WO2010058396A1 - A cd44vra antibody and diagnostic and therapeutic methods using same - Google Patents
A cd44vra antibody and diagnostic and therapeutic methods using same Download PDFInfo
- Publication number
- WO2010058396A1 WO2010058396A1 PCT/IL2009/001086 IL2009001086W WO2010058396A1 WO 2010058396 A1 WO2010058396 A1 WO 2010058396A1 IL 2009001086 W IL2009001086 W IL 2009001086W WO 2010058396 A1 WO2010058396 A1 WO 2010058396A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- cd44vra
- disease
- polypeptide
- diseases
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2884—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD44
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/564—Immunoassay; Biospecific binding assay; Materials therefor for pre-existing immune complex or autoimmune disease, i.e. systemic lupus erythematosus, rheumatoid arthritis, multiple sclerosis, rheumatoid factors or complement components C1-C9
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/5758—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites
- G01N33/5759—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites involving compounds localised on the membrane of tumour or cancer cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/70585—CD44
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/10—Musculoskeletal or connective tissue disorders
- G01N2800/101—Diffuse connective tissue disease, e.g. Sjögren, Wegener's granulomatosis
- G01N2800/102—Arthritis; Rheumatoid arthritis, i.e. inflammation of peripheral joints
Definitions
- the invention in some embodiments thereof relates to an antibody which specifically binds the novel CD44vRA variant, polynucleotides encoding same and, methods and kits using same for diagnosing and treating diseases associated with expression of the novel CD44vRA variant such as inflammatory, autoimmune, rheumatic and malignant diseases.
- the cell surface adhesion molecule, designated CD44 has been implicated in cell-cell and cell-matrix interactions, as well as in cell traffic and cell transendothelial migration.
- CD44 is a single chain molecule comprising a conserved amino terminal extracellular domain, a nonconserved membrane proximal region, a variable region expressing various combinations of variant exons, a conserved transmembrane spanning domain and a conserved cytoplasmic tail.
- the genomic sequence of mouse and human CD44 includes 5 constant exons at the 5' terminus, and 5 constant exons at the 3' end.
- the mouse CD44 gene includes 10 variant exons in the middle of the molecule, designated V 1 -V 10 , resulting in a total of 20 exons.
- the human CD44 gene comprises only 9 of these 10 variant exons (V 2 -V 1O ) thus comprising a total of 19 exons (Screaton, G.R., et al., 1992).
- These molecules are designated CD44 variants (CD44v). To date, a few dozen isoforms of CD44 are known.
- CD44s In standard CD44 (CD44s, SEQ ID NO: 17), constant exon number 5 is spliced directly to constant exon number 16 and therefore this molecule lacks the entire variable region. The resulting protein product is expressed predominantly on hematopoietic cells and therefore, this product is also known as hematopoietic CD44 (CD44H) or standard CD44 product (CD44s product, SEQ ID NO: 18).
- CD44H hematopoietic CD44
- CD44s product SEQ ID NO: 18
- keratinocyte CD44 the longest CD44 identified so far, exon V3 to exon VlO are inserted in tandem between the two constant regions of the molecule.
- the CD44 N-terminus contains the ligand binding site of the molecule.
- Hyaluronic acid is the principal ligand of CD44, but other extracellular matrix (ECM) components (e.g. laminin, collagen, fibronectin and chondroitin sulfate) as well as non-ECM constituents (mucosal vascular addressin, serglycin, osteopontin and class II invariant chain) can also interact with the CD44 receptor. Marked accumulation of CD44, and sometimes hyaluronic acid, is detected in areas of intensive cell migration and cell proliferation, as in wound healing, tissue remodeling, inflammation (including auto inflammation), morphogenesis and carcinogenesis.
- ECM extracellular matrix
- CD44 protein and variants thereof in autoimmune diseases.
- anti-CD44 monoclonal antibodies mAbs
- these mAbs are directed against the constant region of CD44 (and are thus designated anti-pan CD44 mAbs shared by all CD44 isoforms). Therefore, such mAbs may also block CD44 expressed on normal cells, which is required for migratory activity of immune and inflammatory cells engaged in microorganism eradication.
- Monoclonal Abs directed against various variant regions of CD44 have also been suggested as potential agents for treatment of autoimmune diseases.
- Herrlich et al, 1991 describe mAbs directed against metastasis-specific variants of CD44v surface protein of a rat pancreatic adenocarcinoma.
- Anti-CD44-monoclonal antibodies, which inhibit T-cell proliferation, were also provided for treatment of various autoimmune diseases (Aune, T.M. et al., 1992).
- Monoclonal antibodies specific for forms of CD44 containing exon v6 were also reported as being useful for diagnosing inflammatory diseases (Jalkanen, S. et al., 1995).
- Anti-CD44 mAbs which were injected into mice, were shown to inhibit or prevent infiltration of various lymphoma and carcinoma cells into their target organs.
- transfection of a variant CD44 isoform into non metastatic rat pancreatic adenocarcinoma cells conferred metastatic potential to these cells.
- US Patent Application No. 11/130,206 to the present inventors discloses antibodies which comprise an antigen recognition domain capable of specifically binding the CD44vRA polypeptide (SEQ ID NO:22) found in rheumatoid arthritis patients but not the standard (hematopoietic) CD44 (SEQ ID NO:18) or the CD44v3- vlO (SEQ ID NO:20). Additional background art includes Golan I., et al., 2007.
- an isolated antibody comprising an antigen recognition domain which comprises complementarity determining region (CDR) amino acid sequences as set forth in SEQ ID NOs:8, 9, 10, 14, 15 and 16.
- CDR complementarity determining region
- an isolated polynucleotide comprising a nucleic acid sequence encoding the antibody of the invention.
- a nucleic acid construct comprising the isolated polynucleotide of the invention and a promoter for regulating expression of the isolated polynucleotide in a host cell.
- a pharmaceutical composition comprising as an active ingredient the antibody of the invention and a pharmaceutically effective carrier or diluent.
- a method of detecting a presence of a CD44vRA polypeptide in a biological sample comprising contacting the biological sample with the antibody of the invention under conditions which allow immunocomplex formation, wherein a presence and/or a level above a predetermined threshold of the immunocomplex is indicative of the presence of the CD44vRA polypeptide in the biological sample.
- a kit for detecting a presence of a CD44vRA polypeptide in a biological sample comprising the antibody of the invention and at least one reagent suitable for detection of an immunocomplex between the antibody and the CD44vRA polypeptide.
- a method of diagnosing a disease associated with expression of a CD44vRA polypeptide comprising contacting a biological sample of a subject with the antibody of the invention under conditions which allow immunocomplex formation, wherein a presence or a level above a predetermined threshold of the immunocomplex is indicative of the disease in the subject.
- kits for diagnosing a disease associated with expression of a CD44vRA polypeptide comprising the antibody of the invention, at least one reagent suitable for detection of an immunocomplex and instructions for use in diagnosing the disease associated with expression of the CD44vRA polypeptide.
- a method of treating a disease associated with expression of a CD44vRA polypeptide comprising administering to a subject the antibody of the invention or the pharmaceutical composition of the invention, thereby treating the disease associated with expression of the CD44vRA polypeptide.
- a heavy chain of the antibody is encoded by the nucleic acid sequence set forth by SEQ ID NO:1.
- a light chain of the antibody is encoded by the nucleic acid sequence set forth by SEQ ID NO:3. According to some embodiments of the invention, the antibody being conjugated to a therapeutic moiety.
- the antibody being conjugated to a detectable moiety.
- the biological sample is selected from the group consisting of a synovial fluid sample, a blood sample, a bone marrow sample, a tissue biopsy sample and a lymph fluid sample.
- the disease associated with expression of a CD44vRA polypeptide is selected from the group consisting of a rheumatoid disease, an inflammatory disease, an autoimmune disease and a cancerous disease.
- the CD44vRA polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 22.
- the rheumatoid disease is selected from the group consisting of rheumatoid arthritis (RA), psoriatic arthritis (PSA), spondyloarthropathy (SPA), juvenile rheumatoid arthritis (JRA), chronic Reiter's syndrome (CRS), palindrome rheumatism (PR), inflammatory bowel disease (IBD), infected rheumatic disease (IRD), seronegative rheumatoid arthritis (SRA), Gout, and non-diagnosed arthritis.
- RA rheumatoid arthritis
- PSA psoriatic arthritis
- SPA spondyloarthropathy
- JRA juvenile rheumatoid arthritis
- CRS chronic Reiter's syndrome
- PR palindrome rheumatism
- IBD inflammatory bowel disease
- IBD infected rheumatic disease
- SRA seronegative rheumatoid arthritis
- FIGs. IA-D depict the nucleic acid ( Figures IA, C) and amino acid ( Figures IB, D) sequences of the anti CD44vRA antibody according to some embodiments of the invention.
- Figure IA - nucleic acid sequence of the antibody heavy chain SEQ ID NO:1.
- CDRs complementarity determining regions
- CDRl SEQ ID NO:5
- CDR2 SEQ ID NO:6
- CDR3 SEQ ID NO:7
- Figure IB amino acid sequence of the antibody heavy chain (SEQ ID NO:2), note CDRl (SEQ ID NO:8), CDR2 (SEQ ID NO:9) and CDR3 (SEQ ID NO:10) in red
- Figure 1C nucleic acid sequence of the antibody light chain (SEQ ID NO:3), note CDRl (SEQ ID NO: 11), CDR2 (SEQ ID NO: 12) and CDR3 (SEQ ID NO: 13) in red
- Figure ID - amino acid sequence of the antibody light chain SEQ ID NO:4, note CDRl (SEQ ID NO: 14), CDR2 (SEQ ID NO: 15) and CDR3 (SEQ ID NO: 16) in red
- CDR landmarks are shown in green.
- the invention in some embodiments thereof relates to an antibody which specifically binds the novel CD44vRA variant, polynucleotides encoding same and methods and kits using same for diagnosing and treating diseases associated with expression of the novel CD44vRA variant such as inflammatory, autoimmune, rheumatic and malignant diseases.
- diseases associated with expression of the novel CD44vRA variant such as inflammatory, autoimmune, rheumatic and malignant diseases.
- the present inventors have uncovered a novel antibody which specifically binds the CD44vRA variant (SEQ ID NO:22) present in synovial fluid cells of rheumatoid arthritis (RA) but not other CD44 variants such as the CD44 standard (hematopoietic form; SEQ ID NO: 18) and CD44v3- vlO variant (SEQ ID NO:20).
- the novel CD44vRA antibody identified herein comprises complementarity determining regions (CDRs) amino acid sequences as set forth in SEQ ID NOs: 8, 9 and 10 for the antibody heavy chain and SEQ ID NOs: 14, 15 and 16 for the antibody light chain ( Figures IA-D).
- CDRs complementarity determining regions
- Such an antibody can be used for diagnosing and treating various diseases associated with expression of the CD44vRA variant such as rheumatic, inflammatory, autoimmune and cancerous diseases.
- an isolated antibody comprising an antigen recognition domain which comprises complementarity determining region (CDR) amino acid sequences as set forth in SEQ ID NOs:8, 9 and 10 for an heavy chain of the antibody and SEQ ID NOs: 14, 15 and 16 for a light chain of the antibody.
- CDR complementarity determining region
- antibody as used in this invention includes intact molecules as well as functional fragments thereof, such as Fab, F(ab')2, and Fv that are capable of binding to macrophages.
- These functional antibody fragments are defined as follows: (1) Fab, the fragment which contains a monovalent antigen-binding fragment of an antibody molecule, can be produced by digestion of whole antibody with the enzyme papain to yield an intact light chain and a portion of one heavy chain; (2) Fab', the fragment of an antibody molecule that can be obtained by treating whole antibody with pepsin, followed by reduction, to yield an intact light chain and a portion of the heavy chain; two Fab' fragments are obtained per antibody molecule; (3) (Fab")2, the fragment of the antibody that can be obtained by treating whole antibody with the enzyme pepsin without subsequent reduction; F(ab")2 is a dimer of two Fab' fragments held together by two disulfide bonds; (4) Fv, defined as a genetically engineered fragment containing the variable region of the light chain and the variable region of the heavy
- Antibody fragments according to the present invention can be prepared by proteolytic hydrolysis of the antibody or by expression in E. coli or mammalian cells (e.g. Chinese hamster ovary cell culture or other protein expression systems) of DNA encoding the fragment.
- Antibody fragments can be obtained by pepsin or papain digestion of whole antibodies by conventional methods.
- antibody fragments can be produced by enzymatic cleavage of antibodies with pepsin to provide a 5S fragment denoted F(ab * )2.
- This fragment can be further cleaved using a thiol reducing agent, and optionally a blocking group for the sulfhydryl groups resulting from cleavage of disulfide linkages, to produce 3.5S Fab' monovalent fragments.
- a thiol reducing agent optionally a blocking group for the sulfhydryl groups resulting from cleavage of disulfide linkages
- an enzymatic cleavage using pepsin produces two monovalent Fab' fragments and an Fc fragment directly.
- cleaving antibodies such as separation of heavy chains to form monovalent light-heavy chain fragments, further cleavage of fragments, or other enzymatic, chemical, or genetic techniques may also be used, so long as the fragments bind to the antigen that is recognized by the intact antibody.
- Fv fragments comprise an association of VH and VL chains. This association may be noncovalent, as described in Inbar et al. [Proc. Natl Acad. Sci. USA 69:2659-62 (1972O]. Alternatively, the variable chains can be linked by an intermolecular disulfide bond or cross-linked by chemicals such as glutaraldehyde. Preferably, the Fv fragments comprise VH and VL chains connected by a peptide linker.
- sFv single-chain antigen binding proteins
- the structural gene is inserted into an expression vector, which is subsequently introduced into a host cell such as E. coli.
- the recombinant host cells synthesize a single polypeptide chain with a linker peptide bridging the two V domains.
- Methods for producing sFvs are described, for example, by [Whitlow and Filpula, Methods 2: 97-105 (1991); Bird et al., Science 242:423-426 (1988); Pack et al., Bio/Technology 11:1271-77 (1993); and US Patent No. 4,946,778, which is hereby incorporated by reference in its entirety.
- CDR peptides (“minimal recognition units") can be obtained by constructing genes encoding the CDR of an antibody of interest. Such genes are prepared, for example, by using the polymerase chain reaction to synthesize the variable region from RNA of antibody-producing cells. See, for example, Larrick and Fry [Methods, 2: 106-10 (1991)].
- Humanized forms of non-human (e.g., murine) antibodies are chimeric molecules of immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab').sub.2 or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human immunoglobulin.
- Humanized antibodies include human immunoglobulins (recipient antibody) in which residues form a complementary determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity and capacity.
- CDR complementary determining region
- donor antibody such as mouse, rat or rabbit having the desired specificity, affinity and capacity.
- Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues.
- Humanized antibodies may also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences.
- the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence.
- the humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin [Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature, 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol., 2:593-596 (1992)].
- Fc immunoglobulin constant region
- a humanized antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as import residues, which are typically taken from an import variable domain. Humanization can be essentially performed following the method of Winter and co-workers [Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988)], by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody.
- humanized antibodies are chimeric antibodies (US Patent No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
- humanized antibodies are typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
- Human antibodies can also be produced using various techniques known in the art, including phage display libraries [Hoogenboom and Winter, J. MoI. Biol., 227:381 (1991); Marks et al., J. MoI. Biol., 222:581 (1991)]. The techniques of Cole et al. and Boerner et al.
- human antibodies can be made by introduction of human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in US Patent Nos.
- expressible polynucleotides e.g., a polynucleotide which comprises the nucleic acid sequence set forth by SEQ ID NO: 3 encoding the antibody light chain; a polynucleotide which comprises the nucleic acid sequence set forth by SEQ ID NO:1 encoding the antibody heavy chain
- expressible polynucleotides e.g., a polynucleotide which comprises the nucleic acid sequence set forth by SEQ ID NO: 3 encoding the antibody light chain
- SEQ ID NO:1 a polynucleotide which comprises the nucleic acid sequence set forth by SEQ ID NO:1 encoding the antibody heavy chain
- the isolated polynucleotide(s) can be included in a nucleic acid construct which includes a promoter sequence for regulating expression of the isolated polynucleotide in a host cell.
- the promoter can direct transcription of the polynucleotide in a host cell in a constitutive or inducible manner.
- constitutive promoters include the cytomegalovirus (CMV) and Rous sarcoma virus (RSV).
- the nucleic acid construct may further include sequences which render this vector suitable for replication and integration in prokaryotes, eukaryotes, or preferably both (e.g., shuttle vectors); transcription and translation initiation sequence, transcription and translation terminator and a polyadenylation signal; a signal sequence for secretion of the peptide from a host cell in which it is placed; enhancer elements; other specialized elements intended to increase the level of expression of cloned nucleic acids or to facilitate the identification of cells that carry the recombinant DNA; sequences that allow, for example, the translation of several proteins from a single mRNA such as an internal ribosome entry site (IRES) and sequences for genomic integration of the promoter-chimeric polypeptide.
- prokaryotes eukaryotes, or preferably both (e.g., shuttle vectors)
- transcription and translation initiation sequence e.g., transcription and translation terminator and a polyadenylation signal
- the recombinant antibody of the invention can be purified using a variety of standard protein purification techniques, such as, but not limited to, affinity chromatography, ion exchange chromatography, filtration, electrophoresis, hydrophobic interaction chromatography, gel filtration chromatography, reverse phase chromatography, concanavalin A chromatography, chromatofocusing and differential solubilization.
- standard protein purification techniques such as, but not limited to, affinity chromatography, ion exchange chromatography, filtration, electrophoresis, hydrophobic interaction chromatography, gel filtration chromatography, reverse phase chromatography, concanavalin A chromatography, chromatofocusing and differential solubilization.
- the antibody of some embodiments of the present invention can be used in vitro, ex vivo and in vivo in various therapeutic or diagnostic applications.
- the human or humanized antibody or antibody fragment will generally tend to be better tolerated immunologically than one of non human origin since non variable portions of non human antibodies will tend to trigger xenogeneic immune responses more potent than the allogeneic immune responses triggered by human antibodies which will typically be allogeneic with the individual. It will be preferable to minimize such immune responses since these will tend to shorten the half- life, and hence the effectiveness, of the antibody of the invention in the individual. Furthermore, such immune responses may be pathogenic to the individual, for example by triggering harmful inflammatory reactions.
- an antibody or antibody fragment of human origin or a humanized antibody
- a functional physiological effect for example an immune response against a target cell, activated by a constant region of the antibody or antibody fragment in the individual is desired.
- a functional physiological effect for example an immune response against a target cell, activated by a constant region of the antibody or antibody fragment in the individual is desired.
- Such applications particularly include those in which the functional interaction between a functional portion of the antibody or antibody fragment, such as an Fc region, with a molecule such as an Fc receptor or an Fc-binding complement component, is optimal when such a functional portion is, similarly to the Fc region, of human origin.
- the antibody of the invention which includes a constant region, or a portion thereof, of any of various isotypes may be employed.
- the isotype is selected so as to enable or inhibit a desired physiological effect, or to inhibit an undesired specific binding of the antibody of the present invention via the constant region or portion thereof.
- ADCC antibody-dependent cell mediated cytotoxicity
- NK natural killer
- the isotype will preferably be IgG
- the isotype will preferably be IgE
- the isotype will preferably be IgE or IgA.
- the antibody or antibody fragment includes a constant region or portion thereof capable of initiating the cascade.
- the antibody or antibody fragment may advantageously comprise a Cgamma2 domain of IgG or Cmu3 domain of IgM to trigger a Clq-mediated complement cascade.
- the antibody of the present invention will preferably not comprise a constant region, or a portion thereof, of the relevant isotype.
- the antibody or antibody fragment of the invention may be attached to any of various functional moieties (e.g., therapeutic or diagnostic moieties).
- the functional moiety can be conjugated by translationally fusing a polynucleotide encoding the antibody with a polynucleotide encoding the functional moiety.
- the functional moiety can be chemically conjugated (coupled) to the antibody of the invention, using any conjugation method known to one skilled in the art.
