | 1998-04-23 | Japan Tobacco, Inc. | Production of a multimeric protein by cell fusion method |
| US6420140B1 (en) | 1996-10-11 | 2002-07-16 | Abgenix, Inc. | Production of multimeric protein by cell fusion method |
| WO1998023289A1 (en) | 1996-11-27 | 1998-06-04 | The General Hospital Corporation | MODULATION OF IgG BINDING TO FcRn |
| WO1998024893A2 (en) | 1996-12-03 | 1998-06-11 | Abgenix, Inc. | TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| US6821505B2 (en) | 1997-03-03 | 2004-11-23 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
| US6413777B1 (en) | 1997-03-14 | 2002-07-02 | Idec Pharmaceuticals Corp. | Method for integrating genes at specific sites in mammalian cells via homologous recombination and vectors for accomplishing the same |
| WO1998046645A2 (en) | 1997-04-14 | 1998-10-22 | Micromet Gesellschaft Für Biomedizinische Forschung Mbh | Method for the production of antihuman antigen receptors and uses thereof |
| US20030207346A1 (en) | 1997-05-02 | 2003-11-06 | William R. Arathoon | Method for making multispecific antibodies having heteromultimeric and common components |
| WO1998050433A2 (en) | 1997-05-05 | 1998-11-12 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
| WO1998052976A1 (en) | 1997-05-21 | 1998-11-26 | Biovation Limited | Method for the production of non-immunogenic proteins |
| US6190370B1 (en) | 1997-07-25 | 2001-02-20 | Arrow International, Inc. | Devices, systems and methods for determining proper placement of epidural catheters |
| US6528624B1 (en) | 1998-04-02 | 2003-03-04 | Genentech, Inc. | Polypeptide variants |
| US6242195B1 (en) | 1998-04-02 | 2001-06-05 | Genentech, Inc. | Methods for determining binding of an analyte to a receptor |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| WO1999051642A1 (en) | 1998-04-02 | 1999-10-14 | Genentech, Inc. | Antibody variants and fragments thereof |
| US6538124B1 (en) | 1998-04-02 | 2003-03-25 | Genentech, Inc. | Polypeptide variants |
| WO1999058572A1 (en) | 1998-05-08 | 1999-11-18 | Cambridge University Technical Services Limited | Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis |
| WO2000009560A2 (en) | 1998-08-17 | 2000-02-24 | Abgenix, Inc. | Generation of modified molecules with increased serum half-lives |
| WO2000032767A1 (en) | 1998-12-03 | 2000-06-08 | MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. | RECOMBINANT SOLUBLE Fc RECEPTORS |
| WO2000034317A2 (en) | 1998-12-08 | 2000-06-15 | Biovation Limited | Method for reducing immunogenicity of proteins |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2000044788A1 (en) | 1999-01-28 | 2000-08-03 | Idec Pharmaceuticals Corporation | Production of tetravalent antibodies |
| US20020102208A1 (en) | 1999-03-01 | 2002-08-01 | Paul Chinn | Radiolabeling kit and binding assay |
| US20020123057A1 (en) | 2000-11-17 | 2002-09-05 | University Of Rochester | In vitro methods of producing and identifying immunoglobulin molecules in eukaryotic cells |
| WO2002044215A2 (en) | 2000-12-01 | 2002-06-06 | Cockbain, Julian | Hybrid antibodies |
| US7083784B2 (en) | 2000-12-12 | 2006-08-01 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
| WO2002060919A2 (en) | 2000-12-12 | 2002-08-08 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
| WO2002060955A2 (en) | 2001-01-29 | 2002-08-08 | Idec Pharmaceuticals Corporation | Modified antibodies and methods of use |
