WO2010033913A1 - Antibodies, analogs and uses thereof - Google Patents

Antibodies, analogs and uses thereof Download PDF

Info

Publication number
WO2010033913A1
WO2010033913A1 PCT/US2009/057681 US2009057681W WO2010033913A1 WO 2010033913 A1 WO2010033913 A1 WO 2010033913A1 US 2009057681 W US2009057681 W US 2009057681W WO 2010033913 A1 WO2010033913 A1 WO 2010033913A1
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
cancer
pmid
disease
antigen
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2009/057681
Other languages
French (fr)
Inventor
Ram S. Bhatt
Yu Zhang
Rishi S. Bhatt
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
ICB International Inc
Original Assignee
ICB International Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by ICB International Inc filed Critical ICB International Inc
Publication of WO2010033913A1 publication Critical patent/WO2010033913A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/22Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the invention relates to camelid and shark heavy chain only antibodies, their analogs and uses thereof.
  • Ig new antigen receptors IgNARs
  • CNAR constant domains
  • VNAR variable domain
  • the invention provides a polypeptide having all or a portion of at least one variable antigen-binding Vab domain of camelid and or shark heavy chain only antibody, at least ten contiguous amino acids derived from a source other than camelid and/ or shark single-domain heavy chain antibodies lacking light-chains in which the polypeptide includes at least one binding site for an antigen.
  • the polypeptide includes at least two variable antigen-binding (Vab) domains of camelid and or shark heavy chain only antibody.
  • the polypeptide includes at least three, at least four or more variable (Vab) domains of camelid and or shark heavy chain only antibody.
  • the polypeptide may include domains from at least two different species such as camelid and shark, or two different camelid species such as llama, camel, alpaca and dromedaries. In some embodiments, the polypeptide may include one or more substitutions or deletions of the native amino acids.
  • the polypeptide has composition and structures j_a -j_g, 2-14, 20-24, 25-45, 50-79, 81 . -84, 82-91, 93- 97, in which "CHX” represents at least ten contiguous amino acids derived from a source other than camelid and/ or shark single-domain heavy chain antibodies lacking light-chains; "S” represents a linker; "Rn” represents all or a portion of at least one camelid or shark hinge region of single domain heavy chain antibody; L represents an entity linked to the polypeptide, and Vab represents camelid or shark variable region of single domain heavy chain antibody, "D” represents at least two amino acids comprising at least one charged amino acid, VNAR represents shark variable region of single domain heavy chain antibody, CH2 and CH3 represent constant domains 2 and 3 respectively of camelid and or shark single domain antibody lacking light chains, CH4 and CH5 represent constant domains 4 and 5 respectively of shark single domain heavy chain antibody lacking light chains. [0011] In one embodiment
  • Vab Variable antigen-binding domain of camelid and/or shark single domain heavy chain antibodies
  • m 1 to 10, preferably 2 to 5 such that the MW is approximately between 32 to 65 KDa for optimal biodistribution and retention in the body;
  • S is selected from the group consisting of groups I and II in which group I includes 1-20 amino acids of the hinge region of camelid and /or shark single domain heavy chain antibodies comprising at least one lysine and /or cysteine, and group II includes hetrobifunctional linker with one end being capable of covalent binding with amino- or aldehyde group of single-domain antibodies, and the other end with an entity "R9";
  • R9 represents an entity linked to Vab domain.
  • "R9" can be detectable label, enzyme or protein (for example, horse radish peroxidase, alkaline phosphatase, luciferase, beta- galactosidase, and streptavidin), antibody, nucleic acid (for example, DNA, Modified DNA, Locked-DNA, PNA (Peptide Nucleic Acids), RNA, Si-RNA, Micro-RNA, mRNA, RNA- Conjugates/ Modifications), radionucleotides (for example, Fluorine- 18, Gallium-67, Krypton-81m, Rubidium-82, Technetium-99m, Indium-I l l, Iodine-123, Xenon-133, and Thallium-201, Yttrium-90, and Iodine- 131), toxins (for example, Immunotoxins, Ricin, Saporin, Maytansinoid, and Calicheamicin), solid
  • X X-P-Y in which X can be of NHS (N-Hydroxy-succinimide), sulfo-NHS, CHO, COOH, CN, SCN, epoxide, phosphate and other moieties capable of forming covalent bond with NH2 groups of single-domain antibodies;
  • Y can be maleimido, NHS, sulfo-NHS, SH, COOH, SCN, NH2, and epoxide, capable of forming a covalent bond with the thiol group of the detectable label;
  • the invention provides a polypeptide having all or a portion of at least two variable antigen-binding (V ab) domains of camelid and or shark single domain heavy chain antibody lacking light chains, and all or a portion of at least one hinge region of camelid and or shark single domain heavy chain antibody lacking light chains, in a single polypeptide chain in which the polypeptide includes at least one binding site for an antigen.
  • the polypeptide includes at least three, at least four or more variable (Vab) domains of camelid and or shark single domain heavy chain antibody lacking light chain.
  • the polypeptide may include one or more substitutions or deletions of the native amino acids.
  • the invention provides a polypeptide comprising all or a portion of at least one variable (Vab) domain of camelid and or shark single domain heavy chain antibody lacking light chains, and all or a portion of at least one hinge region of camelid and or shark single domain heavy chain antibody.
  • the polypeptide may include one or more substitutions or deletions of the native amino acids.
  • the invention provides a composition having at least two polypeptides, in which each of the polypeptides includes all or a portion of at least one variable (Vab) domain of camelid and or shark single domain heavy chain antibody lacking light chain, all or a portion of at least one hinge region of camelid and or shark single domain heavy chain antibody lacking light chain in which at least one of the polypeptide includes at least one binding site for an antigen, and the polypeptides are linked to each other through at least one linker.
  • the composition has improved biodistribution and retention.
  • at least one linker is a peptide bond.
  • at least one linker is other than a peptide bond.
  • the polypeptides of the composition include at least three, at least four, at least five or more variable antigen-binding (Vab) domains of camelid and or shark single domain heavy chain antibody.
  • the polypeptide may include one or more substitutions or deletions of the native amino acids.
  • the composition is represented by structure Id in which Vab represents variable antigen binding domain of camelid and or shark single domain heavy chain antibody lacking light chain, "Rn” represents all of portion of hinge region of camelid and/or shark heavy chain only antibody, "Man” represents maleic anhydride.
  • the composition is represented by structures 21, 23, and 24 in which at least one of the variable antigen-binding domains is capable of binding to a biomarker associated with a disease.
  • Vab represents variable antigen binding domain of came lid and /or shark single domain heavy chain antibody lacking light chain
  • A represents carbon or nitrogen atom
  • L represents a linker
  • Rn represents all of portion of hinge region of came lid and/or shark single domain heavy chain antibody lacking light chain.
  • composition comprises four variable antigen-binding domains (Vab) of camelid and or shark single domain heavy chain antibody lacking light chain in which the structure of the composition is represented by structures 79 in which at least one of the Vab domains is capable of binding to a biomarker associated with a disease.
  • Vab variable antigen-binding domains
  • CHX may be of all or portion of CHl region of human IgG or cysteine capable of forming s-s bonds
  • CHY represents CHX-R, where R represents [Vab-
  • Sl represents a linker such as structure 15, cysteine-s-s-cysteine
  • R represents all of portion of hinge region of camelid and/or shark heavy chain only antibody
  • N represents at least two amino acids.
  • the invention provides a polypeptide comprising all or a portion of at least two variable antigen-binding (Vab) domains of camelid and or shark single domain heavy chain antibody lacking light chain, at least ten contiguous amino acids derived from a source other than camelid and/ or shark single-domain heavy chain antibodies lacking light- chains, all or a portion of at least one hinge region of camelid and or shark single domain heavy chain antibody lacking light chain in a single polypeptide chain in which at least two Vab domains bind to at least two different antigens, and the polypeptide has improved biodistribution and retention.
  • Vab variable antigen-binding
  • the polypeptide includes all or a portion of at least one hinge region of camelid and or shark single domain heavy chain antibody lacking light chain. In one embodiment of all of the above aspects of the invention, the polypeptide includes all or a portion of at least one camelid and or shark single domain heavy chain constant domain 2 (CH2). In one embodiment of all of the above aspects of the invention, the polypeptide includes all or a portion of at least one camelid and or shark single domain heavy chain constant domain 3 (CH3).
  • CH2 camelid and or shark single domain heavy chain constant domain 2
  • CH3 camelid and or shark single domain heavy chain constant domain 3
  • At least one amino acid at positions 37, 44, 45, and 47 of the Vab region is selected from the group consisting of serine, glutamine, tyrosine, histidine, asparagine, threonine, aspartic acid, glutamic acid, lysine and arginine.
  • the polypeptide may include one or more substitutions or deletions of the native amino acids.
  • the polypeptide may include domains from at least two different species such as camelid and shark, or two different camelid species such as llama, camel, alpaca and dromedaries.
  • the polypeptide or the composition is capable of binding specifically to one or more antigens.
  • antigens include but not limited to AMACR; TMPRS S2-ERG; EPCA2; PSMA; PSA; HAAH; APP; ALZAS; Tau; gamma secretase; beta secretase; APO-Al; Apo-H; alfa- Synuclein; PV-I PEDF; BDNF; Cystatin C; VGF nerve growth factor inducible; APO-E; GSK-3 binding protein; TEMl; PGD2; EGFR; EGFRT790M; Notch-4; ALDH-I; ESR-I; EGFRT790M; HER-2/neu; P53; RAS; KLKBl; SMAD4; Smad7; TNF-alfa; HPV; tPA; PCA-3; Mucin; Cadherin-2; FcRn alpha chain; cytoplasmic acid, gamma secretase; beta secreta
  • the polypeptide is linked to at least one entity other than an antibody.
  • the entity can be detectable label, enzyme or protein (for example, horse radish peroxidase, alkaline phosphatase, luciferase, beta-galactosidase, and streptavidin), antibody, nucleic acid (for example, DNA, Modified DNA, Locked-DNA, PNA (Peptide Nucleic Acids), RNA, Si- RNA, Micro-RNA, mRNA, RNA-Conjugates/ Modifications), radionucleotides (for example, Fluorine- 18, Gallium-67, Rrypton-81m,Rubidium-82, Technetium-99m, Indium-I l l, Iodine- 123, Xenon-133, and Thallium-201, Yttrium-90, and Iodine-131), toxins (for example, Immunotoxins, R
  • At least ten contiguous amino acids derived from a source other than camelid and/ or shark single-domain heavy chain antibodies lacking light-chains can be all or portions of all or a portion constant domain 1 (CHl) of human heavy chain immunoglobulin G.
  • at least ten contiguous amino acids derived from a source other than camelid and/ or shark single-domain heavy chain antibodies lacking light-chains can be CHl domain of any immunoglobulin.
  • at least ten contiguous amino acids can be derived from peptide hormones, signal peptides, interleukins, interferon beta and gamma, growth factors.
  • At least ten amino acids can be derived from the amino acid sequence of SEQ ID NO: 48-97.
  • Exemplary peptide hormones include but not limited luteinizing hormone, follicle-stimulating hormone, prolactin, adrenocorticotrophic hormone, glucocorticoids, and growth hormone.
  • Exemplary growth factors include but not limited to basic fibroblast growth factor, platelet derived growth factor, epidermal growth factor, pigment epithelium derived factor.
  • Exemplary signal peptides include but not limited to peroxisomal targeting signals, nuclear localization signal.
  • the invention provides a method for diagnosing an individual with one or more diseases.
  • the method includes a) obtaining a sample of bodily fluid from the individual, b) detecting the presence or absence of one or more pathological biomarkers for the disease in which the detection includes utilizing the polypeptide or the composition of the above aspects of the invention such that the polypeptide or at least one of the polypeptide in the composition binds specifically to the biomarker, c) determining the level of one or more biomarkers if present in the individual's sample, d) comparing the level of one or more biomarkers to a reference values, and e) identifying the individual as having one or more diseases when the level of one or more biomarkers in the individual's sample is higher than the reference values.
  • the reference values are the levels of the biomarkers in an individual without such one or more diseases.
  • the invention provides a method of preventing, treating, and/or alleviating symptoms associated with one or more diseases by administering to a subject in need thereof one or more polypeptides or the compositions of the above aspects of the invention.
  • one or more diseases can be Parkinson's disease, Alzheimer's disease, AIDS, Lyme disease, malaria, SARS, Down syndrome, anthrax, bacterial botulism.
  • one or more polypeptides or the compositions of the above aspects may further include one or more entities selected from the group consisting of therapeutic agent, toxin, and radionucleotide.
  • the invention provides a method of simultaneously diagnosing, preventing, treating, and/or alleviating symptoms associated with an individual.
  • the method includes a) administering to the individual in need thereof the polypeptide or the composition of the above aspects of the invention, b) detecting the presence or absence of a biomarker for the disease in which the detection includes utilizing the polypeptide or the composition of the above aspects of the invention in which the polypeptide or composition binds specifically to a biomarker associated with the disease, c) determining the level of the biomarker if present in the individual's sample, d) comparing the level to a reference value, e) identifying the individual as having the disease when the level of the biomarker in the individual's sample is higher than the reference value, and f) preventing, treating, and/or alleviating symptoms associated with the disease in the individual when the polypeptide or the composition of the above aspects of the invention specifically binds to the biomarker.
  • the polypeptide or the composition may further include an entity selected from the group consisting of therapeutic agent, toxin, and radionucleotide.
  • the reference value is the level of the biomarker in an individual without such disease. In some embodiments, the reference value is the level of the biomarker in the same individual measured at a different time. In some embodiments, the reference value is the level of the biomarker from a collected pool of samples from different individuals.
  • the disease may be cancer, Parkinson's disease, Alzheimer's disease, AIDS, Lyme disease, malaria, SARS, Down syndrome, anthrax, salmonella or bacterial botulism, staphylococcus aureus.
