CN117285628A - anti-VISTA antibodies and uses thereof - Google Patents

anti-VISTA antibodies and uses thereof Download PDF

Info

Publication number
CN117285628A
CN117285628A CN202311192857.3A CN202311192857A CN117285628A CN 117285628 A CN117285628 A CN 117285628A CN 202311192857 A CN202311192857 A CN 202311192857A CN 117285628 A CN117285628 A CN 117285628A
Authority
CN
China
Prior art keywords
antibody
seq
amino acid
acid sequences
chain variable
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
CN202311192857.3A
Other languages
Chinese (zh)
Inventor
仝爱平
康竞月
郑美君
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Sichuan University
Original Assignee
Sichuan University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Sichuan University filed Critical Sichuan University
Priority to CN202311192857.3A priority Critical patent/CN117285628A/en
Publication of CN117285628A publication Critical patent/CN117285628A/en
Pending legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/07—Tetrapeptides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06—Animal cells or tissues; Human cells or tissues
    • C12N5/0602—Vertebrate cells
    • C12N5/0684—Cells of the urinary tract or kidneys
    • C12N5/0686—Kidney cells
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57484—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6872—Intracellular protein regulatory factors and their receptors, e.g. including ion channels
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00—Genetically modified cells
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00—Nucleic acids vectors
    • C12N2800/10—Plasmid DNA
    • C12N2800/106—Plasmid DNA for vertebrates
    • C12N2800/107—Plasmid DNA for vertebrates for mammalian
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/70503—Immunoglobulin superfamily, e.g. VCAMs, PECAM, LFA-3
    • G01N2333/70532—B7 molecules, e.g. CD80, CD86

Abstract

The invention discloses an anti-VISTA antibody and application thereof, relates to the field of antibodies, and provides an anti-VISTA antibody, wherein CDRs of the anti-VISTA antibody are selected from any one of (1) to (7), the antibody or antigen binding fragment has high affinity to VISTA, can specifically identify and bind to the VISTA, and is applied to construction of an antibody drug conjugate ADC, and through an in vitro killing experiment, the VISTA-MMAE ADC has remarkable anti-tumor effect, so that the anti-VISTA antibody can be widely applied to preparation of drugs for preventing, diagnosing and treating tumors and autoimmune diseases.