| WO2002096948A2 (en) | 2001-01-29 | 2002-12-05 | Idec Pharmaceuticals Corporation | Engineered tetravalent antibodies and methods of use |
| US20030157641A1 (en) | 2001-11-16 | 2003-08-21 | Idec Pharmaceuticals Corporation | Polycistronic expression of antibodies |
| WO2003074569A2 (en) | 2002-03-01 | 2003-09-12 | Immunomedics, Inc. | Bispecific antibody point mutations for enhancing rate of clearance |
| WO2004002431A2 (en) * | 2002-07-01 | 2004-01-08 | Biogen, Inc. | Humanized anti-lymphotoyin beta receptor antibodies |
| WO2004016750A2 (en) | 2002-08-14 | 2004-02-26 | Macrogenics, Inc. | FcϜRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF |
| WO2004029207A2 (en) | 2002-09-27 | 2004-04-08 | Xencor Inc. | Optimized fc variants and methods for their generation |
| WO2004035752A2 (en) | 2002-10-15 | 2004-04-29 | Protein Design Labs, Inc. | ALTERATION OF FcRn BINDING AFFINITIES OR SERUM HALF-LIVES OF ANTIBODIES BY MUTAGENESIS |
| WO2004063351A2 (en) | 2003-01-09 | 2004-07-29 | Macrogenics, Inc. | IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME |
| WO2004074455A2 (en) | 2003-02-20 | 2004-09-02 | Applied Molecular Evolution | Fc REGION VARIANTS |
| WO2004099249A2 (en) | 2003-05-02 | 2004-11-18 | Xencor, Inc. | Optimized fc variants and methods for their generation |
| WO2005018572A2 (en) | 2003-08-22 | 2005-03-03 | Biogen Idec Ma Inc. | Improved antibodies having altered effector function and methods for making the same |
| WO2005040217A2 (en) | 2003-10-17 | 2005-05-06 | Cambridge University Technical Services Limited | Antibodies having a mutated amino acid residue at position 268 (ch2 region) in constant regions |
| WO2005047327A2 (en) | 2003-11-12 | 2005-05-26 | Biogen Idec Ma Inc. | NEONATAL Fc RECEPTOR (FcRn)-BINDING POLYPEPTIDE VARIANTS, DIMERIC Fc BINDING PROTEINS AND METHODS RELATED THERETO |
| WO2005077981A2 (en) | 2003-12-22 | 2005-08-25 | Xencor, Inc. | Fc POLYPEPTIDES WITH NOVEL Fc LIGAND BINDING SITES |
| WO2005070963A1 (en) | 2004-01-12 | 2005-08-04 | Applied Molecular Evolution, Inc | Fc region variants |
| WO2005092925A2 (en) | 2004-03-24 | 2005-10-06 | Xencor, Inc. | Immunoglobulin variants outside the fc region |
| WO2005123780A2 (en) | 2004-04-09 | 2005-12-29 | Protein Design Labs, Inc. | Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis |
| WO2006085967A2 (en) | 2004-07-09 | 2006-08-17 | Xencor, Inc. | OPTIMIZED ANTI-CD20 MONOCONAL ANTIBODIES HAVING Fc VARIANTS |
| WO2006019447A1 (en) | 2004-07-15 | 2006-02-23 | Xencor, Inc. | Optimized fc variants |
| WO2006047350A2 (en) | 2004-10-21 | 2006-05-04 | Xencor, Inc. | IgG IMMUNOGLOBULIN VARIANTS WITH OPTIMIZED EFFECTOR FUNCTION |
| WO2007024715A2 (en) | 2005-08-19 | 2007-03-01 | Abbott Laboratories | Dual variable domain immunoglobin and uses thereof |
| US8602269B2 (en) | 2009-09-14 | 2013-12-10 | Guala Dispensing S.P.A. | Trigger sprayer |
Non-Patent Citations (211)
| Title |
|---|
| "Current Protocols in Immunology", JOHN WILEY & SONS |
| "Immobilized Cells And Enzymes", 1986, IRL PRESS |
| "Manipulating the Mouse Embryo", 1986, COLD SPRING HARBOR LABORATORY PRESS |
| "Methods In Enzymology", ACADEMIC PRESS, INC. |
| "Monoclonal Antibodies For Cancer Detection And Therapy", 1985, ACADEMIC PRESS, article "Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody In Cancer Therapy", pages: 303 - 16 |