  • the cancer can be lung cancer, bladder cancer, gastric cancer, ovarian cancer, brain cancer, breast cancer, prostate cancer, cervical cancer, ovarian cancer, oral cancer, colorectal cancer, leukemia, childhood neuroblastoma, or Non-Hodgkin's lymphoma.
  • the biomarker can be AMACR, TMPRSS2-ERG, HAAH, APP, A ⁇ 42, ALZAS, Tau, gamma secretase, beta secretase, PEDF, BDNF, Cystatin C, VGF nerve growth factor inducible, APO-E, GSK-3 binding protein, TEMl, PGD2, EGFR, ESR-I, HER-2/neu, P53, RAS, SMAD4, Smad7, TNF-alfa, HPV, tPA, PCA-3, Mucin, Cadherin-2, FcRn alpha chain, cytokerratin 1-20, Apo-H, Celuloplasmin, Apo All, VGF, Vif, LEDGF/p75, TSlOl, gp 120, CCR5, HIV protease, HIV integrase, Bacillus anthracis protein, NadD (Nicotinate Mononucletide Adenyltransferas
  • the biomarkers for Alzheimer's disease may be Amyloid- beta, ALZAS, Tau, DJ-I, Bax-1, PEDF, HPX, Cystatin-C, Beta-2-Microglobulin, BDNF, Tau-Kinase, gamma-Sercretase, beta-Secretase, Apo-E4, and VGF-Peptide.
  • the biomarkers associated with Parkinson's Disease may be Apo-H, Cerulopasmin, Chromogranin-B, VDBP, Apo-E, Apo-AII, and alaf-Synuclein.
  • the biomarkers for Brain Cancer may be TEMl , Plasmalemmal Vesicle (PV-I), Prostaglandin D Synthetase, and (PGD-S).
  • the biomarkers for HIVAIDS wherein said biomarkers for HIVAIDS may be gpl20, Vif, LEDGF/p75, TSlOl, HIV-Integrase, HIV-Reverse Transcriptase, HIV-Protease, CCR5, and CXCR4.
  • the biomarkers for Lung Cancer may be KRAS, Ki67, EGFR, KLKBl, EpCAM, CYFRA21-1, tPA, ProGRP, Neuron-specific Enolase (NSE), and hnRNP.
  • the biomarkers for Prostate Cancer may be AMACR, PCA3, TMPRSS2-ERG, HEPSIN, B7-H3, SSeCKs, EPCA-2, PSMA, BAG-I, PSA, MUC6, hK2, PCA-I, PCNA, RKIP, and c-HGK.
  • the biomarkers for Breast Cancer may be EGFR, EGFRT790M, HER-2, Notch-4, ALDH-I, ESRl, SBEM, HSP70, hK-10, MSA, p53, MMP- 2, PTEN, Pepsinigen-C, Sigma-S, Topo-11-alfauKPA, BRCA-I, BRCA-2, SCGB2A1, and SCGB1D2.
  • the biomarkers for Colorectal Cancer may be SMAD4, EGFR, KRAS, p53, TS, MSI-H, REGIA, EXTL3, plK3CA, VEGF, HAAH, EpCAM, TEM8, TKl, STAT-3, SMAD-7, beta-Catenin, CK20, MMP-I, MMP-2, MMP-7,9,11, and VEGF-D.
  • the biomarkers for Ovarian Cancer may be CD24, CD34, EpCAM, hK8, 10, 13, CKB, Cathesin B, M-CAM, c-ETSl, and EMMPRIN.
  • the biomarkers for Cervical Cancer may be HPV, CD34, ERCCl, Beta-CF, Id-I, UGF, SCC, pl6, p21WAFl, PP-4, and TPS.
  • the biomarkers for Bladder Cancer may be CKl 8, CK20, BLCa-I, BLCA-4, CYFRA21-1, TFT, BTA, Survivin, UCAl, UPII, FAS, and DD23.
  • the bacteria or biomarkers associated with a disease causing bacteria can be Clostridium Botulinum (Bacterial Botulism), Bacillus Anthracis (Anthrax), Salmonella Typhi (Typhoid Fever), Treponema Pallidum (Syphilis), Plasmodinum (Malaria), Chlamadyia (STDs), Borrelia B (Lyme disease), Staphyloccus Aureus, Tetanus, Meningococcal Meningitis (Bacterial Meningitis), and Mycobacterium tuberculosis (Tuberculosis, TB), and NadD(Nicotinate Mononucleotide Adenyltransferase, an enzyme involved in inducing resistance to antibiotics );
  • disease causing virus or biomarkers associated may be Pandemic Flu Virus HlNl strain, Influenza virus H5N1 strain, Hepatitis B virus (HBV) antigen OSt-577, HBV core antigen HBcAg (HBV), HBV antigen Wnt-1, Hepatitis C Virus (HCV) antigen Wnt-1, and HCV RNA (HCV).
  • HBV Hepatitis B virus
  • HBV antigen Wnt-1 HBV antigen Wnt-1
  • HCV Hepatitis C Virus
  • a nucleic acid encodes all or portion of a polypeptide having all or a portion of at least one variable (Vab) domain of camelid and or shark single domain heavy chain antibody, all or a portion of at least one constant domain 1 (CHl) of human heavy chain immunoglobulin G in which the polypeptide includes at least one binding site for an antigen.
  • the polypeptide includes at least two variable (Vab) domains of camelid and or shark single domain heavy chain antibody.
  • the polypeptide includes at least three, at least four or more variable (Vab) domains of camelid and or shark single domain heavy chain antibody.
  • the nucleic acid is operably linked to one or more expression regulatory element which is capable of modulating the expression of the nucleic acid.
  • expression regulatory elements include but are not limited to a promoter, enhancer, 5'- and 3 '-untranslated regions, polyadenylation signal.
  • the invention provides a method for producing a polypeptide of the above aspects of the invention.
  • the method includes transforming a host cell with a recombinant nucleic acid encoding the polypeptide of the above aspects of the invention, and expressing the polypeptide in the host cell.
  • the host cell is eukaryotic. In another embodiment, the host cell is prokaryotic.
  • the invention provides a method for producing a polypeptide of the above aspects of the invention.
  • the method includes a chemical synthesis of a polypeptide comprising one , two, or more variable antigen-binding (Vab) domains using the parent antibody produced from camelid and /or shark as a starting material for generating the polypeptide with one or more Vab domains.
  • the invention provides a method for generating polypeptides comprising multivalent variable antigen- binding domains improving binding affinity between antibody and its antigen, and to improve it biodistribution and retention.
  • Biological molecules with molecular weight between 15 to 17 KDa though can enter a cell or cross blood brain barrier (BBB), they are not retained inside the cell to be therapeutically efficacious [Nature Biotechnology, 23, 1126 (2005)]. Conversely, biologicals, such as, conventional mouse monoclonal antibodies are too big (MW- 150 KDa) to enter a cell or cross BBB efficiently. Ideal tumor targeting reagents are intermediate-sized multivalent molecules with molecular weight of- 55 KDa [Nature Biotechnology, 23, 1126 (2005)].
  • the invention encompasses the synthesis of a polypeptide with two or more variable antigen-binding domains to generate the polypeptide with a MW - 30 to 60 KDa, more preferably 40 to 60 KDa, but ideally - 55 KDa.
  • the polypeptide comprises camelid Vab domains and /or shark V-NAR domains, in which such constructions/preparations are performed either chemically and/or via recombinant DNA methods.
  • the invention provides a method for detecting the presence or absence of an antigen associated with a disease in a sample.
  • the method includes a) obtaining a sample suspected of having the antigen, b) detecting the level of the antigen in the sample utilizing the polypeptide or composition of the above aspects of the invention in which the polypeptide or composition binds specifically to the antigen.
  • the level of the antigen in the sample is indicative of the presence or absence of the antigen.
  • the invention provides a method for detecting the presence or absence of circulating tumor cells in a sample.
  • the method includes a) obtaining a sample suspected of having circulating tumor cells, b) detecting the level of one or more tumor cell surface receptors utilizing the polypeptide or composition of the above aspects of the invention in which the polypeptide or composition binds specifically to the tumor cell surface receptors.
  • the level of the tumor cell surface receptors in the sample is indicative of the presence or absence of the circulating tumor cell.
  • Exemplary tumor cell surface receptors include but not limited to MUC-I, VCAM-I, EpCAm-I, CD44, CD133, E-Cadherin, VEGF, bFGF, sFASL, CD95, p53, Bcl-2 CyclinDl, Cyclin E, TNF-alfa, TGF-betal, Her-2, EGFR, IGF-I and IGF-IR, IL-2R, Ras, and cMyc.
  • the invention provides a method for detecting the presence or absence of circulating fetal cells in a sample.
  • the method includes a) obtaining a sample suspected of having circulating fetal cells, b) detecting the level of one or more fetal cell surface receptors utilizing the polypeptide or composition of the above aspects of the invention in which the polypeptide or composition binds specifically to the fetal cell surface receptors.
  • the level of the fetal cell surface receptors in the sample is indicative of the presence or absence of the circulating fetal cell.
  • Exemplary tumor cell surface receptors include but not limited to GPA, CD71, CD133, CD34, CD44, ITCAM, ITGBl (Integrin beta-1), Trop-1, Trop-2, HLA-G233, and 6B5.
  • the invention provides a method for detecting an organism or a cell.
  • the method includes obtaining a sample, detecting the presence or absence of one or biomarkers associated with the organism or a cell utilizing the polypeptides or compositions of the above aspects of the invention.
  • the presence of one or more biomarkers in the sample is indicative of the presence of the organism or a cell.
  • the organism is a pathogenic organism such as bacteria or virus.
  • the pathogenic organism is selected from the group consisting of Bacillus anthracis, Borrelia burgdorferi, Salmonella typhi, Plasmodium falciparum, Human immune deficiency virus (HIV), Hepatitis B virus (HBV), and severe acute respiratory syndrome virus (SARS).
  • the cell is selected from the group consisting of circulating fetal cell and circulating tumor cell.
  • antibody refers to immunoglobulin G (IgG) having only heavy chains without the heavy chain constant domain 1 (CHl) and also lacking the light chain such as in shark IgNAR and came lids IgG2 and IgG3. Antibody can be monoclonal or polyclonal.
  • analogs within the scope of the term “antibody” include those produced by digestion with various proteases, those produced by chemical cleavage, chemical coupling, chemical conjugation, and those produced recombinantly, so long as the fragment remains capable of specific binding to a target molecule.
  • Analogs within the scope of the term include antibodies (or fragments thereof) that have been modified in sequence, but remain capable of specific binding to a target molecule, including: interspecies chimeric and humanized antibodies; antibody fusions; heteromeric antibody complexes and antibody fusions, such as diabodies (bispecif ⁇ c antibodies), single-chain diabodies, and intrabodies (see, e.g., Marasco (ed.), Intracellular Antibodies: Research and Disease Applications, Springer-Verlag New York, Inc. (1998) (ISBN: 3540641513).
  • antibodies can be produced by any known technique, including harvest from cell culture of native B lymphocytes, harvest from culture of hybridomas, recombinant expression systems, and phage display.
  • heavy chain only antibody and “single domain heavy chain antibody” has been used herein interchangeably in the context of came lid and shark antibodies and refer to camelid immunoglobulin G (IgG) and shark IgNAR having only heavy chains without the heavy chain constant domain 1 (CHl) and further lacking the light chain such as camelids IgG2 and IgG3 and shark IgNAR.
  • Heavy chain only antibody can be monoclonal or polyclonal.
  • polypeptides, antibodies and its analogs refers to polypeptides, antibodies and its analogs that can cross cell membrane and blood brain barrier (BBB) and have greater thermal and chemical stability than conventional immunoglobulin G with heavy and light chains.
  • BBB blood brain barrier
  • polypeptides, antibodies and its analogs typically have molecular weight between 25 to 90 KDa, preferably between 30 to 60 KDa.
  • the molecular weight is at least 25 KDa, 30 KDa, 35 KDa, 40 KDa, 45 KDa, 50 KDa, 55 KDa, 60 KDa, 65 KDa, 70 KDa, 75 KDa, 80 KDa, 85 KDa, or 90 KDa. Although larger and smaller molecular weights are possible.
  • biomarker and antigen is used interchangeably and refer to a molecule or group of molecules comprised of nucleic acids, carbohydrates, lipids, proteins, peptides, enzymes and antibodies which is associated with a disease, physiological condition, or an organism. An organism can be pathogenic or nonpathogenic. A biomarker may not necessarily be the reason for a disease or a physiological condition. An amount of a biomarker may be increased or decreased in disease or a physiological condition.
  • came lid refers to members of the biological family Camelidae in the Order: Artiodactyla, Suborder: Tylopoda. Exemplary members of this group include camels, dromedaries, llamas, alpacas, vicunas, and guanacos.
  • the term "shark” as used herein refers to members that belong to the super order Selachimorpha in the subclass Elasmobranchii in the class Chondrichthyes. There are more than 400 species of sharks known. Exemplary members of the class Chondrichthyes include great white sharks, houndsharks, cat sharks, hammerhead sharks, blue, tiger, bull, grey reef, blacktip reef, Caribbean reef, blacktail reef, whitetip reef, oceanic whitetip sharks, zebra sharks, nurse sharks, wobbegongs, bramble sharks, dogfish, roughsharks, and prickly sharks.
  • a portion of in the context of antibodies such as camelid and shark heavy chain only antibodies and their analogs, or human antibodies means at least 2, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 125, 150, 200, 250, 300, 350, 400 or more amino acids.
  • a portion of in the context of hinge region of camelid and shark single domain heavy chain antibodies means at least 1, 2, 5, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 125, 150, 200, 250, 300, 350, 400 or more amino acids of the hinge region.
  • diagnosis refers to the act or process of identifying or determining a disease or condition in an organism or the cause of a disease or condition by the evaluation of the signs and symptoms of the disease or disorder.
  • a diagnosis of a disease or disorder is based on the evaluation of one or more factors and/or symptoms that are indicative of the disease. That is, a diagnosis can be made based on the presence, absence or amount of a factor which is indicative of presence or absence of the disease or condition.