Description

anti-VISTA antibodies and uses thereof
Technical Field
The invention relates to the field of antibodies, in particular to an anti-VISTA antibody and application thereof.
Background
Tumor immunotherapy, which is an innovative therapeutic approach, has become a major hotspot in the field of tumor therapy research, and is expected to bring new therapeutic options for patients. By blocking the PD-L1/PD-1 pathway or CTLA-4 signaling pathway, the immunosuppressive state of T cells can be reversed, and the autoimmune system of a patient can be improved to inhibit or kill tumors. However, current blockers of the PD-L1/PD-1 pathway or CTLA-4 pathway are clinically effective on only a small fraction of patients, and new immunotherapeutic targets or strategies are still sought.
T cell activation V domain Ig inhibitor (V-domain Ig suppressor of T cell activation, VISTA), belonging to the B7 family of molecules. Unlike other immune checkpoint molecules, VISTA is constitutively expressed in naive T cellsT cell), lost when an immune response occurs; in addition to T cells, VISTA is also expressed on the surface of antigen presenting cells. VISTA inhibits T cell activation through both T cell internal and T cell external mechanisms. In short, VISTA is a unique negative checkpoint regulator on naive T cells, critical to maintaining its resting and peripheral immune tolerant steady state.
Human VISTA proteins share 279 amino acid residues, including an extracellular region of 162 amino acid residues (extracellular domain, ECD), a transmembrane region of 21 amino acid residues (transmembrane domain) and a cytoplasmic region of 96 amino acid residues (cytoplasmic domain). VISTA is highly expressed in bone marrow-derived cells, such as cd11b+ monocytes, cd11c+ dendritic cells, and to a lesser extent cd4+ and cd8+ T cells. Overexpression of VISTA has been found in a variety of human cancers, including prostate cancer, renal clear cell carcinoma, non-small cell lung cancer, colorectal cancer, and pleural mesothelioma.
Therefore, developing an anti-VISTA antibody with strong specificity and high affinity will provide possibility for the treatment of various cancers, and has great application potential and market value.
In view of this, the present invention has been made.
Disclosure of Invention
The present invention aims to provide anti-VISTA antibodies and uses thereof.
The invention is realized in the following way:
in a first aspect, embodiments of the present invention provide an anti-VISTA antibody or antigen binding fragment comprising the CDRs as set forth in any one of (1) to (7):
(1) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 2-4, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO:6 to 8; (2) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 10-12, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO:14 to 16; (3) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 18-20, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO: 22-24; (4) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 26-28, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO:30 to 32; (5) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 34-36, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO:38 to 40; (6) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 42-44, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO:46 to 48; (7) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 50-52, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO:54 to 56.
In a second aspect, embodiments of the present invention provide an antibody conjugate comprising: the antibody or antigen-binding fragment thereof of the preceding embodiment.
In a third aspect, embodiments of the present invention provide the use of an antibody or antigen binding fragment thereof as described in the preceding embodiments for the preparation of a detection product for VISTA antigen.
In a fourth aspect, embodiments of the present invention provide the use of an antibody or antigen binding fragment thereof as described in the preceding embodiments for the manufacture of a product for targeting VISTA for the diagnosis, prevention or treatment of a disease.
In a fifth aspect, embodiments of the invention provide a reagent or kit comprising an antibody or antigen-binding fragment thereof as described in the previous embodiments.
In a sixth aspect, embodiments of the invention provide an isolated nucleic acid encoding an antibody or antigen-binding fragment thereof as described in the previous embodiments.
In a seventh aspect, embodiments of the present invention provide a vector comprising the isolated nucleic acid of the previous embodiments.
In an eighth aspect, embodiments of the present invention provide a cell comprising the vector of the previous embodiment.
In a ninth aspect, embodiments of the present invention provide a medicament or pharmaceutical composition comprising an active ingredient comprising at least one of an antibody or antigen binding fragment thereof as described in the preceding embodiments, an antibody conjugate as described in the preceding embodiments, a reagent or kit as described in the preceding embodiments, an isolated nucleic acid as described in the preceding embodiments, and a vector as described in the preceding embodiments or a cell as described in the preceding embodiments.
The invention has the following beneficial effects:
the present invention provides antibodies against VISTA, which have high affinity for VISTA, and are capable of specifically recognizing and binding to VISTA.
The invention is based on the provided anti-VISTA antibody, and carries out construction of an Antibody Drug Conjugate (ADC), and through an in vitro killing experiment, the anti-tumor effect of the VISTA-MMAE ADC provided by the invention is verified, and the VISTA-MMAE ADC has a remarkable killing effect on NCI-H2803-hVISTA-GFP tumor cells.
The anti-VISTA antibody provided by the invention can be widely applied to the preparation of medicines for preventing, diagnosing and treating tumors and autoimmune diseases.
Drawings
In order to more clearly illustrate the technical solutions of the embodiments of the present invention, the drawings that are needed in the embodiments will be briefly described below, it being understood that the following drawings only illustrate some embodiments of the present invention and therefore should not be considered as limiting the scope, and other related drawings may be obtained according to these drawings without inventive effort for a person skilled in the art.
FIG. 1 shows the binding results of immunofluorescence analysis of recombinant murine monoclonal antibodies 2D12, 16H8, 10A12, 1G2, JCY, F8, KY to cell over-expressed VISTA molecules;
FIG. 2 shows in vitro tumor killing results of ADC with 2D12, 16H8, 10A12, 1G2, JCY, F8, KY coupled to MMAE, respectively;
FIG. 3 is the results of an in vivo anti-tumor assay for evaluating ADC with 2D12, 16H8, 10A12, 1G2, JCY, F8, KY coupled to MMAE respectively using NCG murine model;