| "Remington's Pharmaceutical Sciences 16th ed.", 1980, MACK PUBLISHING CO. |
| ABBAS A.; ABUL, A.; LICHTMAN, A.: "Cellular and Molecular Immunology", 2005, ELSEVIER HEALTH SCIENCES DIVISION |
| ADV. IN DRUG DELIV. REV., vol. 54, 2002, pages 531 |
| AMES ET AL., J. IMMUNOL. METHODS, vol. 184, 1995, pages 177 - 186 |
| ARNON ET AL.: "Monoclonal Antibodies And Cancer Therapy", 1985, ALAN R. LISS, INC., article "Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy", pages: 243 - 56 |
| ARNON ET AL.: "Monoclonal Antibodies And Cancer Therapy", 1985, ALAN R. LISS, INC., article "Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer, Therapy", pages: 243 - 56 |
| ARUFFO ET AL., C'ELL, vol. 61, 1990, pages 1303 - 1313 |
| ASHKENAZI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 10535 - 10539 |
| AUSUBEL ET AL..: "Immunology", vol. 2, 1996, JOHN WILEY & SONS, INC., article "Current Protocols in Molecular Biology" |
| AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1989, JOHN WILEY AND SONS |
| AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1993, JOHN WILEY & SONS |
| B. C. JOHNSON,: "Posttranslational Covalent Modification Of Proteins", 1983, ACADEMIC PRESS, pages: 1 - 12 |
| B. D. HAMES & S. J. HIGGINS: "Nucleic Acid Hybridization", 1984 |
| B. D. HAMES & S. J. HIGGINS: "Transcription And Translation", 1984 |
| B. PERBAL, A PRACTICAL GUIDE TO MOLECULAR CLONING, 1984 |
| BARBAS ET AL., PROCNAT. ACAD. SCI, USA, vol. 91, 1994, pages 3809 - 3813 |
| BEBBINGTON; HENTSCHEL: "DNA cloning", vol. 3, 1987, ACADEMIC PRESS, article "The use of vectors based on gene amplification for the expression of cloned genes in mammalian cells" |
| BEIDLER ET AL., J. IMMUNOL., vol. 141, 1988, pages 4053 - 4060 |
| BETTER ET AL., SCIENCE, vol. 240, 1988, pages 1041 - 1043 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 |
| BIRD, SCIENCE, vol. 242, 1988, pages 423 - 442 |
| BODER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 97, 2000, pages 10701 |
| BRENSING-KUPPERS J; ZOCHER I; THIEBE R; ZACHAU HG., GENE, vol. 191, no. 2, 1997, pages 173 - 81 |
| BRINKMAN ET AL., J. IMMUNOL., vol. 182, 1995, pages 41 - 50 |
| BROWNING ET AL., J IMMUNOL, vol. 154, 1995, pages 33 |
| BROWNING J. ET AL., CELL, vol. 72, 1993, pages 847 - 856 |
| BROWNING JEFFREY L: "Inhibition of the lymphotoxin pathway as a therapy for autoimmune disease", IMMUNOLOGICAL REVIEWS, BLACKWELL PUBLISHING, MUNKSGAARD LNKD- DOI:10.1111/J.1600-065X.2008.00633.X, vol. 223, no. 1, 1 June 2008 (2008-06-01), pages 202 - 220, XP002554450, ISSN: 0105-2896, [retrieved on 20080708] * |
| BURTON ET AL., ADVANCES IN IMMUNOLOGY, vol. 57, 1994, pages 191 - 280 |
| BUTLER, J. E., METH.. ENZYMOL., vol. 73, 1981, pages 482 - 523 |
| BYRN, NATURE, vol. 344, 1990, pages 667 - 670 |
| C.A.K. BORREBAECK: "Antibody Engineering, 2nd edition,", 1995, OXFORD UNIV. PRESS |
| CAMPBELL, A. ET AL.: "Laboratory Techniques in Biochemistry and Molecular Biology", vol. 13, 1984, ELSEVERE, article "Monoclonal Antibody Technology" |
| CAPON ET AL., NATURE, vol. 337, 1989, pages 525 - 531 |
| CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CHOTHIA, C.; LESK, A.M.; TRAMONTANO, A.; LEVITT, M.; SMITH-GILL, S.J.; AIR, G.; SHERIFF, S.; PADLAN, E.A.; DAVIES, D.; TULIP, W.R., NATURE, vol. 342, 1989, pages 877 - 883 |
| CHOTHIA, C.; NOVOTNY, J.; BRUCCOLERI, R.; KARPLUS, M., J. MOL. BIOL., vol. 186, 1985, pages 651 |