- a peptide can be conjugated to an antibody of interest, using a 3-(2-pyridyldithio)propionic acid Nhydroxysuccinimide ester (also called N-succinimidyl 3-(2pyridyldithio) propionate) (“SDPD”) (Sigma, Cat. No. P-
- the functional moiety is a therapeutic moiety.
- the therapeutic moiety can be, for example, a cytotoxic moiety, a toxic moiety
- cytokine moiety e.g., interleukin 2 (GenBank Accession Nos. CAA00227 and A02159), interleukin 10
- an antibody or antibody fragment attached to a toxin may be referred to in the art as an "immunotoxin".
- the functional moiety is a detectable moiety which enables specific detection of an immunocomplex formed between the CD44vRA polypeptide and the antibody or antibody fragment of the invention.
- the detectable moiety can be a label which is directly visualized [e.g., radioactive isotopes (e.g., ⁇ 125 Hodine), phosphorescent chemicals, chemiluminescent chemicals, fluorescent chemicals].
- radioactive isotopes e.g., ⁇ 125 Hodine
- phosphorescent chemicals e.g., phosphorescent chemicals, chemiluminescent chemicals, fluorescent chemicals.
- fluorescent molecules include, but are not limited to, phycoerythrin (PE), fluorescein isothiocyanate (FITC; e.g., GenBank Accession Nos. AAF22695 and AF098239), Cy-chrome, rhodamine, green fluorescent protein (GFP; e.g., GenBank Accession Nos. AAL33912 and AF435427), blue fluorescent protein (BFP), orange fluorescent protein (; e.g., GenBank Accession Nos. AAL33917 and AF435432), Texas red, PE-Cy5, and the like.
- PE phycoerythrin
- FITC fluorescein isothiocyanate
- Cy-chrome Cy-chrome
- rhodamine Cy-chrome
- GFP green fluorescent protein
- BFP blue fluorescent protein
- orange fluorescent protein e.g., GenBank Accession Nos. AAL33917 and AF435432
- Texas red PE-Cy5, and the like
- fluorophore selection methods of linking fluorophores to various types of molecules, such as an antibody or antibody fragment of the invention, and methods of using such conjugates to detect molecules which are capable of being specifically bound by antibodies or antibody fragments comprised in such immunoconjugates is available in the literature of the art [for example, refer to: Richard P. Haugland, "Molecular Probes: Handbook of Fluorescent Probes and Research Chemicals 1992-1994", 5th ed., Molecular Probes, Inc. (1994); US Patent. No. 6,037,137 to Oncoimmunin Inc.; Hermanson, "Bioco ⁇ jugate Techniques", Academic Press New York, N.Y. (1995); Kay M. et al, 1995.
- the detectable moiety can be a member of a binding (affinity) pair, which is identifiable via its interaction with an additional member of the binding pair. It should be noted that any of members of the binding pair can be labeled.
- the member of the binding pair is an antigen (e.g., a tag such as a Myc of Histidine tag) which is identified by a corresponding labeled antibody.
- the member of the binding pair is a biotin molecule which binds to streptavidin or avidin molecules.
- the label is a fluorescent protein or an enzyme producing a colorimetric reaction.
- suitable enzymes include horseradish peroxidase (HPR), peroxidase (e.g., GenBank Accession Nos.
- beta-galactosidase e.g., GenBank Accession Nos.
- a detectable moiety which comprises a fluorophore or results in activation of a fluorescent molecule can be used in numerous fluorescence detection methods such as fluorescence activated flow cytometry (FACS), immunofluorescence, fluorescence resonance energy transfer (FRET), and the like.
- FACS fluorescence activated flow cytometry
- FRET fluorescence resonance energy transfer
- detectable moieties e.g., radioactive molecules or chemiluminescent chemicals
- RIA radioimmuno assay
- Detection methods which utilize enzymes include, but are not limited to, enzyme linked immunosorbent assay (ELISA which can be performed to detect the CD44vRA polypeptide in a solution), enzyme-linked chemiluminescence assay (for example, to detect the CD44vRA polypeptide in an electrophoretically separated protein mixture), and enzyme-linked immunohistochemical assay (for example, to detect the CD44vRA polypeptide in a fixed tissue).
- ELISA enzyme linked immunosorbent assay
- enzyme-linked chemiluminescence assay for example, to detect the CD44vRA polypeptide in an electrophoretically separated protein mixture
- enzyme-linked immunohistochemical assay for example, to detect the CD44vRA polypeptide in a fixed tissue.
- the antibody of the invention can be used to detect the CD44vRA polypeptide in a biological sample.
- a method of detecting a presence of a CD44vRA polypeptide in a biological sample is effected by contacting the biological sample with the antibody of the invention under conditions which allow immunocomplex formation, wherein a presence or a level above a predetermined threshold of the immunocomplex is indicative of the presence of the
- the biological sample can be any sample comprising cells or portion thereof (e.g., a portion of a cell membrane) which is derived from a subject. Examples include, but are not limited to a synovial fluid sample, a blood sample, a bone marrow sample, lymph fluid, a tissue biopsy sample such as synovial membrane tissue (SMTs) and splenocytes. It should be noted that for in vivo detection the biological sample may not be physically removed from the subject.
- SMTs synovial membrane tissue
- Procedures for obtaining biological samples from individuals are well known in the art. Such procedures include, but are not limited to, drawing blood (e.g., of a vein, umbilical cord), bone biopsy, lymph node biopsy, pleural biopsy, skin biopsy, thyroid biopsy, CT-guided biopsy, joint biopsy (e.g., of the knee), needle aspiration biopsy and breast biopsy.
- drawing blood e.g., of a vein, umbilical cord
- lymph node biopsy e.g., pleural biopsy
- skin biopsy e.g., thyroid biopsy
- CT-guided biopsy e.g., of the knee
- needle aspiration biopsy e.g., of the knee
- a joint biopsy (a sample of the joint lining, synovial membrane or fluid) can be obtained by introducing an incision in the joint and withdrawing fluid using a needle attached to a syringe.
- contacting is performed under conditions sufficient to form an immunocomplex (e.g. a complex between the antibody of the invention and the
- CD44vRA polypeptide such conditions (e.g., appropriate concentrations, buffers, temperatures, reaction times) as well as methods of optimize same are known to those skilled in the art.
- the immunocomplex can be formed and detected on a cell surface, e.g., a cell membrane or a portion thereof (such as a ruptured membrane) which includes the CD44vRA polypeptide. Determining a presence or level of the immunocomplex is dependent on the detectable moiety attached to the antibody, essentially as described hereinabove.
- CD44vRA polypeptide SEQ ID NO:22
- a disease associated with CD44vRA expression such as an inflammatory disease, allergic disease, rheumatoid disease, autoimmune disease, graft rejection disease or a cancer disease.
- subject refers to a mammal, preferably, a male or female human subject.
- disease associated with expression of the CD44vRA polypeptide refers to any disease characterized by expression (Le., presence, e.g., above a predetermined threshold) of the CD44vRA polypeptide in cells of the affected subject.
- the predetermined threshold is determined in comparison to a level of the CD44vRA polypeptide in a control biological sample such as of an unaffected subject (Le., a healthy subject-free of the disease, same subject being in remission or prior to disease initiation) or based upon literature data.
- the inflammatory disease is associated with hypersensitivity.
- hypersensitivity examples include, but are not limited to, Type I hypersensitivity, Type II hypersensitivity, Type III hypersensitivity, Type IV hypersensitivity, immediate hypersensitivity, antibody mediated hypersensitivity, immune complex mediated hypersensitivity, T lymphocyte mediated hypersensitivity and DTH.
- a non-limiting example of Type I or immediate hypersensitivity, is asthma.
- Type II and type III hypersensitivity include, but are not limited to, rheumatoid diseases, rheumatoid autoimmune diseases, rheumatoid arthritis (Krenn V. et al, Histol
- paraneoplastic neurological diseases cerebellar atrophy, paraneoplastic cerebellar atrophy, non-paraneoplastic stiff man syndrome, cerebellar atrophies, progressive cerebellar atrophies, encephalitis, Rasmussen's encephalitis, amyotrophic lateral sclerosis, Sydenham chorea, Gilles de Ia Tourette syndrome, polyendocrinopathies, autoimmune polyendocrinopathies (Antoine JC. and Honnorat J. Rev Neurol (Paris) 2000 Jan; 156 (1):23); neuropathies, dysimmune neuropathies (Nobile-Orazio E.
- vasculitises necrotizing small vessel vasculitises, microscopic polyangiitis, Churg and Strauss syndrome, glomerulonephritis, pauci-immune focal necrotizing glomerulonephritis, crescentic glomerulonephritis (Noel LH. Ann Med Interne (Paris). 2000 May; 151 (3): 178); antiphospholipid syndrome (Flamholz R. et al, J Clin Apheresis 1999;14 (4): 171); heart failure, agonist-like beta-adrenoceptor antibodies in heart failure (Wallukat G. et al, Am J Cardiol.
- Type IV or T cell mediated hypersensitivity include, but are not limited to, rheumatoid diseases, rheumatoid arthritis (Tisch R, McDevitt HO. Proc Natl Acad Sci U S A 1994 Jan 18; 91 (2):437), systemic diseases, systemic autoimmune diseases, systemic lupus erythematosus (Datta SK., Lupus 1998; 7 (9):591), glandular diseases, glandular autoimmune diseases, pancreatic diseases, pancreatic autoimmune diseases, Type 1 diabetes (Castano L. and Eisenbarth GS. Ann. Rev. Immunol. 8:647); thyroid diseases, autoimmune thyroid diseases, Graves' disease (Sakata S.
- delayed type hypersensitivity examples include, but are not limited to, contact dermatitis and drug eruption.
- T lymphocyte mediating hypersensitivity examples include, but are not limited to, helper T lymphocytes and cytotoxic T lymphocytes.
- helper T lymphocyte-mediated hypersensitivity examples include, but are not limited to, T h I lymphocyte mediated hypersensitivity and T h 2 lymphocyte mediated hypersensitivity.
- the disease is rheumatoid disease, including, but not limited to, rheumatoid arthritis (RA), psoriatic arthritis (PSA), spondyloarthropathy (SPA), juvenile rheumatoid arthritis (JRA), chronic Reiter's syndrome (CRS), palindrome rheumatism (PR), inflammatory bowel disease (IBD), infected rheumatic disease (IRD), seronegative rheumatoid arthritis (SRA), Gout, and non-diagnosed arthritis.
- RA rheumatoid arthritis
- PSA psoriatic arthritis
- SPA spondyloarthropathy
- JRA juvenile rheumatoid arthritis
- CRS chronic Reiter's syndrome
- PR palindrome rheumatism
- IBD inflammatory bowel disease
- IBD infected rheumatic disease
- SRA seronegative rheumatoid arthritis
- Autoimmune diseases include, but are not limited to, cardiovascular diseases, rheumatoid diseases, glandular diseases, gastrointestinal diseases, cutaneous diseases, hepatic diseases, neurological diseases, muscular diseases, nephric diseases, diseases related to reproduction, connective tissue diseases and systemic diseases.
- autoimmune cardiovascular diseases include, but are not limited to atherosclerosis (Matsuura E. et al, Lupus. 1998; 7 Suppl 2:S135), myocardial infarction (Vaarala O. Lupus. 1998; 7 Suppl 2:S132), thrombosis (Tincani A. et al, Lupus 1998; 7 Suppl 2:S107-9), Wegener's granulomatosis, Takayasu's arteritis, Kawasaki syndrome (Praprotnik S. et al, Wien Klin Klin Klin Klinschr 2000 Aug 25; 112 (15-16):660), anti-factor VIII autoimmune disease (Lacroix-Desmazes S.
- autoimmune rheumatoid diseases include, but are not limited to rheumatoid arthritis (Krenn V. et al, Histol Histopathol 2000 JuI; 15 (3):791; Tisch R, McDevitt HO. Proc Natl Acad Sci units S A 1994 Jan 18; 91 (2):437) and ankylosing spondylitis (Jan Voswinkel et al, Arthritis Res 2001; 3 (3): 189).
- autoimmune glandular diseases include, but are not limited to, pancreatic disease, Type I diabetes, thyroid disease, Graves' disease, thyroiditis, spontaneous autoimmune thyroiditis, Hashimoto's thyroiditis, idiopathic myxedema, ovarian autoimmunity, autoimmune anti-sperm infertility, autoimmune prostatitis and Type I autoimmune polyglandular syndrome diseases include, but are not limited to autoimmune diseases of the pancreas, Type 1 diabetes (Castano L. and Eisenbarth GS. Ann. Rev. Immunol. 8:647; Zimmet P. Diabetes Res Clin Pract 1996 Oct;34 Suppl:S125), autoimmune thyroid diseases, Graves' disease (Orgiazzi J.
- autoimmune gastrointestinal diseases include, but are not limited to, chronic inflammatory intestinal diseases (Garcia Herola A. et al, Gastroenterol Hepatol. 2000 Jan; 23 (1):16), celiac disease (Landau YE. and Shoenfeld Y. Harefuah 2000 Jan 16; 138 (2):122), colitis, ileitis and Crohn's disease.
- autoimmune cutaneous diseases include, but are not limited to, autoimmune bullous skin diseases, such as, but are not limited to, pemphigus vulgaris, bullous pemphigoid and pemphigus foliaceus.
- autoimmune hepatic diseases include, but are not limited to, hepatitis, autoimmune chronic active hepatitis (Franco A. et al, Clin Immunol Immunopathol 1990 Mar; 54 (3):382), primary biliary cirrhosis (Jones DE. Clin Sci (Colch) 1996 Nov; 91 (5):551; Strassburg CP. et al, Eur J Gastroenterol Hepatol. 1999 Jun; 11 (6):595) and autoimmune hepatitis (Manns MP. J Hepatol 2000 Aug; 33 (2):326).
- autoimmune neurological diseases include, but are not limited to, multiple sclerosis (Cross AH. et al, J Neuroimmunol 2001 Jan 1; 112 (1-2):1), Alzheimer's disease (Oron L. et al, J Neural Transm Suppl. 1997; 49:77), myasthenia gravis (Infante AJ. And Kraig E, Int Rev Immunol 1999; 18 (l-2):83; Oshima M. et al, Eur J Immunol 1990 Dec; 20 (12):2563), neuropathies, motor neuropathies (Kornberg AJ. J Clin Neurosci.
- autoimmune muscular diseases include, but are not limited to, myositis, autoimmune myositis and primary Sjogren's syndrome (Feist E. et al, Int Arch Allergy Immunol 2000 Sep;123 (1):92) and smooth muscle autoimmune disease (Zauli D. et al, Biomed Pharmacother 1999 Jun;53 (5-6):234).
- autoimmune nephric diseases include, but are not limited to, nephritis and autoimmune interstitial nephritis (Kelly CJ. J Am Soc Nephrol 1990 Aug;l (2):140).
- autoimmune diseases related to reproduction include, but are not limited to, repeated fetal loss (Tincani A. et al, Lupus 1998;7 Suppl 2:S107-9).
- autoimmune connective tissue diseases include, but are not limited to, ear diseases, autoimmune ear diseases (Yoo TJ. et al, Cell Immunol 1994 Aug;157 (1):249) and autoimmune diseases of the inner ear (Gloddek B. et al, Ann N Y Acad Sci 1997 Dec 29;830:266).
- autoimmune systemic diseases include, but are not limited to, systemic lupus erythematosus (Erikson J. et al, Immunol Res 1998; 17 (l-2):49) and systemic sclerosis (Renaudineau Y. et al, Clin Diagn Lab Immunol. 1999 Mar;6 (2): 156); Chan OT. et al, Immunol Rev 1999 Jun;169:107).
- Infectious diseases include, but are not limited to, chronic infectious diseases, sub-acute infectious diseases, acute infectious diseases, viral diseases, bacterial diseases, protozoan diseases, parasitic diseases, fungal diseases, mycoplasma diseases and prion diseases.
- Graft rejection diseases include, but are not limited to, graft rejection, chronic graft rejection, sub acute graft rejection, hyper acute graft rejection, acute graft rejection and graft versus host disease.
- Allergic diseases include, but are not limited to, asthma, hives, urticaria, pollen allergy, dust mite allergy, venom allergy, cosmetics allergy, latex allergy, chemical allergy, drug allergy, insect bite allergy, animal dander allergy, stinging plant allergy, poison ivy allergy and food allergy.
- Cancerous diseases include but are not limited to carcinoma, lymphoma, blastoma, sarcoma, and leukemia. Particular examples of cancerous diseases but are not limited to: Myeloid leukemia such as Chronic myelogenous leukemia. Acute myelogenous leukemia with maturation. Acute promyelocytic leukemia, Acute nonlymphocytic leukemia with increased basophils, Acute monocytic leukemia. Acute myelomonocytic leukemia with eosinophilia; Malignant lymphoma, such as Burkitt's
- Non-Hodgkin's Lymphoctyic leukemia, such as Acute lymphoblastic leukemia,
- Benign Meningioma Mixed tumors of salivary gland, Colonic adenomas; Adenocarcinomas, such as Small cell lung cancer, Kidney, Uterus, Prostate, Bladder,
- Rhabdomyosarcoma (alveolar), Extraskeletal myxoid chondrosarcoma, Ewing's tumor; other include Testicular and ovarian dysgerminoma, Retinoblastoma, Wilms 1 tumor,
- Neuroblastoma Malignant melanoma, Mesothelioma, breast, skin, prostate, and ovarian.
- the antibody of the invention can be used to treat any of the above mentioned diseases which are associated with expression of the CD44vRA polypeptide.
- a method of treating a disease associated with expression of a CD44vRA polypeptide is effected by administering to a subject the antibody of the invention.
- treating refers to inhibiting or arresting the development of a disease, disorder or condition and/or causing the reduction, remission, or regression of a disease, disorder or condition.
- Those of skill in the art will understand that various methodologies and assays can be used to assess the development of a disease, disorder or condition, and similarly, various methodologies and assays may be used to assess the reduction, remission or regression of a disease, disorder or condition.
- the antibody of the invention can be administered to an organism per se, or in a pharmaceutical composition where it is mixed with suitable carriers or excipients.
- a "pharmaceutical composition” refers to a preparation of one or more of the active ingredients described herein with other chemical components such as physiologically suitable carriers and excipients.
- the purpose of a pharmaceutical composition is to facilitate administration of a compound to an organism.
- active ingredient refers to the antibody of the invention accountable for the biological effect.
- physiologically acceptable carrier refers to the phrases "physiologically acceptable carrier" and
- pharmaceutically acceptable carrier refers to a carrier or a diluent that does not cause significant irritation to an organism and does not abrogate the biological activity and properties of the administered compound.
- An adjuvant is included under these phrases.
- excipient refers to an inert substance added to a pharmaceutical composition to further facilitate administration of an active ingredient. Examples, without limitation, of excipients include calcium carbonate, calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils and polyethylene glycols. Techniques for formulation and administration of drugs may be found in
- Suitable routes of administration may, for example, include oral, rectal, transmucosal, especially transnasal, intestinal or parenteral delivery, including intramuscular, subcutaneous and intramedullary injections as well as intrathecal, direct intraventricular, intracardiac, e.g., into the right or left ventricular cavity, into the common coronary artery, intravenous, inrtaperitoneal, intranasal, or intraocular injections.
- a tissue region of a patient e.g., joint tissue
- compositions of the present invention may be manufactured by processes well known in the art, e.g., by means of conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping or lyophilizing processes.
- compositions for use in accordance with the present invention thus may be formulated in conventional manner using one or more physiologically acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active ingredients into preparations which, can be used pharmaceutically. Proper formulation is dependent upon the route of administration chosen.
- the active ingredients of the pharmaceutical composition may be formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological salt buffer.
- physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological salt buffer.
- penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art.
- the pharmaceutical composition can be formulated readily by combining the active compounds with pharmaceutically acceptable carriers well known in the art.
- Such carriers enable the pharmaceutical composition to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions, and the like, for oral ingestion by a patient.
- Pharmacological preparations for oral use can be made using a solid excipient, optionally grinding the resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries if desired, to obtain tablets or dragee cores.
- Suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carbomethylcellulose; and/or physiologically acceptable polymers such as polyvinylpyrrolidone (PVP).
- disintegrating agents may be added, such as cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate.
- Dragee cores are provided with suitable coatings.
- suitable coatings For this purpose, concentrated sugar solutions may be used which may optionally contain gum arabic, talc, polyvinyl pyrrolidone, carbopol gel, polyethylene glycol, titanium dioxide, lacquer solutions and suitable organic solvents or solvent mixtures.
- Dyestuffs or pigments may be added to the tablets or dragee coatings for identification or to characterize different combinations of active compound doses.
- compositions which can be used orally include push-fit capsules made of gelatin as well as soft, sealed capsules made of gelatin and a plasticizer, such as glycerol or sorbitol.
- the push-fit capsules may contain the active ingredients in admixture with filler such as lactose, binders such as starches, lubricants such as talc or magnesium stearate and, optionally, stabilizers.
- the active ingredients may be dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols.
- stabilizers may be added. All formulations for oral administration should be in dosages suitable for the chosen route of administration.
- the compositions may take the form of tablets or lozenges formulated in conventional manner.
- the active ingredients for use according to the present invention are conveniently delivered in the form of an aerosol spray presentation from a pressurized pack or a nebulizer with the use of a suitable propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane, dichloro-tetrafluoroethane or carbon dioxide.
- a suitable propellant e.g., dichlorodifluoromethane, trichlorofluoromethane, dichloro-tetrafluoroethane or carbon dioxide.
- the dosage unit may be determined by providing a valve to deliver a metered amount.
- Capsules and cartridges of, e.g., gelatin for use in a dispenser may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch.
- compositions described herein may be formulated for parenteral administration, e.g., by bolus injection or continuous infusion.
- Formulations for injection may be presented in unit dosage form, e.g., in ampoules or in multidose containers with optionally, an added preservative.
- the compositions may be suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- compositions for parenteral administration include aqueous solutions of the active preparation in water-soluble form. Additionally, suspensions of the active ingredients may be prepared as appropriate oily or water based injection suspensions. Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acids esters such as ethyl oleate, triglycerides or liposomes. Aqueous injection suspensions may contain substances, which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol or dextran. Optionally, the suspension may also contain suitable stabilizers or agents which increase the solubility of the active ingredients to allow for the preparation of highly concentrated solutions.
- the active ingredient may be in powder form for constitution with a suitable vehicle, e.g., sterile, pyrogen-free water based solution, before use.
- a suitable vehicle e.g., sterile, pyrogen-free water based solution
- the pharmaceutical composition of the present invention may also be formulated in rectal compositions such as suppositories or retention enemas, using, e.g., conventional suppository bases such as cocoa butter or other glycerides.
- compositions suitable for use in context of the present invention include compositions wherein the active ingredients are contained in an amount effective to achieve the intended purpose. More specifically, a therapeutically effective amount means an amount of active ingredients (Le., the antibody of the invention) effective to prevent, alleviate or ameliorate symptoms of a disease (e.g., inflammatory or rheumatoid disease) or prolong the survival of the subject being treated. Determination of a therapeutically effective amount is well within the capability of those skilled in the art, especially in light of the detailed disclosure provided herein.
- the therapeutically effective amount or dose can be estimated initially from in vitro and cell culture assays.
- a dose can be formulated in animal models to achieve a desired concentration or titer. Such information can be used to more accurately determine useful doses in humans.
- Toxicity and therapeutic efficacy of the active ingredients described herein can be determined by standard pharmaceutical procedures in vitro, in cell cultures or experimental animals.
- the data obtained from these in vitro and cell culture assays and animal studies can be used in formulating a range of dosage for use in human.
- the dosage may vary depending upon the dosage form employed and the route of administration utilized.
- the exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient's condition. (See e.g., Fingl, et al., 1975, in "The Pharmacological Basis of Therapeutics", Ch. 1 p.l).
- Dosage amount and interval may be adjusted individually to provide levels of the active ingredient which are sufficient to induce or suppress the biological effect
- MEC minimum effective concentration
- dosing can be of a single or a plurality of administrations, with course of treatment lasting from several days to several weeks or until cure is effected or diminution of the disease state is achieved.
- compositions to be administered will, of course, be dependent on the subject being treated, the severity of the affliction, the manner of administration, the judgment of the prescribing physician, etc.
- the active ingredient is provided to the individual with additional active agents to achieve an improved therapeutic effect as compared to treatment with each agent by itself.
- measures e.g., dosing and selection of the complementary agent
- Administration of such combination therapy can be simultaneous, such as in a single capsule having a fixed ratio of these active agents, or in multiple capsules for each agent.
- the active ingredient e.g., the antibody of the invention
- NSAID nonsteroidal anti-inflammatory drugs
- DARDS disease- modifying antirheumatic drugs
- corticosteroids analgesics
- Fibromyalgia medications chemotherapeutic agents and others.
- compositions of the present invention may, if desired, be presented in a pack or dispenser device, such as an FDA approved kit, which may contain one or more unit dosage forms containing the active ingredient.
- the pack may, for example, comprise metal or plastic foil, such as a blister pack.
- the pack or dispenser device may be accompanied by instructions for administration.
- the pack or dispenser may also be accommodated by a notice associated with the container in a form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals, which notice is reflective of approval by the agency of the form of the compositions or human or veterinary administration.
- Such notice for example, may be of labeling approved by the U.S. Food and Drug Administration for prescription drugs or of an approved product insert.
- compositions comprising a preparation of the invention formulated in a compatible pharmaceutical carrier may also be prepared, placed in an appropriate container, and labeled for treatment of an indicated condition, as is further detailed above.
- the antibody of the invention which is described hereinabove for detecting the CD44vRA polypeptide may be included in a diagnostic kit/article of manufacture preferably along with appropriate instructions for use in diagnosing and/or assessing diseases associated with expression of the CD44vRA polypeptide and optionally labels indicating FDA approval for use in diagnosing and/or assessing diseases associated with expression of the CD44vRA polypeptide.
- kit can include, for example, at least one container including at least one of the above described diagnostic agents (e.g., the antibody of the invention, or an immunoconjugate thereof) and an imaging reagent packed in another container (e.g., enzymes, secondary antibodies, buffers, chromogenic substrates, fluorogenic material).
- the kit may also include appropriate buffers and preservatives for improving the shelf- life of the kit.
- CD44vRA peptide SNPEVLLQTTTRMTADVDRNGTTAYEGNWN
- SEQ ID NO:23 obtained from Corixa (Seattle, WA), and 100 ⁇ g/ml soluble CD44vRA (SEQ ID NO:22) produced as described in U.S. Pat. Appl. No. 11/130,206, both emulsified in complete Freund's adjuvant (CFA) (Sigma) and were used to immunize subcutaneously or intramuscularly 8-week-old female C75BL/6 mice. The immunization was repeated on days 14 and 28 and two weeks later the mice were bled and their sera were tested by flow cytometry for their ability to bind to Namalwa cells expressing CD44.
- CFA complete Freund's adjuvant
- mice with highest polyclonal anti-CD44 antibody titers were selected and boosted intraperitoneally (i.p.) with 10 8 Namalwa-CD44vRA cells. After 72 hours, spleen cells from the mice were harvested and fused with SP 2/0 myeloma cells according to Kohler and Milstein [Kohler, G., and Milstein C. Nature 256:495-497 (1975)].
- the supernatants from isolated hybridoma clones were screened by flow cytometry for their ability to bind to Namalwa-Neo, Namalwa-CD44v3-10 or Namalwa-CD44vRA cells.
- Hybridoma whose supernatants bound selectively or preferentially to Namalwa-CD44vRA were cloned by limiting dilution and then re-cloned for additional three cycles.
- the isolated hybridoma were maintained in enriched RPMI 1640 containing HAT media supplement and 20 % FBS.
- the isotype of the CD44vRA-positive hybridoma supernatant was determined by ELISA using Clonotype System-HRP (Southern Biotechnology Associates, Inc.). Determination of antibody heavy (VH) and light (VL) chain CDRs -
- Hybridoma cells were centrifuged (30 ml of hybridoma cells centrifuged for 10 minutes at 1200 rpm at 4 0 C).
- RNA was extracted using TRiReagent (Sigma) according to manufacturer instructions.
- TRiReagent Sigma
- RNA was quantified by nanodrop and integrity was checked by applying 3 ⁇ l from each sample on agarose gel.
- the isolated RNA was subjected to DNase I treatment [4 ⁇ g of RNA was taken for DNase I (Sigma) treatment according to the manufacturer instructions], followed by reverse transcription (using M-MLV, Reverse Transcriptase and random primers).
- PCR amplification of IgG was performed using Ig-Primer Sets kit (Novagen) according to manufacturer protocol.
- PCR conditions were denaturation at 94 °C for 5 minutes, 35 cycles, each including a denaturation at 94 0 C for 1 minute, annealing at 53 °C for 1 minute and elongation at 72 0 C for 1 minute, followed by 72 0 C for 5 minutes.
- Cloning of the PCR products of the heavy (HC) and light (LC) chains into pGEM-luc vector (Promega) was into the pGEM (ampR) vector (Promega).
- the plasmid DNA was purified (Pure YieldTM Plasmid Midiprep, Promega) from transformed bacteria and concentration determined by UV spectroscopy.
- the constructs (each containing 10 ⁇ g DNA) were sequenced using ABI37000 cycle sequencing.
- CD44vRA Production of anti-CD44vRA mAb - CD44vRA, CD44v3-vlO (derived from human keratinocytes) and CD44s (derived from HeLa cells) cDNAs were transfected into CD44-negative Namalwa Burkett lymphoma cell line.
- CD44 transfectants expressing high levels of CD44s, as well as CD44v3-vlO and CD44vRA transfectants expressing equal levels of v6-containing CD44 variant were selected.
- the transfectants were designated Namalwa-CD44s, Namalwa-CD44v3-vlO and Namalwa-CD44vRA, respectively.
- Namalwa cells transfected with an empty vector were designated Namalwa-Neo.
- C57BL/6 mice were immunized with soluble CD44vRA, incorporated into CFA and challenged with Namalwa-CD44vRA cells as described in Materials and Methods. Splenocytes from mice showing polyclonal anti-CD4vRA antibodies in their serum were fused with SP2/0 myeloma cells.
- Hybridoma cell clones were selected according to the ability of their supernatants to bind to Namalwa-CD44vRA (expressing the polypeptide set forth by SEQ ID NO:22), but not to Namalwa-CD44v3-vlO (expressing the polypeptide set forth by SEQ ID NO:20), Namalwa-CD44s (expressing the polypeptide set forth by SEQ ID NO: 18) or to Namalwa-Neo, as indicated by flow cytometry.
- Clones and sub-clones were established from positive hybridoma cell colonies, and they were stable in culture for over 8 months.
- Anti-CD44vRA mAbs from supernatants of positive hybridomas were purified on G protein column.
Landscapes
- Health & Medical Sciences (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Hematology (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Medicinal Chemistry (AREA)
- Food Science & Technology (AREA)
- Pathology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Cell Biology (AREA)
- Biotechnology (AREA)
- General Physics & Mathematics (AREA)
- Microbiology (AREA)
- Organic Chemistry (AREA)
- Rheumatology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Rehabilitation Therapy (AREA)
- Peptides Or Proteins (AREA)
Abstract
Provide is an antibody comprising an antigen recognition domain which comprises complementarity determining region (CDR) amino acid sequences as set forth in SEQ ID NOs:8, 9, 10, 14, 15 and 16. Also provided are methods and kits using same for diagnosing and treating diseases associated with expression of the CD44vRA variant.
Description
A CD44VRA ANTIBODY AND DIAGNOSTIC AND THERAPEUTIC METHODS
USING SAME
FIELD AND BACKGROUND OF THE INVENTION The invention in some embodiments thereof relates to an antibody which specifically binds the novel CD44vRA variant, polynucleotides encoding same and, methods and kits using same for diagnosing and treating diseases associated with expression of the novel CD44vRA variant such as inflammatory, autoimmune, rheumatic and malignant diseases. The cell surface adhesion molecule, designated CD44, has been implicated in cell-cell and cell-matrix interactions, as well as in cell traffic and cell transendothelial migration.
CD44 is a single chain molecule comprising a conserved amino terminal extracellular domain, a nonconserved membrane proximal region, a variable region expressing various combinations of variant exons, a conserved transmembrane spanning domain and a conserved cytoplasmic tail. The genomic sequence of mouse and human CD44 includes 5 constant exons at the 5' terminus, and 5 constant exons at the 3' end. The mouse CD44 gene includes 10 variant exons in the middle of the molecule, designated V1-V10, resulting in a total of 20 exons. The human CD44 gene comprises only 9 of these 10 variant exons (V2-V1O) thus comprising a total of 19 exons (Screaton, G.R., et al., 1992). Differential V2-V10 alternative splicing generates many isoforms of CD44 that express various combinations of variant exons (designated exon Vx, x = 1- 10), which are inserted in the membrane proximal domain and constitute the variable region of the molecule. These molecules are designated CD44 variants (CD44v). To date, a few dozen isoforms of CD44 are known.
In standard CD44 (CD44s, SEQ ID NO: 17), constant exon number 5 is spliced directly to constant exon number 16 and therefore this molecule lacks the entire variable region. The resulting protein product is expressed predominantly on hematopoietic cells and therefore, this product is also known as hematopoietic CD44 (CD44H) or standard CD44 product (CD44s product, SEQ ID NO: 18). In keratinocyte CD44, the longest CD44 identified so far, exon V3 to exon VlO are inserted in tandem between the two constant regions of the molecule.
The CD44 N-terminus contains the ligand binding site of the molecule. Hyaluronic acid (HA) is the principal ligand of CD44, but other extracellular matrix (ECM) components (e.g. laminin, collagen, fibronectin and chondroitin sulfate) as well as non-ECM constituents (mucosal vascular addressin, serglycin, osteopontin and class II invariant chain) can also interact with the CD44 receptor. Marked accumulation of CD44, and sometimes hyaluronic acid, is detected in areas of intensive cell migration and cell proliferation, as in wound healing, tissue remodeling, inflammation (including auto inflammation), morphogenesis and carcinogenesis.
The involvement of CD44 protein and variants thereof in autoimmune diseases is known. For example, it has been shown that anti-CD44 monoclonal antibodies (mAbs) can ameliorate the severity of experimentally induced autoimmune arthritis in mice (Verdrengh, M. et al. 1995). However, these mAbs are directed against the constant region of CD44 (and are thus designated anti-pan CD44 mAbs shared by all CD44 isoforms). Therefore, such mAbs may also block CD44 expressed on normal cells, which is required for migratory activity of immune and inflammatory cells engaged in microorganism eradication.
Monoclonal Abs directed against various variant regions of CD44 have also been suggested as potential agents for treatment of autoimmune diseases. Herrlich et al, 1991 describe mAbs directed against metastasis-specific variants of CD44v surface protein of a rat pancreatic adenocarcinoma. Anti-CD44-monoclonal antibodies, which inhibit T-cell proliferation, were also provided for treatment of various autoimmune diseases (Aune, T.M. et al., 1992). Monoclonal antibodies specific for forms of CD44 containing exon v6 were also reported as being useful for diagnosing inflammatory diseases (Jalkanen, S. et al., 1995). In addition, it has been reported (Hale, L.P., 1994) that administration of a CD44 protein, peptide or derivative can be used for treating various autoimmune diseases.
In an experimental arthritis mouse model (collagen-induced arthritis), injection of one of three different anti-CD44 mAbs, but not of the isotype-matched control mAbs, at disease onset, prevented an increase in footpad swelling and helped to maintain the clinical score at a very low level (Nedvetzki et al. 1999). Each of the three different types of anti-CD44 mAb recognized a distinct constant epitope of the CD44 receptor. All three antibodies displayed a similar anti-arthritic effect.
The involvement of CD44 in malignant processes has also been described (Naor,
D., 1997). Anti-CD44 mAbs which were injected into mice, were shown to inhibit or prevent infiltration of various lymphoma and carcinoma cells into their target organs. In addition, transfection of a variant CD44 isoform into non metastatic rat pancreatic adenocarcinoma cells conferred metastatic potential to these cells.
US Patent Application No. 11/130,206 to the present inventors discloses antibodies which comprise an antigen recognition domain capable of specifically binding the CD44vRA polypeptide (SEQ ID NO:22) found in rheumatoid arthritis patients but not the standard (hematopoietic) CD44 (SEQ ID NO:18) or the CD44v3- vlO (SEQ ID NO:20). Additional background art includes Golan I., et al., 2007.
SUMMARY OF THE INVENTION
According to an aspect of some embodiments of the present invention there is provided an isolated antibody comprising an antigen recognition domain which comprises complementarity determining region (CDR) amino acid sequences as set forth in SEQ ID NOs:8, 9, 10, 14, 15 and 16.
According to an aspect of some embodiments of the present invention there is provided an isolated polynucleotide comprising a nucleic acid sequence encoding the antibody of the invention. According to an aspect of some embodiments of the present invention there is provided a nucleic acid construct comprising the isolated polynucleotide of the invention and a promoter for regulating expression of the isolated polynucleotide in a host cell.
According to an aspect of some embodiments of the present invention there is provided a pharmaceutical composition comprising as an active ingredient the antibody of the invention and a pharmaceutically effective carrier or diluent.
According to an aspect of some embodiments of the present invention there is provided a method of detecting a presence of a CD44vRA polypeptide in a biological sample, comprising contacting the biological sample with the antibody of the invention under conditions which allow immunocomplex formation, wherein a presence and/or a level above a predetermined threshold of the immunocomplex is indicative of the presence of the CD44vRA polypeptide in the biological sample.
According to an aspect of some embodiments of the present invention there is provided a kit for detecting a presence of a CD44vRA polypeptide in a biological sample, comprising the antibody of the invention and at least one reagent suitable for detection of an immunocomplex between the antibody and the CD44vRA polypeptide. According to an aspect of some embodiments of the present invention there is provided a method of diagnosing a disease associated with expression of a CD44vRA polypeptide, comprising contacting a biological sample of a subject with the antibody of the invention under conditions which allow immunocomplex formation, wherein a presence or a level above a predetermined threshold of the immunocomplex is indicative of the disease in the subject.
According to an aspect of some embodiments of the present invention there is provided a kit for diagnosing a disease associated with expression of a CD44vRA polypeptide, comprising the antibody of the invention, at least one reagent suitable for detection of an immunocomplex and instructions for use in diagnosing the disease associated with expression of the CD44vRA polypeptide.
According to an aspect of some embodiments of the present invention there is provided a method of treating a disease associated with expression of a CD44vRA polypeptide, comprising administering to a subject the antibody of the invention or the pharmaceutical composition of the invention, thereby treating the disease associated with expression of the CD44vRA polypeptide.
According to some embodiments of the invention, a heavy chain of the antibody is encoded by the nucleic acid sequence set forth by SEQ ID NO:1.
According to some embodiments of the invention, a light chain of the antibody is encoded by the nucleic acid sequence set forth by SEQ ID NO:3. According to some embodiments of the invention, the antibody being conjugated to a therapeutic moiety.
According to some embodiments of the invention, the antibody being conjugated to a detectable moiety.
According to some embodiments of the invention, the biological sample is selected from the group consisting of a synovial fluid sample, a blood sample, a bone marrow sample, a tissue biopsy sample and a lymph fluid sample.
According to some embodiments of the invention, the disease associated with expression of a CD44vRA polypeptide is selected from the group consisting of a rheumatoid disease, an inflammatory disease, an autoimmune disease and a cancerous disease. According to some embodiments of the invention, the CD44vRA polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 22.
According to some embodiments of the invention, the rheumatoid disease is selected from the group consisting of rheumatoid arthritis (RA), psoriatic arthritis (PSA), spondyloarthropathy (SPA), juvenile rheumatoid arthritis (JRA), chronic Reiter's syndrome (CRS), palindrome rheumatism (PR), inflammatory bowel disease (IBD), infected rheumatic disease (IRD), seronegative rheumatoid arthritis (SRA), Gout, and non-diagnosed arthritis.
Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below. In case of conflict, the patent specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.
BRIEF DESCRIPTION OF THE DRAWINGS
The invention is herein described, by way of example only, with reference to the accompanying drawings. With specific reference now to the drawings in detail, it is stressed that the particulars shown are by way of example and for purposes of illustrative discussion of the preferred embodiments of the present invention only, and are presented in the cause of providing what is believed to be the most useful and readily understood description of the principles and conceptual aspects of the invention.
In this regard, no attempt is made to show structural details of the invention in more detail than is necessary for a fundamental understanding of the invention, the description taken with the drawings making apparent to those skilled in the art how the several forms of the invention may be embodied in practice.
In the drawings:
FIGs. IA-D depict the nucleic acid (Figures IA, C) and amino acid (Figures IB, D) sequences of the anti CD44vRA antibody according to some embodiments of the invention. Figure IA - nucleic acid sequence of the antibody heavy chain (SEQ ID NO:1). Note the complementarity determining regions (CDRs, in red): CDRl (SEQ ID NO:5), CDR2 (SEQ ID NO:6) and CDR3 (SEQ ID NO:7); Figure IB - amino acid sequence of the antibody heavy chain (SEQ ID NO:2), note CDRl (SEQ ID NO:8), CDR2 (SEQ ID NO:9) and CDR3 (SEQ ID NO:10) in red; Figure 1C - nucleic acid sequence of the antibody light chain (SEQ ID NO:3), note CDRl (SEQ ID NO: 11), CDR2 (SEQ ID NO: 12) and CDR3 (SEQ ID NO: 13) in red; Figure ID - amino acid sequence of the antibody light chain (SEQ ID NO:4), note CDRl (SEQ ID NO: 14), CDR2 (SEQ ID NO: 15) and CDR3 (SEQ ID NO: 16) in red; CDR landmarks are shown in green.
DESCRIPTION OF THE PREFERRED EMBODIMENTS The invention in some embodiments thereof relates to an antibody which specifically binds the novel CD44vRA variant, polynucleotides encoding same and methods and kits using same for diagnosing and treating diseases associated with expression of the novel CD44vRA variant such as inflammatory, autoimmune, rheumatic and malignant diseases. The principles and operation of the present invention may be better understood with reference to the drawings and accompanying descriptions.
Before explaining at least one embodiment of the invention in detail, it is to be understood that the invention is not limited in its application to the details set forth in the following description or exemplified by the Examples. The invention is capable of other embodiments or of being practiced or carried out in various ways. Also, it is to be understood that the phraseology and terminology employed herein is for the purpose of description and should not be regarded as limiting.
While reducing the present invention to practice, the present inventors have uncovered a novel antibody which specifically binds the CD44vRA variant (SEQ ID NO:22) present in synovial fluid cells of rheumatoid arthritis (RA) but not other CD44 variants such as the CD44 standard (hematopoietic form; SEQ ID NO: 18) and CD44v3- vlO variant (SEQ ID NO:20).
As shown in the Examples section which follows, the novel CD44vRA antibody identified herein comprises complementarity determining regions (CDRs) amino acid sequences as set forth in SEQ ID NOs: 8, 9 and 10 for the antibody heavy chain and SEQ ID NOs: 14, 15 and 16 for the antibody light chain (Figures IA-D). Such an antibody can be used for diagnosing and treating various diseases associated with expression of the CD44vRA variant such as rheumatic, inflammatory, autoimmune and cancerous diseases.
Thus, according to an aspect of some embodiments of the invention, there is provided an isolated antibody comprising an antigen recognition domain which comprises complementarity determining region (CDR) amino acid sequences as set forth in SEQ ID NOs:8, 9 and 10 for an heavy chain of the antibody and SEQ ID NOs: 14, 15 and 16 for a light chain of the antibody.
The term "antibody" as used in this invention includes intact molecules as well as functional fragments thereof, such as Fab, F(ab')2, and Fv that are capable of binding to macrophages. These functional antibody fragments are defined as follows: (1) Fab, the fragment which contains a monovalent antigen-binding fragment of an antibody molecule, can be produced by digestion of whole antibody with the enzyme papain to yield an intact light chain and a portion of one heavy chain; (2) Fab', the fragment of an antibody molecule that can be obtained by treating whole antibody with pepsin, followed by reduction, to yield an intact light chain and a portion of the heavy chain; two Fab' fragments are obtained per antibody molecule; (3) (Fab")2, the fragment of the antibody that can be obtained by treating whole antibody with the enzyme pepsin without subsequent reduction; F(ab")2 is a dimer of two Fab' fragments held together by two disulfide bonds; (4) Fv, defined as a genetically engineered fragment containing the variable region of the light chain and the variable region of the heavy chain expressed as two chains; and (5) Single chain antibody ("SCA"), a genetically engineered molecule containing the variable region of the light chain and the variable region of the heavy chain, linked by a suitable polypeptide linker as a genetically fused single chain molecule. Methods of producing polyclonal and monoclonal antibodies as well as fragments thereof are well known in the art (See for example, Harlow and Lane,
Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, New York, 1988, incorporated herein by reference).
Antibody fragments according to the present invention can be prepared by proteolytic hydrolysis of the antibody or by expression in E. coli or mammalian cells (e.g. Chinese hamster ovary cell culture or other protein expression systems) of DNA encoding the fragment. Antibody fragments can be obtained by pepsin or papain digestion of whole antibodies by conventional methods. For example, antibody fragments can be produced by enzymatic cleavage of antibodies with pepsin to provide a 5S fragment denoted F(ab*)2. This fragment can be further cleaved using a thiol reducing agent, and optionally a blocking group for the sulfhydryl groups resulting from cleavage of disulfide linkages, to produce 3.5S Fab' monovalent fragments. Alternatively, an enzymatic cleavage using pepsin produces two monovalent Fab' fragments and an Fc fragment directly. These methods are described, for example, by Goldenberg, US Patent Nos. 4,036,945 and 4,331,647, and references contained therein, which patents are hereby incorporated by reference in their entirety. See also Porter, R. R. [Biochem. J. 73: 119-126 (1959)]. Other methods of cleaving antibodies, such as separation of heavy chains to form monovalent light-heavy chain fragments, further cleavage of fragments, or other enzymatic, chemical, or genetic techniques may also be used, so long as the fragments bind to the antigen that is recognized by the intact antibody.
Fv fragments comprise an association of VH and VL chains. This association may be noncovalent, as described in Inbar et al. [Proc. Natl Acad. Sci. USA 69:2659-62 (1972O]. Alternatively, the variable chains can be linked by an intermolecular disulfide bond or cross-linked by chemicals such as glutaraldehyde. Preferably, the Fv fragments comprise VH and VL chains connected by a peptide linker. These single-chain antigen binding proteins (sFv) are prepared by constructing a structural gene comprising DNA sequences encoding the VH and VL domains connected by an oligonucleotide. The structural gene is inserted into an expression vector, which is subsequently introduced into a host cell such as E. coli. The recombinant host cells synthesize a single polypeptide chain with a linker peptide bridging the two V domains. Methods for producing sFvs are described, for example, by [Whitlow and Filpula, Methods 2: 97-105 (1991); Bird et al., Science 242:423-426
(1988); Pack et al., Bio/Technology 11:1271-77 (1993); and US Patent No. 4,946,778, which is hereby incorporated by reference in its entirety.
Another form of an antibody fragment is a peptide coding for a single complementarity-determining region (CDR). CDR peptides ("minimal recognition units") can be obtained by constructing genes encoding the CDR of an antibody of interest. Such genes are prepared, for example, by using the polymerase chain reaction to synthesize the variable region from RNA of antibody-producing cells. See, for example, Larrick and Fry [Methods, 2: 106-10 (1991)].
Humanized forms of non-human (e.g., murine) antibodies are chimeric molecules of immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab').sub.2 or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human immunoglobulin. Humanized antibodies include human immunoglobulins (recipient antibody) in which residues form a complementary determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity and capacity. In some instances, Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues. Humanized antibodies may also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin [Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature, 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol., 2:593-596 (1992)].
Methods for humanizing non-human antibodies are well known in the art. Generally, a humanized antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as import residues, which are typically taken from an import variable domain. Humanization can be essentially performed following the method of Winter
and co-workers [Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988)], by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. Accordingly, such humanized antibodies are chimeric antibodies (US Patent No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In practice, humanized antibodies are typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies. Human antibodies can also be produced using various techniques known in the art, including phage display libraries [Hoogenboom and Winter, J. MoI. Biol., 227:381 (1991); Marks et al., J. MoI. Biol., 222:581 (1991)]. The techniques of Cole et al. and Boerner et al. are also available for the preparation of human monoclonal antibodies (Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985) and Boerner et al., J. Immunol., 147(l):86-95 (1991)]. Similarly, human antibodies can be made by introduction of human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in US Patent Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,661,016, and in the following scientific publications: Marks et al., Bio/Technology 10,: 779-783 (1992); Lonberg et al., Nature 368: 856-859 (1994); Morrison, Nature 368 812-13 (1994); Fishwild et al., Nature Biotechnology 14, 845-51 (1996); Neuberger, Nature Biotechnology 14: 826 (1996); and Lonberg and Huszar, Intern. Rev. Immunol. 13, 65-93 (1995).
It will be appreciated that once the CDRs of an antibody are identified, using genetic engineering techniques, expressible polynucleotides (e.g., a polynucleotide which comprises the nucleic acid sequence set forth by SEQ ID NO: 3 encoding the antibody light chain; a polynucleotide which comprises the nucleic acid sequence set forth by SEQ ID NO:1 encoding the antibody heavy chain) encoding any of the forms or fragments of antibodies described herein can be devised and modified in one of many
ways in order to produce a spectrum of related-products as further described herein below. For example, the isolated polynucleotide(s) can be included in a nucleic acid construct which includes a promoter sequence for regulating expression of the isolated polynucleotide in a host cell. The promoter can direct transcription of the polynucleotide in a host cell in a constitutive or inducible manner. Non-limiting examples of constitutive promoters include the cytomegalovirus (CMV) and Rous sarcoma virus (RSV).
The nucleic acid construct may further include sequences which render this vector suitable for replication and integration in prokaryotes, eukaryotes, or preferably both (e.g., shuttle vectors); transcription and translation initiation sequence, transcription and translation terminator and a polyadenylation signal; a signal sequence for secretion of the peptide from a host cell in which it is placed; enhancer elements; other specialized elements intended to increase the level of expression of cloned nucleic acids or to facilitate the identification of cells that carry the recombinant DNA; sequences that allow, for example, the translation of several proteins from a single mRNA such as an internal ribosome entry site (IRES) and sequences for genomic integration of the promoter-chimeric polypeptide.
Recovery of the recombinant antibody is effected following an appropriate time in culture. The phrase "recovering the recombinant antibody" refers to collecting the whole fermentation medium containing the antibody and need not imply additional steps of separation or purification. Not withstanding the above, the recombinant antibody of the invention can be purified using a variety of standard protein purification techniques, such as, but not limited to, affinity chromatography, ion exchange chromatography, filtration, electrophoresis, hydrophobic interaction chromatography, gel filtration chromatography, reverse phase chromatography, concanavalin A chromatography, chromatofocusing and differential solubilization.
The antibody of some embodiments of the present invention can be used in vitro, ex vivo and in vivo in various therapeutic or diagnostic applications.
In case the antibody of the invention is to be used for administration into an individual (e.g., human), the human or humanized antibody or antibody fragment will generally tend to be better tolerated immunologically than one of non human origin since non variable portions of non human antibodies will tend to trigger xenogeneic
immune responses more potent than the allogeneic immune responses triggered by human antibodies which will typically be allogeneic with the individual. It will be preferable to minimize such immune responses since these will tend to shorten the half- life, and hence the effectiveness, of the antibody of the invention in the individual. Furthermore, such immune responses may be pathogenic to the individual, for example by triggering harmful inflammatory reactions.
Alternately, an antibody or antibody fragment of human origin, or a humanized antibody, will also be advantageous for applications in which a functional physiological effect, for example an immune response against a target cell, activated by a constant region of the antibody or antibody fragment in the individual is desired. For example, for applications including targeted cell killing a specific immune response is advantageous. Such applications particularly include those in which the functional interaction between a functional portion of the antibody or antibody fragment, such as an Fc region, with a molecule such as an Fc receptor or an Fc-binding complement component, is optimal when such a functional portion is, similarly to the Fc region, of human origin.
Depending on the application and purpose, the antibody of the invention which includes a constant region, or a portion thereof, of any of various isotypes may be employed. Preferably, the isotype is selected so as to enable or inhibit a desired physiological effect, or to inhibit an undesired specific binding of the antibody of the present invention via the constant region or portion thereof. For example, for inducing antibody-dependent cell mediated cytotoxicity (ADCC) by a natural killer (NK) cell, the isotype will preferably be IgG; for inducing ADCC by a mast cell/basophil, the isotype will preferably be IgE; and for inducing ADCC by an eosinophil, the isotype will preferably be IgE or IgA. For inducing a complement cascade the antibody or antibody fragment includes a constant region or portion thereof capable of initiating the cascade. For example, the antibody or antibody fragment may advantageously comprise a Cgamma2 domain of IgG or Cmu3 domain of IgM to trigger a Clq-mediated complement cascade. Conversely, for avoiding an immune response, such as the aforementioned one, or for avoiding a specific binding via the constant region or portion thereof, the
antibody of the present invention will preferably not comprise a constant region, or a portion thereof, of the relevant isotype.
The antibody or antibody fragment of the invention may be attached to any of various functional moieties (e.g., therapeutic or diagnostic moieties). The functional moiety can be conjugated by translationally fusing a polynucleotide encoding the antibody with a polynucleotide encoding the functional moiety.
Additionally or alternatively, the functional moiety can be chemically conjugated (coupled) to the antibody of the invention, using any conjugation method known to one skilled in the art. For example, a peptide can be conjugated to an antibody of interest, using a 3-(2-pyridyldithio)propionic acid Nhydroxysuccinimide ester (also called N-succinimidyl 3-(2pyridyldithio) propionate) ("SDPD") (Sigma, Cat. No. P-
3415; see e.g., Cumber et al. 1985, Methods of Enzymology 112: 207-224), a glutaraldehyde conjugation procedure (see e.g., G.T. Hermanson 1996, "Antibody
Modification and Conjugation, in Bioconjugate Techniques, Academic Press, San Diego) or a carbodiimide conjugation procedure [see e.g., J. March, Advanced Organic
Chemistry: Reaction's, Mechanism, and Structure, pp. 349-50 & 372-74 (3d ed.), 1985;
B. Neises et al. 1978, Angew Chem., Int. Ed. Engl. 17:522; A. Hassner et al. 1978,
Tetrahedron Lett. 4475; E.P. Boden et al. 1986, J. Org. Chem. 50:2394 and LJ.
Mathias 1979, Synthesis 561]. According to some embodiments of the invention, the functional moiety is a therapeutic moiety.
The therapeutic moiety can be, for example, a cytotoxic moiety, a toxic moiety
[e.g., Pseudomonas exotoxin (GenBank Accession Nos. AAB25018 and S53109);
PE38KDEL; Diphtheria toxin (GenBank Accession Nos. E00489 and E00489); Ricin A toxin (GenBank Accession Nos. 225988 and A23903)], a cytokine moiety [e.g., interleukin 2 (GenBank Accession Nos. CAA00227 and A02159), interleukin 10
(GenBank Accession Nos. P22301 and M57627)], or a bi-specific antibody moiety (see e.g., Withoff, S., Helfrich, W., de Leij, LF., Molema, G. (2001) Curr Opin MoI Ther.
3,:53-62). An antibody or antibody fragment attached to a toxin may be referred to in the art as an "immunotoxin".
According to some embodiments of the invention, the functional moiety is a detectable moiety which enables specific detection of an immunocomplex formed
between the CD44vRA polypeptide and the antibody or antibody fragment of the invention.
The detectable moiety can be a label which is directly visualized [e.g., radioactive isotopes (e.g., ^125Hodine), phosphorescent chemicals, chemiluminescent chemicals, fluorescent chemicals].
Examples of suitable fluorescent molecules include, but are not limited to, phycoerythrin (PE), fluorescein isothiocyanate (FITC; e.g., GenBank Accession Nos. AAF22695 and AF098239), Cy-chrome, rhodamine, green fluorescent protein (GFP; e.g., GenBank Accession Nos. AAL33912 and AF435427), blue fluorescent protein (BFP), orange fluorescent protein (; e.g., GenBank Accession Nos. AAL33917 and AF435432), Texas red, PE-Cy5, and the like.
Ample guidance regarding fluorophore selection, methods of linking fluorophores to various types of molecules, such as an antibody or antibody fragment of the invention, and methods of using such conjugates to detect molecules which are capable of being specifically bound by antibodies or antibody fragments comprised in such immunoconjugates is available in the literature of the art [for example, refer to: Richard P. Haugland, "Molecular Probes: Handbook of Fluorescent Probes and Research Chemicals 1992-1994", 5th ed., Molecular Probes, Inc. (1994); US Patent. No. 6,037,137 to Oncoimmunin Inc.; Hermanson, "Biocoηjugate Techniques", Academic Press New York, N.Y. (1995); Kay M. et al, 1995. Biochemistry 34:293; Stubbs et al, 1996. Biochemistry 35:937; Gakamsky D. et al, "Evaluating Receptor Stoichiometry by Fluorescence Resonance Energy Transfer," in "Receptors: A Practical Approach," 2nd ed., Stanford C. and Horton R. (eds.), Oxford University Press, UK. (2001); U.S. Pat. No. 6,350,466 to Targesome, Inc.]. Additionally or alternatively, the detectable moiety can be a member of a binding (affinity) pair, which is identifiable via its interaction with an additional member of the binding pair. It should be noted that any of members of the binding pair can be labeled. In one example, the member of the binding pair is an antigen (e.g., a tag such as a Myc of Histidine tag) which is identified by a corresponding labeled antibody. In one example, the member of the binding pair is a biotin molecule which binds to streptavidin or avidin molecules. In one example, the label is a fluorescent protein or an enzyme producing a colorimetric reaction. Non-limiting examples of suitable enzymes
include horseradish peroxidase (HPR), peroxidase (e.g., GenBank Accession Nos.
NP_568674 and NM_124071), beta-galactosidase (e.g., GenBank Accession Nos.
NP_201186 and NM_125776), and alkaline phosphatase (AP; e.g., GenBank Accession
Nos. AAK73766 and AY042185) and their substrates. Depending on the application and purpose, a detectable moiety which comprises a fluorophore or results in activation of a fluorescent molecule can be used in numerous fluorescence detection methods such as fluorescence activated flow cytometry (FACS), immunofluorescence, fluorescence resonance energy transfer (FRET), and the like.
Other detectable moieties (e.g., radioactive molecules or chemiluminescent chemicals) can be used in Western blot analysis and radioimmuno assay (RIA).
Detection methods which utilize enzymes include, but are not limited to, enzyme linked immunosorbent assay (ELISA which can be performed to detect the CD44vRA polypeptide in a solution), enzyme-linked chemiluminescence assay (for example, to detect the CD44vRA polypeptide in an electrophoretically separated protein mixture), and enzyme-linked immunohistochemical assay (for example, to detect the CD44vRA polypeptide in a fixed tissue). Ample guidance for practicing enzyme-based detection methods is provided in the literature of the art (for example, refer to: Khatkhatay MI. and Desai M., 1999. J Immunoassay 20:151-83; Wisdom GB., 1994. Methods MoI Biol.
32:433-40; Ishikawa E. et al, 1983. J Immunoassay 4:209-327; Oellerich M., 1980. J Clin Chem Clin Biochem. 18:197-208; Schuurs AH. and van Weemen BK., 1980. J
Immunoassay 1:229-49).
As mentioned, the antibody of the invention can be used to detect the CD44vRA polypeptide in a biological sample.