FIG. 4 is an immunohistochemical analysis of a clinical tissue sample VISTA of pleural mesothelioma.
Detailed Description
In order to make the objects, technical solutions and advantages of the embodiments of the present invention more clear, the technical solutions of the embodiments of the present invention will be clearly and completely described below. The specific conditions are not noted in the examples and are carried out according to conventional conditions or conditions recommended by the manufacturer. The reagents or apparatus used were conventional products commercially available without the manufacturer's attention.
In one aspect, embodiments of the present invention provide an anti-VISTA antibody or antigen binding fragment comprising the CDRs as set forth in any one of (1) to (7):
(1) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 2-4, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO:6 to 8;
(2) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 10-12, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO:14 to 16;
(3) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 18-20, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO: 22-24;
(4) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 26-28, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO:30 to 32;
(5) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 34-36, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO:38 to 40;
(6) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 42-44, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO:46 to 48;
(7) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 50-52, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO:54 to 56.
The present invention provides antibodies against VISTA, which have high affinity for VISTA, and are capable of specifically recognizing and binding to VISTA.
In the present invention, the term "antibody" encompasses a variety of antibody structures, including, but not limited to, monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies, trispecific antibodies, tetraspecific antibodies, and the like), murine antibodies, chimeric antibodies, full length antibodies, and the like, so long as they exhibit the desired antigen-binding activity.
The "chimeric antibody" according to the present invention is an antibody in which a variable region of a murine antibody and a constant region of a human antibody are fused, and can reduce an immune response induced by the murine antibody. The chimeric antibody is established by firstly establishing a hybridoma secreting the mouse-derived specific monoclonal antibody, cloning a variable region gene from a mouse hybridoma cell, cloning a constant region gene of a human antibody according to requirements, connecting the mouse variable region gene and the human constant region gene into a chimeric gene, inserting the chimeric gene into a human vector, and finally expressing chimeric antibody molecules in a eukaryotic industrial system or a prokaryotic industrial system.
In the present invention, the terms "complementarity determining regions", "CDRs" or "CDRs" refer to the highly variable regions of the heavy and light chains of immunoglobulins, which are regions within the antibody variable domains that contribute primarily to specific binding to an antigen.
In the present invention, the heavy chain complementarity determining region is represented by HCDR, and 3 CDR regions are contained in the heavy chain variable region: HCDR1, HCDR2 and HCDR3, or VH-CDR1, VH-CDR2 and VH-CDR3; the light chain complementarity determining region is denoted by LCDR, and the 3 CDR regions contained in the light chain variable region: LCDR1, LCDR2, and LCDR3, or VL-CDR1, VL-CDR2, and VL-CDR3.
In some embodiments, the antibody or antigen binding fragment further comprises a framework region of a heavy chain variable region and a framework region of a light chain variable region.
In the present invention, the "framework region" or "FR" region refers to a region other than CDRs in the antibody heavy chain variable region and light chain variable region; the heavy chain framework region can be further subdivided into contiguous regions (FR 1, FR2, FR3, and FR 4) separated by CDRs, wherein the heavy chain framework region can be further subdivided into contiguous regions separated by CDRs comprising HFR1, HFR2, HFR3, and HFR4 framework regions; the light chain framework regions may be further subdivided into contiguous regions separated by LCDR, comprising LFR1, LFR2, LFR3 and LFR4 framework regions. The heavy chain variable region is obtained by ligating the following numbered CDRs with an FR (from amino-terminal to carboxy-terminal) arrangement: HFR1-HCDR1-HFR2-HCDR2-HFR3-HCDR3-HFR4; the light chain variable region is obtained by ligating the following numbered CDRs with an FR (from amino-terminal to carboxy-terminal) arrangement: LFR1-LCDR1-LFR2-LCDR2-LFR3-LCDR3-LFR4.
In some embodiments, the heavy chain variable region and the light chain variable region are as set forth in any one of (a) - (g):
(a) The amino acid sequences of the heavy chain variable region and the light chain variable region are shown in SEQ ID NO:1 and 5;
(b) The amino acid sequences of the heavy chain variable region and the light chain variable region are shown in SEQ ID NO:9 and 13;
(c) The amino acid sequences of the heavy chain variable region and the light chain variable region are shown in SEQ ID NO:17 and 21;
(d) The amino acid sequences of the heavy chain variable region and the light chain variable region are shown in SEQ ID NO:25 and 29;
(e) The amino acid sequences of the heavy chain variable region and the light chain variable region are shown in SEQ ID NO:33 and 37;
(f) The amino acid sequences of the heavy chain variable region and the light chain variable region are shown in SEQ ID NO:41 and 45;
(g) The amino acid sequences of the heavy chain variable region and the light chain variable region are shown in SEQ ID NO:49 and 53.
The CDRs shown in (1) to (7) correspond to the heavy chain variable regions and the light chain variable regions shown in (a) to (g) one by one in this order.
In some embodiments, the antibody or antigen binding fragment further comprises a constant region. Optionally, the constant region comprises a heavy chain constant region and/or a light chain constant region. The light chain of a full length antibody comprises a light chain variable region domain VL at the amino terminus of the light chain and a constant region domain CL at the carboxy terminus of the CL domain, the light chain comprising a kappa chain and a lambda chain; the full length antibody heavy chain comprises a heavy variable region domain VH at the amino terminus of the heavy chain and a constant region CH, the CH domain being at the carboxy terminus.
In some embodiments, the constant region is selected from the constant region of any of IgG1, igG2, igG3, igG4, igA, igM, igE, and IgD.