| CLINICAL PHARMACY, vol. 12, pages 488 - 505 |
| COCKETT ET AL., BIOLTECHNOLOGY, vol. 8, 1990, pages 2 |
| COLBERRE-GARAPIN ET AL., J. MOL. BIOL., vol. 150, 1981, pages 1 |
| COLIGAN ET AL.,: "Current Protocols in Imrraunology", 1991, GREEN PUBLISHING ASSOCIATES AND WILEY-INTERSCIENCE |
| COLOMA M.J. ET AL., NATURE BIOTECHNOLOGY, vol. 15, 1997, pages 159 - 163 |
| CROUSE ET AL., MOL. CELL. BIOL., vol. 3, 1983, pages 257 |
| D. M. WEIR AND C. C. BLACKWELL: "Handbook Of Experimental Immunology", vol. I-IV, 1986 |
| D. N. GLOVER: "DNA Cloning", vol. I, II, 1985 |
| DAUGHERTY ET AL., J. IMMUNOL. METHODS, vol. 243, 2000, pages 21 1 |
| DAVIES J ET AL: "Affinity improvement of single antibody VH domains: residues in all three hypervariable regions affect antigen binding", IMMUNOTECHNOLOGY, ELSEVIER SCIENCE PUBLISHERS BV, NL LNKD- DOI:10.1016/S1380-2933(96)00045-0, vol. 2, no. 3, 1 September 1996 (1996-09-01), pages 169 - 179, XP004070292, ISSN: 1380-2933 * |
| DIEFFENBACH; DVEKSLER: "PCR Primer", 2003, COLD SPRING HARBOR PRESS |
| DRACOPOLI ET AL.: "Current Protocols in Human Genetics", 1994, JOHN WILEY & SONS |
| DUMOULIN ET AL., PROTEIN SCIENCE, vol. 11, 2002, pages 500 - 515 |
| FOECKING ET AL., GENE, vol. 45, 1986, pages 101 |
| FU KAI ET AL: "Inhibition of the lymphotoxin-beta pathway is efficacious in the adenoviral-IFN alpha accelerated model of SLE", ARTHRITIS & RHEUMATISM, vol. 58, no. 9, Suppl. S, September 2008 (2008-09-01), & 72ND ANNUAL SCIENTIFIC MEETING OF THE AMERICAN-COLLEGE-OF-RHEUMATOLOG Y/43RD ANNUAL SCIENTIFIC MEETIN; SAN FRANCISCO, CA, USA; OCTOBER 24 29, 2008, pages S314 - S315, XP009132090, ISSN: 0004-3591 * |
| GASCOIGNE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 84, 1987, pages 2936 - 2940 |
| GENTZ ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 821 - 824 |
| GHETIE, MARIA-ANA ET AL., BLOOD, vol. 97, 2001, pages 1392 - 1398 |
| GHETIE, MARIA-ANA ET AL., PROC. NAIL. ACAD. SCI., vol. 94, 1997, pages 7509 - 7514 |
| GILLIES ET AL., J. IMMUNOL. METHODS, vol. 125, 1989, pages 191 - 202 |
| GODING: "Monoclonal An.libodies: Principles and Practice", 1986, ACADEMIC PRESS, pages: 59 - 103 |
| HAMERS-CASTERMAN ET AL., NATURE, vol. 363, 1993, pages 446 - 448 |
| HAMMERLING ET AL.: "Monoclonal Antibodies and T-Cell Hybridomas", 1981, ELSEVIER, pages: 563 - 681 |
| HANES ET AL., NAT. BIOTECHNOL., vol. 18, 2000, pages 1287 |
| HARLOW ET AL.: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS |
| HARLOW: "Antibodies: A Laboratory Manual, 2nd ed.", 1988, COLD SPRING HARBOR LABORATORY PRESS, pages: 27 - 28 |
| HARLOW; LANE: "Anti.bodies: A Laboratory Manual", 1988, COLD SPRING HARBOR PRESS |
| HAWKINS ET AL., J. MOL BIOL., vol. 226, 1992, pages 889 - 896 |
| HELLSTROM ET AL.: "Controlled Drug Delivery(2nd Ed.)", 1987, MARCEL DEKKER, INC., article "Antibodies For Drug Delivery", pages: 623 - 53 |
| HO ET AL., GENE, vol. 77, 1989, pages 51 |
| HOET ET AL., NATURE BIOTECHNOL., vol. 23, 2005, pages 344 - 348 |
| HOOGENBOOM, H.R.; CHAMES, IMMUNOL. TODAY, vol. 21, 2000, pages 371 |
| HUIE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 98, 2001, pages 2682 |
| HUSTON ET AL., METHODS IN ENZYMOLOGY, vol. 203, 1991, pages 46 - 88 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| INOUYE; INOUYE, NUCLEIC ACIDS RES., vol. 13, 1985, pages 3101 - 3109 |