Thus, according to another aspect of the invention there is provided a method of detecting a presence of a CD44vRA polypeptide in a biological sample. The method is effected by contacting the biological sample with the antibody of the invention under conditions which allow immunocomplex formation, wherein a presence or a level above a predetermined threshold of the immunocomplex is indicative of the presence of the
CD44vRA polypeptide in the biological sample. Contacting the biological sample with antibody of the invention may be effected in vitro (e.g., in a cell line), ex vivo or in vivo.
The biological sample can be any sample comprising cells or portion thereof (e.g., a portion of a cell membrane) which is derived from a subject. Examples include, but are not limited to a synovial fluid sample, a blood sample, a bone marrow sample, lymph fluid, a tissue biopsy sample such as synovial membrane tissue (SMTs) and splenocytes. It should be noted that for in vivo detection the biological sample may not be physically removed from the subject.
Procedures for obtaining biological samples from individuals are well known in the art. Such procedures include, but are not limited to, drawing blood (e.g., of a vein, umbilical cord), bone biopsy, lymph node biopsy, pleural biopsy, skin biopsy, thyroid biopsy, CT-guided biopsy, joint biopsy (e.g., of the knee), needle aspiration biopsy and breast biopsy. These and other procedures for obtaining tissue or fluid biopsies are described in details in Hypertext Transfer Protocol://World Wide Web (dot) healthatoz (dot) com/healthatoz/Atoz/search (dot) asp.
For example, a joint biopsy (a sample of the joint lining, synovial membrane or fluid) can be obtained by introducing an incision in the joint and withdrawing fluid using a needle attached to a syringe.
As mentioned, contacting is performed under conditions sufficient to form an immunocomplex (e.g. a complex between the antibody of the invention and the
CD44vRA polypeptide); such conditions (e.g., appropriate concentrations, buffers, temperatures, reaction times) as well as methods of optimize same are known to those skilled in the art.
The immunocomplex can be formed and detected on a cell surface, e.g., a cell membrane or a portion thereof (such as a ruptured membrane) which includes the CD44vRA polypeptide. Determining a presence or level of the immunocomplex is dependent on the detectable moiety attached to the antibody, essentially as described hereinabove.
Since the CD44vRA polypeptide (SEQ ID NO:22) is not expressed in or on cells of normal (healthy) individuals its presence and/or level in cells of a subject can be used to diagnose a disease associated with CD44vRA expression, such as an inflammatory disease, allergic disease, rheumatoid disease, autoimmune disease, graft rejection disease or a cancer disease.
As used herein the term "subject" refers to a mammal, preferably, a male or female human subject.
As used herein the phrase "disease associated with expression of the CD44vRA polypeptide" refers to any disease characterized by expression (Le., presence, e.g., above a predetermined threshold) of the CD44vRA polypeptide in cells of the affected subject.
It should be noted that the predetermined threshold is determined in comparison to a level of the CD44vRA polypeptide in a control biological sample such as of an unaffected subject (Le., a healthy subject-free of the disease, same subject being in remission or prior to disease initiation) or based upon literature data.
According to some embodiments of the invention, the inflammatory disease is associated with hypersensitivity.
Examples of hypersensitivity include, but are not limited to, Type I hypersensitivity, Type II hypersensitivity, Type III hypersensitivity, Type IV hypersensitivity, immediate hypersensitivity, antibody mediated hypersensitivity, immune complex mediated hypersensitivity, T lymphocyte mediated hypersensitivity and DTH.
A non-limiting example of Type I or immediate hypersensitivity, is asthma.
Type II and type III hypersensitivity include, but are not limited to, rheumatoid diseases, rheumatoid autoimmune diseases, rheumatoid arthritis (Krenn V. et al, Histol
Histopathol 2000 Jul;15 (3):791), spondylitis, ankylosing spondylitis (Jan Voswinkel et al, Arthritis Res 2001; 3 (3): 189), systemic diseases, systemic autoimmune diseases, systemic lupus erythematosus (Erikson J. et al, Immunol Res 1998;17 (l-2):49), sclerosis, systemic sclerosis (Renaudineau Y. et al., Clin Diagn Lab Immunol. 1999 Mar;6 (2):156); Chan OT. et al, Immunol Rev 1999 Jun;169:107), glandular diseases, glandular autoimmune diseases, pancreatic autoimmune diseases, diabetes, Type I diabetes (Zimmet P. Diabetes Res Clin Pract 1996 Oct;34 Suppl:S125), thyroid diseases, autoimmune thyroid diseases, Graves' disease (Orgiazzi J. Endocrinol Metab
Clin North Am 2000 Jun;29 (2):339), thyroiditis, spontaneous autoimmune thyroiditis (Braley-Mullen H. and Yu S, J Immunol 2000 Dec 15;165 (12):7262), Hashimoto's thyroiditis (Toyoda N. et al, Nippon Rinsho 1999 Aug;57 (8): 1810), myxedema, idiopathic myxedema (Mitsuma T. Nippon Rinsho. 1999 Aug;57 (8): 1759);
autoimmune reproductive diseases, ovarian diseases, ovarian autoimmunity (Garza KM. et al, J Reprod Immunol 1998 Feb;37 (2):87), autoimmune anti-sperm infertility (Diekman AB. et al, Am J Reprod Immunol. 2000 Mar;43 (3): 134), repeated fetal loss (Tincani A. et al, Lupus 1998;7 Suppl 2:S 107-9), neurodegenerative diseases, neurological diseases, neurological autoimmune diseases, multiple sclerosis (Cross AH. et al, J Neuroimmunol 2001 Jan 1;112 (1-2):1), Alzheimer's disease (Oron L. et al, J Neural Transm Suppl. 1997;49:77), myasthenia gravis (Infante AJ. And Kraig E, Int Rev Immunol 1999; 18 (l-2):83), motor neuropathies (Kornberg AJ. J Clin Neurosci. 2000 May;7 (3): 191), Guillain-Barre syndrome, neuropathies and autoimmune neuropathies (Kusunoki S. Am J Med Sci. 2000 Apr;319 (4):234), myasthenic diseases, Lambert-Eaton myasthenic syndrome (Takamori M. Am J Med Sci. 2000 Apr;319 (4):204), paraneoplastic neurological diseases, cerebellar atrophy, paraneoplastic cerebellar atrophy, non-paraneoplastic stiff man syndrome, cerebellar atrophies, progressive cerebellar atrophies, encephalitis, Rasmussen's encephalitis, amyotrophic lateral sclerosis, Sydenham chorea, Gilles de Ia Tourette syndrome, polyendocrinopathies, autoimmune polyendocrinopathies (Antoine JC. and Honnorat J. Rev Neurol (Paris) 2000 Jan; 156 (1):23); neuropathies, dysimmune neuropathies (Nobile-Orazio E. et al, Electroencephalogr Clin Neurophysiol Suppl 1999;50:419); neuromyotonia, acquired neuromyotonia, arthrogryposis multiplex congenita (Vincent A. et al, Ann N Y Acad Sci. 1998 May 13;841:482), cardiovascular diseases, cardiovascular autoimmune diseases, atherosclerosis (Matsuura E. et al, Lupus. 1998;7 Suppl 2:S135), myocardial infarction (Vaarala O. Lupus. 1998;7 Suppl 2:S132), thrombosis (Tincani A. et al, Lupus 1998;7 Suppl 2:S107-9), granulomatosis, Wegener's granulomatosis, arteritis, Takayasu's arteritis and Kawasaki syndrome (Praprotnik S. et al, Wien Klin Wochenschr 2000 Aug 25;112 (15-16):660); anti-factor VIII autoimmune disease (Lacroix-Desmazes S. et al, Semin Thromb Hemost.2000;26 (2): 157); vasculitises, necrotizing small vessel vasculitises, microscopic polyangiitis, Churg and Strauss syndrome, glomerulonephritis, pauci-immune focal necrotizing glomerulonephritis, crescentic glomerulonephritis (Noel LH. Ann Med Interne (Paris). 2000 May; 151 (3): 178); antiphospholipid syndrome (Flamholz R. et al, J Clin Apheresis 1999;14 (4): 171); heart failure, agonist-like beta-adrenoceptor antibodies in heart failure (Wallukat G. et al, Am J Cardiol. 1999 Jun 17;83 (12A):75H),
thrombocytopenic purpura (Moccia F. Ann Ital Med Int. 1999 Apr-Jun;14 (2): 114); hemolytic anemia, autoimmune hemolytic anemia (Efremov DG. et al, Leuk Lymphoma 1998 Jan;28 (3-4):285), gastrointestinal diseases, autoimmune diseases of the gastrointestinal tract, intestinal diseases, chronic inflammatory intestinal disease (Garcia Herola A. et al, Gastroenterol Hepatol. 2000 Jan;23 (1):16), celiac disease (Landau YE. and Shoenfeld Y. Harefuah 2000 Jan 16; 138 (2): 122), autoimmune diseases of the musculature, myositis, autoimmune myositis, Sjogren's syndrome (Feist E. et al, Int Arch Allergy Immunol 2000 Sep;123 (1):92); smooth muscle autoimmune disease (Zauli D. et al, Biomed Pharmacother 1999 Jun;53 (5-6):234), hepatic diseases, hepatic autoimmune diseases, autoimmune hepatitis (Manns MP. J Hepatol 2000 Aug; 33 (2):326) and primary biliary cirrhosis (Strassburg CP. et al, Eur J Gastroenterol Hepatol. 1999 Jun; 11 (6):595).
Type IV or T cell mediated hypersensitivity, include, but are not limited to, rheumatoid diseases, rheumatoid arthritis (Tisch R, McDevitt HO. Proc Natl Acad Sci U S A 1994 Jan 18; 91 (2):437), systemic diseases, systemic autoimmune diseases, systemic lupus erythematosus (Datta SK., Lupus 1998; 7 (9):591), glandular diseases, glandular autoimmune diseases, pancreatic diseases, pancreatic autoimmune diseases, Type 1 diabetes (Castano L. and Eisenbarth GS. Ann. Rev. Immunol. 8:647); thyroid diseases, autoimmune thyroid diseases, Graves' disease (Sakata S. et al, MoI Cell Endocrinol 1993 Mar; 92 (1):77); ovarian diseases (Garza KM. et al, J Reprod Immunol 1998 Feb; 37 (2):87), prostatitis, autoimmune prostatitis (Alexander RB. et al, Urology 1997 Dec; 50 (6):893), polyglandular syndrome, autoimmune polyglandular syndrome, Type I autoimmune polyglandular syndrome (Hara T. et al, Blood. 1991 Mar 1; 77 (5): 1127), neurological diseases, autoimmune neurological diseases, multiple sclerosis, neuritis, optic neuritis (Soderstrom M. et al, J Neurol Neurosurg Psychiatry 1994 May; 57 (5):544), myasthenia gravis (Oshima M. et al, Eur J Immunol 1990 Dec; 20 (12):2563), stiff-man syndrome (Hiemstra HS. et al, Proc Natl Acad Sci U S A 2001 Mar 27; 98 (7):3988), cardiovascular diseases, cardiac autoimmunity in Chagas' disease (Cunha-Neto E. et al, J Clin Invest 1996 Oct 15; 98 (8): 1709), autoimmune thrombocytopenic purpura (Semple JW. et al, Blood 1996 May 15; 87 (10):4245), anti-helper T lymphocyte autoimmunity (Caporossi AP. et al, Viral Immunol 1998; 11 (1):9), hemolytic anemia (Sallah S. et al, Ann Hematol 1997 Mar;
74 (3): 139), hepatic diseases, hepatic autoimmune diseases, hepatitis, chronic active hepatitis (Franco A. et al, Clin Immunol Immunopathol 1990 Mar; 54 (3):382), biliary cirrhosis, primary biliary cirrhosis (Jones DE. Clin Sci (Colch) 1996 Nov; 91 (5):551), nephric diseases, nephric autoimmune diseases, nephritis, interstitial nephritis (Kelly CJ. J Am Soc Nephrol 1990 Aug; 1 (2): 140), connective tissue diseases, ear diseases, autoimmune connective tissue diseases, autoimmune ear disease (Yoo TJ. et al, Cell Immunol 1994 Aug; 157 (1):249), disease of the inner ear (Gloddek B. et al, Ann N Y Acad Sci 1997 Dec 29; 830:266), skin diseases, cutaneous diseases, dermal diseases, bullous skin diseases, pemphigus vulgaris, bullous pemphigoid and pemphigus foliaceus. Note that several same diseases can be classified to different classes of hypersensitivity, because the heterogeneity of these diseases.
Examples of delayed type hypersensitivity include, but are not limited to, contact dermatitis and drug eruption.
Examples of types of T lymphocyte mediating hypersensitivity include, but are not limited to, helper T lymphocytes and cytotoxic T lymphocytes.
Examples of helper T lymphocyte-mediated hypersensitivity include, but are not limited to, ThI lymphocyte mediated hypersensitivity and Th2 lymphocyte mediated hypersensitivity.
According to some embodiments of the invention, the disease is rheumatoid disease, including, but not limited to, rheumatoid arthritis (RA), psoriatic arthritis (PSA), spondyloarthropathy (SPA), juvenile rheumatoid arthritis (JRA), chronic Reiter's syndrome (CRS), palindrome rheumatism (PR), inflammatory bowel disease (IBD), infected rheumatic disease (IRD), seronegative rheumatoid arthritis (SRA), Gout, and non-diagnosed arthritis. Autoimmune diseases include, but are not limited to, cardiovascular diseases, rheumatoid diseases, glandular diseases, gastrointestinal diseases, cutaneous diseases, hepatic diseases, neurological diseases, muscular diseases, nephric diseases, diseases related to reproduction, connective tissue diseases and systemic diseases.
Examples of autoimmune cardiovascular diseases include, but are not limited to atherosclerosis (Matsuura E. et al, Lupus. 1998; 7 Suppl 2:S135), myocardial infarction (Vaarala O. Lupus. 1998; 7 Suppl 2:S132), thrombosis (Tincani A. et al, Lupus 1998; 7 Suppl 2:S107-9), Wegener's granulomatosis, Takayasu's arteritis, Kawasaki syndrome
(Praprotnik S. et al, Wien Klin Wochenschr 2000 Aug 25; 112 (15-16):660), anti-factor VIII autoimmune disease (Lacroix-Desmazes S. et al, Semin Thromb Hemost.2000; 26 (2): 157), necrotizing small vessel vasculitis, microscopic polyangiitis, Churg and Strauss syndrome, pauci-immune focal necrotizing and crescentic glomerulonephritis (Noel LH. Ann Med Interne Paris). 2000 May; 151 (3): 178), antiphospholipid syndrome (Flamholz R. et al, J Clin Apheresis 1999; 14 (4):171), antibody-induced heart failure (Wallukat G. et al, Am J Cardiol. 1999 Jun 17; 83 (12A):75H), thrombocytopenic purpura (Moccia F. Ann Ital Med Int. 1999 Apr- Jun; 14 (2):114; Semple JW. et al, Blood 1996 May 15; 87 (10):4245), autoimmune hemolytic anemia (Efremov DG. et al, Leuk Lymphoma 1998 Jan; 28 (3-4):285; Sallah S. et al, Ann Hematol 1997 Mar; 74 (3): 139), cardiac autoimmunity in Chagas' disease (Cunha-Neto E. et al, J Clin Invest 1996 Oct 15; 98 (8): 1709) and anti-helper T lymphocyte autoimmunity (Caporossi AP. et al, Viral Immunol 1998; 11 (1):9). Examples of autoimmune rheumatoid diseases include, but are not limited to rheumatoid arthritis (Krenn V. et al, Histol Histopathol 2000 JuI; 15 (3):791; Tisch R, McDevitt HO. Proc Natl Acad Sci units S A 1994 Jan 18; 91 (2):437) and ankylosing spondylitis (Jan Voswinkel et al, Arthritis Res 2001; 3 (3): 189).
Examples of autoimmune glandular diseases include, but are not limited to, pancreatic disease, Type I diabetes, thyroid disease, Graves' disease, thyroiditis, spontaneous autoimmune thyroiditis, Hashimoto's thyroiditis, idiopathic myxedema, ovarian autoimmunity, autoimmune anti-sperm infertility, autoimmune prostatitis and Type I autoimmune polyglandular syndrome diseases include, but are not limited to autoimmune diseases of the pancreas, Type 1 diabetes (Castano L. and Eisenbarth GS. Ann. Rev. Immunol. 8:647; Zimmet P. Diabetes Res Clin Pract 1996 Oct;34 Suppl:S125), autoimmune thyroid diseases, Graves' disease (Orgiazzi J. Endocrinol Metab Clin North Am 2000 Jun; 29 (2):339; Sakata S. et al, MoI Cell Endocrinol 1993 Mar; 92 (1):77), spontaneous autoimmune thyroiditis (Braley-Mullen H. and Yu S, J Immunol 2000 Dec 15; 165 (12):7262), Hashimoto's thyroiditis (Toyoda N. et al, Nippon Rinsho 1999 Aug; 57 (8): 1810), idiopathic myxedema (Mitsuma T. Nippon Rinsho. 1999 Aug; 57 (8): 1759), ovarian autoimmunity (Garza KM. et al, J Reprod Immunol 1998 Feb; 37 (2):87), autoimmune anti-sperm infertility (Diekman AB. et al,
Am J Reprod Immunol. 2000 Mar; 43 (3): 134), autoimmune prostatitis (Alexander RB. et al, Urology 1997 Dec; 50 (6):893) and Type I autoimmune polyglandular syndrome (Hara T. et al, Blood. 1991 Mar 1; 77 (5):1127).
Examples of autoimmune gastrointestinal diseases include, but are not limited to, chronic inflammatory intestinal diseases (Garcia Herola A. et al, Gastroenterol Hepatol. 2000 Jan; 23 (1):16), celiac disease (Landau YE. and Shoenfeld Y. Harefuah 2000 Jan 16; 138 (2):122), colitis, ileitis and Crohn's disease.
Examples of autoimmune cutaneous diseases include, but are not limited to, autoimmune bullous skin diseases, such as, but are not limited to, pemphigus vulgaris, bullous pemphigoid and pemphigus foliaceus.
Examples of autoimmune hepatic diseases include, but are not limited to, hepatitis, autoimmune chronic active hepatitis (Franco A. et al, Clin Immunol Immunopathol 1990 Mar; 54 (3):382), primary biliary cirrhosis (Jones DE. Clin Sci (Colch) 1996 Nov; 91 (5):551; Strassburg CP. et al, Eur J Gastroenterol Hepatol. 1999 Jun; 11 (6):595) and autoimmune hepatitis (Manns MP. J Hepatol 2000 Aug; 33 (2):326).
Examples of autoimmune neurological diseases include, but are not limited to, multiple sclerosis (Cross AH. et al, J Neuroimmunol 2001 Jan 1; 112 (1-2):1), Alzheimer's disease (Oron L. et al, J Neural Transm Suppl. 1997; 49:77), myasthenia gravis (Infante AJ. And Kraig E, Int Rev Immunol 1999; 18 (l-2):83; Oshima M. et al, Eur J Immunol 1990 Dec; 20 (12):2563), neuropathies, motor neuropathies (Kornberg AJ. J Clin Neurosci. 2000 May; 7 (3):191); Guillain-Barre syndrome and autoimmune neuropathies (Kusunoki S. Am J Med Sci. 2000 Apr;319 (4):234), myasthenia, Lambert-Eaton myasthenic syndrome (Takamori M. Am J Med Sci. 2000 Apr; 319 (4):204); paraneoplastic neurological diseases, cerebellar atrophy, paraneoplastic cerebellar atrophy and stiff-man syndrome (Hiemstra HS. et al, Proc Natl Acad Sci units S A 2001 Mar 27;98 (7):3988); non-paraneoplastic stiff man syndrome, progressive cerebellar atrophies, encephalitis, Rasmussen's encephalitis, amyotrophic lateral sclerosis, Sydenham chorea, Gilles de Ia Tourette syndrome and autoimmune polyendocrinopathies (Antoine JC. and Honnorat J. Rev Neurol (Paris) 2000 Jan;156 (1):23); dysimmune neuropathies (Nobile-Orazio E. et al, Electroencephalogr Clin Neurophysiol Suppl 1999;50:419); acquired neuromyotonia, arthrogryposis multiplex
congenita (Vincent A. et al, Ann N Y Acad Sci. 1998 May 13;841:482), neuritis, optic neuritis (Soderstrom M. et al, J Neurol Neurosurg Psychiatry 1994 May;57 (5):544) and neurodegenerative diseases.