In some embodiments, the constant region is of a species origin of bovine, equine, porcine, ovine, rat, mouse, canine, feline, rabbit, donkey, deer, mink, chicken, duck, goose, or human.
In some embodiments, the antibody is selected from any one of a monoclonal antibody, a polyclonal antibody, a multispecific antibody, a murine antibody, a chimeric antibody, and a full-length antibody.
An "antigen binding fragment" herein is a portion of an intact antibody that specifically binds to an antigen to which the intact antibody binds. It will be readily appreciated by those skilled in the art from the disclosure herein that antigen binding fragments may be obtained by methods known in the art, for example, enzymatic digestion (including pepsin or papain) and/or by chemical reduction cleavage of disulfide bonds, and may also be obtained by recombinant genetic techniques or by synthesis by an automated peptide synthesizer (e.g., an automated peptide synthesizer of Applied BioSystems).
In some embodiments, the antigen binding fragment is selected from the group consisting of F (ab') 2 Any of Fab', fab, fv and scFv.
In another aspect, embodiments of the present invention provide an antibody conjugate comprising: the antibody or antigen-binding fragment thereof of any of the preceding embodiments.
In some embodiments, the antibody conjugate further comprises a drug molecule conjugated to the antibody or antigen binding fragment.
In some embodiments, the drug molecule comprises: monomethyl auristatin E.
In some embodiments, the antibody conjugate further comprises a solid support coupled to the antibody or antigen binding fragment thereof.
In some embodiments, the antibody conjugate further comprises a detectable label conjugated to the antibody or antigen binding fragment thereof.
In the actual use process, a person skilled in the art can select a suitable marker according to the detection condition or the actual requirement, and no matter what marker is used, the marker belongs to the protection scope of the invention.
In some embodiments, the label is selected from at least one of a fluorescent dye, an enzyme, a radioisotope, a chemiluminescent reagent, and a nanoparticle-based label.
In another aspect, embodiments of the present invention provide the use of an antibody or antigen binding fragment thereof as described in any of the preceding embodiments in the preparation of a detection product for VISTA antigen.
In some embodiments, the product comprises any one of a test strip, a reagent, and a kit;
in some embodiments, the method of detecting is selected from the group consisting of: ELISA, immunofluorescence, chemiluminescent immunoassay, western blot, immunochromatography, electrochemical immunoassay and magnetic bead method.
In another aspect, embodiments of the invention provide the use of an antibody or antigen binding fragment thereof as described in any of the preceding embodiments in the manufacture of a product for targeting VISTA to diagnose, prevent or treat a disease.
In some embodiments, the disease comprises: any one of a tumor and an autoimmune disease.
In some embodiments, the tumor comprises: at least one of prostate cancer, renal clear cell carcinoma, non-small cell lung cancer, colorectal cancer and pleural mesothelioma.
In some embodiments, the product is selected from any one of a reagent, a kit, and a medicament.
In another aspect, embodiments of the invention provide a reagent or kit comprising an antibody or antigen-binding fragment thereof as described in any of the previous embodiments.
In another aspect, embodiments of the invention provide an isolated nucleic acid encoding an antibody or antigen-binding fragment thereof as described in any of the previous embodiments.
In another aspect, embodiments of the invention provide a vector comprising an isolated nucleic acid as described in any of the preceding embodiments.
In some embodiments, the vector comprises an expression vector. The term "expression vector" as used herein refers to any recombinant polynucleotide construct that can be used to introduce a DNA fragment of interest directly or indirectly (e.g., packaged into a virus) into a host cell by transformation, transfection or transduction for expression of the gene of interest. One type of vector is a plasmid, i.e., a circular double stranded DNA molecule, into which a DNA fragment of interest can be ligated into a plasmid loop. Another type of vector is a viral vector, which can ligate and package the DNA fragment of interest into the viral genome (e.g., adenovirus, adeno-associated virus, retrovirus, lentivirus, oncolytic virus). After these vectors enter host cells, expression of the gene of interest can be performed.
The person skilled in the art can also use the nucleic acid sequence of the invention as a template by means of in vitro transcription to transcribe into RNA, and further transduce or transform the RNA into host cells by transfection, or can express the antibody or the functional fragment thereof of the invention to exert the biological effect of the invention.
In another aspect, embodiments of the invention provide a cell comprising a vector according to any of the preceding embodiments.
In some embodiments, the cell is a host cell, including prokaryotic host cells, eukaryotic host cells, and phage. The prokaryotic host cell can be escherichia coli, streptomycete, bacillus subtilis or the like. The eukaryotic host cell may be 293 cells, 293T cells, 293FT cells, CHO cells, COS cells, per6, saccharomyces cerevisiae, pichia pastoris, hansen yeast, candida, a portion of insect cells, and plant cells. 293 series cells, per6 cells and CHO cells are common mammalian cells used for the production of antibodies or recombinant proteins and are well known to those of ordinary skill in the art.
In another aspect, embodiments of the present invention provide a method of producing an antibody or antigen-binding fragment thereof according to any of the preceding embodiments, comprising culturing a cell capable of expressing the antibody or antigen-binding fragment thereof.
Based on the disclosed amino acid sequences of the antibodies, the antibodies can be prepared by a person skilled in the art using genetic engineering techniques or other techniques (chemical synthesis, recombinant expression), e.g. by isolation and purification from a culture of recombinant cells capable of recombinantly expressing an antibody according to any of the above claims, which is readily accomplished by a person skilled in the art, and on which the antibodies of the invention are prepared by any of the techniques, which fall within the scope of the invention.
In addition, the embodiment of the present invention provides a medicament or pharmaceutical composition, wherein the active ingredient comprises at least one of the antibody or antigen binding fragment thereof according to any of the preceding embodiments, the antibody conjugate according to any of the preceding embodiments, the reagent or kit according to any of the preceding embodiments, the isolated nucleic acid according to any of the preceding embodiments, and the vector according to any of the preceding embodiments or the cell according to any of the preceding embodiments.