| IRVING ET AL., J. IMMUNOL. METHODS, vol. 248, 2001, pages 31 |
| ISHIKAWA, E. ET AL.,: "Enzyme Immunoassay", 1981, KGAKU SHOIN |
| J. H. MILLER AND M. P. CALOS: "Gene Transfer Vectors For Mammalian Cells", 1987, COLD SPRING HARBOR LABORATORY |
| JACKSON ET AL., J.IMMUNOL., vol. 154, no. 7, 1995, pages 3310 - 9 |
| JESPERS ET AL., BIO/TECHNOLOGY, vol. 12, 1988, pages 899 - 903 |
| JOHNSON, T.A.; RASSENTI, L.Z.; KIPPS, T.J., J. IMMUNOL., vol. 158, 1997, pages 235 - 246 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 552 - 525 |
| JONES, GENETICS, vol. 85, 1977, pages 12 |
| KABAT ET AL., J. BIOL. CHEM., vol. 252, 1977, pages 6609 - 6616 |
| KABAT ET AL., SEQUENCES OF PROTEIN OF IMMUNOLOGICAL INTEREST., 1991 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest, 5th edition,", 1991, U.S. DEPT. HEALTH AND HUMAN SERVICES |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest.. 5th Edition,", 1991, U.S. DEPT. OF HEALTH AND HUMAN SERVICES |
| KABAT, E.A.; WU, T.T.; PERRY, H.M.; GOTTESMAN, K.S.; FOELLER, C.: "Sequences of Proteins of Immunological Interest. 5th Edition,", 1991, U.S. DEPT. HEALTH AND HUMAN SERVICES |
| KENNETT, R., ET AL.,: "Monoclonal Antibodies, Hybridoma: A New Dimension in Biological Analyses", 1980, PLENUM PRESS |
| KETTLEBOROUGH ET AL., EUR. J. IMMUNOL., vol. 24, 1994, pages 952 - 958 |
| KIM, J.C. ET AL., INT. J. CANCER, vol. 97, no. 4, 2002, pages 542 - 547 |
| KINGSMAN ET AL., GENE, vol. 7, 1979, pages 141 |
| KLEIN, J.: "Immunology: The Science of Self-Nonself Discrimination", 1982, JOHN WILEY & SONS |
| KOHLER, NATURE, vol. 256, 1975, pages 495 |
| KOHLER, PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 2197 |
| KONTERMANN; DUBEL: "Antibody Engineering", 2001, SPRINGER |
| KOSTELNY ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547 - 1553 |
| KRIEGLER: "Gene Transfer and Expression, A Laboratory Manual", 1990, STOCKTON PRESS |
| KUBY: "Immunology", 2000, H. FREEMAND & CO. |
| LEONG, S.R. ET AL., CYTOKINE, vol. 16, 2001, pages 106 |
| LESSLAUER ET AL., EUR. J. IMMUNOL., vol. 27, 1991, pages 2883 - 2886 |
| LEWIN: "Genes", vol. VIII, 2003, PRENTICE HALL |
| LINSLEY ET AL., J. EXP. MED., vol. 173, 1991, pages 721 - 730 |
| LISLEY, J. EXP. MED., vol. 174, 1991, pages 561 - 569 |
| LIU ET AL., J. IMMUNOL., vol. 139, 1987, pages 3521 - 3526 |
| LIU ET AL., PROC. NATL. ACAD. SCI. USA, vol. 84, 1987, pages 3439 - 3443 |
| LONBERG; HUSZAR, INT. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93 |
| LOWY ET AL., CELL, vol. 22, 1980, pages 817 |
| LUI ET AL., J. MOL. BIOL., vol. 315, 2002, pages 1063 |
| M. J. GAIT: "Oligonucleolide Synthesis", 1984 |
| MACCALLUM ET AL., J. MOL. BIOL., vol. 262, 1996, pages 732 - 745 |
| MACKAY F ET AL: "LYMPHOTOXIN BUT NOT TUMOR NECROSIS FACTOR FUNCTIONS TO MAINTAIN SPLENIC ARCHITECTURE AND HUMORAL RESPONSIVESNESS IN ADULT MICE", EUROPEAN JOURNAL OF IMMUNOLOGY, WILEY - V C H VERLAG GMBH & CO. KGAA, DE LNKD- DOI:10.1002/EJI.1830270830, vol. 27, no. 8, 1 August 1997 (1997-08-01), pages 2033 - 2042, XP002063546, ISSN: 0014-2980 * |
| MAGGIO, E.: "Enzyme Immunoassay", 1980, CRC PRESS |
| MARKS ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 779 - 783 |
| MATSUDA F; ISHII K; BOURVAGNET P; KUMA K; HAYASHIDA H; MIYATA T; HONJO T., J EXP MED., vol. 188, no. 11, 1998, pages 2151 - 62 |
| MAYER AND WALKER,: "Immunochemical Methods In Cell And Molecular Biology", 1987, ACADEMIC PRESS |