Examples of autoimmune muscular diseases include, but are not limited to, myositis, autoimmune myositis and primary Sjogren's syndrome (Feist E. et al, Int Arch Allergy Immunol 2000 Sep;123 (1):92) and smooth muscle autoimmune disease (Zauli D. et al, Biomed Pharmacother 1999 Jun;53 (5-6):234).
Examples of autoimmune nephric diseases include, but are not limited to, nephritis and autoimmune interstitial nephritis (Kelly CJ. J Am Soc Nephrol 1990 Aug;l (2):140).
Examples of autoimmune diseases related to reproduction include, but are not limited to, repeated fetal loss (Tincani A. et al, Lupus 1998;7 Suppl 2:S107-9).
Examples of autoimmune connective tissue diseases include, but are not limited to, ear diseases, autoimmune ear diseases (Yoo TJ. et al, Cell Immunol 1994 Aug;157 (1):249) and autoimmune diseases of the inner ear (Gloddek B. et al, Ann N Y Acad Sci 1997 Dec 29;830:266).
Examples of autoimmune systemic diseases include, but are not limited to, systemic lupus erythematosus (Erikson J. et al, Immunol Res 1998; 17 (l-2):49) and systemic sclerosis (Renaudineau Y. et al, Clin Diagn Lab Immunol. 1999 Mar;6 (2): 156); Chan OT. et al, Immunol Rev 1999 Jun;169:107).
Infectious diseases include, but are not limited to, chronic infectious diseases, sub-acute infectious diseases, acute infectious diseases, viral diseases, bacterial diseases, protozoan diseases, parasitic diseases, fungal diseases, mycoplasma diseases and prion diseases. Graft rejection diseases include, but are not limited to, graft rejection, chronic graft rejection, sub acute graft rejection, hyper acute graft rejection, acute graft rejection and graft versus host disease.
Allergic diseases include, but are not limited to, asthma, hives, urticaria, pollen allergy, dust mite allergy, venom allergy, cosmetics allergy, latex allergy, chemical allergy, drug allergy, insect bite allergy, animal dander allergy, stinging plant allergy, poison ivy allergy and food allergy.
Cancerous diseases include but are not limited to carcinoma, lymphoma, blastoma, sarcoma, and leukemia. Particular examples of cancerous diseases but are not limited to: Myeloid leukemia such as Chronic myelogenous leukemia. Acute myelogenous leukemia with maturation. Acute promyelocytic leukemia, Acute nonlymphocytic leukemia with increased basophils, Acute monocytic leukemia. Acute myelomonocytic leukemia with eosinophilia; Malignant lymphoma, such as Burkitt's
Non-Hodgkin's; Lymphoctyic leukemia, such as Acute lymphoblastic leukemia,
Chronic lymphocytic leukemia; Myeloproliferative diseases, such as Solid tumors
Benign Meningioma, Mixed tumors of salivary gland, Colonic adenomas; Adenocarcinomas, such as Small cell lung cancer, Kidney, Uterus, Prostate, Bladder,
Ovary, Colon, Sarcomas, Liposarcoma, myxoid, Synovial sarcoma,
Rhabdomyosarcoma (alveolar), Extraskeletal myxoid chondrosarcoma, Ewing's tumor; other include Testicular and ovarian dysgerminoma, Retinoblastoma, Wilms1 tumor,
Neuroblastoma, Malignant melanoma, Mesothelioma, breast, skin, prostate, and ovarian.
Being specific to the VD44vRA polypeptide (SEQ ID NO:22) and not to the CD44std (SEQ ID NO: 18) or CD44v3-vlO (SEQ ID NO:20), the antibody of the invention can be used to treat any of the above mentioned diseases which are associated with expression of the CD44vRA polypeptide. Thus, according to an additional aspect of the present invention there is provided a method of treating a disease associated with expression of a CD44vRA polypeptide. The method is effected by administering to a subject the antibody of the invention.
The term "treating" refers to inhibiting or arresting the development of a disease, disorder or condition and/or causing the reduction, remission, or regression of a disease, disorder or condition. Those of skill in the art will understand that various methodologies and assays can be used to assess the development of a disease, disorder or condition, and similarly, various methodologies and assays may be used to assess the reduction, remission or regression of a disease, disorder or condition.
The antibody of the invention can be administered to an organism per se, or in a pharmaceutical composition where it is mixed with suitable carriers or excipients.
As used herein a "pharmaceutical composition" refers to a preparation of one or more of the active ingredients described herein with other chemical components such as
physiologically suitable carriers and excipients. The purpose of a pharmaceutical composition is to facilitate administration of a compound to an organism.
Herein the term "active ingredient" refers to the antibody of the invention accountable for the biological effect. Hereinafter, the phrases "physiologically acceptable carrier" and
"pharmaceutically acceptable carrier" which may be interchangeably used refer to a carrier or a diluent that does not cause significant irritation to an organism and does not abrogate the biological activity and properties of the administered compound. An adjuvant is included under these phrases. Herein the term "excipient" refers to an inert substance added to a pharmaceutical composition to further facilitate administration of an active ingredient. Examples, without limitation, of excipients include calcium carbonate, calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils and polyethylene glycols. Techniques for formulation and administration of drugs may be found in
"Remington's Pharmaceutical Sciences," Mack Publishing Co., Easton, PA, latest edition, which is incorporated herein by reference.
Suitable routes of administration may, for example, include oral, rectal, transmucosal, especially transnasal, intestinal or parenteral delivery, including intramuscular, subcutaneous and intramedullary injections as well as intrathecal, direct intraventricular, intracardiac, e.g., into the right or left ventricular cavity, into the common coronary artery, intravenous, inrtaperitoneal, intranasal, or intraocular injections.
Alternately, one may administer the pharmaceutical composition in a local rather than systemic manner, for example, via injection of the pharmaceutical composition directly into a tissue region of a patient (e.g., joint tissue).
Pharmaceutical compositions of the present invention may be manufactured by processes well known in the art, e.g., by means of conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping or lyophilizing processes.
Pharmaceutical compositions for use in accordance with the present invention thus may be formulated in conventional manner using one or more physiologically
acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active ingredients into preparations which, can be used pharmaceutically. Proper formulation is dependent upon the route of administration chosen.
For injection, the active ingredients of the pharmaceutical composition may be formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological salt buffer. For transmucosal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art.
For oral administration, the pharmaceutical composition can be formulated readily by combining the active compounds with pharmaceutically acceptable carriers well known in the art. Such carriers enable the pharmaceutical composition to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions, and the like, for oral ingestion by a patient. Pharmacological preparations for oral use can be made using a solid excipient, optionally grinding the resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries if desired, to obtain tablets or dragee cores. Suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carbomethylcellulose; and/or physiologically acceptable polymers such as polyvinylpyrrolidone (PVP). If desired, disintegrating agents may be added, such as cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate.
Dragee cores are provided with suitable coatings. For this purpose, concentrated sugar solutions may be used which may optionally contain gum arabic, talc, polyvinyl pyrrolidone, carbopol gel, polyethylene glycol, titanium dioxide, lacquer solutions and suitable organic solvents or solvent mixtures. Dyestuffs or pigments may be added to the tablets or dragee coatings for identification or to characterize different combinations of active compound doses.
Pharmaceutical compositions which can be used orally, include push-fit capsules made of gelatin as well as soft, sealed capsules made of gelatin and a plasticizer, such as glycerol or sorbitol. The push-fit capsules may contain the active ingredients in admixture with filler such as lactose, binders such as starches, lubricants such as talc or
magnesium stearate and, optionally, stabilizers. In soft capsules, the active ingredients may be dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols. In addition, stabilizers may be added. All formulations for oral administration should be in dosages suitable for the chosen route of administration. For buccal administration, the compositions may take the form of tablets or lozenges formulated in conventional manner.
For administration by nasal inhalation, the active ingredients for use according to the present invention are conveniently delivered in the form of an aerosol spray presentation from a pressurized pack or a nebulizer with the use of a suitable propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane, dichloro-tetrafluoroethane or carbon dioxide. In the case of a pressurized aerosol, the dosage unit may be determined by providing a valve to deliver a metered amount. Capsules and cartridges of, e.g., gelatin for use in a dispenser may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch. The pharmaceutical composition described herein may be formulated for parenteral administration, e.g., by bolus injection or continuous infusion. Formulations for injection may be presented in unit dosage form, e.g., in ampoules or in multidose containers with optionally, an added preservative. The compositions may be suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
Pharmaceutical compositions for parenteral administration include aqueous solutions of the active preparation in water-soluble form. Additionally, suspensions of the active ingredients may be prepared as appropriate oily or water based injection suspensions. Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acids esters such as ethyl oleate, triglycerides or liposomes. Aqueous injection suspensions may contain substances, which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol or dextran. Optionally, the suspension may also contain suitable stabilizers or agents which increase the solubility of the active ingredients to allow for the preparation of highly concentrated solutions.
Alternatively, the active ingredient may be in powder form for constitution with a suitable vehicle, e.g., sterile, pyrogen-free water based solution, before use.
The pharmaceutical composition of the present invention may also be formulated in rectal compositions such as suppositories or retention enemas, using, e.g., conventional suppository bases such as cocoa butter or other glycerides.
Pharmaceutical compositions suitable for use in context of the present invention include compositions wherein the active ingredients are contained in an amount effective to achieve the intended purpose. More specifically, a therapeutically effective amount means an amount of active ingredients (Le., the antibody of the invention) effective to prevent, alleviate or ameliorate symptoms of a disease (e.g., inflammatory or rheumatoid disease) or prolong the survival of the subject being treated. Determination of a therapeutically effective amount is well within the capability of those skilled in the art, especially in light of the detailed disclosure provided herein.
For any preparation used in the methods of the invention, the therapeutically effective amount or dose can be estimated initially from in vitro and cell culture assays.
For example, a dose can be formulated in animal models to achieve a desired concentration or titer. Such information can be used to more accurately determine useful doses in humans.
Toxicity and therapeutic efficacy of the active ingredients described herein can be determined by standard pharmaceutical procedures in vitro, in cell cultures or experimental animals. The data obtained from these in vitro and cell culture assays and animal studies can be used in formulating a range of dosage for use in human. The dosage may vary depending upon the dosage form employed and the route of administration utilized. The exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient's condition. (See e.g., Fingl, et al., 1975, in "The Pharmacological Basis of Therapeutics", Ch. 1 p.l). Dosage amount and interval may be adjusted individually to provide levels of the active ingredient which are sufficient to induce or suppress the biological effect
(minimal effective concentration, MEC). The MEC will vary for each preparation, but can be estimated from in vitro data. Dosages necessary to achieve the MEC will depend on individual characteristics and route of administration. Detection assays can be used to determine plasma concentrations.
Depending on the severity and responsiveness of the condition to be treated, dosing can be of a single or a plurality of administrations, with course of treatment
lasting from several days to several weeks or until cure is effected or diminution of the disease state is achieved.
The amount of a composition to be administered will, of course, be dependent on the subject being treated, the severity of the affliction, the manner of administration, the judgment of the prescribing physician, etc.
According to some embodiments of the invention, the active ingredient is provided to the individual with additional active agents to achieve an improved therapeutic effect as compared to treatment with each agent by itself. In such therapy, measures (e.g., dosing and selection of the complementary agent) are taken to adverse side effects which may be associated with combination therapies.
Administration of such combination therapy can be simultaneous, such as in a single capsule having a fixed ratio of these active agents, or in multiple capsules for each agent.
For example, the active ingredient (e.g., the antibody of the invention) can be administered along with nonsteroidal anti-inflammatory drugs (NSAID), disease- modifying antirheumatic drugs (DMARDS), corticosteroids, analgesics, Fibromyalgia medications, chemotherapeutic agents and others.
Compositions of the present invention may, if desired, be presented in a pack or dispenser device, such as an FDA approved kit, which may contain one or more unit dosage forms containing the active ingredient. The pack may, for example, comprise metal or plastic foil, such as a blister pack. The pack or dispenser device may be accompanied by instructions for administration. The pack or dispenser may also be accommodated by a notice associated with the container in a form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals, which notice is reflective of approval by the agency of the form of the compositions or human or veterinary administration. Such notice, for example, may be of labeling approved by the U.S. Food and Drug Administration for prescription drugs or of an approved product insert. Compositions comprising a preparation of the invention formulated in a compatible pharmaceutical carrier may also be prepared, placed in an appropriate container, and labeled for treatment of an indicated condition, as is further detailed above.
The antibody of the invention which is described hereinabove for detecting the CD44vRA polypeptide may be included in a diagnostic kit/article of manufacture preferably along with appropriate instructions for use in diagnosing and/or assessing diseases associated with expression of the CD44vRA polypeptide and optionally labels indicating FDA approval for use in diagnosing and/or assessing diseases associated with expression of the CD44vRA polypeptide.
Such a kit can include, for example, at least one container including at least one of the above described diagnostic agents (e.g., the antibody of the invention, or an immunoconjugate thereof) and an imaging reagent packed in another container (e.g., enzymes, secondary antibodies, buffers, chromogenic substrates, fluorogenic material). The kit may also include appropriate buffers and preservatives for improving the shelf- life of the kit.
As used herein the term "about" refers to ± 10 %.
Additional objects, advantages, and novel features of the present invention will become apparent to one ordinarily skilled in the art upon examination of the following examples, which are not intended to be limiting. Additionally, each of the various embodiments and aspects of the present invention as delineated hereinabove and as claimed in the claims section below finds experimental support in the following examples.
EXAMPLES
Reference is now made to the following examples, which together with the above descriptions, illustrate the invention in a non limiting fashion.
Generally, the nomenclature used herein and the laboratory procedures utilized in the present invention include molecular, biochemical, microbiological and recombinant DNA techniques. Such techniques are thoroughly explained in the literature. See, for example, "Molecular Cloning: A laboratory Manual" Sambrook et al., (1989); "Current Protocols in Molecular Biology" Volumes I-III Ausubel, R. M., ed. (1994); Ausubel et al., "Current Protocols in Molecular Biology", John Wiley and Sons, Baltimore, Maryland (1989); Perbal, "A Practical Guide to Molecular Cloning", John
Wiley & Sons, New York (1988); Watson et al., "Recombinant DNA", Scientific American Books, New York; Birren et al. (eds) "Genome Analysis: A Laboratory Manual Series", VoIs. 1-4, Cold Spring Harbor Laboratory Press, New York (1998); methodologies as set forth in U.S. Pat. Nos. 4,666,828; 4,683,202; 4,801,531; 5,192,659 and 5,272,057; "Cell Biology: A Laboratory Handbook", Volumes I-III Cellis, J. E., ed. (1994); "Current Protocols in Immunology" Volumes I-III Coligan J. E., ed. (1994); Stites et al. (eds), "Basic and Clinical Immunology" (8th Edition), Appleton & Lange, Norwalk, CT (1994); Mishell and Shiigi (eds), "Selected Methods in Cellular Immunology", W. H. Freeman and Co., New York (1980); available immunoassays are extensively described in the patent and scientific literature, see, for example, U.S. Pat. Nos. 3,791,932; 3,839,153; 3,850,752; 3,850,578; 3,853,987; 3,867,517; 3,879,262; 3,901,654; 3,935,074; 3,984,533; 3,996,345; 4,034,074; 4,098,876; 4,879,219; 5,011,771 and 5,281,521; "Oligonucleotide Synthesis" Gait, M. J., ed. (1984); "Nucleic Acid Hybridization" Hames, B. D., and Higgins S. J., eds. (1985); "Transcription and Translation" Hames, B. D., and Higgins S. J., Eds. (1984); "Animal Cell Culture" Freshney, R. L, ed. (1986); "Immobilized Cells and Enzymes" IRL Press, (1986); "A Practical Guide to Molecular Cloning" Perbal, B., (1984) and "Methods in Enzymology" Vol. 1-317, Academic Press; "PCR Protocols: A Guide To Methods And Applications", Academic Press, San Diego, CA (1990); Marshak et al., "Strategies for Protein Purification and Characterization - A Laboratory Course Manual" CSHL Press (1996); all of which are incorporated by reference as if fully set forth herein. Other general references are provided throughout this document. The procedures therein are believed to be well known in the art and are provided for the convenience of the reader. All the information contained therein is incorporated herein by reference.
EXAMPLE 1 GENERATION OF ANTIBODIES SPECIFICALLY BINDABLE
TO THE CD44VRA VARIANT Materials and Experimental Procedures Generation of monoclonal antibody secreting hybridomas - Thirty mer
CD44vRA peptide: SNPEVLLQTTTRMTADVDRNGTTAYEGNWN
(SEQ ID NO:23) obtained from Corixa (Seattle, WA), and 100 μg/ml soluble
CD44vRA (SEQ ID NO:22) produced as described in U.S. Pat. Appl. No. 11/130,206, both emulsified in complete Freund's adjuvant (CFA) (Sigma) and were used to immunize subcutaneously or intramuscularly 8-week-old female C75BL/6 mice. The immunization was repeated on days 14 and 28 and two weeks later the mice were bled and their sera were tested by flow cytometry for their ability to bind to Namalwa cells expressing CD44. The animals with highest polyclonal anti-CD44 antibody titers were selected and boosted intraperitoneally (i.p.) with 108 Namalwa-CD44vRA cells. After 72 hours, spleen cells from the mice were harvested and fused with SP 2/0 myeloma cells according to Kohler and Milstein [Kohler, G., and Milstein C. Nature 256:495-497 (1975)]. After one day of incubation in enriched RPMI 1640 (Sigma) containing L- glutamine, penicillin-streptomycin solution, sodium pyruvate and MEM-eagle nonessential amino acids (Biological Industries Ltd., Israel) and 20 % fetal bovine serum (FBS) (Sigma), the hybridomas were grown in ClonaCell™-HY Hybridoma Selection Medium (medium D, StemCell Technologies Inc.). Between days 10 to 14, isolated hybridoma colonies were collected from the semi-solid agar and grown in 96-well plates (Costar) in enriched RPMI 1640 medium containing HAT media supplement (Sigma) and 20 % of FBS. At day 7 after plating, the supernatants from isolated hybridoma clones were screened by flow cytometry for their ability to bind to Namalwa-Neo, Namalwa-CD44v3-10 or Namalwa-CD44vRA cells. Hybridoma whose supernatants bound selectively or preferentially to Namalwa-CD44vRA were cloned by limiting dilution and then re-cloned for additional three cycles. The isolated hybridoma were maintained in enriched RPMI 1640 containing HAT media supplement and 20 % FBS. The isotype of the CD44vRA-positive hybridoma supernatant was determined by ELISA using Clonotype System-HRP (Southern Biotechnology Associates, Inc.). Determination of antibody heavy (VH) and light (VL) chain CDRs -
Hybridoma cells were centrifuged (30 ml of hybridoma cells centrifuged for 10 minutes at 1200 rpm at 4 0C). RNA was extracted using TRiReagent (Sigma) according to manufacturer instructions. RNA was quantified by nanodrop and integrity was checked by applying 3 μl from each sample on agarose gel. The isolated RNA was subjected to DNase I treatment [4 μg of RNA was taken for DNase I (Sigma) treatment according to the manufacturer instructions], followed by reverse transcription (using M-MLV, Reverse Transcriptase and random primers). PCR amplification of IgG was performed
using Ig-Primer Sets kit (Novagen) according to manufacturer protocol. PCR conditions were denaturation at 94 °C for 5 minutes, 35 cycles, each including a denaturation at 94 0C for 1 minute, annealing at 53 °C for 1 minute and elongation at 72 0C for 1 minute, followed by 72 0C for 5 minutes. Cloning of the PCR products of the heavy (HC) and light (LC) chains into pGEM-luc vector (Promega) was into the pGEM (ampR) vector (Promega). The plasmid DNA was purified (Pure Yield™ Plasmid Midiprep, Promega) from transformed bacteria and concentration determined by UV spectroscopy. The constructs (each containing 10 μg DNA) were sequenced using ABI37000 cycle sequencing. Experimental Results
Production of anti-CD44vRA mAb - CD44vRA, CD44v3-vlO (derived from human keratinocytes) and CD44s (derived from HeLa cells) cDNAs were transfected into CD44-negative Namalwa Burkett lymphoma cell line. CD44 transfectants expressing high levels of CD44s, as well as CD44v3-vlO and CD44vRA transfectants expressing equal levels of v6-containing CD44 variant were selected. The transfectants were designated Namalwa-CD44s, Namalwa-CD44v3-vlO and Namalwa-CD44vRA, respectively. Namalwa cells transfected with an empty vector were designated Namalwa-Neo.