  • Each factor or symptom that is considered to be indicative for the diagnosis of a particular disease does not need be exclusively related to the particular disease; i.e. there may be differential diagnoses that can be inferred from a diagnostic factor or symptom.
  • there may be instances where a factor or symptom that is indicative of a particular disease is present in an individual that does not have the particular disease.
  • reference value means a value which can be used for comparison with a biomarker under investigation.
  • a reference value may be the level of a biomarker under investigation from one or more individuals without any known disease.
  • a reference value may be the level of the biomarker in an idividual's sample collected at a different time.
  • treatment refers to care by procedures or application that are intended to relieve illness or injury.
  • treating a condition or disease will result in an improvement of the condition
  • the term treating as used herein does not indicate, imply, or require that the procedures or applications are at all successful in ameliorating symptoms associated with any particular condition. Treating a patient may result in adverse side effects or even a worsening of the condition which the treatment was intended to improve.
  • sample or “patient sample” as used herein includes biological samples such as cells, tissues, bodily fluids, and stool.
  • Bodily fluids may include, but are not limited to, blood, serum, plasma, saliva, cerebral spinal fluid, pleural fluid, tears, lactal duct fluid, lymph, sputum, urine, amniotic fluid, and semen.
  • a sample may include a bodily fluid that is "acellular”.
  • An "acellular bodily fluid” includes less than about 1% (w/w) whole cellular material. Plasma or serum are examples of acellular bodily fluids.
  • a sample may include a specimen of natural or synthetic origin.
  • body fluid refers to any fluid from the body of an animal.
  • body fluids include, but are not limited to, plasma, serum, blood, lymphatic fluid, cerebrospinal fluid, synovial fluid, urine, saliva, mucous, phlegm and sputum.
  • a body fluid sample may be collected by any suitable method. The body fluid sample may be used immediately or may be stored for later use. Any suitable storage method known in the art may be used to store the body fluid sample; for example, the sample may be frozen at about -2O 0 C to about -7O 0 C. Suitable body fluids are acellular fluids.
  • Acellular fluids include body fluid samples in which cells are absent or are present in such low amounts that the peptidase activity level determined reflects its level in the liquid portion of the sample, rather than in the cellular portion. Typically, an acellular body fluid contains no intact cells. Examples of acellular fluids include plasma or serum, or body fluids from which cells have been removed.
  • ELISA enzyme linked immunosorbent assay
  • ELISA enzyme linked immunosorbent assay
  • ELISA enzyme linked immunosorbent assay
  • ELISA refers to an antibody-based assay in which detection of the antigen of interest is accomplished via an enzymatic reaction producing a detectable signal.
  • ELISA can be run as a competitive or noncompetitive format.
  • ELISA also includes a 2-site or "sandwich” assay in which two antibodies to the antigen are used, one antibody to capture the antigen and one labeled with an enzyme or other detectable label to detect captured antibody-antigen complex.
  • the antigen has at least one epitope to which unlabeled antibody and an enzyme-linked antibody can bind with high affinity. An antigen can thus be affinity captured and detected using an enzyme-linked antibody.
  • Typical enzymes of choice include alkaline phosphatase or horseradish peroxidase, both of which generated a detectable product upon digestion of appropriate substrates.
  • label refers to any physical molecule directly or indirectly associated with a specific binding agent or antigen which provides a means for detection for that antibody or antigen.
  • a "detectable label” as used herein refers any moiety used to achieve signal to measure the amount of complex formation between a target and a binding agent. These labels are detectable by spectroscopic, photochemical, biochemical, immunochemical, electromagnetic, radiochemical, or chemical means, such as fluorescence, chemifluoresence, or chemiluminescence, electro-chemiluminescence or any other appropriate means. Suitable detectable labels include fluorescent dye molecules or fluorophores.
  • polypeptide polypeptide
  • protein protein
  • peptide polypeptide
  • peptide polypeptide
  • protein protein
  • peptide polypeptide
  • peptide polypeptide
  • the amino acid chains can be of any length of greater than two amino acids.
  • polypeptide polypeptide
  • modified forms may be naturally occurring modified forms or chemically modified forms. Examples of modified forms include, but are not limited to, glycosylated forms, phosphorylated forms, myristoylated forms, palmitoylated forms, ribosylated forms, acetylated forms, ubiquitinated forms, etc.
  • Modifications also include intra-molecular crosslinking and covalent attachment to various moieties such as lipids, flavin, biotin, polyethylene glycol or derivatives thereof, etc.
  • modifications may also include cyclization, branching and cross-linking.
  • amino acids other than the conventional twenty amino acids encoded by genes may also be included in a polypeptide.
  • detectable label refers to a molecule or a compound or a group of molecules or a group of compounds associated with a binding agent such as an antibody or its analogs, secondary antibody and is used to identify the binding agent bound to its target such as an antigen, primary antibody.
  • a detectable label can also be used in to detect nucleic acids. In such cases a detectable label may be incorporated into a nucleic acid during amplification reactions or a detectable label may be associated a probe to detect the nucleic acid.
  • Detecting as used herein in context of detecting a signal from a detectable label to indicate the presence of a nucleic acid of interest in the sample (or the presence or absence of a protein of interest in the sample) does not require the method to provide 100% sensitivity and/or 100% specificity.
  • sensitivity is the probability that a test is positive, given that the person has a genomic nucleic acid sequence
  • specificity is the probability that a test is negative, given that the person does not have the genomic nucleic acid sequence.
  • a sensitivity of at least 50% is preferred, although sensitivities of at least 60%, at least 70%, at least 80%, at least 90% and at least 99% are clearly more preferred.
  • a specificity of at least 50% is preferred, although specificity of at least 60%, at least 70%, at least 80%, at least 90% and at least 99% are clearly more preferred. Detecting also encompasses assays with false positives and false negatives. False negative rates may be 1%, 5%, 10%, 15%, 20% or even higher. False positive rates may be 1%, 5%, 10%, 15%, 20% or even higher.
  • Nucleic acid refers to an oligonucleotide, nucleotide or polynucleotide, and fragments or portions thereof, which may be single or double stranded, and represent the sense or antisense strand.
  • a nucleic acid may include DNA or RNA, and may be of natural or synthetic origin and may contain deoxyribonucleotides, ribonucleotides, or nucleotide analogs in any combination.
  • Non- limiting examples of polynucleotides include a gene or gene fragment, genomic DNA, exons, introns, mRNA, tRNA, rRNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, synthetic nucleic acid, nucleic acid probes and primers.
  • Polynucleotides may be natural or synthetic.
  • Polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs, uracyl, other sugars and linking groups such as fluororibose and thiolate, and nucleotide branches.
  • a nucleic acid may be modified such as by conjugation, with a labeling component.
  • Other types of modifications included in this definition are caps, substitution of one or more of the naturally occurring nucleotides with an analog, and introduction of chemical entities for attaching the polynucleotide to other molecules such as proteins, metal ions, labeling components, other polynucleotides or a solid support.
  • Nucleic acid may include nucleic acid that has been amplified (e.g., using polymerase chain reaction).
  • a fragment of a nucleic acid generally contains at least about 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 200, 300, 400, 500, 1000 nucleotides or more. Larger fragments are possible and may include about 2,000, 2,500, 3,000, 3,500, 4,000, 5,000 7,500, or 10,000 bases.
  • Gene refers to a DNA sequence that comprises control and coding sequences necessary for the production of an RNA, which may have a non-coding function (e.g., a ribosomal or transfer RNA) or which may include a polypeptide or a polypeptide precursor.
  • RNA Ribonucleic acid
  • polypeptide Ribonucleic acid
  • the RNA or polypeptide may be encoded by a full length coding sequence or by any portion of the coding sequence so long as the desired activity or function is retained.
  • cDNA refers to complementary or copy polynucleotide produced from an RNA template by the action of RNA-dependent DNA polymerase activity (e.g., reverse transcriptase).
  • cDNA can be single stranded, double stranded or partially double stranded.
  • cDNA may contain unnatural nucleotides.
  • cDNA can be modified after being synthesized.
  • cDNA may comprise a detectable label.
  • subject or “individual” is meant a human or any other animal that has cells.
  • a subject can be a patient, which refers to a human presenting to a medical provider for diagnosis or treatment of a disease.
  • a human includes pre and post natal forms.
  • patient refers to one who receives medical care, attention or treatment. As used herein, the term is meant to encompass a person diagnosed with a disease as well as a person who may be symptomatic for a disease but who has not yet been diagnosed.
  • vector refers to a recombinant DNA or RNA plasmid or virus that comprises a heterologous polynucleotide capable of being delivered to a target cell, either in vitro, in vivo or ex-vivo.
  • the heterologous polynucleotide can comprise a sequence of interest and can be operably linked to another nucleic acid sequence such as promoter or enhancer and may control the transcription of the nucleic acid sequence of interest.
  • a vector need not be capable of replication in the ultimate target cell or subject.
  • the term vector may include expression vector and cloning vector.
  • Suitable expression vectors are well-known in the art, and include vectors capable of expressing a polynucleotide operatively linked to a regulatory sequence, such as a promoter region that is capable of regulating expression of such DNA.
  • an expression vector refers to a recombinant DNA or RNA construct, such as a plasmid, a phage, recombinant virus or other vector that, upon introduction into an appropriate host cell, results in expression of the inserted DNA.
  • Appropriate expression vectors include those that are replicable in eukaryotic cells and/or prokaryotic cells and those that remain episomal or those which integrate into the host cell genome.
  • promoter refers to a segment of DNA that controls transcription of polynucleotide to which it is operative Iy linked. Promoters, depending upon the nature of the regulation, may be constitutive or regulated. Exemplary eukaryotic promoters contemplated for use in the practice of the present invention include the SV40 early promoter, the cytomegalovirus (CMV) promoter, the mouse mammary tumor virus (MMTV) steroid-inducible promoter, Moloney murine leukemia virus (MMLV) promoter.
  • CMV cytomegalovirus
  • MMTV mouse mammary tumor virus
  • MMLV Moloney murine leukemia virus
  • Exemplary promoters suitable for use with prokaryotic hosts include T7 promoter, beta- lactamase promoter, lactose promoter systems, alkaline phosphatase promoter, a tryptophan (trp) promoter system, and hybrid promoters such as the lac promoter.
  • FIG. 1 shows structural differences between camel, shark, and mouse immunoglobulins (IgGs).
  • the notations CH2, CH3, CH4, CH5 represent constant domain 2, 3, 4 of single domain heavy chain antibody of the respective species.
  • the notations Vab and VNAR represent variable domain of camelid and shark single domain heavy chain antibodes respectively.
  • FIG. 2 shows an exemplary nucleic acid sequence of variable antigen-binding region (Vab) of camel heavy chain only antibody without the light chains (SEQ ID NO: 3).
  • FIG. 3 shows exemplary chemical and/or protease digests of camelid and shark heavy chain only antibodies.
  • the notatio "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
  • FIG. 4 A and B shows the structure of exemplary analogs of camelid heavy chain only antibodies: Micro-, Sub-nano-, Nano- antibodies 3-6, and Multimeric Constructs: Bivalent,_7, Trivalent,8, Multivalent 8, Rabbit Ear-Like Bivalent Construct 9, and Bivalent Construct IJ) with and without Val37, Gly44, Leu45, and Trp47 of Vab changed to polar hydrophilic amino acids, namely, Ser, GIn, Tyr., His, Asn, Thr, Asp, Cys, GIu, Lys, and Arg.
  • the notation "Rn” represents all or portion of the hinge region of camelid or shark single domain antibodies.
  • FIG. 5 shows an exemplary scheme of cloning and expression of camelid heavy chain only antibodies and their analogs.
  • FIG. 6 shows an exemplary nucleic acid sequence of constant domain 1 (CHl) of human IgG (SEQ ID NO: 7).
  • FIG. 7 shows an exemplary scheme of making recombinant bivalent analog of camelid heavy chain only antibodies.
  • FIG. 8 shows an exemplary scheme of chemical synthesis of bivalent analog of camelid and shark heavy chain only antibodies.
  • the notation "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
  • FIG. 9 shows an alternative exemplary scheme of chemical synthesis of bivalent analog of camelid heavy chain only antibodies.
  • the notation "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
  • FIG. 10 shows an exemplary scheme of chemical synthesis of multivalent analog of camelid and shark heavy chain only antibodies.
  • the notation "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
  • FIG. 11 shows an exemplary scheme of chemical synthesis of trivalent analog of camelid and shark heavy chain only antibodies.
  • the notation "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
  • FIG. 12 A and B shows exemplary camelid heavy-chain only antibodies and its analogs conjugated to various entities for diagnostic and therapeutic applications.
  • Man stands for maleic anhydride.
  • the notation "Rn” represents all or portion of the hinge region of camelid or shark single domain antibodies.
  • FIG. 13 shows the exemplary pegylation scheme of camelid heavy-chain only antibodies and its analogs to yield the corresponding pegylated products.
  • the notation "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
  • FIG. 14 shows an exemplary conjugation scheme of nucleic acid to camelid and shark heavy chain only antibodies and their analogs.
  • the notation "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
  • FIG. 15 outlines the steps involved in immobilization of camelid and shark heavy chain only antibodies and their analogs to solid surfaces.
  • FIG. 16 shows the comparison of amino acid sequences of VH domains of conventional monoclonal antibody (mAbVH) with Vab (cVab) region of camel IgG3, Vab region of camel IgG2 having shorter hinge region (lVab) and shark V-NAR.
  • FIG. 17 shows shark heavy chain only antibody (Structure 2), exemplary analogs (structures 52, 53, 54, 55, 56) and exemplary means of making such analogs.
  • the notations "Rn” represents all or portion of the hinge region of camelid or shark single domain antibodies, "D” represents at least two amino acids comprising at least one charged amino acid.
  • FIG. 18 shows schematics of chemically making exemplary shark heavy chain only antibody analogs (structures 52-56, 67- 73) and exemplary means of making conjugates with various entities.