| MILENIC ET AL., CANCER RESEARCH, vol. 51, 1991, pages 6363 |
| MISHELL AND SHIIGI: "Selected Methods in Cellular Immunology", 1980, W.H. FREEMAN AND CO. |
| MORGAN; ANDERSON, ANN. REV. BIOCHEM., vol. 62, 1993, pages 191 - 217 |
| MORNSON, SCIENCE, vol. 229, 1985, pages 1202 |
| MORRIS, G.: "Epitope Mapping Protocols", 1996, HUMANA PRESS |
| MORRISON ET AL., ADV. LMMUNOL., vol. 44, 1988, pages 65 - 92 |
| MORRISON ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 81, 1984, pages 6851 - 55 |
| MORRISON ET AL., PROC. NATL. ACAD. SCI., vol. 81, 1984, pages 6851 - 6855 |
| MORRISON ET AL., PROC. NATL. ACAD. SCI., vol. 81, 1984, pages 851 - 855 |
| MORRISON, SCIENCE, vol. 229, 1985, pages 1202 - 1207 |
| MULLIGAN, SCIENCE, vol. 260, 1993, pages 926 - 932 |
| MULLIGAN; BERG, PROC. NALL. ACAD. SCI. USA, vol. 78, 1981, pages 2072 |
| MULLINAX ET AL., BIOTECHNIQUES, vol. 12, no. 6, 1992, pages 864 - 869 |
| NAGY ET AL., NAT. MED., vol. 8, 2002, pages 801 |
| NEUBERGER ET AL., NATURE, vol. 312, 1984, pages 604 - 608 |
| NEWMAN, BIOTECHNOLOGY, vol. 10, 1992, pages 1455 - 1460 |
| NISHIMURA ET AL., CANCER RES., vol. 47, 1987, pages 999 - 1005 |
| NISONOFF, A.: "Molecular Immunology, 2nd ed.,", 1984, SINAUER ASSOCIATES |
| O'HARE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 78, 1981, pages 1527 |
| OI ET AL., BIOTECHNIQUES, vol. 4, 1986, pages 214 |
| PADLAN, MOLEC. IMMUN., vol. 28, 1991, pages 489 - 498 |
| PADLAN, MOLEC. IMMUN., vol. 31, 1994, pages 169 - 2L7 |
| PADLAN, MOLECULAR IMMUNOLOGY, vol. 28, no. 4, 5, 1991, pages 489 - 498 |
| PANTOLIANO ET AL., BIOCHEMISTRY, vol. 30, 1991, pages 10117 |
| PEARSON ET AL., CURR TOP MICROBIOL IMMUNOL, vol. 324, 2008, pages 25 |
| PEPPEL ET AL., T. EXP. MED., vol. 174, 1991, pages 1483 - 1489 |
| PERSIC ET AL., GENE, vol. 187, 1997, pages 9 - 18 |
| PESSI ET AL., NATURE, vol. 362, 1993, pages 367 - 369 |
| PRESTA, LEONARD G., CURENT PHARMACEUTICAL BIOTECHNOLOGY, vol. 3, 2002, pages 237 - 256 |
| PROUDFOOT, NATURE, vol. 322, 1986, pages 52 |
| R. I. FRESHNEY: "Culture Of Animal Cells", 1987, ALAN R. LISS, INC. |
| RATTAN ET AL., ANN NYACAD SOI, vol. 663, 1992, pages 48 - 62 |
| RICKWOOD, D., EL AL.,: "Protein Engineering, A Practical Approach", 1995, IRL PRESS AT OXFORD UNIV. PRESS |
| RIDGWAY, A. A. G.: "Vectors", 1988, BUTTERWORTHS, article "Mammalian Expression Vectors", pages: 470 - 472 |
| RIDGWAY; GORMAN, J. CELL. BIOL., vol. 115, 1991 |
| RIECHMANN, NATURE, vol. 332, 1988, pages 323 |
| ROGUSKA ET AL., PNAS, vol. 91, 1994, pages 969 - 973 |
| ROITT, I.; BROSTOFF, J.; MALE D.: "Immunology 6th ed.", 2001 |
| ROUX ET AL., J. IMMUNOL., vol. 161, 1998, pages 4083 |
| RUTHER ET AL., EMBO J., vol. 2, 1983, pages 1791 |
| SAMBROOK ET AL.,: "Molecular Cloning A Laboratory Manual, 2nd Ed.,", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SAMBROOK ET AL.,: "Molecular Cloning: A Laboratory Manual", 1992, COLD SPRINGS HARBOR LABORATORY |
| SAMBROOK; RUSSELL: "Molecular Cloning: A Laboratory Manual", 2001, COLD SPRING HARBOR PRESS |
| SANTERRE ET AL., GENE, vol. 30, 1984, pages 147 |
| SANTOS A.D. ET AL., CLINICAL CANCER RESEARCH, vol. 5, 1999, pages 3118S - 3123S |
| SAWAI ET AL., AJRL, vol. 34, 1995, pages 26 - 34 |
| SCHIER ET AL., GENE, vol. 169, 1995, pages 147 - 155 |
| SCIFTER ET AL., MET.H ENZYMOL., vol. 182, 1990, pages 626 - 646 |