C57BL/6 mice were immunized with soluble CD44vRA, incorporated into CFA and challenged with Namalwa-CD44vRA cells as described in Materials and Methods. Splenocytes from mice showing polyclonal anti-CD4vRA antibodies in their serum were fused with SP2/0 myeloma cells. Hybridoma cell clones were selected according to the ability of their supernatants to bind to Namalwa-CD44vRA (expressing the polypeptide set forth by SEQ ID NO:22), but not to Namalwa-CD44v3-vlO (expressing the polypeptide set forth by SEQ ID NO:20), Namalwa-CD44s (expressing the polypeptide set forth by SEQ ID NO: 18) or to Namalwa-Neo, as indicated by flow cytometry. Clones and sub-clones were established from positive hybridoma cell colonies, and they were stable in culture for over 8 months. Anti-CD44vRA mAbs from supernatants of positive hybridomas were purified on G protein column. Determination of antibody heavy (VH) and light (Vi) chain CDRs - As shown in Figures IA-D the CDRs of the antibody's heavy chain (SEQ ID NOs:8, 9 and 10;
Figure IB) and light chain (SEQ ID NOs: 14, 15 and 16; Figure ID) as well as the nucleic acid sequences encoding same (Figures IA and C) were determined.
It is appreciated that certain features of the invention, which are, for clarity, described in the context of separate embodiments, may also be provided in combination in a single embodiment. Conversely, various features of the invention, which are, for brevity, described in the context of a single embodiment, may also be provided separately or in any suitable subcombination.
Although the invention has been described in conjunction with specific embodiments thereof, it is evident that many alternatives, modifications and variations will be apparent to those skilled in the art. Accordingly, it is intended to embrace all such alternatives, modifications and variations that fall within the spirit and broad scope of the appended claims. All publications, patents and patent applications and GenBank Accession numbers mentioned in this specification are herein incorporated in their entirety by reference into the specification, to the same extent as if each individual publication, patent or patent application or GenBank Accession number was specifically and individually indicated to be incorporated herein by reference. In addition, citation or identification of any reference in this application shall not be construed as an admission that such reference is available as prior art to the present invention.
REFERENCES
(Additional references are cited in text)
Aune, T. M., et al., Published EP Application No. 501233 (1992);
Hale, L. P., et al., WO 9409811 (1994);
Herrlich et al., European Patent No. 538754, (1991);
Jalkanen, S., et al., WO 9500658, (1995);
Koopman et al., J. Exp. Med. 177:897-904 (1993);
Naor, D., et al., Adv. Cancer Res., 71:241, (1997);
Screaton, G. R., et al., Proc. Natl. Acad. Sci. USA, 89:12160 (1992);
Verdrengh, M., et al., Scand J. Immunol., 42:353, (1995);
Golan L, Nedvetzki S, Golan I, Eshkar-Sebban L, Levartovsky D, Elkayam O, Caspi D, Aamar S, Amital H, Rubinow A, Naor D. Expression of extra trinucleotide in CD44 variant of rheumatoid arthritis patients allows generation of disease-specific monoclonal antibody. J Autoimmun. (2007), Mar-May;28(2-3):99-113. Epub 2007 Mar 23;
Nedvetzki S, Walmsley M, Alpert E, Williams RO, Feldmann M, Naor D. CD44 involvement in experimental collagen-induced arthritis (CIA). J Autoimmun. (1999), 13(l):39-47.
Claims
1. An isolated antibody comprising an antigen recognition domain which comprises complementarity determining region (CDR) amino acid sequences as set forth in SEQ ID NOs:8, 9, 10, 14, 15 and 16.
2. An isolated polynucleotide comprising a nucleic acid sequence encoding the antibody of claim 1.
3. The isolated polynucleotide of claim 2, wherein a heavy chain of the antibody is encoded by the nucleic acid sequence set forth by SEQ ID NO:1.
4. The isolated polynucleotide of claim 2, wherein a light chain of the antibody is encoded by the nucleic acid sequence set forth by SEQ ID NO:3.
5. A nucleic acid construct comprising the isolated polynucleotide of claim 2, 3 or 4 and a promoter for regulating expression of the isolated polynucleotide in a host cell.
6. The antibody of claim 1, being conjugated to a therapeutic moiety.
7. The antibody of claim 1, being conjugated to a detectable moiety.
8. A pharmaceutical composition comprising as an active ingredient the antibody of claim 1 or 6 and a pharmaceutically effective carrier or diluent.
9. A method of detecting a presence of a CD44vRA polypeptide in a biological sample, comprising contacting the biological sample with the antibody of claim 1 or 7 under conditions which allow immunocomplex formation, wherein a presence and/or a level above a predetermined threshold of said immunocomplex is indicative of the presence of the CD44vRA polypeptide in the biological sample.
10. A kit for detecting a presence of a CD44vRA polypeptide in a biological sample, comprising the antibody of claim 1 or 7 and at least one reagent suitable for detection of an immunocomplex between the antibody and the CD44vRA polypeptide.
11. A method of diagnosing a disease associated with expression of a CD44vRA polypeptide, comprising contacting a biological sample of a subject with the antibody of claim 1 or 7 under conditions which allow immunocomplex formation, wherein a presence or a level above a predetermined threshold of said immunocomplex is indicative of the disease in the subject.
12. A kit for diagnosing a disease associated with expression of a CD44vRA polypeptide, comprising the antibody of claim 1 or 7, at least one reagent suitable for detection of an immunocomplex and instructions for use in diagnosing the disease associated with expression of the CD44vRA polypeptide.
13. A method of treating a disease associated with expression of a CD44vRA polypeptide, comprising administering to a subject the antibody of claim 1 or 6 or the pharmaceutical composition of claim 8, thereby treating the disease associated with expression of the CD44vRA polypeptide.
14. The method of claim 9 or 11 or the kit of claim 10 or 12, wherein said biological sample is selected from the group consisting of a synovial fluid sample, a blood sample, a bone marrow sample, a tissue biopsy sample and a lymph fluid sample.
15. The method of claim 11 or 13, or the kit of claim 12, wherein the disease associated with expression of a CD44vRA polypeptide is selected from the group consisting of a rheumatoid disease, an inflammatory disease, an autoimmune disease and a cancerous disease.
16. The method of claim 9, 11 or 13, or the kit of claim 10 or 12, wherein said CD44vRA polypeptide comprises the amino acid sequence set forth in SEQ ID NO:22.
17. The method or kit of claim 15, wherein said rheumatoid disease is selected from the group consisting of rheumatoid arthritis (RA), psoriatic arthritis (PSA), spondyloarthropathy (SPA), juvenile rheumatoid arthritis (JRA), chronic Reiter's syndrome (CRS), palindrome rheumatism (PR), inflammatory bowel disease (IBD), infected rheumatic disease (IRD), seronegative rheumatoid arthritis (SRA), Gout, and non-diagnosed arthritis.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US19334008P | 2008-11-19 | 2008-11-19 | |
| US61/193,340 | 2008-11-19 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2010058396A1 true WO2010058396A1 (en) | 2010-05-27 |
Family
ID=41693445
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IL2009/001086 Ceased WO2010058396A1 (en) | 2008-11-19 | 2009-11-17 | A cd44vra antibody and diagnostic and therapeutic methods using same |
Country Status (1)
| Country | Link |
|---|---|
| WO (1) | WO2010058396A1 (en) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013063498A1 (en) * | 2011-10-26 | 2013-05-02 | The Regents Of The University Of California | Cd44 monoclonal antibody for the treatment of b-cell chronic lymphocytic leukemia and other hematological malignancies |
| EP2886126A1 (en) * | 2013-12-23 | 2015-06-24 | Endosignals Medizintechnik GmbH | CD44 binding peptides |
| WO2016009436A1 (en) | 2014-07-15 | 2016-01-21 | Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd. | Isolated polypeptides of cd44 and uses thereof |
| EP3552014A4 (en) * | 2016-12-08 | 2020-08-12 | Washington University | INCOMPATIBLE BLOOD GROUP ANTIGEN FOR CANCER DETECTION AND TREATMENT |
Citations (41)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3791932A (en) | 1971-02-10 | 1974-02-12 | Akzona Inc | Process for the demonstration and determination of reaction components having specific binding affinity for each other |
| US3839153A (en) | 1970-12-28 | 1974-10-01 | Akzona Inc | Process for the detection and determination of specific binding proteins and their corresponding bindable substances |
| US3850752A (en) | 1970-11-10 | 1974-11-26 | Akzona Inc | Process for the demonstration and determination of low molecular compounds and of proteins capable of binding these compounds specifically |
| US3850578A (en) | 1973-03-12 | 1974-11-26 | H Mcconnell | Process for assaying for biologically active molecules |
| US3853987A (en) | 1971-09-01 | 1974-12-10 | W Dreyer | Immunological reagent and radioimmuno assay |
| US3867517A (en) | 1971-12-21 | 1975-02-18 | Abbott Lab | Direct radioimmunoassay for antigens and their antibodies |
| US3879262A (en) | 1972-05-11 | 1975-04-22 | Akzona Inc | Detection and determination of haptens |
| US3901654A (en) | 1971-06-21 | 1975-08-26 | Biological Developments | Receptor assays of biologically active compounds employing biologically specific receptors |
| US3935074A (en) | 1973-12-17 | 1976-01-27 | Syva Company | Antibody steric hindrance immunoassay with two antibodies |
| US3984533A (en) | 1975-11-13 | 1976-10-05 | General Electric Company | Electrophoretic method of detecting antigen-antibody reaction |
| US3996345A (en) | 1974-08-12 | 1976-12-07 | Syva Company | Fluorescence quenching with immunological pairs in immunoassays |
| US4034074A (en) | 1974-09-19 | 1977-07-05 | The Board Of Trustees Of Leland Stanford Junior University | Universal reagent 2-site immunoradiometric assay using labelled anti (IgG) |
| US4036945A (en) | 1976-05-03 | 1977-07-19 | The Massachusetts General Hospital | Composition and method for determining the size and location of myocardial infarcts |
| US4098876A (en) | 1976-10-26 | 1978-07-04 | Corning Glass Works | Reverse sandwich immunoassay |
| US4331647A (en) | 1980-03-03 | 1982-05-25 | Goldenberg Milton David | Tumor localization and therapy with labeled antibody fragments specific to tumor-associated markers |
| US4666828A (en) | 1984-08-15 | 1987-05-19 | The General Hospital Corporation | Test for Huntington's disease |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| US4801531A (en) | 1985-04-17 | 1989-01-31 | Biotechnology Research Partners, Ltd. | Apo AI/CIII genomic polymorphisms predictive of atherosclerosis |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4879219A (en) | 1980-09-19 | 1989-11-07 | General Hospital Corporation | Immunoassay utilizing monoclonal high affinity IgM antibodies |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US5011771A (en) | 1984-04-12 | 1991-04-30 | The General Hospital Corporation | Multiepitopic immunometric assay |
| EP0501233A1 (en) | 1991-02-26 | 1992-09-02 | Bayer Corporation | Hybridomas and monoclonal antibodies that inhibit anti-CD3-stimulated T cell proliferation |
| US5192659A (en) | 1989-08-25 | 1993-03-09 | Genetype Ag | Intron sequence analysis method for detection of adjacent and remote locus alleles as haplotypes |
| EP0538754A2 (en) | 1991-10-23 | 1993-04-28 | Forschungszentrum Karlsruhe GmbH | Use of antibody-containing preparations for immunosuppression |
| US5272057A (en) | 1988-10-14 | 1993-12-21 | Georgetown University | Method of detecting a predisposition to cancer by the use of restriction fragment length polymorphism of the gene for human poly (ADP-ribose) polymerase |
| US5281521A (en) | 1992-07-20 | 1994-01-25 | The Trustees Of The University Of Pennsylvania | Modified avidin-biotin technique |
| WO1994009811A1 (en) | 1992-10-30 | 1994-05-11 | Duke University | An adhesion molecule |
| WO1995000658A1 (en) | 1993-06-18 | 1995-01-05 | Sirpa Jalkanen | COMPOSITIONS AND DIAGNOSTIC METHODS USING MONOCLONAL ANTIBODIES AGAINST CD44v6 |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US6037137A (en) | 1997-02-20 | 2000-03-14 | Oncoimmunin, Inc. | Fluorogenic peptides for the detection of protease activity |
| WO2000075312A1 (en) * | 1999-06-08 | 2000-12-14 | Yissum Research And Development Company Of The Hebrew University Of Jerusalem | Cd44 splice variant associated with rheumatoid arthritis |
| US6350466B1 (en) | 1994-08-05 | 2002-02-26 | Targesome, Inc. | Targeted polymerized liposome diagnostic and treatment agents |
| WO2003072606A2 (en) * | 2002-02-28 | 2003-09-04 | Yeda Research And Development Company Ltd. | Galectin-8and functional derivatives as binding agents for cd44 glycoproteins and methods of use |
| WO2005007700A1 (en) * | 2003-07-15 | 2005-01-27 | Yissum Research Development Company Of The Hebrew University Of Jerusalem | Antibodies to cd44 vra and methods of use |
| US20060019340A1 (en) * | 1999-06-08 | 2006-01-26 | David Naor | CD44 polypeptides, polynucleotides encoding same, antibodies directed thereagainst and method of using same for diagnosing and treating inflammatory diseases |
-
2009
- 2009-11-17 WO PCT/IL2009/001086 patent/WO2010058396A1/en not_active Ceased
Patent Citations (42)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3850752A (en) | 1970-11-10 | 1974-11-26 | Akzona Inc | Process for the demonstration and determination of low molecular compounds and of proteins capable of binding these compounds specifically |
| US3839153A (en) | 1970-12-28 | 1974-10-01 | Akzona Inc | Process for the detection and determination of specific binding proteins and their corresponding bindable substances |
| US3791932A (en) | 1971-02-10 | 1974-02-12 | Akzona Inc | Process for the demonstration and determination of reaction components having specific binding affinity for each other |
| US3901654A (en) | 1971-06-21 | 1975-08-26 | Biological Developments | Receptor assays of biologically active compounds employing biologically specific receptors |
| US3853987A (en) | 1971-09-01 | 1974-12-10 | W Dreyer | Immunological reagent and radioimmuno assay |
| US3867517A (en) | 1971-12-21 | 1975-02-18 | Abbott Lab | Direct radioimmunoassay for antigens and their antibodies |
| US3879262A (en) | 1972-05-11 | 1975-04-22 | Akzona Inc | Detection and determination of haptens |
| US3850578A (en) | 1973-03-12 | 1974-11-26 | H Mcconnell | Process for assaying for biologically active molecules |
| US3935074A (en) | 1973-12-17 | 1976-01-27 | Syva Company | Antibody steric hindrance immunoassay with two antibodies |
| US3996345A (en) | 1974-08-12 | 1976-12-07 | Syva Company | Fluorescence quenching with immunological pairs in immunoassays |
| US4034074A (en) | 1974-09-19 | 1977-07-05 | The Board Of Trustees Of Leland Stanford Junior University | Universal reagent 2-site immunoradiometric assay using labelled anti (IgG) |
| US3984533A (en) | 1975-11-13 | 1976-10-05 | General Electric Company | Electrophoretic method of detecting antigen-antibody reaction |
| US4036945A (en) | 1976-05-03 | 1977-07-19 | The Massachusetts General Hospital | Composition and method for determining the size and location of myocardial infarcts |
| US4098876A (en) | 1976-10-26 | 1978-07-04 | Corning Glass Works | Reverse sandwich immunoassay |
| US4331647A (en) | 1980-03-03 | 1982-05-25 | Goldenberg Milton David | Tumor localization and therapy with labeled antibody fragments specific to tumor-associated markers |
| US4879219A (en) | 1980-09-19 | 1989-11-07 | General Hospital Corporation | Immunoassay utilizing monoclonal high affinity IgM antibodies |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5011771A (en) | 1984-04-12 | 1991-04-30 | The General Hospital Corporation | Multiepitopic immunometric assay |
| US4666828A (en) | 1984-08-15 | 1987-05-19 | The General Hospital Corporation | Test for Huntington's disease |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| US4683202B1 (en) | 1985-03-28 | 1990-11-27 | Cetus Corp | |
| US4801531A (en) | 1985-04-17 | 1989-01-31 | Biotechnology Research Partners, Ltd. | Apo AI/CIII genomic polymorphisms predictive of atherosclerosis |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| US5272057A (en) | 1988-10-14 | 1993-12-21 | Georgetown University | Method of detecting a predisposition to cancer by the use of restriction fragment length polymorphism of the gene for human poly (ADP-ribose) polymerase |
| US5192659A (en) | 1989-08-25 | 1993-03-09 | Genetype Ag | Intron sequence analysis method for detection of adjacent and remote locus alleles as haplotypes |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| EP0501233A1 (en) | 1991-02-26 | 1992-09-02 | Bayer Corporation | Hybridomas and monoclonal antibodies that inhibit anti-CD3-stimulated T cell proliferation |