  • the notations "Rn” represents all or portion of the hinge region of camelid or shark single domain antibodies, "D” represents at least two amino acids comprising at least one charged amino acid.
  • FIG. 19 shows schematics of cloning strategy of shark heavy chain only antibody and its analogs.
  • FIG. 20 shows an exemplary amino acid sequence of shark IgNAR (SEQ ID NO: 16). Amino acid sequence of the various regions of the protein are underlined and indicated.
  • FIG. 21 shows an exemplary nucleic acid sequence of shark IgNAR (SEQ ID NO:
  • FIG. 22 shows schematics of chemically linking exemplary hydrophilic linker to shark heavy chain only antibody analog with structure 74.
  • the notation "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
  • FIG. 23 shows an exemplary method of making bi-valent analogs of shark heavy chain only antibody.
  • the notation "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
  • FIG. 24 shows an exemplary method of making tetra-valent analogs of shark heavy chain only antibody.
  • the notation "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
  • FIG. 25 shows an exemplary scheme of capturing and detecting antigens/biomarkers associated with a disease using camelid and shark heavy chain only antibodies and their analogs.
  • FIG. 26 shows an exemplary scheme of capturing and detecting antigens/biomarkers associated with a disease using camelid and shark heavy chain only antibodies and their analogs using immuno-PCR.
  • FIG. 27 shows an exemplary scheme of capturing and detecting rare cells associated with a disease using camelid and shark heavy chain only antibodies and their analogs.
  • FIG. 28 shows an exemplary scheme of detecting chromosomal translocation using captured circulating tumor cells using camelid and shark heavy chain only antibodies and their analogs.
  • FIG. 29 shows an exemplary scheme of detecting prenatal genetic disorder using captured circulating fetal cells using camelid and shark heavy chain only antibodies and their analogs.
  • FIG. 30 shows exemplary amino acid sequences of different biomarkers associated with a disease or pathogen (SEQ ID NOs: 48-97).
  • the terms “a” or “an” mean “one or more” throughout this application.
  • the present invention teaches composition of camelid and/or shark single- domain heavy-chain only antibodies and their analogs for efficient cell and blood brain barrier (BBB) permeability for optimal biodistribution and retention for diagnosing and /or treating human diseases, methods for the development of nano-biomedical technology platforms utilizing camelid and/or shark heavy-chain only antibodies and their analogs for in- vitro and in- vivo diagnosis and treatment of human and animal diseases with such antibodies.
  • BBB blood brain barrier
  • camel antibodies can maintain their antigen binding ability even at 90 0 C [Biochim. Biophys. Acta., 141, 7 (1999)].
  • complementary determining region 3 (CDR3) of camel Vab region is longer, comprising of 16-21 amino acids, than the CDR3 of mouse VH region comprising of 9 amino acids [Protein Engineering, 7, 1129 (1994)]. The larger length of CDR3 of camel Vab region is responsible for higher diversity of antibody repertoire of camel antibodies.
  • camel heavy-chain antibodies In addition to being devoid of light chains, the camel heavy-chain antibodies also lack the first domain of the constant region called CHl, though the shark antibodies do have CHl domain and two additional constant domains CH4 and CH5 [ Nature Biotech. 23, 1126 (2005)]. Furthermore, the hinge regions of camel and shark antibodies have an amino acid sequence different from that of normal heterotetrameric conventional antibodies [(S. Muyldermans, Reviews in MoI. Biotech., 74, 277 (2001)].
  • variable antigen- binding domain of the heavy-chain immunoglobulin is referred to as Vab by the authors of this application (VHH in the literature), to distinguish it from the variable domain VH of the conventional antibodies.
  • the single -domain Vab is remarkably stable by itself without having to be attached to the heavy-chain.
  • This smallest intact and independently functional antigen-binding fragment Vab, with a molecular weight of -12-15 K. Da, derived from a functional heavy-chain full length mini-immunoglobulin, is referred to as nano-antibody by the authors of this application . In the literature, it is known as nanobody [(S. Muyldermans, Reviews in MoI. Biotech., 74, 277 (2001)].
  • the genes encoding these full length single-domain heavy-chain antibodies and antibody-antigen binding fragment Vab can be cloned in phage display vectors, and selection of antigen binders by panning and expression of selected VHH in bacteria offer a very good alternative procedure to produce these antibodies on a large scale. Also, only one domain has to be cloned and expressed to produce in vivo an intact, matured antigen-binding fragment.
  • VH conventional antibodies
  • Vab heavy-chain only antibodies of camel and shark
  • Camelid Vab and shark V-NAR domains each display surface loops which are larger than for conventional murine and human IgGs, and are able to penetrate cavities in target antigens, such as enzyme active sites and canyons in viral and infectious disease biomarkers [PNAS USA., 101, 12444 (2004); Proteins, 55, 187 (2005)].
  • Vab domains which are scattered throughout the primary structure of Vab domain. These amino acid substitutions are, for example, Leu 45 to R (arginine) or Leu45 to C (cysteine); Val37 to Y (Tyr); G44 to E( GIu), and W47(Trp) to G (GIy). Therefore, the solubility of Vab is much higher than the Fab fragment of conventional mouse and human antibodies.
  • camelid Vab and shark V-NAR Another characteristic feature of the structure of camelid Vab and shark V-NAR is that it often contains a cysteine residue in the CDR3 in addition to cysteines that normally exist at positions 22 and 92 of the variable region.
  • the cysteine residues in CDR3 form S-S bonds with other cysteines in the vicinity of CDRl or CDR2 [Protein Engineering, ⁇ , 1129 (1994)].
  • CDRl and CDR2 are determined by the germline V gene. They play important roles together with CDR3 in antigenic binding [Nature Structural Biol.,_9, 803 (1996); J. MoI. Biol, 311, 123 (2001)].
  • camel CDR3 Like camel CDR3, shark also has elongated CDR3 regions comprising of 16 -27 amino acids residues [Eur. J. Immunol., 35_, 936 (2005)].
  • Camelid heavy chain only antibodies comprise a variable antigen-binding (Vab) region , hinge region (HR), and two constant regions CH2 and CH3 as shown in Fig. 1.
  • Vab variable antigen-binding
  • HR hinge region
  • CH2 and CH3 constant regions
  • Exemplary amino acid sequence of camel Vab is disclosed in GenBank accession number ACF49483. The sequence is incorporated herein by reference.
  • Exemplary camel Vab region is listed as SEQ ID NO: 1 and shown below:
  • amino acid sequence of camel hinge region is disclosed in Nature 1993; 363: 446-8.
  • amino acid sequence of camel hinge region is listed as SEQ ID NO: 2 and shown below:
  • EPKIPQPQPKPQPQPQPQPKPQPKPEPECTCPKCP (SEQ ID NO: 2) [0127] Exemplary nucleic acid sequence of camel Vab region is disclosed in GenBank accession number EU861212. Sequence of which is incorporated herein by reference. Exemplary sequence of camel Vab region is listed as SEQ ID NO: 3 and shown in Fig. 2.
  • nucleic acid sequence of the hinge region of heavy chain only antibodies deduced from amino acid sequence is listed as SEQ ID NO: 4 and shown below: ggacagaagacaccgcaccaacggccaagaccccacccccaacagaccgcagccgagacagcggcagagacacgaaccg gagtgcacgtgtcccagatgtcc (SEQ ID NO: 4)
  • Camelids such as camels, alpacas, llamas will be immunized with one or more antigens using the biomarkers associated with different diseases and/or organisms to produce the parent antibody (HCmnAbs, Structure 1) and the mRNA, from which the variants and analogs will be derived, either chemically or through recombinant means.
  • HCmnAbs, Structure 1 the parent antibody
  • mRNA the mRNA
  • exemplary analogs of camelid heavy chain only antibodies include Ia-Ig, 3-14, 20-21, 23-45 and shown in Fig. 1, 3-4, and 8-14.
  • Exemplary analogs include but not limited to structures Ia-Ig, 3-14, 20-21, 23-45 shown in Fig. 1, 3-4, and 8-14.
  • the analogs may be univalent or multivalent such as, divalent, trivalent, tetravalent, pentavalent etc.
  • the analogs may be made by recombinant technology or by chemical means.
  • Fig. 5 The steps involved in the production of various analogs of camelid single-domain antibodies Ia, Ib, and Ic with and without the constant domain 1 (CHl) of human IgG are outlined in Fig. 5.
  • Exemplary nucleic acid sequence of CHl domain of human IgG is disclosed in GenBank accession number EO 1508. Sequences of which are incorporated herein by reference.
  • Exemplary nucleic acid sequence of CHl domain of human IgG is listed as SEQ ID NO: 7 and shown in Fig. 6.
  • mRNA from camelid species will be isolated using commercially available kits for example, RNeasy Protect Mini kit, RNeasy Protect Cell Mini kit, QIAamp RNA Blood Mini kit, RNeasy Protect Saliva Mini kit, Paxgene Blood RNA kit from Qiagen; MELTTM, RNaqueous®, ToTALLY RNATM, RiboPureTM-Blood, Poly(A)PuristTM from Applied Biosystems; TRIZOL® reagent, Dynabeads® mRNA direct kit from Invitrogen.
  • Nucleic acid extracted can be amplified using nucleic acid amplification techniques well know in the art. Nucleic acid amplification can be linear or exponential. By way of example, but not by way of limitation these techniques can include the polymerase chain reaction (PCR) and reverse transcriptase polymerase chain reaction (RT-PCR).
  • PCR polymerase chain reaction
  • RT-PCR reverse transcriptase polymerase chain reaction
  • Oligonucleotide primers for use in these methods can be designed according to general guidance well known in the art as described herein, as well as with specific requirements as described herein for each step of the particular methods described.
  • oligonucleotide primers for cDNA synthesis and PCR are 10 to 100 nucleotides in length, preferably between about 15 and about 60 nucleotides in length, more preferably 25 and about 50 nucleotides in length, and most preferably between about 25 and about 40 nucleotides in length. There is no standard length for optimal hybridization or polymerase chain reaction amplification.
  • T m of a polynucleotide affects its hybridization to another polynucleotide (e.g., the annealing of an oligonucleotide primer to a template polynucleotide).
  • the oligonucleotide primer selectively hybridizes to a target template or polynucleotides derived from the target template (i.e., first and second strand cDNAs and amplified products).
  • target template or polynucleotides derived from the target template i.e., first and second strand cDNAs and amplified products.
  • selective hybridization occurs when two polynucleotide sequences are substantially complementary (at least about 65% complementary over a stretch of at least 14 to 25 nucleotides, preferably at least about 75%, more preferably at least about 90% complementary).
  • mismatch may be small, such as a mono-, di- or tri-nucleotide. In preferred embodiments, 100% complementarity is preferred.
  • Portions of CHl domain of human IgG can be synthesized.
  • Exemplary sequences include SEQ ID NO: 8-15.
  • Restriction enzyme sites (such as Xho 1) can be designed at the 3 '-end of the sequence. Sequences of SEQ ID NO: 8-15 are shown below. The Xho restriction site is underlined.
  • Portions of CHl domain of human IgG can be blunt end ligated to the 3'-end of camelid Vab domain sequence using methods well known in the art. See, Sambrook et al., Molecular Cloning: A Laboratory Manual (2nd Ed.) (1989), Cold Spring Harbor Press, N. Y. The ligated product will be analyzed and purified by agarose gel. The ligated product may be inserted into phage display vectors using standard methods. See, Sambrook et al., Molecular Cloning: A Laboratory Manual (2nd Ed.) (1989), Cold Spring Harbor Press, N. Y.
  • Plasmid library will be constructed using the PCR amplicons comprising Vab domains and all possible permutation and combination of all or portions of Hinge region (HR), constant domain 1 of heavy chain of human IgG (CHl), constant domain 2 of camelid or the constant domain 1 (CHl) shark heavy chain only antibody, or constant domain 2 CH2, constant domain 3 of camelid or shark heavy chain only antibody (CH3).
  • the amplicons may include domains from at least two different species such camelid and shark, or two different camelid species such as llama, camel, alpaca.
  • Exemplary amplicons include but not limited to Vab-HR-CH2-CH3, Vab-HR, Vab-HR-CHl, Vab-CH2- CH3 + AA 45 (amino acid 45 is hydrophilic amino acids such as, Lys, His, Ser, Asn, GIn, Arg, GIn, GIu, Cys, Asp or Thr), Vab-HR-CH1+ AA 45, Vab-HR+AA 45, Vab-HR-Vab, Vab-HR-CHl-Vab, Vab-HR-CH2-Vab, Vab-HR- Vab-HR-Vab, Vab-HR-Vab-HR- Vab-HR- Vab-HR- Vab-HR- Vab-vab.
  • the Ig-NAR protein has been found to be a dimer with each chain composed of one variable (V) and five constant (C) domains and shown as structure 2 in Fig. 1.
  • the V regions of NAR proteins conforms to the model of prototypic Ig superfamily domains with the predicted canonical disulfide bond connecting two beta sheets and several other invariants or conserved residues involved in the structural packing.
  • the V-NAR region has been found to be unique in that it has an exceptionally small CDR2 and poor conservation of those amino acid residues responsible for VH/VL domain in typical IgGs and T-cell receptors.
  • Exemplary amino acid sequence of shark Ig-NAR is disclosed in GenBank accession number ABB83616. Sequence of which is incorporated herein by reference.
  • Exemplary amino acid sequence of shark Ig-NAR is listed as SEQ ID NO: 16 and shown in Fig. 20.
  • Exemplary nucleic acid sequence of shark IgNAR is disclosed in GenBank accession number DQ268538. Sequence of which is incorporated herein by reference. Exemplary sequence of shark IgNAR is listed as SEQ ID NO: 17 and shown in Fig. 21.
  • V-NAR of shark antibodies is also independently stable and functionally active without being attached to the parent antibody. It is advantageous to develop and evaluate the following shark antibodies and their analogs for diagnostics, therapeutics and diagnostics with therapeutic (theranostic) applications.