The term "pharmaceutical composition" as used herein means a combination of at least one drug and optionally a pharmaceutically acceptable carrier or adjuvant, which are combined together to achieve a particular purpose. In certain embodiments, the pharmaceutical compositions comprise combinations that are separated in time and/or space, so long as they are capable of co-acting to achieve the objects of the present invention. Some pharmaceutical compositions achieve enhanced biological efficacy or reduced side effects of the invention (e.g., may be used in combination with other antineoplastic agents to enhance antineoplastic effects) by the combined administration of some pharmaceutically acceptable ingredients or compounds. Other pharmaceutical compositions have the purpose of facilitating the administration to organisms, facilitating the absorption of the active ingredient, enhancing stability or targeting, extending half-life and thus better exerting the biological efficacy of the invention.
The features and capabilities of the present invention are described in further detail below in connection with the examples.
Example 1
(1) Preparation of VISTA recombinant protein: the nucleic acid sequence encoding human VISTA (nm_ 022153.2) was synthesized by the Anhui general biosystems. PCR was amplified and subcloned into pcDNA3.1 expression vector (Invitrogen). The extracellular domain of VISTA was then subcloned into pcdna3.1 expression vectors carrying Fc or His tags at the C-terminus, respectively. Wherein the Fc tag comprises human Fc (hFc) and murine Fc (mFc). By transient transfection 293FT, freeStyle was used TM Serum-free medium (Life Technologies) was shake-flask cultured for 5-7 days, the supernatant was collected, subjected to centrifugal ultrafiltration, and then purified by Protein a/G or nickel column affinity chromatography and molecular sieve chromatography column for recombinant VISTA Protein carrying Fc or His tag.
(2) Preparation of stable transgenic cell lines expressing human VISTA antigen: the full-length sequence encoding human VISTA was constructed into pcdna3.1 expression vector carrying IRES-EGFP. CHO-S (ATCC) cells were cultured in CD-CHO medium (Life Technologies); heLa cells were cultured in DMEM containing 10% fetal bovine serum. Cell transfection was performed using the Lipofectamine LTX (Life Technologies) transfection reagent, after 48 hours, flow sorting was performed, cultured to 96 well plates, monoclonal stable cell lines were screened and identified, and CHO (CHO-VISTA-EGFP) and Hela (Hela-VISTA-EGFP) cells stably expressing VISTA were maintained.
Example 2
1. Preparation of anti-VISTA monoclonal antibodies:
(1) Immunization of animals
Balb/c female mice aged 5-6 weeks were used as immunized animals at a dose of 100. Mu.g/mouse. The first immunization was performed by subcutaneous multipoint injection after full emulsification with 100 μl Freund's complete adjuvant (Sigma) mixed with an equal volume of recombinant VISTA protein. Every 2 weeks, the recombinant protein was mixed with an equal volume of Freund's incomplete adjuvant (Sigma), and after sufficient emulsification, subcutaneous multipoint injection was performed. The boost was performed 4 times, and the mice were tested for antibody titers by tail-cutting blood sampling on day 10 after the last boost. 3 days before cell fusion, 100 μg of recombinant protein was impacted intraperitoneally once.
(2) Cell fusion and hybridoma selection
Under aseptic conditions, spleen of mice was taken, a suspension enriched in B cells was prepared, and cell fusion with SP2/0 was performed according to the classical PEG (Sigma) method. The fused cells were resuspended in HAT medium and cultured. Half-plating was performed on day 5 and day 10 after fusion using fresh HAT medium. ELISA, immunofluorescence and flow analysis were performed 11-15 days after fusion, and positive clones were screened.
ELISA screening was performed using 96-well plates, and in brief, VISTA recombinant protein was coated at 100 ng/well at 4℃overnight onto the bottom of the well plates, developed using HRP-conjugated anti-mouse IgG antibodies and chemiluminescent reagents (Biyun Biotech), and read at 450nm using an ELISA reader. Immunofluorescence staining using Hela cell lines stably expressing VISTA, briefly, cell lines were grown in 96-well plates with the addition of 50 μl hybridoma supernatant as primary antibody, incubation at 4 degrees for 2 hours, PBS wash 3 times, cy 3-labeled coat Anti-Mouse IgG (proteontech) as secondary antibody, incubation at room temperature for 1 hour, PBS wash 3 times, and images were collected using a fluorescence microscope. Flow cytometry analysis CHO cells stably expressing VISTA were used, briefly, cells were collected by centrifugation and resuspended in PBS buffer containing 50 μl of hybridoma supernatant, incubated at 4 degrees for 2 hours, PBS washed 3 times, CY 3-labeled coat Anti-Mouse IgG (bi cloud biotechnology company) as secondary antibody, incubated for 1 hour at room temperature, PBS washed 3 times, and analyzed by flow cytometry (Agilent-Novosampler Pro).
According to the ELISA analysis, immunofluorescence analysis and flow cytometry analysis results, seven optimal hybridoma clones (named 2D12, 16H8, 10A12, 1G2, JCY, F8, KY) can be finally determined for subsequent sequence cloning and affinity analysis.
Example 3
Cloning of hybridoma antibody variable region sequences: the hybridoma cells in the logarithmic growth phase were collected, and RNA was extracted by Trizol (Invitrogen) and reverse transcribed (PrimeScriptTM Reverse Transcriptase, takara). And (3) carrying out PCR amplification on the cDNA obtained by reverse transcription by using a mouse Ig-Primer Set (Novagen), and sequencing to finally obtain the heavy chain variable region sequences and the light chain variable region sequences of the seven monoclonal antibodies. Wherein the variable region CDR sequences of the heavy and light chains are shown in table 1.
TABLE 1 CDR sequences contained in the heavy and light chain variable regions of murine monoclonal antibodies
Remarks: VH is a heavy chain variable region and VL is a light chain variable region.
Example 4
Binding assay of recombinant chimeric antibodies to hela cervical cancer cells over-expressing VISTA.