| EP0538754A2 (en) | 1991-10-23 | 1993-04-28 | Forschungszentrum Karlsruhe GmbH | Use of antibody-containing preparations for immunosuppression |
| US5281521A (en) | 1992-07-20 | 1994-01-25 | The Trustees Of The University Of Pennsylvania | Modified avidin-biotin technique |
| WO1994009811A1 (en) | 1992-10-30 | 1994-05-11 | Duke University | An adhesion molecule |
| WO1995000658A1 (en) | 1993-06-18 | 1995-01-05 | Sirpa Jalkanen | COMPOSITIONS AND DIAGNOSTIC METHODS USING MONOCLONAL ANTIBODIES AGAINST CD44v6 |
| US6350466B1 (en) | 1994-08-05 | 2002-02-26 | Targesome, Inc. | Targeted polymerized liposome diagnostic and treatment agents |
| US6037137A (en) | 1997-02-20 | 2000-03-14 | Oncoimmunin, Inc. | Fluorogenic peptides for the detection of protease activity |
| WO2000075312A1 (en) * | 1999-06-08 | 2000-12-14 | Yissum Research And Development Company Of The Hebrew University Of Jerusalem | Cd44 splice variant associated with rheumatoid arthritis |
| US20060019340A1 (en) * | 1999-06-08 | 2006-01-26 | David Naor | CD44 polypeptides, polynucleotides encoding same, antibodies directed thereagainst and method of using same for diagnosing and treating inflammatory diseases |
| WO2003072606A2 (en) * | 2002-02-28 | 2003-09-04 | Yeda Research And Development Company Ltd. | Galectin-8and functional derivatives as binding agents for cd44 glycoproteins and methods of use |
| WO2005007700A1 (en) * | 2003-07-15 | 2005-01-27 | Yissum Research Development Company Of The Hebrew University Of Jerusalem | Antibodies to cd44 vra and methods of use |
Non-Patent Citations (134)
| Title |
|---|
| "Cell Biology: A Laboratory Handbook", vol. I-III, 1994 |
| "Immobilized Cells and Enzymes", 1986, IRL PRESS |
| "Methods in Enzymology", vol. 1, ACADEMIC PRESS |
| "PCR Protocols: A Guide To Methods And Applications", 1990, ACADEMIC PRESS |
| A. HASSNER ET AL., TETRAHEDRON LETT., 1978, pages 4475 |
| ALEXANDER RB. ET AL., UROLOGY, vol. 50, no. 6, December 1997 (1997-12-01), pages 893 |
| ANTOINE JC.; HONNORAT J., REV NEUROL (PARIS), vol. 156, no. 1, January 2000 (2000-01-01), pages 23 |
| AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1989, JOHN WILEY AND SONS |
| AUSUBEL, R. M.,: "Current Protocols in Molecular Biology", vol. I-III, 1994 |
| B. NEISES ET AL., ANGEW CHEM., INT. ED. ENGL., vol. 17, 1978, pages 522 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BIRREN ET AL.: "Genome Analysis: A Laboratory Manual Series", vol. 1-4, 1998, COLD SPRING HARBOR LABORATORY PRESS |
| BOERNER ET AL., J. IMMUNOL., vol. 147, no. 1, 1991, pages 86 - 95 |
| BRALEY-MULLEN H.; YU S, J IMMUNOL, vol. 165, no. 12, 15 December 2000 (2000-12-15), pages 7262 |
| CAPOROSSI AP ET AL., VIRAL IMMUNOL, vol. 11, no. 1, 1998, pages 9 |
| CAPOROSSI AP. ET AL., VIRAL IMMUNOL, vol. 11, no. 1, 1998, pages 9 |
| CASTANO L.; EISENBARTH GS., ANN. REV. IMMUNOL., vol. 8, pages 647 |
| CHAN OT. ET AL., IMMUNOL REV, vol. 169, June 1999 (1999-06-01), pages 107 |
| COLE ET AL.: "Monoclonal Antibodies and Cancer Therapy", 1985, ALAN R. LISS, pages: 77 |
| COLIGAN J. E.,: "Current Protocols in Immunology", vol. I-III, 1994 |
| CROSS AH. ET AL., J NEUROIMMUNOL, vol. 112, no. 1-2, 1 January 2001 (2001-01-01), pages 1 |
| CUMBER ET AL., METHODS OF ENZYMOLOGY, vol. 112, 1985, pages 207 - 224 |
| CUNHA-NETO E. ET AL., J CLIN INVEST, vol. 98, no. 8, 15 October 1996 (1996-10-15), pages 1709 |
| DATTA SK., LUPUS, vol. 7, no. 9, 1998, pages 591 |
| DIEKMAN AB. ET AL., AM J REPROD IMMUNOL., vol. 43, no. 3, March 2000 (2000-03-01), pages 134 |
| E.P. BODEN ET AL., J. ORG. CHEM., vol. 50, 1986, pages 2394 |
| EFREMOV DG. ET AL., LEUK LYMPHOMA, vol. 28, no. 3-4, January 1998 (1998-01-01), pages 285 |
| ERIKSON J. ET AL., IMMUNOL RES, vol. 17, no. 1-2, 1998, pages 49 |
| FEIST E. ET AL., INT ARCH ALLERGY IMMUNOL, vol. 123, no. 1, September 2000 (2000-09-01), pages 92 |
| FISHWILD ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 845 - 51 |
| FLAMHOLZ R. ET AL., J CLIN APHERESIS, vol. 14, no. 4, 1999, pages 171 |
| FRANCO A. ET AL., CLIN IMMUNOL IMMUNOPATHOL, vol. 54, no. 3, March 1990 (1990-03-01), pages 382 |
| FRESHNEY, R. I.,: "Animal Cell Culture", 1986 |
| G.T. HERMANSON: "Antibody Modification and Conjugation, in Bioconjugate Techniques", 1996, ACADEMIC PRESS |
| GAIT, M. J.,: "Oligonucleotide Synthesis", 1984 |
| GAKAMSKY D. ET AL.: "Receptors: A Practical Approach", 2001, OXFORD UNIVERSITY PRESS, article "Evaluating Receptor Stoichiometry by Fluorescence Resonance Energy Transfer" |
| GARCIA HEROLA A. ET AL., ASTROENTEROL HEPATOL., vol. 23, no. 1, January 2000 (2000-01-01), pages 16 |
| GARCIA HEROLA A. ET AL., GASTROENTEROL HEPATOL., vol. 23, no. 1, January 2000 (2000-01-01), pages 16 |
| GARZA KM. ET AL., J REPROD IMMUNOL, vol. 37, no. 2, February 1998 (1998-02-01), pages 87 |
| GLODDEK B. ET AL., ANN N Y ACAD SCI, vol. 830, 29 December 1997 (1997-12-29), pages 266 |
| GOLAN ET AL: "Expression of extra trinucleotide in CD44 variant of rheumatoid arthritis patients allows generation of disease-specific monoclonal antibody", JOURNAL OF AUTOIMMUNITY, LONDON, GB, vol. 28, no. 2-3, 5 May 2007 (2007-05-05), pages 99 - 113, XP022064945, ISSN: 0896-8411 * |
| GOLAN I.; NEDVETZKI S; GOLAN I; ESHKAR-SEBBAN L; LEVARTOVSKY D; ELKAYAM O; CASPI D; AAMAR S; AMITAL H; RUBINOW A: "Expression of extra trinucleotide in CD44 variant of rheumatoid arthritis patients allows generation of disease-specific monoclonal antibody", J AUTOIMMUN. (2007), MAR-MAY, vol. 28, no. 2-3, 23 March 2007 (2007-03-23), pages 99 - 113, XP022064945, DOI: doi:10.1016/j.jaut.2007.02.007 |
| HAMES, B. D., AND HIGGINS S. J.,: "Nucleic Acid Hybridization", 1985 |
| HAMES, B. D., AND HIGGINS S. J.,: "Transcription and Translation", 1984 |
| HARA T. ET AL., BLOOD., vol. 77, no. 5, 1 March 1991 (1991-03-01), pages 1127 |
| HARLOW; LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY |
| HERMANSON: "Bioconjugate Techniques", 1995, ACADEMIC PRESS |
| HIEMSTRA HS. ET AL., PROC NATL ACAD SCI U S A, vol. 98, no. 7, 27 March 2001 (2001-03-27), pages 3988 |
| HIEMSTRA HS., PROC NATL ACAD SCI UNITS S A, vol. 98, no. 7, 27 March 2001 (2001-03-27), pages 3988 |
| HOOGENBOOM; WINTER, J. MOL. BIOL., vol. 227, 1991, pages 381 |
| INBAR ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 69, 1972, pages 2659 - 62 |
| INFANTE AJ.; KRAIG E, INT REV IMMUNOL, vol. 18, no. 1-2, 1999, pages 83 |
| ISHIKAWA E. ET AL., J IMMUNOASSAY, vol. 4, 1983, pages 209 - 327 |
| J. MARCH: "Advanced Organic Chemistry: Reaction's, Mechanism, and Structure (3d ed.)", 1985, pages: 349-50 - 372-74 |
| JAN VOSWINKEL ET AL., ARTHRITIS RES, vol. 3, no. 3, 2001, pages 189 |
| JONES DE., CLIN SCI (COLCH), vol. 91, no. 5, November 1996 (1996-11-01), pages 551 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| KAY M. ET AL., BIOCHEMISTRY, vol. 34, 1995, pages 293 |
| KELLY CJ., J AM SOC NEPHROL, vol. 1, no. 2, August 1990 (1990-08-01), pages 140 |
| KHATKHATAY MI; DESAI M., J IMMUNOASSAY, vol. 20, 1999, pages 151 - 83 |
| KOHLER, G.; MILSTEIN C., NATURE, vol. 256, 1975, pages 495 - 497 |
| KOOPMAN ET AL., J. EXP. MED., vol. 177, 1993, pages 897 - 904 |
| KORNBERG AJ., J CLIN NEUROSCI., vol. 7, no. 3, May 2000 (2000-05-01), pages 191 |
| KRENN V. ET AL., HISTOL HISTOPATHOL, vol. 15, no. 3, July 2000 (2000-07-01), pages 791 |
| KUSUNOKI S., AM J MED SCI., vol. 319, no. 4, April 2000 (2000-04-01), pages 234 |
| L.J. MATHIAS, SYNTHESIS, 1979, pages 561 |
| LACROIX-DESMAZES S. ET AL., SEMIN THROMB HEMOST., vol. 26, no. 2, 2000, pages 157 |
| LANDAU YE.; SHOENFELD Y., HAREFUAH, vol. 138, no. 2, 16 January 2000 (2000-01-16), pages 122 |
| LARRICK; FRY, METHODS, vol. 2, 1991, pages 106 - 10 |
| LODDEK B. ET AL., ANN N Y ACAD SCI, vol. 830, 29 December 1997 (1997-12-29), pages 266 |
| LONBERG ET AL., NATURE, vol. 368, 1994, pages 856 - 859 |
| LONBERG; HUSZAR, INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93 |
| MANNS MP., J HEPATOL, vol. 33, no. 2, August 2000 (2000-08-01), pages 326 |
| MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 |
| MARKS ET AL.: "Bio/Technology", vol. 10, 1992, SCIENTIFIC PUBLICATIONS, pages: 779 - 783 |
| MARSHAK ET AL.: "Strategies for Protein Purification and Characterization - A Laboratory Course Manual", 1996, CSHL PRESS, article "Strategies for Protein Purification and Characterization - A Laboratory Course Manual" |
| MATSUURA E. ET AL., LUPUS., vol. 7, no. 2, 1998, pages 135 |
| MATSUURA E.; 1998 ET AL., LUPUS., vol. 7, no. 2, pages 135 |
| MISHELL AND SHIIGI: "Selected Methods in Cellular Immunology", 1980, W. H. FREEMAN AND CO. |
| MITSUMA T., NIPPON RINSHO., vol. 57, no. 8, August 1999 (1999-08-01), pages 1759 |
| MOCCIA F., ANN ITAL MED INT., vol. 14, no. 2, April 1999 (1999-04-01), pages 114 |
| MORRISON, NATURE, vol. 368, 1994, pages 812 - 13 |
| NAOR D ET AL: "CD44 IN RHEUMATOID ARTHRITIS", ARTHRITIS RESEARCH, CURRENT SCIENCE, LONDON, GB, vol. 5, no. 3, 1 January 2003 (2003-01-01), pages 105 - 115, XP001152927, ISSN: 1465-9905 * |
| NAOR DAVID ET AL: "CD44 involvement in autoimmune inflammations: the lesson to be learned from CD44-targeting by antibody or from knockout mice.", ANNALS OF THE NEW YORK ACADEMY OF SCIENCES SEP 2007, vol. 1110, September 2007 (2007-09-01), pages 233 - 247, XP009130167, ISSN: 0077-8923 * |
| NAOR, D. ET AL., ADV. CANCER RES., vol. 71, 1997, pages 241 |
| NEDVETZKI S ET AL: "A MUTATION IN A CD44 VARIANT OF INFLAMMATORY CELLS ENHANCES THE MITOGENIC INTERACTION OF FGF WITH ITS RECEPTOR", JOURNAL OF CLINICAL INVESTIGATION, AMERICAN SOCIETY FOR CLINICAL INVESTIGATION, US, vol. 111, no. 8, 1 April 2003 (2003-04-01), pages 1211 - 1220, XP001152920, ISSN: 0021-9738 * |
| NEDVETZKI S; WALMSLEY M; ALPERT E; WILLIAMS RO; FELDMANN M; NAOR D.: "CD44 involvement in experimental collagen-induced arthritis (CIA)", J AUTOIMMUN., vol. 13, no. 1, 1999, pages 39 - 47, XP001203628, DOI: doi:10.1006/jaut.1999.0294 |
| NEUBERGER, NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 826 |
| NOBILE-ORAZIO E. ET AL., ELECTROENCEPHALOGR CLIN NEUROPHYSIOL SUPPL, vol. 50, 1999, pages 419 |
| NOEL LH., ANN MED INTERNE (PARIS), vol. 151, no. 3, May 2000 (2000-05-01), pages 178 |
| NOEL LH., ANN MED INTERNE PARIS, vol. 151, no. 3, May 2000 (2000-05-01), pages 178 |
| OELLERICH M., J CLIN CHEM CLIN BIOCHEM., vol. 18, 1980, pages 197 - 208 |
| ORGIAZZI J., ENDOCRINOL METAB CLIN NORTH AM, vol. 29, no. 2, June 2000 (2000-06-01), pages 339 |
| ORON L. ET AL., J NEURAL TRANSM SUPPL., vol. 49, 1997, pages 77 |
| OSHIMA M. ET AL., EUR J IMMUNOL, vol. 20, no. 12, December 1990 (1990-12-01), pages 2563 |
| PACK ET AL., BIO/TECHNOLOGY, vol. 11, 1993, pages 1271 - 77 |
| PERBAL, B.: "A Practical Guide to Molecular Cloning", 1984 |
| PERBAL: "A Practical Guide to Molecular Cloning", 1988, JOHN WILEY & SONS |
| PORTER, R. R., BIOCHEM. J., vol. 73, 1959, pages 119 - 126 |
| PRAPROTNIK S. ET AL., WIEN KLIN WOCHENSCHR, vol. 112, no. 15-16, 25 August 2000 (2000-08-25), pages 660 |
| PRESTA, CURR. OP. STRUCT. BIOL., vol. 2, 1992, pages 593 - 596 |
| RENAUDINEAU Y. ET AL., CLIN DIAGN LAB IMMUNOL., vol. 6, no. 2, March 1999 (1999-03-01), pages 156 |
| RICHARD P. HAUGLAND: "Molecular Probes: Handbook of Fluorescent Probes and Research Chemicals 1992-1994, 5th ed.,", 1994, MOLECULAR PROBES, INC. |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 327 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 329 |
| SAKATA S. ET AL., MOL CELL ENDOCRINOL, vol. 92, no. 1, March 1993 (1993-03-01), pages 77 |
| SALLAH S. ET AL., ANN HEMATOL, vol. 74, no. 3, March 1997 (1997-03-01), pages 139 |
| SAMBROOK ET AL.: "Molecular Cloning: A laboratory Manual", 1989 |
| SCHUURS AH; VAN WEEMEN BK., J IMMUNOASSAY, vol. 1, 1980, pages 229 - 49 |
| SCREATON, G. R. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 12160 |
| SEBBAN L E ET AL: "The involvement of CD44 and its novel ligand galectin-8 in apoptotic regulation of autoimmune inflammation", JOURNAL OF IMMUNOLOGY 20070715 US, vol. 179, no. 2, 15 July 2007 (2007-07-15), pages 1225 - 1235, XP009130170 * |
| SEMPLE JW. ET AL., BLOOD, vol. 87, no. 10, 15 May 1996 (1996-05-15), pages 4245 |
| SODERSTROM M. ET AL., J NEUROL NEUROSURG PSYCHIATRY, vol. 57, no. 5, May 1994 (1994-05-01), pages 544 |
| STITES ET AL.: "Basic and Clinical Immunology (8th Edition)", 1994, APPLETON & LANGE |
| STRASSBURG CP. ET AL., EUR J GASTROENTEROL HEPATOL., vol. 11, no. 6, June 1999 (1999-06-01), pages 595 |
| STUBBS ET AL., BIOCHEMISTRY, vol. 35, 1996, pages 937 |
| TAKAMORI M., AM J MED SCI., vol. 319, no. 4, April 2000 (2000-04-01), pages 204 |
| TINCANI A. ET AL., LUPUS, vol. 7, no. 2, 1998, pages 107 - 9 |
| TISCH R; MCDEVITT HO., PROC NATL ACAD SCI U S A, vol. 91, no. 2, 18 January 1994 (1994-01-18), pages 437 |
| TISCH R; MCDEVITT HO., PROC NATL ACAD SCI UNITS S A, vol. 91, no. 2, 18 January 1994 (1994-01-18), pages 437 |
| TOYODA N. ET AL., NIPPON RINSHO, vol. 57, no. 8, August 1999 (1999-08-01), pages 1810 |
| VAARALA O., LUPUS., vol. 7, no. 2, 1998, pages 132 |
| VERDRENGH, M. ET AL., SCAND J. IMMUNOL., vol. 42, 1995, pages 353 |
| VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536 |
| VINCENT A. ET AL., ANN N Y ACAD SCI., vol. 841, 13 May 1998 (1998-05-13), pages 482 |
| WALLUKAT G. ET AL., AM J CARDIOL., vol. 83, no. 12A, 17 June 1999 (1999-06-17), pages 75H |
| WATSON ET AL.: "Scientific American Books", article "Recombinant DNA" |
| WHITLOW; FILPULA, METHODS, vol. 2, 1991, pages 97 - 105 |
| WISDOM GB., METHODS MOL BIOL., vol. 32, 1994, pages 433 - 40 |
| WITHOFF, S.; HELFRICH, W.; LEIJ, LF.; MOLEMA, G., CURR OPIN MOL THER., vol. 3, 2001, pages 53 - 62 |
| YOO TJ. ET AL., CELL IMMUNOL, vol. 157, no. 1, August 1994 (1994-08-01), pages 249 |
| YOO TJ.; 1994 AUG ET AL., CELL IMMUNOL, vol. 157, no. 1, pages 249 |
| ZAULI D. ET AL., BIOMED PHARMACOTHER, vol. 53, no. 5-6, June 1999 (1999-06-01), pages 234 |
| ZIMMET P., DIABETES RES CLIN PRACT, vol. 34, October 1996 (1996-10-01), pages 125 |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013063498A1 (en) * | 2011-10-26 | 2013-05-02 | The Regents Of The University Of California | Cd44 monoclonal antibody for the treatment of b-cell chronic lymphocytic leukemia and other hematological malignancies |
| EP2886126A1 (en) * | 2013-12-23 | 2015-06-24 | Endosignals Medizintechnik GmbH | CD44 binding peptides |
| WO2015097170A1 (en) * | 2013-12-23 | 2015-07-02 | Exchange Imaging Technologies Gmbh | Cd44 binding peptides |
| WO2016009436A1 (en) | 2014-07-15 | 2016-01-21 | Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd. | Isolated polypeptides of cd44 and uses thereof |
| US10611819B2 (en) | 2014-07-15 | 2020-04-07 | Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd. | Isolated polypeptides of CD44 and uses thereof |
| US11560417B2 (en) | 2014-07-15 | 2023-01-24 | Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd. | Isolated polypeptides of CD44 and uses thereof |
| EP3552014A4 (en) * | 2016-12-08 | 2020-08-12 | Washington University | INCOMPATIBLE BLOOD GROUP ANTIGEN FOR CANCER DETECTION AND TREATMENT |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240218076A1 (en) | Therapeutic antibodies | |
| CN102089326B (en) | Anti-IL-6/IL-6R antibodies and methods of use thereof | |
| EP1866336B9 (en) | Neutralizing antibodies and methods of use thereof | |
| EP1871807B1 (en) | Antibodies against cxcr4 and methods of use thereof | |
| CN104059149B (en) | Anti-C5aR antibodies with improved properties | |
| JPH09509307A (en) | Humanized antibodies and their use | |
| CN102659945B (en) | Anti-C5aR antibody and application thereof | |
| WO2015015489A1 (en) | Antibody for treating diabetes and autoimmune diseases | |
| US7534605B2 (en) | CD44 polypeptides, polynucleotides encoding same, antibodies directed thereagainst and method of using same for diagnosing and treating inflammatory diseases | |
| CN115947855B (en) | Preparation of anti-CD 24 antibodies and uses thereof | |
| US20250296984A1 (en) | Therapeutic and diagnostic agents and uses thereof | |
| US7335741B2 (en) | Means for use in diagnostics and/or therapy | |
| US11274161B2 (en) | Monoclonal antibodies that specifically recognize canine DLA-DR antigen and their uses | |
| WO2024012513A1 (en) | Antibody, antigen-binding fragment thereof, and pharmaceutical use thereof | |
| CN121311505A (en) | Anti-GPRC5D antibodies and their pharmaceutical uses | |
| WO2026002198A1 (en) | Anti-cd25 antibody and use thereof | |
| CN119101155A (en) | A monoclonal antibody with human SIRPα binding activity and its application | |
| CN117285628A (en) | Anti-VISTA antibodies and their applications | |
| CN115785269A (en) | anti-PD-L1 antibodies and uses thereof | |
| HK1099315A (en) | Variant cd44 polypeptide, polynucleotides encoding same, antibodies directed there against and method of using same for diagnosing and treating inflammatory diseases |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 09796823 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 09796823 Country of ref document: EP Kind code of ref document: A1 |