  • the sharks will be immunized with one or more antigens using the biomarkers associated with different diseases and/or organisms.
  • Shark heavy chain only antibodies and their analogs can be generated by either by protease digestion, recombinant or chemical means.
  • the analogs may be monovalent, divalent or multivalent (e.g., tri-, terra-, penta- valent).
  • RNA may be extracted using MagNA Pure LC mRNA HS kit and Mag NA Pure LC Instrument (Roche Diagnostics Corporation, Roche Applied Science, Indianapolis, IN).
  • Qiagen products such as the QiaAmp DNA Blood MiniKit (Cat.# 51104, Qiagen, Valencia, CA), the QiaAmp RNA Blood MiniKit (Cat.# 52304, Qiagen, Valencia, CA); Promega products such as the Wizard Genomic DNA Kit (Cat.# Al 620, Promega Corp. Madison, WI), Wizard SV Genomic DNA Kit (Cat.# A2360, Promega Corp. Madison, WI), the SV Total RNA Kit (Cat.# X3100, Promega Corp. Madison, WI), PolyATract System (Cat.# Z5420, Promega Corp. Madison, WI), or the PurYield RNA System (Cat.# Z3740, Promega Corp. Madison, WI).
  • Qiagen products such as the QiaAmp DNA Blood MiniKit (Cat.# 51104, Qiagen, Valencia, CA), the QiaAmp RNA Blood MiniKit (Cat.# 52304, Qiagen, Valencia, CA); Prom
  • Nucleic acid extracted can be amplified using nucleic acid amplification techniques well know in the art. Nucleic acid amplification can be linear or exponential. By way of example, but not by way of limitation these techniques can include the polymerase chain reaction (PCR) reverse transcriptase polymerase chain reaction (RT-PCR). Oligonucleotide primers for use in these methods can be designed according to general guidance well known in the art as described herein, as well as with specific requirements as described herein for each step of the particular methods described.
  • PCR polymerase chain reaction
  • RT-PCR reverse transcriptase polymerase chain reaction
  • IgNAR gene can be amplified using different combinations of forward and reverse primers. Sequences of exemplary forward and reverse primers to amplify all or portions of shark IgNAR gene are shown below:
  • VNAR-HR-CHl region can be amplified using the various combinations of forward and reverse primers. Sequences of exemplary forward and reverse primers are shown below:
  • VNAR-HR-CH 1-CH2 region can be amplified using the various combinations of forward and reverse primers. Sequences of exemplary forward and reverse primers are shown below:
  • VNAR-HR region can be amplified using the various combinations of forward and reverse primers. Sequences of exemplary forward and reverse primers are shown below:
  • Analogs may also be generated by chemical and enzymatic treatment of camelid heavy chain only antibodies and analogs thereof.
  • the analogs may be monovalent, divalent or multivalent (e.g., tri-, terra-, penta- valent).
  • Series of novel analogs of heavy-chain antibodies may be generated by chemical means or enzymatic means. Exemplary methods are disclosed in Fig. 8-14 and 17-19.
  • camelid and shark heavy chain only antibodies (structures 1 and ⁇ respectively) will be purified using standard methods of purifying antibodies. Exemplary method of antibody purification is shown in Example 12. Camelid and shark heavy chain only antibodies will then be used to develop several analogs by chemical techniques.
  • TCEP Tris-carboxyethyl phosphine
  • camelid and shark heavy chain only antibody can be treated with reducing agents such as beta mercaptoethanol or dithiothreitol.
  • the single chain analog (structures Ia and 52) can be treated with proteolytic enzymes such as pepsin, trypsin or papain to generate analogs of smaller size.
  • single chain analog can be treated with pepsin under controlled condition to generate an analog of structure of structure Ib and 55.
  • the pepsin digests (structures Ib and 55) can be further subjected to proteolytic treatment, such as with trypsin to generate a smaller fragment such as structures Ic and 53.
  • structure 53 can be further fragment by protease digest such as pepsin, trypsin, papain under controlled condition to generate shark heavy chain only antibody analog comprising all or portions of NAR and all or portions of HR domains, such as structure 72.
  • Crosslinking can be done with or without spacers of various lengths. Crosslinking can be done for example, between two primary amines using commercially available reagents (e.g., BS(PEG)9, BS(PEG)5, EGS, BSOCOES, DSP, DSG, from Thermo Scientific, Rockford, IL), between a primary amine and a sulfhydryl group using commercially available reagents (e.g., SM(PEG)24, SM(PEG)12, LC-SMCC, Sulfo-SMCC, Sulfo-LC-SPDP, Sulfo-EMCS, SMCC, from Thermo Scientific, Rockford, IL).
  • reagents e.g., BS(PEG)9, BS(PEG)5, EGS, BSOCOES, DSP, DSG, from Thermo Scientific, Rockford, IL
  • Proteins can be derivatized to generate new functional groups. For example, N-hydroxysulfosuccinimide (Sulfo-NHS) and its uncharged analog N-hydroxysuccinimide (NHS) are used to convert carboxyl groups to amine -reactive Sulfo-NHS esters. Traut's reagent can be used to generate a sulfhydryl group. Proteins can be pegylated using commercially available reagents. For example, SM(PEG)n, BS(PEG)9, BS(PEG)5 from Thermo Scientific, Rockford, IL.
  • the recombinant nucleic acid (e.g., cDNA or genomic DNA) encoding at least a portion of a polypeptide may be introduced into host cells thereby genetically modifying the host cell.
  • Host cells may be used for cloning and/or for expression of the recombinant nucleic acid.
  • Host cells can be prokaryotic, for example bacteria.
  • Host cell can be also be eukaryotic which includes but not limited to yeast, fungal cell, insect cell, plant cell and animal cell.
  • the host cell can be a mammalian cell.
  • host cell can be human cells.
  • Host cells may comprise wild-type genetic information.
  • the genetic information of the host cells may be altered on purpose to allow it to be a permissive host for the recombinant DNA. Examples of such alterations include mutations, partial or total deletion of certain genes, or introduction of non-host nucleic acid into the host cell. Host cells may also comprise mutations which are not introduced on purpose.
  • Non limiting examples of commercial kits and bacterial host cells for electroporation include ZappersTM electrocompetent cells (EMD Chemicals Inc, NJ, USA), XLl-Blue Electroporation-competent cells (Stratagene, CA, USA), ElectroMAXTM A. tumefaciens LBA4404 Cells (Invitrogen Corp., Carlsbad, CA, USA).
  • Non- limiting examples of commercial kits and reagents for transfection of recombinant nucleic acid to eukaryotic cell include LipofectamineTM 2000, OptifectTM Reagent, Calcium Phosphate Transfection Kit (Invitrogen Corp., Carlsbad, CA, USA), GeneJammer® Transfection Reagent, LipoTAXI® Trasfection Reagent (Stratagene, CA, USA).
  • recombinant nucleic acid may be introduced into insect cells (e.g. sf9, sf21, High FiveTM) by using baculo viral vectors.
  • eukaryotic expression vectors include expression vector pCMV SPORT (Invitrogen, Carsbad, CA), pExchange, pCMV-Script, pCMV-Tag (Stratagene).
  • prokaryotic expression vectors include pET expression vectors (Novagen®).
  • Proteins from samples can be isolated using techniques that are well-known to those of skill in the art.
  • the protein isolation methods employed can, e.g., be including, but not limited to, e.g., those described in Harlow & Lane, Antibodies: A Laboratory Manual (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1988), US Patent 6005079, 5759808,.
  • an antigen protein is extracted from the acellular body fluid sample. Plasma purification methods are known in the art as such. See e.g., Cohn, E.J., et ah, Am. Chem. Soc, 62:3396-3400.(1940); Cohn, E.J., et ah, J. Am.
  • ELISA Assay The specificity and reactivity of the camelid and shark heavy-chain only antibodies and analogs towards the natural and synthetic antigens will be determined using ELISA. ELISA assays will be performed with pre-made reagents purchased from vendors such as Pierce, Sigma, etc., following vendor protocol, using appropriate negative and positive controls will be also be used.
  • Affinity Determination 96-Microwell plates will be coated with heavy-chain only antibodies and their analogs, and conventional mouse monoclonal antibody (as a control) in different concentrations (for example, 1, 20, 40. 80, 160 ng/ul), and will be blocked with BSA overnight. The blocked antibody will be reacted with the peptide antigen conjugated to HRP for 1-2 hours at 37°C. After thoroughly washing the plate with a plate washer with IX PBS containing 0.5% NP-40, enzyme substrate will be added and the plate incubated at RT for 1-2 hours. The optical density of the color generated will be read at an appropriate wave length. The affinity will then be calculated using the method of Beatty et al [J. Immunol. Methods, 100, 173 (1987)].
  • Western Blot Assay Western blot will be performed using methods known in the art. See, Harlow & Lane, Antibodies: A Laboratory Manual (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1988); Sambrook et al., Molecular Cloning: A Laboratory Manual (2nd Ed.) (1989), Cold Spring Harbor Press, N. Y.
  • the antibody or a sample may be immobilized on a carrier or solid support by covalent or non-covalent means. Immobilization of the antibodies or its analogs to the solid support may be done prior to, subsequent to, or simultaneously with binding to an antigen.
  • Well-known supports or carriers include, but are not limited to, e.g., glass, microchannels, microfluidic device , polystyrene, polypropylene, polyethylene, latex, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, gabbros, nanop articles, gold, and magnetite.
  • the support material may have any possible configuration including spherical ⁇ e.g. bead), cylindrical ⁇ e.g. inside surface of a test tube or well, or the external surface of a rod), or flat ⁇ e.g. sheet, test strip).
  • the solid surface is a bead.
  • beads or microparticles are substantially the same size.
  • beads or microparticles are of one or more sizes.
  • the beads or microparticles may be magnetic.
  • the preferred surface is microchannels made of glass or any other suitable matrix. These beads or microparticles may be composed of, for example, polystyrene, gold or latex. Beads or microparticles may be approximately 0.1 ⁇ m - 10 ⁇ m in diameter or may be as large as 50 ⁇ m - lOO ⁇ m in diameter, however, smaller and larger bead sizes are possible.
  • the solid surface is a streptavidin coated bead.
  • Streptavidin coated beads are available commercially e.g., from Bang laboratories (Catalog No. 214, 217), EMD Biosciences (Catalog No. 70716-3, 70716-4), Dynal beads from Invitrogen Corporation (Catalog No. 658-01D, 602-10).
  • the solid surfaces may have functional groups capable of covalently linking the antibodies or its analogs directly or indirectly through chemical linkers.
  • functional groups include but not limited to poly L-lysine, aminosilane, epoxysilane, aldehydes, amino groups, epoxy groups, cyano groups, ethylenic groups, hydroxyl groups, thiol groups.
  • a preferred method of non-covalently immobilizing antibodies or their analogs to the solid surface is via a "binding pair," which refers herein to two molecules which form a complex through a specific interaction.
  • the antibodies or its analogs can be captured on the solid support through an interaction between one member of the binding pair linked to the antibodies or its analogs and the other member of the binding pair coupled to the solid support.
  • the binding pair is biotin and avidin, or variants of avidin such as streptavidin, NeutrAvidinTM.
  • the solid surface may comprises streptavidin or its variants and the antibodies or its analogs may be modified to consist of biotin.
  • Methods for biotinylating antibodies or its analogs are known in the art (e.g. through primary amine by NHS-PEO 12-Biotin, NHS-LC-LC-Biotin, NHS-SS-PEO4-Biotin from Pierce Chemical Co.; through sulfhydryl group by Maleimide-PEOl 1 -Biotin, Biotin-BMCC Sulfhydryl, Iodacetyl- PEO2-Biotin).
  • the binding pair consists of a ligand-receptor, a hormone- receptor, an antigen-antibody.
  • binding pair include but are not limited to digoxigenin and anti-digoxigenin antibody; 6-(2,4-dinitrophenyl) aminohexanoic acid and anti-dinitrophenyl antibody; 5-Bromo-dUTP (BrdUTP) and anti-BrdUTP antibody; N-acetyl 2-aminofluorene (AAF) and anti-AAF antibody.
  • the antibodies or their analogs may be anchored to the solid support covalently though chemical coupling using chemical linkers.
  • the solid surface will usually be functional or be capable of being functionalized.
  • functional groups used for linking include but are not limited to carboxylic acids, aldehydes, amino groups, cyano groups, ethylenic groups, hydroxyl groups, thiol groups.
  • the antibodies and their analogs can be covalently attached to the solid surface derivatized with primary amines through the sulfhydryl group using Sulfo-SMCC using manufacturer's protocol (Pierce Chemical Co.).
  • sulfhydryl group can be introduced into the antibodies and their analogs using Traut's reagent or SATA (Pierce Chemical Co.) and such sulfhydryl group can be used to covalently link with the amine on the solid surface.
  • the solid support may be coated with epoxy group, amino group, mercapto group, polylysine.
  • Coated solid supports are available commercially e.g., beads coated with functional groups are available from Invitrogen Corporation, BD Biosciences; glass slides coated with functional groups are available from Pierce, Asper Biotech, Full Moon Biosystems, ThermoFisher Inc.
  • Antibodies may be detectably labeled by methods known in the art.
  • Labels include, radioisotopes, enzymes (e.g., peroxidase, alkaline phosphatase, beta-galactosidase, luciferase, alkaline phosphatase, acetylcholinesterase and glucose oxidase), enzyme substrates, luminescent substances (e.g., luminol), fluorescent substances (e.g., FITC, rhodamine, lanthanide phosphors), biotinyl groups (which can be detected by marked avidin e.g., streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods), predetermined polypeptide epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags) and colored substances.
  • enzymes e.g., peroxida
  • the maleimide method Kitagawa, T., et al., J. Biochem., 79:233-236 (1976)
  • the activated biotin method Hofmann, K., et al., J. Am. Chem. Soc, 100:3585 (1978)
  • the hydrophobic bond method for instance, can be used.