| SHAW ET AL., J. NATL. CANCER INST., vol. 80, 1988, pages 1553 - 1559 |
| SHU ET AL., PNAS, vol. 90, 1993, pages 7995 - 7999 |
| SKERRA ET AL., SCIENCE, vol. 240, 1988, pages 1038 - 1040 |
| SKERRA ET AL., SCIENCE, vol. 242, 1988, pages 1038 - 1041 |
| STAMENKOVIC ET AL., CELL, vol. 66, 1991, pages 1133 - 1144 |
| STEWARD, M.W.: "Antihndie.s, Their Structure and Function", 1984, CHAPMAN AND HALL |
| STINCHCOMB ET AL., NATURE, vol. 282, 1979, pages 39 |
| STITES ET AL.: "Basic and Clinical - Immunology(8th ed.),", 1994, APPLETON & LANGE |
| STUDNICKA ET AL., PROTEIN ENGINEERING, vol. 7, no. 6, 1994, pages 805 - 814 |
| SUN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 84, 1987, pages 214 - 218 |
| SZYBALSKA; SZYBALSKI, PROC. NATL. ACAD. SCI. USA, vol. 48, 1992, pages 202 |
| T. E. CREIGHTON: "Proteins - Structure And Molecular Properties", 1993, W. H. FREEMAN AND COMPANY |
| TAKEDA ET AL., NATURE, vol. 314, 1985, pages 452 - 454 |
| TAKKINEN ET AL., PROTEIN ENGINEERING, vol. 4, 1991, pages 837 |
| THORPE ET AL.: "Monoclonal Antibodies '84: Biological And Clinical Applications", 1985, article "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review", pages: 475 - 506 |
| THORPE ET AL.: "The Preparation And Cytotoxic Properties Of Antibody-Toxin Conjugates", IMMUNOL. REV., vol. 62, 1982, pages 119 - 58, XP001179872, DOI: doi:10.1111/j.1600-065X.1982.tb00392.x |
| TIB TECH, vol. 11, no. 5, May 1993 (1993-05-01), pages 155 - 215 |
| TODOROVSKA, ANETA ET AL., JOURNAL OF IMMUNOLOGICAL METHODS, vol. 248, 2001, pages 47 - 66 |
| TOLSTOSHEV, ANN. REV. PHARMACOL. TOXICOL., vol. 32, 1993, pages 573 - 596 |
| TRAUNECKER ET AL., NATURE, vol. 339, 1989, pages 68 - 70 |
| TSCHEMPER ET AL., GENE, vol. 10, 1980, pages 157 |
| TUTT ET AL., J. IMMUNOL., vol. 147, 1991, pages 60 - 69 |
| VAN HEEKE; SCHUSTER, J. BIOL. CHEM., vol. 24, 1989, pages 5503 - 5509 |
| VAN SPRIEL, ANNEMIEK ET AL., REVIEW IMMUNOLOGY TODAY, vol. 21, no. 8, 2000, pages 391 - 397 |
| VERHOEYAN ET AL., SCIENCE, vol. 239, 1988, pages 1534 |
| VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536 |
| VOLLER ET AL., J. CLIN. PATHOL., vol. 31, 1978, pages 507 - 520 |
| VOLLER, A.: "Diagnostic Horizons", vol. 2, 1978, MICROBIOLOGICAL ASSOCIATES QUARTERLY PUBLICATION, article "The Enzyme Linked Immunosorbent Assay (ELISA)", pages: 1 - 7 |
| WARD, NALURE, vol. 334, 1989, pages 544 - 554 |
| WATSON ET AL., J. CELL. BIOL., vol. 110, 1990, pages 2221 - 2229 |
| WATSON ET AL., NATURE, vol. 349, 1991, pages 164 - 167 |
| WEINTRAUB, B.: "Principles of Radioimmunoassays, Seventh Training Course on Radioligand Assay Techniques", March 1986, THE ENDOCRINE SOCIETY |
| WEIR, RIOCHEM. SOC. TRANSACTIONS, vol. 30, 2002, pages 512 |
| WIGLER ET AL., CELL, vol. 11, 1977, pages 223 |
| WIGLER ET AL., NATL. ACAD. SCI. USA, vol. 77, 1980, pages 357 |
| WILSON ET AL., CELL, vol. 37, 1984, pages 767 |
| WILSON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 98, 2001, pages 3750 |
| WINTER; MILSTEIN, NATURE, vol. 349, 1991, pages 293 - 99 |
| WOLFF, EDITH A. ET AL., CANCER RES?ARCH, vol. 53, 1993, pages 2560 - 2565 |
| WOOD ET AL., NATURE, vol. 314, 1985, pages 446 - 449 |
| WU ET AL.: "Methods In Enzymology", vol. 154, 155 |
| WU; WU, BIOTHERAPY, vol. 3, 1991, pages 87 - 95 |
| YELTON ET AL., J. IMMUNOL., vol. 155, 1995, pages 1994 - 2004 |