Human (IgG 1) and murine (IgG 2 a) heavy chain constant regions, as well as human/murine light chain constant regions, were cloned into pcDNA3.1 (Invitrogen) plasmid vectors, and then the VH and VL gene fragments of hybridoma clones 2D12, 16H8, 10A12, 1G2, JCY, F8, KY were constructed into human IgG1 heavy chain constant region (ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT, SEQ ID NO: 57) and human IgG kappa light chain constant region (TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF, respectivelyNRGEC, SEQ ID NO: 58) to obtain recombinant chimeric antibody heavy chain expression vector and light chain expression vector, transient transfection of 293FT, and use of FreeStyle TM Serum-free medium (Life Technologies) is shake-flask cultured for 5-7 days, supernatant is collected, centrifugal ultrafiltration is carried out, and then corresponding type of anti-VISTA recombinant monoclonal antibody is obtained through Protein A/G affinity chromatography and molecular sieve chromatographic column purification. Hela-VISTA-EGFP cells were plated in 24-well cell culture dishes, the next day recombinant chimeric antibodies 2D12, 16H8, 10A12, 1G2, JCY, F8, KY were used as primary antibodies, CY 3-labeled Goat Anti-Mouse IgG (Biyun biotechnology Co.) was used as secondary antibodies, and the antibodies were photographed by fluorescent confocal imaging.
As shown in fig. 1, the results from fig. 1 indicate that: the recombinant chimeric antibodies 2D12, 16H8, 10A12, 1G2, JCY, F8 and KY can specifically bind to the cell Hela-VISTA-EGFP.
Example 5
Binding assay of hybridoma antibodies to murine VISTA.
cDNA clones of murine VISTA were purchased from Yinqiao Shenzhou, and then a stable expression cell line CHO-mVISTA of murine VISTA was constructed as in example 2. Then, supernatants of hybridomas 2D12, 16H8, 10A12, 1G2, JCY, F8, and KY were collected and analyzed by flow cytometry according to example 2. The results indicate that the monoclonal antibodies are not able to bind to murine VISTA.
Example 6
In vitro binding affinity and kinetic experiments.
This example was measured using the Surface Plasmon Resonance (SPR) method and analyzed using the GE company Biacore 8K instrument. The VISTA-His recombinant protein is covalently connected to a CM5 (GE) chip by using a kit provided by Biacore through a standard amino coupling method, and then antibodies to be detected (recombinant chimeric antibodies 2D12, 16H8, 10A12, 1G2, JCY, F8 and KY) are diluted in the same buffer solution according to different concentration gradients for sample injection, and the sample injection is regenerated by using a regeneration reagent matched in the kit. Analysis and collection of data was performed using Biacore 8K companion analysis software. The results obtained are shown in Table 2 below.
TABLE 2 in vitro binding affinity and kinetic analysis of antibody antigens
Antibodies to Antigens Binding Rate ka (1/M. Times.s) Dissociation rate kd (1/s) Affinity KD (M)
2D12 VISTA-His 6.78E+05 2.33E-04 3.44E-10
16H8 VISTA-His 5.28E+05 2.31E-03 4.38E-09
10A12 VISTA-His 1.64E+06 2.87E-04 1.75E-10
1G2 VISTA-His 2.34E+05 3.55E-07 1.52E-12
JCY VISTA-His 4.32E+05 3.14E-05 7.28E-11
F8 VISTA-His 1.32E+06 6.02E-06 4.59E-12
KY VISTA-His 1.96E+06 3.82E-04 1.95E-10
Example 7
In vitro killing experiments of VISTA-MMAE ADC.
Cell viability was measured with CCK8 reagent after three days incubation with VISTA-MMAE and NCI-H2803-hVISTA-GFP cells. Drugs are classified into monoclonal antibody groups and VISTA-MMAE groups. Drug concentration was three-fold diluted from 1 μm to twelfth concentration. The control group was cell-only and medium-only. Each group had 3 duplicate wells. NCI-H2803-hVISTA-GFP cells were plated in 96-well plates at approximately 5000 cells/well. The following day, each group of drugs was added to the cells and incubated at 37℃for 72 hours in incubator. The 96-well plate was removed, 10. Mu.l of CCK8 reagent was added to each well, and the wells were placed again in a 37℃incubator and incubated for 2 hours. The well plate was removed and absorbance was measured at 450 nm. The results are shown in FIG. 2.
As can be seen from the results of fig. 2, VISTA-MMAE ADC (recombinant chimeric antibodies 2D12, 16H8, 10a12, 1G2, JCY, F8, KY) had a significant killing effect on NCI-H2803-hVISTA-GFP tumor cells compared to the addition of the monoclonal antibody set.
Example 8
Xenograft mouse model anti-tumor experiments.
This example uses a xenograft mouse model to evaluate the in vivo anti-tumor activity of VISTA-targeted antibodies (recombinant chimeric antibodies 2D12, 16H8, 10a12, 1G2, JCY, F8, KY). The assessment was performed using an immunodeficient murine model.
NCG severe immunodeficiency murine model: NCG severe immunodeficiency mice were purchased from Nanjing university model animal institute, 3X 10 6 NCI-H2803-hVISTA-GFP cells in logarithmic growth phase were inoculated subcutaneously in the right back of NCG mice. When the tumor grows to 200mm about 6 days 3 After that, mice with uniform tumor-bearing volumes were randomly grouped, 5 mice per group. An equal volume of ADC storage buffer was set as a control group for dosing. The ADC was administered by tail vein administration, 5, 10 or 15mg/kg, 1 time every 4 days, for a total of 3 times. Mice were weighed every 4 days and tumor size was measured. The average volume of the transplanted tumor is calculated according to the formula v=1/2 (l×w2), where L represents the length of the tumor body and W represents the width of the tumor body. When the tumor volume of the mice reaches 2000mm 3 Or the surface of the tumor is obviously broken, the mice are sacrificed, and the animal experiment is finished. The experimental results are shown in FIG. 3.
As is clear from the results of FIG. 3, the VISTA-MMAE ADC (2D 12, 16H8, 10A12, 1G2, JCY, F8, KY) had a remarkable inhibitory effect on the growth of NCI-H2803-hVISTA-GFP tumor cells, as compared with the control group without administration.
Example 9
Immunohistochemical analysis of clinical tumor tissue specimens VISTA.
Tissue sections were incubated at 65℃for 1H, blocked with PBS containing 10% goat serum for 30 min at room temperature, and then incubated overnight with VISTA monoclonal antibody (2D 12, 16H8 of example 4) at 4 ℃. Incubation with goat anti-human secondary antibody, staining with 3,3' -diamine aniline. The percentage of positively stained cells and the intensity of cell staining for 5 fields were selected randomly by simple statistics.
Staining intensity score 0 (negative); 1 (weak positive); 2 (moderate positive); 3 (strong positive). The total score was quantified as = (1 x weak positive stain%2 x positive stain%3 x strong positive stain%) x 100 for the histopathological score. The experimental results are shown in FIG. 4.
From the results of fig. 4, VISTA was expressed more highly in pleural mesothelioma.
The following are sequences according to the invention:
/>
/>
the above description is only of the preferred embodiments of the present invention and is not intended to limit the present invention, but various modifications and variations can be made to the present invention by those skilled in the art. Any modification, equivalent replacement, improvement, etc. made within the spirit and principle of the present invention should be included in the protection scope of the present invention.