  • Detectable labels include but are not limited to fluorophores, isotopes (e.g. 32 P, 33 P 5 35 S, 3 H, 14 C, 125 I, 131 I), electron-dense reagents (e.g., gold, silver), nanoparticles, enzyme? (e.g., peroxidase, alkaline phosphatase, beta-galactosidase, luciferase, alkaline phosphatase, acetylcholinesterase and glucose oxidase), enzyme substrates, luminescent substances (e.g., luminol), chemiluminiscent compound, colorimetric labels (e.g., colloidal gold), magnetic labels (e.g.
  • DynabeadsTM DynabeadsTM
  • biotin digoxigenin
  • haptens proteins for which antisera or monoclonal antibodies are available
  • ligands ligands
  • hormones oligonucleotides capable of forming a complex with the corresponding oligonucleotide complement.
  • the detectable label is a fluorophore.
  • fluorophore refers to a molecule that absorbs light at a particular wavelength (excitation frequency), and subsequently emits light of a different, typically longer, wavelength (emission frequency) in response.
  • the detectable label is a donor fluorophore in close proximity of a quencher moiety.
  • Suitable fluorescent moieties include but are not limited to the following fluorophores working individually or in combination:
  • Novel analogs of single-domain heavy-chain only camelid and shark antibodies can be used for developing Nano-biomedical Technology Platforms to overcome problems of the conventional antibodies: i)the conventional antibodies neither have the specificity, nor sensitivity, nor thermal and chemical stability that allows the use of stringent assay development conditions to optimize detection sensitivity and specificity; ii) they are unable to cross cell membrane and blood brain barrier (BBB); iii) they are immunogenic; and iv) high toxicity due to cross-reactivity.
  • the shark and camelid antibodies, particularly, their analogs do not have the shortcomings of conventional mAbs.
  • these antibodies are small enough to cross cell and BBB to diagnose and treat most diseases that so far have been impossible to diagnose and treat without invasive and risky procedures.
  • they are highly specific and have very little to none cross-reactivity.
  • these antibodies have extremely low immunogenicity, and can be further humanized to take care of any residual toxicity.
  • In-Vitro Diagnostics a. Immunodiagnostics of human diseases b. DNA-Probes Based Diagnostics of human diseases.
  • CTCs Circulating Tumor Cells
  • fetal cells for non-invasive prenatal diagnosis of genetic disorders
  • shark and camelid antibodies are known to cross cell wall and blood brain barrier
  • shark and camelid heavy chain only antibodies and their analogs against the biomarkers of brain diseases and the cytoplasmic markers of cancer will be useful in scanning the whole body for early detection of cancer, Alzheimer's disease, Parkinson's disease and other brain diseases.
  • breast and lung cancers can be screened and diagnosed with a mixture of nano-antibodies against HER-2, p53, EGFR, and Ras.
  • Brain cancer and Alzheimer's diseases can be detected and treated, in principle, with BBB permeable mixture of nano-antibodies against TEMl (tumor endothelial marker- 1) , amyloid- ⁇ 42, , Tau protein, beta- and gamma-secretases.
  • Neuroimaging of brain diseases will be done with detectably labeled (e.g., radiolabel) antibodies and their analogs which will be administered intravenously and detected using appropriate methodology for example, the brain scanned under PET scanner after a short time thereafter.
  • fetal cells from the blood of pregnant women will be captured with shark and camelid heavy chain only antibodies and their analogs against the fetal cell surface antigens such as, CD71, glycophorin -A (GPA), CD133, CD34, HLA-G233, and Trop-1, which is/are bound to solid matrixes such as micro-channels and beads.
  • the red blood cells will be lysed using commercial RBC lysis buffer.
  • the cells will then be pelleted and passed through micro-fluidic device coated with a mixture of the above antibodies.
  • the captured cells will be analyzed by FISH probes for chromosomes 21, 13 and 18. Exemplary schematics of the capture of circulating fetal cells by shark and camelid heavy chain only antibodies and their analogs is shown in Fig. 29.
  • shark and camelid heavy chain only antibodies and their analogs can be used in isolation of cell free nucleic acids circulating in bodily fluids, blood, marrow, urine, saliva, CSF and cervical mucus. It is known that cell free DNA is elevated in the blood of cancer patients [T.L. Wu, et al, Clin. Chim. Acta., 321, 77 (2002)]. Though the cell free DNA in blood is known for many years, its clinical utility has not been established in spite of the fact that cell- free DNA has exhibited all the characteristics as the tumor DNA [P. Anker, et al., Cancer Metastasis Rev.,J_8, 65 (1999)].
  • shark and camelid heavy chain only antibodies and their analogs can be used, for example tumor biomarkers.
  • HER-2 implanticated in breast cancer
  • TMRESS2-ERG gene implanticated in prostate cancer
  • K-ras pancreatic carcinoma
  • Camelid or shark can be immunized with the pathogenic proteins associated with the disease discussed above.
  • Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be made from the parent single-domain heavy-chain only antibodies using various methods such as, protease digestion, recombinant DNA technology and chemical means as described above.
  • Such antibodies and their analogs can be used in in-vitro diagnostics of human diseases, capture of circulating fetal cells for prenatal diagnosis, and capture of tumor cells for studying gene expression of key proteins pre- and post treatment.
  • Prostate cancer is a disease in which cancer develops in the prostate, a gland in the male reproductive system. Rates of prostate cancer vary widely across the world. According to the American Cancer Society, prostate cancer is least common among Asian men and most common among black men, with figures for European men in-between. However, these high rates may be affected by increasing rates of detection. Prostate cancer develops most frequently in men over fifty. It is the most common type of cancer in men in the United States, where it is responsible for more male deaths than any other cancer, except lung cancer. However, many men who develop prostate cancer never have symptoms, undergo no therapy, and eventually die of other causes.
  • Camelid or shark can be immunized with the biomarkers associated with prostate cancer.
  • Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be made using various methods such as, protease digestion, recombinant DNA technology and chemical means as described above. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be used in diagnosis, prognosis and/or treatment of prostate cancer. Exemplary prostate cancer biomarkers are shown in Table 2.
  • Breast cancer is a cancer of the breast tissue. Worldwide, it is the most common form of cancer in females - affecting, at some time in their lives, approximately 192,000 new cases of breast cancer will be diagnosed in the US in 2009, and estimated 41,000 women will lose their lives to the disease this year. According to the United Nations World Health Organization, it is the leading cause of cancer deaths among women in the US and worldwide. Because the breast is composed of identical tissues in males and females, breast cancer also occurs in males, though it is far less common.
  • Came lid or shark can be immunized with the biomarkers associated with breast cancer.
  • Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be made using various methods such as, protease digestion, recombinant DNA technology and chemical means as described above. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be used in diagnosis, prognosis and/or treatment of breast cancer. Exemplary breast cancer biomarkers are shown below:
  • PIP highly expressed for breast cancer. It has been identified in most breast cancer biopsies.
  • SCGB2A1 found in breast tumors.
  • SCGB 1D2 highly expressed in breast tumor.
  • SBEM protein expressed in >90% of invasive ductal carcinoma.
  • ESRl is expressed in about 67% of all breast cancers and thus is known as the main discriminator in breast tumor classification. ESRl is the main mediator of endocrine therapy, Tamoxifen, and its detection in breast tumors is thus of considerable clinical significance.
  • NKRD30A C-B726P, NY-BR-I.
  • 6-PGDH-HCAb (6-phosphogluconate dehydrogenase)
  • Skeletal ALP could represent a valid marker for bone metastases in association with mucinous markers in the follow-up of patients operated for breast cancer.
  • Serum levels of alpha-lactalbumin may be useful as a marker for monitoring breast cancer.
  • AMAS-HCAb anti-malignin antibody in serum
  • AR-HCAb for Androgen Receptor (AR) • AR immunohistochemistry could serve as a marker to increase sensitivity for identifying breast cancer in skin metastasis of unknown primary sites.
  • Has prognostic value for predicting survival of breast cancer patients is a bio- marker in prostate and breast cancer progression.
  • Bcl-2-HCAb for detecting Bcl-2.
  • CAXII- HCAb for Carbonic Anhydrase XII (CA- 12)
  • CEA monitoring should be considered an expensive and inefficient method of follow-up evaluation for breast cancer patients, and it provides no additional value when used in combination with CA 15.3.
  • CD44-HHCAb for CD44s
  • a prognostic marker of breast carcinoma and serum ErbB-2 is a preoperative prognostic marker and may be useful for monitoring tumor recurrence of the breast.
  • TMA analysis for Glut-1 expression may be useful to predict disease free survival but it does not predict race specific recurrence.
  • KAIl may also be a useful marker for staging human breast disease.
  • Serum KL-6 may be helpful for clinical use as a tumor marker for breast cancer, and it may play an important role, especially in the surveillance of disease relapse.
  • KPNA2-HCAb for KPNA2 (karyopherin alpha2) • A potential novel prognostic marker in breast cancer.
  • hMAM mRNA detection by RT-PCR is a specific assay potentially suitable for identification of occult cancer cells in peripheral blood of BC patients.
  • MCA-HCAb for MCA mucinous carcinoma associated antigen
  • the new tumor marker antigen MCA reacts with breast cancer cells in paraffin sections. It might be used in identification of cancer cells in tissue sections. MCA can also be used as a weak indicator of aggressiveness of the tumor. PMID: 1695077
  • the growth fraction of a tumor as determined by the MIB-I labelling index is an important prognostic factor in patients with primary breast cancer.
  • MMP-2 immunoreactive protein has been associated strongly with a shortened survival independent of major prognostic indicators in patients with primary breast carcinoma, increasing the risk of death 3.6-fold during the first 10 years of follow-up.
  • MSA-HCAb for MSA (Mammary serum antigen)
  • MSA levels are elevated in patients with breast cancer and may provide a useful means of following the clinical course of patients with this disease.
  • MSA levels may therefore be of some use for the monitoring of breast cancer patients, and as a diagnostic aid to screen populations for breast cancer.
  • the NCC-ST-439 level especially in combination with the CEA level, may be useful for the early detection and the monitoring of relapses in breast cancer patients.
  • Mutant p53 protein in serum could be used as a molecular marker in human breast cancer.
  • Nuclear p53 protein expression may represent an adverse prognostic marker in inflammatory breast cancer (IBC) and may provide a valuable tool for selecting treatment for this aggressive disease.
  • IBC inflammatory breast cancer
  • PKC-alfa-HCAb for PKC alpha PKC alpha
  • PTA-HCAb for PTA prothymosin alpha
  • PTTG-HCAb for PTTG epitary tumor-transforming gene
  • RCP-HCAb for RCP riboflavin carrier protein
  • SNSE-HCAb for S-NSE serum neuron-specific enolase
  • S 14-HCAb for Spot 14 (S 14) • A marker of aggressive breast cancer and a potential therapeutic target.
  • TAG 12-HCAb for TAG 12 Tumor associated glycoprotein 12
  • TIMP-I tissue inhibitor of metalloproteinase-1
  • TP53 mutation is a strong marker for the prediction of overall and disease-free survival in breast cancer, irrespective of nodal status.
  • TPpa-HCAb for TPpA tissue polypeptide antigen
  • Tartrate-resistant acid phosphatase 5b activity is a useful bone marker for monitoring bone metastases in breast cancer patients after treatment.
  • TRACP 5b activity can be considered a surrogate indicator of bone metastasis in breast cancer patients.
  • uPA expression in breast cancer patients is under epigenetic control via methylation of its promoter. Determination of uPA promoter methyl ation can therefore serve as an early reliable indicator of uPA production in breast cancer patients.
  • YBl-HCAb for YB-I (Y-box binding protein 1) • A marker of tumor aggressiveness and response to adjuvant chemotherapy in breast cancer. PMID: 15703814
  • FBL for detecting FBL is associated with early manifestation of breast cancer and may be considered as a tool for the screening of breast cancer in high risk women.
  • Urinary testosterone is a prognostic indicator of early breast cancer recurrence in node-positive patients.
  • Colorectal cancer also called colon cancer or bowel cancer, includes cancerous growths in the colon, rectum and appendix. It is the third most common form of cancer and the second leading cause of death among cancers in the Western world. Many colorectal cancers are thought to arise from adenomatous polyps in the colon. These mushroom-like growths are usually benign, but some may develop into cancer over time. The majority of the time, the diagnosis of localized colon cancer is through colonoscopy. Therapy is usually through surgery, which in many cases is followed by chemotherapy.
  • Camelid or shark can be immunized with the biomarkers associated with colon cancer.
  • Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be made using various methods such as, protease digestion, recombinant DNA technology and chemical means as described above. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be used in diagnosis, prognosis and/or treatment of colon cancer. Exemplary colon cancer biomarkers are shown below.
  • AFU alpha-L-fucosidase
  • Serum AFU activity appears to be a good prognostic factor of tumor recurrence in colorectal carcinoma.
  • Nuclear beta catenin expression is a potential prognostic factor in patients with colorectal cancer, and together with CK20, it could be used to identify colorectal carcinoma in the Hong Kong population.
  • CCSP-2 Cold cancer secreted protein-2
  • CEA carcinoembryonic antigen
  • CEA concentration in colonic effluent is a simple and practical biomarker for identification of patients at high risk for colorectal carcinoma (CRC).
  • CRC colorectal carcinoma
  • Plasma CR-I might represent a novel biomarker for the detection of breast and colon carcinomas.
  • Expression in the primary lesion may be a useful marker for evaluating prognosis and liver metastasis in patients with colorectal cancer.
  • Urinary DHN-MA is a useful noninvasive biomarker for determining the risk of preneoplastic lesions associated with heme iron consumption and should be further investigated as a potential biomarker of colon cancer risk.
  • DiAcSpm di-acetyl spermine
  • Tumor DPD level is an efficacious marker in oral 5 -FU based-adjuvant chemotherapy for colorectal cancer; however, low tumor DPD predicts reduced survival in patients treated with curative surgery alone.