| ZETTMEISSL ET AL., DNA CELL BIOL. USA, vol. 9, 1990, pages 347 - 353 |
| ZUO, ZHUANG ET AL., PROTEIN ENGINEERING, vol. 13, no. 5, 2000, pages 361 - 367 |
Cited By (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3763388A1 (en) * | 2011-02-18 | 2021-01-13 | AbbVie Stemcentrx LLC | Novel modulators and methods of use |
| US10301394B2 (en) | 2011-07-01 | 2019-05-28 | Cellerant Therapeutics, Inc. | Antibodies that specifically bind to TIM3 |
| US9631026B2 (en) | 2011-07-01 | 2017-04-25 | Cellerant Therapeutics, Inc. | Antibodies that specifically bind to TIM3 |
| WO2013006490A3 (en) * | 2011-07-01 | 2014-05-08 | Cellerant Therapeutics, Inc. | Antibodies that specifically bind to tim3 |
| EP3145546A4 (en) * | 2014-02-19 | 2017-10-25 | Jody Berry | Marburg monoclonal antibodies |
| WO2015127140A2 (en) | 2014-02-19 | 2015-08-27 | Jody Berry | Marburg monoclonal antibodies |
| WO2018013797A1 (en) | 2016-07-13 | 2018-01-18 | President And Fellows Of Harvard College | Antigen-presenting cell-mimetic scaffolds and methods for making and using the same |
| EP4606890A2 (en) | 2016-07-13 | 2025-08-27 | President and Fellows of Harvard College | Antigen-presenting cell-mimetic scaffolds and methods for making and using the same |
| WO2018089305A1 (en) * | 2016-11-08 | 2018-05-17 | University Of Miami | Anti-secretogranin iii (scg3) antibodies and uses thereof |
| US11414482B2 (en) | 2016-11-08 | 2022-08-16 | University Of Miami | Anti-secretogranin III (SCG3) antibodies and uses thereof |
| WO2023076511A1 (en) | 2021-10-28 | 2023-05-04 | Lyell Immunopharma, Inc. | Methods of generating cells |
| WO2024077174A1 (en) | 2022-10-05 | 2024-04-11 | Lyell Immunopharma, Inc. | Methods for culturing nr4a-deficient cells |
| WO2025217398A1 (en) | 2024-04-10 | 2025-10-16 | Lyell Immunopharma, Inc. | Methods for culturing cells with improved culture medium |
| WO2026006604A1 (en) | 2024-06-26 | 2026-01-02 | Lyell Immunopharma, Inc. | Feeder cell replacement |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2012514458A (ja) | 2012-06-28 |
| US20120003235A1 (en) | 2012-01-05 |
| CN102341411A (zh) | 2012-02-01 |
| CA2748757A1 (en) | 2010-07-08 |
| AU2009334498A2 (en) | 2011-08-11 |
| EP2382238A1 (en) | 2011-11-02 |
| US20140079716A1 (en) | 2014-03-20 |
| AU2009334498A1 (en) | 2011-07-21 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12006364B2 (en) | Anti-CD100 antibodies and methods for using the same | |
| US11981730B2 (en) | Anti-CXCL13 antibodies and methods of using the same | |
| US20120003235A1 (en) | Anti-lymphotoxin antibodies | |
| US20090226442A1 (en) | RON antibodies and uses thereof | |
| AU2013204503A1 (en) | Anti-lymphotoxin antibodies |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 200980157746.0 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 09796593 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13141297 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2011544632 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2009334498 Country of ref document: AU |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2748757 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2009334498 Country of ref document: AU Date of ref document: 20091231 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 5638/DELNP/2011 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2009796593 Country of ref document: EP |