Claims (10)

1. An anti-VISTA antibody or antigen-binding fragment comprising the CDRs of any one of (1) to (7):
(1) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 2-4, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO:6 to 8;
(2) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 10-12, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO:14 to 16;
(3) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 18-20, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO: 22-24;
(4) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 26-28, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO:30 to 32;
(5) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 34-36, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO:38 to 40;
(6) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 42-44, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO:46 to 48;
(7) The amino acid sequences of HCDR1, HCDR2 and HCDR3 are shown in SEQ ID NO: 50-52, the amino acid sequences of LCDR1, LCDR2 and LCDR3 are shown in SEQ ID NO:54 to 56.
2. The antibody or antigen-binding fragment of claim 1, further comprising a framework region of a heavy chain variable region and a framework region of a light chain variable region;
optionally, the heavy chain variable region and the light chain variable region are as set forth in any one of (a) to (g):
(a) The amino acid sequences of the heavy chain variable region and the light chain variable region are shown in SEQ ID NO:1 and 5;
(b) The amino acid sequences of the heavy chain variable region and the light chain variable region are shown in SEQ ID NO:9 and 13;
(c) The amino acid sequences of the heavy chain variable region and the light chain variable region are shown in SEQ ID NO:17 and 21;
(d) The amino acid sequences of the heavy chain variable region and the light chain variable region are shown in SEQ ID NO:25 and 29;
(e) The amino acid sequences of the heavy chain variable region and the light chain variable region are shown in SEQ ID NO:33 and 37;
(f) The amino acid sequences of the heavy chain variable region and the light chain variable region are shown in SEQ ID NO:41 and 45;
(g) The amino acid sequences of the heavy chain variable region and the light chain variable region are shown in SEQ ID NO:49 and 53;
optionally, the antibody or antigen binding fragment further comprises a constant region;
alternatively, the constant region is selected from the group consisting of a constant region of any one of IgG1, igG2, igG3, igG4, igA, igM, igE, and IgD;
optionally, the constant region is derived from bovine, equine, porcine, ovine, rat, mouse, canine, feline, rabbit, donkey, deer, mink, chicken, duck, goose, or human;
alternatively, the antibody is selected from any one of a monoclonal antibody, a polyclonal antibody, a multispecific antibody, a murine antibody, a chimeric antibody, and a full-length antibody;
alternatively, the antigen binding fragment is selected from the group consisting of F (ab') 2 Any of Fab', fab, fv and scFv.
3. An antibody conjugate, comprising: the antibody or antigen-binding fragment thereof of claim 1 or 2;
optionally, the antibody conjugate further comprises a drug molecule conjugated to the antibody or antigen binding fragment;
optionally, the drug molecule comprises: monomethyl auristatin E;
optionally, the antibody conjugate further comprises a solid support coupled to the antibody or antigen binding fragment thereof;
optionally, the antibody conjugate further comprises a detectable label conjugated to the antibody or antigen binding fragment thereof.
4. Use of the antibody or antigen binding fragment thereof of claim 1 or 2 in the preparation of a detection product for VISTA antigen;
optionally, the product comprises any one of a test paper, a reagent and a kit;
optionally, the method of detecting is selected from: ELISA, immunofluorescence, chemiluminescent immunoassay, western blot, immunochromatography, electrochemical immunoassay and magnetic bead method.
5. Use of the antibody or antigen-binding fragment thereof of claim 1 or 2 in the manufacture of a product for targeting VISTA for diagnosis, prevention or treatment of a disease;
optionally, the disease comprises: any one of a tumor and an autoimmune disease;
optionally, the tumor comprises: at least one of prostate cancer, renal clear cell carcinoma, non-small cell lung cancer, colorectal cancer, and pleural mesothelioma;
optionally, the product is selected from any one of a reagent, a kit and a medicament.
6. A reagent or kit comprising the antibody or antigen-binding fragment thereof according to claim 1 or 2.
7. An isolated nucleic acid encoding the antibody or antigen-binding fragment thereof of claim 1 or 2.
8. A vector comprising the isolated nucleic acid of claim 7.
9. A cell comprising the vector of claim 8.
10. A medicament or pharmaceutical composition, characterized in that the active ingredients thereof comprise: at least one of the antibody or antigen binding fragment thereof of claim 1 or 2, the antibody conjugate of claim 3, the reagent or kit of claim 6, the isolated nucleic acid of claim 7 and the vector of claim 8 and the cell of claim 9.
CN202311192857.3A 2023-09-15 2023-09-15 anti-VISTA antibodies and uses thereof Pending CN117285628A (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
CN202311192857.3A CN117285628A (en) 2023-09-15 2023-09-15 anti-VISTA antibodies and uses thereof