  • Reverse transcriptase PCR is a sensitive and specific technique for identifying tumor cells in extraintestinal sites and may be useful for staging and postoperative surveillance of patients with colorectal cancer.
  • HECA homologue of the Drosophila headcase protein
  • Ki-67 labeling index in the mucosa adjacent to cancer might be a good marker for metastasis in colorectal cancer.
  • a new target gene for nt/beta-catenin-TCF signaling is associated with tumor progression and poor survival in patients with colorectal cancer and may be clinically useful as a marker for poor prognosis.
  • PPMID 17211730
  • MnSOD Manganese superoxide dismutase
  • MUCl Mature MUCl mucins become ectopically expressed in colorectal carcinoma progressed to the metastatic stages and that mature MUC 1 mucins may be a useful marker for advanced colorectal carcinoma.
  • Serum NCC-ST-439 value was clinically useful for the diagnosis and monitoring for patients with colorectal cancers as a new distinct tumor marker.
  • PAI-I plasmaogen activator inhibitor- 1
  • PKC Protein kinase C
  • Active TGF-betal might be used as a tumor marker for colorectal cancer.
  • TKl-LI showed more potential as a proliferating marker in colorectal carcinoma than PCNA-LI, especially for evaluating high-risk tumor grade and advanced stage in colorectal carcinoma.
  • VEGF vascular endothelial growth factor
  • VEGF-D expression but not that of its receptor VEGFR-3, is an independent prognostic indicator in colorectal carcinomas (CRC).
  • CRC colorectal carcinomas
  • the level of vitamin D receptor correlates with the degree of differentiation in human colon cancer cell lines and may serve as a useful biological marker in predicting clinical outcome in patients.
  • Fecal sphingomyelinase activity could really reflect the human intestinal mucosa enzyme level and could represent a new marker for human colorectal adenocarcinoma, mainly taking into account its early appearance in intestinal neoplasms.
  • An assay of fecal DNA integrity may be a useful biomarker for the detection of colorectal cancer (CRC).
  • CRC colorectal cancer
  • Hyaluronic acid may provide additional information to that given by other biochemical markers currently used in colorectal cancer.
  • Tumor Budding is a reliable biological prognostic variable to identify higher malignancy potential. Scoring system using tumor budding and N stage showed better prognostic stratification in stage-III rectal carcinoma. PMID: 17216219
  • Ovarian cancer is a malignant ovarian neoplasm (an abnormal growth located on the ovaries). Often, this cancer is detected at an advanced stage when it is too late to treat. Early detection is a must for early intervention of a disease. Came lid and shark heavy chain only antibodies and their analogs may be used to detect ovarian cancer biomarkers.
  • Camelid or shark can be immunized with the biomarkers associated with ovarian cancer.
  • Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be made using various methods such as, protease digestion, recombinant DNA technology and chemical means as described above. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be used in diagnosis, prognosis and/or treatment of ovarian cancer. Exemplary ovarian cancer biomarkers are shown below.
  • CA125 tumor marker Cancer Antigen 125
  • CAl 25 II is a better tumor marker than conventional CAl 25.
  • CASA or YKL-40 • Low serum levels of tetranectin, or high serum levels of CASA or YKL-40, are associated with increased risk of second-line chemoresistance in patients with ovarian cancer.
  • Serum cathepsin B-like activity may be helpful in the preoperative differential diagnosis between ovarian carcinomas and benign ovarian or uterine tumors.
  • EMMPRIN extracellular matrix metalloproteinase inducer
  • Ep-CAM epidermal cell adhesion molecule
  • PMID: 8434966 • The lower positive rate of GAT in endometriosis, when compared with the positive rate of other markers, suggests the usefulness of GAT in distinguishing malignant ovarian tumors from benign ovarian tumors.
  • the use of GAT in a combination assay is expected to overcome the disadvantages of CA602 or CAl 25.
  • GEP Gramulin-epithelin precursor
  • IAP immunosuppressive acidic protein
  • CCC clear cell carcinoma
  • OCCC ovarian clear cell carcinoma
  • IGFBP-2 • May therefore be an important additional prognostic marker in ovarian cancer.
  • KLK9 (kallikrein gene 9)
  • M-CAM melanoma cell adhesion molecule
  • EOC epithelial ovarian cancer
  • MMP-2 matrix metalloproteinase-2
  • P-III-P type III procollagen peptide
  • the antibody may be useful in confirming the ovarian origin of an adenocarcinoma when used as part of a larger panel.
  • STN antigen serum sialyl Tn antigen
  • YB-I Y box-binding protein- 1
  • P-gp P-glycoprotein
  • FDG-PET is a useful technique to detect recurrent ovarian cancers for patients suspected of recurrent ovarian cancers due to asymptomatically elevated serum levels of CA- 125 antigen.
  • Cervical cancer is a malignancy of the cervix. It may present with vaginal bleeding but symptoms may be absent until the cancer is in its advanced stages, which has made cervical cancer the focus of intense screening efforts utilizing the Pap smear. Most scientific studies have found that human papilloma virus (HPV) infection is responsible for virtually all cases of cervical cancer. Treatment consists of surgery (including local excision) in early stages and chemotherapy and radiotherapy in advanced stages of the disease. [0198] Came lid or shark can be immunized with the biomarkers associated with cervical cancer. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be made using various methods such as, protease digestion, recombinant DNA technology and chemical means as described above. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be used in diagnosis, prognosis and/or treatment of cervical cancer. Exemplary cervical cancer biomarkers are shown below.
  • Beta-CF Beta-CF (Beta-core fragment)
  • Detection of aberrant methylation of CDH1/CDH13 may be of potential use as a marker for selecting cervical cancer patients at high risk for relapse who could benefit from additional systemic therapy.
  • Serum HPV DNA might be a useful additional marker for early detection of recurrence in cervical cancer patients.
  • a recently characterized glycoprotein from human placenta can be regarded as a tumor associated protein which most likely can serve as tumor marker in cervical and endometrial cancer.
  • SCC antigen squamous cell carcinoma antigen
  • Tn antigen Tn-Ag
  • UGF urinary gonadotropin fragment
  • SCC squamous cell carcinoma antigen
  • Bladder Cancer refers to any of several types of malignant growths of the urinary bladder. It is a disease in which abnormal cells multiply without control in the bladder. The most common type of bladder cancer begins in cells lining the inside of the bladder and is called urothelial cell or transitional cell carcinoma (UCC or TCC). Approximately 20% of bladder cancers occur in patients without predisposing risk factors. Bladder cancer is not currently believed to be heritable (i.e., does not "run in families" as a consequence of a specific genetic abnormality).
  • Camelid or shark can be immunized with the biomarkers associated with bladder cancer.
  • Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be made using various methods such as, protease digestion, recombinant DNA technology and chemical means as described above. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be used in diagnosis, prognosis and/or treatment of bladder cancer. Exemplary bladder cancer biomarkers are shown below.
  • Beta-hCG (beta human chorionic gonadotrophin)
  • a bladder cancer specific biomarker is present in urine samples from patients with bladder cancer, but not in samples from healthy individuals.
  • Urinary BLCA-4 determination appears to have high potential as a test for screening and monitoring bladder cancer in the general population and in groups at high risk for the disease, such as those with spinal cord injury.
  • Serum and urine clusterin can differ between bladder cancer patients and the control group.
  • Urine clusterin could be the possible laboratory marker of bladder cancer. PMID: 16830064
  • FBP farucose-binding proteins
  • Hyaluronic acid a glycosaminoglycan and known to promote tumor cell adhesion and migration, and its small fragments stimulate angio genesis, is a new sensitive and specific urine marker for bladder cancer.
  • Lewis X antigen on exfoliated bladder cells enhances the detection of urothelial tumor cells, particularly from low grade and low stage neoplasms.
  • MMP-2 protein overexpression may be an independent prognostic biomarker for bladder cancer progression.
  • Urinary NMP22 is a useful tool for the screening of urothelial cancer in patients with microscopic hematuria.
  • Urinary NMP22 is a useful diagnostic marker as a substitute for voided-urine cytology for the surveillance of urothelial cancer.
  • Urine prothymosin-alpha has the potential of being a useful tumor marker for the detection and follow-up of bladder cancer.
  • telomerase in bladder washes may be a specific marker of bladder cancer, especially in low-grade tumors.
  • PMID: 9533519 Can be determined in voided urine samples of patients with superficial bladder cancer. It has a higher sensitivity and specificity than conventional urinary cytology and is a good marker for diagnosis and follow-up of these patients.
  • TPA tissue polypeptide antigen
  • TFR Transferrin Receptors
  • TFR activity in low grade superficial bladder tumors is a useful marker for predicting the recurrence rate.
  • Ce6-PVP formulation appeared to have the potential as a fluorescent marker for fluorescence diagnosis of human bladder cancer.
  • Camelid or shark can be immunized with the biomarkers associated with circulating tumor cell.
  • Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be made using various methods such as, protease digestion, recombinant DNA technology and chemical means as described above. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be used in diagnosis, prognosis and/or treatment of cancer. Exemplary bladder cancer biomarkers are shown below.
  • bFGF Breast, head, and neck cancers sFasL Bladder and Gastric Carcinomas sFas (CD95) Leukemia, colon, breast and bladder cancers
  • p53 HCAb Breast, lung, colon, gastric, oral, and lymphoreticular cancers
  • TGF-betal Bladder cancer TGF-betal Bladder cancer, ovarian carcinoma, live cancer, and prostate cancer
  • TNF-alfa Pancreatic cancer C-erbB2 (HER-2) Breast, ovarian, gastric, endometrial carcinoma, adenocarcinoma, and prostate cancer
  • IGF-I and IGF-IR Breast, prostate, colon and lung cancers. IGF-IR is a therapeutic target
  • IL-2R Breast cancer, leukemia, head and neck cancer
  • Ras Protein Colon bladder, gastric, and pancreatic cancers.
  • a brain tumor is any intracranial tumor created by abnormal and uncontrolled cell division, normally either found in the brain itself (neurons, glial cells (astrocytes, oligodendrocytes, ependymal cells), lymphatic tissue, blood vessels), in the cranial nerves (myelin-producing Schwann cells), in the brain envelopes (meninges), skull, pituitary and pineal gland, or spread from cancers primarily located in other organs (metastatic tumors).
  • Primary (true) brain tumors are commonly located in the posterior cranial fossa in children and in the anterior two-thirds of the cerebral hemispheres in adults, although they can affect any part of the brain.
  • AD Alzheimer's disease
  • brain diseases include: Parkinson's disease, Lyme's disease and Cysticercosis. Detecting Fetal Down Syndrome Biomarkers
  • shark and camelid heavy chain only antibodies and their analogs can be used in capturing circulating fetal cells in a pregnant women's blood and diagnosing genetic disorders of the fetus such.
  • Exemplary genetic disorder includes Down syndrome.
  • Arginine/serine rich splicing factor 4 (RS SF4) is one of the biomarkers found only in the amniotic fluid of Down syndrome fetuses and not in normal pregnancies (Michael PE et al., Electrophoresis, 27, 1169 (2006)], transthyretin (TTHY), alpha- 1 -macro globulin (AMP), ataman (FAN) and Apo lipoprotein (APE) [Prenatal Diag., 28, 691 (2008)].
  • TTHY transthyretin
  • AMP alpha- 1 -macro globulin
  • APE Apo lipoprotein
  • SAMP serum amyloid P-component
  • ANITA alfa-1- antitrypsin
  • Camelid or shark can be immunized with the biomarkers associated with BrainTumors / Lesions / Plaques.
  • Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be made using various methods such as, protease digestion, recombinant DNA technology and chemical means as described above. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be used in diagnosis, prognosis and/or treatment of BrainTumors / Lesions / Plaques. Exemplary BrainTumors / Lesions / Plaques biomarkers are shown below.
  • biomarkers for brain tumor include:
  • Endosialin tumor endothelial marker 1, TEMl
  • PMID: 9844724 PV-I (Plasmalemmal vesicle associated protein- 1) represents a novel marker of brain tumor angiogenesis and integrity of the blood-brain barrier and is a potential therapeutic target.
  • Exemplary biomarkers for Alzheimer's disease include:
  • the invention provides a method for the development of shark and camelid heavy chain only antibodies and their analogs for use as immunohistochemical agents for cell surface, cytoplasmic and/or nuclear proteins for the identification of pathological cells from bodily fluids (blood, urine, saliva, semen, mucus, tears, etc) and tissues, but not limited to, cancer cells, bacterial cells including anthrax, viral cells, including SARS, HIV, HBV, and HPV, neurological cells, cardiac cells, fetal cells and cells of the autoimmune diseases. It is known that all epithelial neoplasms express cytoskeleton proteins of the cytokeratin (CK) family. Shark and camelid heavy chain only antibodies and their analogs for CKl through CK20 will be developed to distinguish between normal and neoplastic cells with much higher sensitivity and specificity than the conventional monoclonal antibodies.
  • CK cytokeratin
  • CD44 is a adhesion molecule present on leukocytes.
  • single-domain antibodies for cell adhesion molecules including, but not limited to, CD44, VCAM-I, and ICAM- l(aka: EpCAM) will be developed to improve sensitivity and specificity of detection of various forms of cancer.
  • the invention provides camelid and shark heavy chain only antibodies and their analogs for all the cell surface molecules known as cell adhesion molecules or the cluster of differentiation proteins (often abbreviated as CD). These proteins are used for the identification and investigation of cell surface molecules present on leukocytes.
  • CD molecules can act in numerous ways, often acting as receptors or ligands (the molecule that activates a receptor) important to the cell. A signal cascade is usually initiated, altering the behavior of the cell.
  • Some CD proteins do not play a role in cell signaling, but have other functions, such as cell adhesion.
  • Approximately, 320 CD cell surface proteins are known as of today which are involved in various physiological functions.
  • mAbs Monoclonal antibodies
  • mAbs Monoclonal antibodies
  • the proposed surface molecule is assigned a CD number once two specific monoclonal antibodies (mAb) are shown to bind to the molecule. If the molecule has not been well-characterized, or has only one mAb, it is usually given the provisional indicator "w" (as in "CDwI 86").