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN202311192857.3A CN117285628A (en) 2023-09-15 2023-09-15 anti-VISTA antibodies and uses thereof

Publications (1)

Publication Number Publication Date
CN117285628A true CN117285628A (en) 2023-12-26

Family

ID=89256431

Family Applications (1)

Application Number Title Priority Date Filing Date
CN202311192857.3A Pending CN117285628A (en) 2023-09-15 2023-09-15 anti-VISTA antibodies and uses thereof

Country Status (1)

Country Link
CN (1) CN117285628A (en)

Similar Documents

Publication Publication Date Title
EP3689909A1 (en) Tigit antibody, antigen-binding fragment thereof, and medical use thereof
EP3511346A1 (en) Anti-ctla4 and anti-pd-1 bifunctional antibody, pharmaceutical composition thereof and use thereof
JP5631733B2 (en) Anti-EpCAM antibodies and uses thereof
JP2020018298A (en) Antibody constructs for cldn18.2 and cd3
WO2017201766A1 (en) Anti-human pd-1 humanized monoclonal antibody and use thereof
KR20180037950A (en) Bispecific antibody constructs that bind mesothelin and CD3
CN114560941B (en) Antibodies to CLDN18.2 and uses thereof
US11639388B2 (en) CD3 antigen binding fragment and application thereof
EP1871807A2 (en) Antibodies against cxcr4 and methods of use thereof
CN110914304A (en) CD96 antibody, antigen binding fragment thereof and medical application
KR102608028B1 (en) Monoclonal antibody that specifically binds to the human plasma membrane vesicle-related protein PV-1 and its production method and use
KR20200096814A (en) Continuous manufacturing process of bispecific antibody product
EP4101867A1 (en) Anti-cd3 and anti-cd123 bispecific antibody and use thereof
CN113508139A (en) Antibodies that bind human LAG-3, methods of making, and uses thereof
CN115298216A (en) Antibody or antigen binding fragment thereof, preparation method and medical application thereof
CN114853890B (en) PRLR antigen binding protein and preparation method and application thereof
WO2023001155A1 (en) Glypican-3 antibody and application thereof
TW202309083A (en) Anti-cldn4/anti-cd137 bispecific antibody
CN116761889A (en) Antigen binding proteins and uses thereof
CN117285628A (en) anti-VISTA antibodies and uses thereof
CN114761042A (en) IL-38 specific antibodies
CN115785269B (en) anti-PD-L1 antibodies and uses thereof
JP2022514786A (en) MUC18-specific antibody
CN115947855B (en) Preparation of anti-CD 24 antibodies and uses thereof
CN116003598B (en) Recombinant humanized monoclonal antibody targeting human GPRC5D and application thereof

Legal Events

Date Code Title Description
PB01 Publication
PB01 Publication
SE01 Entry into force of request for substantive examination
SE01 Entry into force of request for substantive examination