  • Anti-CD antibodies are also used as cell markers.
  • anti-CD34 antibody is used to capture and label embroynic cells
  • anti-CD45 antibody for capturing and labeling leukocytes.
  • the usefulness of these antibodies is obvious to anybody who is skillful biochemist or biologist.
  • the table below illustrates the cell surface markers of some of the cells.
  • micro-, subnano- and nano-antibodies are potential therapeutic agents for the treatment of diseases, namely, viral, bacterial, cancer, neurological, cardiac, metabolic, and diseases of immune disorders.
  • camelid and shark antibodies and analogs Due to their ability to enter the cell and cross BBB, the camelid and shark antibodies and analogs represent an unprecedented class of biological molecules to detect and treat all human diseases, including, but not limiting to solid tumors, infectious diseases, diseases of brain, metabolic system and autoimmune disorders.
  • Therapeutic applications of camelid and shark heavy chain-only antibodies and their analogs may include inhibition of cellular uptake of pathogens, for example, HIV by blocking the CCR5 and CXCR4 host co-receptor the virus uses for entry into the cell.
  • pathogens for example, HIV by blocking the CCR5 and CXCR4 host co-receptor the virus uses for entry into the cell.
  • These antibodies and their analogs may also be directed to interfere with the function of key proteins involved in the pathogenesis of the diseases.
  • HIV viral envelope proteins namely vif, LEDGF/p75, TSAlOl, gpl20 and gp41.
  • HER-2- positive breast cancer is a breast cancer that tests positive for a protein called human epidermal growth factor receptor-2 (HER-2), which promotes the growth of cancer cells.
  • HER-2 human epidermal growth factor receptor-2
  • the cancer cells make an excess of HER2 due to a gene mutation. This gene mutation can occur in many types of cancer — not only breast cancer.
  • Single-domain Herceptin might be more beneficial than the conventional Herceptin due to the fact that these antibodies are highly specific with none to low toxicity.
  • anti-A ⁇ 42-nano-antibody, produced either in shark and /or camel is likely to have superior performance to detect and treat Alzheimer's disease to classical mAbs.
  • Camelid and shark heavy-chain antibodies and analogs can be used against deadly toxin Clostridium botulinum (CB), a causative agent of botulism, against S. typhi, a causative agent of Typhoid fever, Bacillus anthracis a causative agent of anthrax, against Borrelia burgdorferi, a causative agent of Lyme disease, against Plasmodium falciparum, a causative agent of malaria.
  • CB Clostridium botulinum
  • S. typhi a causative agent of Typhoid fever
  • Bacillus anthracis a causative agent of anthrax, against Borrelia burgdorferi
  • a causative agent of Lyme disease against Plasmodium falciparum
  • a causative agent of malaria can be used against deadly toxin Clostridium botulinum (CB), a causative agent of botulism, against S. typhi,
  • the present invention describes the production and use of camelid and shark heavy chain-only antibodies and their analogs for improving the therapeutic efficacy of existing FDA approved therapeutic antibodies for the treatment of cancer and few other diseases. Because of their small size, low molecular weight, higher specificity, solubility, stability, bio- distribution, and higher binding affinity than the conventional antibodies, these single-domain antibodies are the embodiment of the present invention for pharmaceutical applications.
  • Herceptin developed by Genentech, FDA approved, has become a major therapeutic option for patients with HER-2 positive metastatic breast cancer. Despite its dramatic benefits, cardiac toxicity remains a limiting factor for Herceptin's chemotherapy use.
  • this invention provides a method for producing antibodies such as Herceptin in camelids and shark for medical diagnostics and pharmaceuticals.
  • Such antibodies include but not limited to the antibodies listed below:
  • Herceptin Breast Cancer (HER-2 positive)
  • invention includes developing therapeutic camelid and shark heavy chain-only antibodies and their analogs that specifically binds to various disease biomarkers.
  • Exemplary diseases include, but not limited to:
  • HIV-I entry is mediated by the binding of the viral envelope protein to a specific receptor, CD4, which is expressed on the cell surface of T-lymphocytes and certain monocyte/macrophage populations.
  • CD4 a specific receptor
  • HIV also requires other co-receptors, such as, CCR5 and CXCR4, for entry into cell.
  • CCR5 and CXCR4 co-receptors
  • single-domain antibodies against the gpl20 envelope protein of HIV and V3 loop and gp41 will be developed to neutralize HIV-I.
  • Camelid or shark can be immunized with the biomarkers associated with HIV.
  • Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be made using various methods such as, protease digestion, recombinant DNA technology and chemical means as described above.
  • Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be used in diagnosis, prognosis and/or treatment of HIV/ AIDS. Exemplary HIV/ AIDS biomarkers are shown below.
  • the invention provides Heavy chain-only antibodies and their analogs for the treatment of chronic hepatitis B by developing the antibodies and their analogs against the surface antigens.
  • conventional antibody against the surface antigen, OST-577 has resulted in reduction of HBV DNA by 75% in a small patient pool.
  • Camelid and shark heavy chain-only antibodies and their analogs antibody against the surface antigens of HBV, including OST-577, will be evaluated against HBV.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Immunology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

Camelid and shark heavy chain only antibodies and their analogs are disclosed. Methods of making such antibodies and their analogs are also provided. Also provided are kits, and methods of using such antibodies and their analogs in diagnostics, prognostics, therapy, and simultaneous diagnosis and therapy.

Description

ANTIBODIES, ANALOGS AND USES THEREOF
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of U.S. Provisional Application 61/192,732, filed September 22, 2008 which is hereby incorporated by reference in its entirety.
FIELD OF THE INVENTION
[0002] The invention relates to camelid and shark heavy chain only antibodies, their analogs and uses thereof.
BACKGROUND OF THE INVENTION
[0003] As early as 1983 it was suspected that the sera of camelid comprised of two different kinds of immunoglobulin: conventional heterodimeric IgGs composed of heavy and light chains, and an unconventional IgGs without the light chains [Graver YP, et al., Indian Journal of Biochemistry and Biophysics, 20, 238 (1983)]. Graver et al. demonstrated the presence of three bands which were designated as IgM, IgA, and a broad heterogeneous band containing a mixture of IgG complexes. One can speculate that the broad band these authors observed was due to the presence of mixture of normal IgG and heavy-chain IgG without the light chain but since a proper sizing marker had not been used, coupled with the poor resolution of the bands, these authors could not satisfactorily characterize the broad IgGs band.
[0004] Ungar-Waron et al. disclosed a SDS-PAGE analysis of camelid IgGs mixture treated with and without 2-mercaptoethanol (2ME) [Israel J. Vet. Medicine, 43 (3), 198 (1987)]. In the absence of 2-ME, IgG-complex, obtained from camel serum, dissociated into two components with approximate molecular weight (MW) of 155 KDa (Conventional IgG) and 100 KDa (New IgG) on SDS-PAGE. However, in the presence of 2-ME, three bands of MW 55 KDa (gamma-like heavy chain), 22 KDa (Light chain) and an additional protein band of 43 KDa (now known as heavy-chain only camel antibody band without the light chains) were seen.
[0005] Subsequently, Azwai et al. from University of Liverpool, UK, independently confirmed the presence of an additional IgG band in camel serums with a molecular weight of 42 K Da by SDS-PAGE electrophoresis under reducing conditions [Azwai, S. M., et al., J. Comp. Path., 109, 187 (1993)].
[0006] Hamers-Casterman et al. reported similar findings, confirming independently the presence of 42 KDa IgG subclass in the sera of camels upon SDS-PAGE analysis under reducing conditions. [Nature, 363, 446 (1993) and US Patent # 6,005,079].
[0007] Thus, two types of antibodies exist in camels, dromedaries and llamas: one a conventional hetero-tetramer having two heavy and two light chains (MW -150 K Da), and the other consisting of only two heavy chains, devoid of light chains (MW ~90 to 100 K Da).
[0008] In addition to came lid antibodies having only two heavy chains and devoid of light chains, distinctly unconventional antibody isotype was identified in the serum of nurse sharks (Ginglymostoma cirratum) and wobbegong sharks (Orectolobus maculatus). The antibody was called the Ig new antigen receptors (IgNARs). They are disulfide-bonded homodimers consisting of five constant domains (CNAR) and one variable domain (VNAR). There is no light chain, and the individual variable domains are independent in solution and do not appear to associate across a hydrophobic interface (Greenberg, A. S., Avila, D., Hughes, M., Hughes, A., McKinney, E. & Flajnik, M. F. (1995) Nature 374, 168-173; Nuttall, S. D., Krishnan, U. V., Hattarki, M., De Gori, R., Irving, R. A. & Hudson P. J. (2001) MoI. Immunol. 38, 313-326, Comp. Biochem. Physiol. B., 15, 225 (1973)). There are three different types of IgNARs characterized by their time of appearance in shark development, and by their disulfide bond pattern (Diaz, M., Stanfield, R. L., Greenberg, A. S. & Flajnik, M. F. (2002) Immunogenetics 54, 501-512; Nuttall, S. D., Krishnan, U. V., Doughty, L., Pearson, K., Ryan, M. T., Hoogenraad, N. J., Hattarki, M., Carmichael, J. A., Irving, R. A. & Hudson, P. J. (2003) Eur. J. Biochem. 270, 3543-3554).
Relevant References:
Relevant Foreign and US Patents:
Figure imgf000004_0001
Figure imgf000005_0001
Other References:
Azwai SM et al, Serology of orthopoxvirus Camel Infection in Dromedary camels, Comp.
Immun. Microbiol. Infect. Dis., 19, 65 (1996).
Kelly PJ, et al, Isolation and characterization of immunoglobulin g and IgG Subclasses of the
African elephant, Comp. Immun. Microbiol. Infect. Dis., 21_, 65 (1998).
Linden Richard van der et al., Induction of immune responses and molecular cloning of the heavy-chain antibody repertoire of Lama glama, J. Immun. Methods, 240, 185 (2000).
Rivera H et al., Serological survey of viral antibodies in the Peruvian alpaca., Am. J. Vet.
Res.,48, 189 (1987).
Kumar M et al., Biochemical studies on Indian Camels: Blood proteins and lipids, J. Sci.
Industrial Res., 20c, 236 (1961).
Azwai SM et al., The isolation and characterization of camel immunoglobulin classes and subclasses, J. Comp. Path., 109, 187 (1993).
Zhang J, Tanha J. et al., Pentamerization of single-domain antibodies from phage libraries: a novel strategy for the rapid generation of high-avidity antibody reagents, J. MoI. Biol, 335,
49 (2004).
Vranken W et al., Solution structure of a llama single-domain antibody with hydrophilic residues, Biochemistry, 41, 8570 (2002).
Omidfar K et al, Production of a novel camel single-domain antibody specific for the Type iii mutant EGFR, Tumor Biology, 25, 296 (2004).
Frenken Leon GJ et al., Isolation of antigen specific Llama VHH antibody fragments and their high level secretion by Saccharomyces cerevisiae, J. Biotechnology, 78, 11 (2000). Holliger P., Hudson P, Engineered antibody fragments and the rise of single domains, Nature
Biotechnology, 23, 1126 (2005).
Stanfield Robyn et al., Crystal Structure of a Shark-Single-Domain Antibody V Region in
Complex with Lysozyme, Science, 305, 1770 (2004).
Lee V., et al., The Evolution of Multiple Isotype IgM Heavy Chain Genes in the Shark, J.
Immunology, 180, 7461 (2008).
SUMMARY OF THE INVENTION
[0009] In one aspect, the invention provides a polypeptide having all or a portion of at least one variable antigen-binding Vab domain of camelid and or shark heavy chain only antibody, at least ten contiguous amino acids derived from a source other than camelid and/ or shark single-domain heavy chain antibodies lacking light-chains in which the polypeptide includes at least one binding site for an antigen. In one embodiment, the polypeptide includes at least two variable antigen-binding (Vab) domains of camelid and or shark heavy chain only antibody. In another embodiment, the polypeptide includes at least three, at least four or more variable (Vab) domains of camelid and or shark heavy chain only antibody. In some embodiments, the polypeptide may include domains from at least two different species such as camelid and shark, or two different camelid species such as llama, camel, alpaca and dromedaries. In some embodiments, the polypeptide may include one or more substitutions or deletions of the native amino acids.
[0010] In some embodiments, the polypeptide has composition and structures j_a -j_g, 2-14, 20-24, 25-45, 50-79, 81.-84, 82-91, 93- 97, in which "CHX" represents at least ten contiguous amino acids derived from a source other than camelid and/ or shark single-domain heavy chain antibodies lacking light-chains; "S" represents a linker; "Rn" represents all or a portion of at least one camelid or shark hinge region of single domain heavy chain antibody; L represents an entity linked to the polypeptide, and Vab represents camelid or shark variable region of single domain heavy chain antibody, "D" represents at least two amino acids comprising at least one charged amino acid, VNAR represents shark variable region of single domain heavy chain antibody, CH2 and CH3 represent constant domains 2 and 3 respectively of camelid and or shark single domain antibody lacking light chains, CH4 and CH5 represent constant domains 4 and 5 respectively of shark single domain heavy chain antibody lacking light chains. [0011] In one embodiment, the generic composition of the polypeptide is represented by : [Vab]m- S-R9 in which
Vab = Variable antigen-binding domain of camelid and/or shark single domain heavy chain antibodies; m = 1 to 10, preferably 2 to 5 such that the MW is approximately between 32 to 65 KDa for optimal biodistribution and retention in the body;
S is selected from the group consisting of groups I and II in which group I includes 1-20 amino acids of the hinge region of camelid and /or shark single domain heavy chain antibodies comprising at least one lysine and /or cysteine, and group II includes hetrobifunctional linker with one end being capable of covalent binding with amino- or aldehyde group of single-domain antibodies, and the other end with an entity "R9";
R9 represents an entity linked to Vab domain. "R9" can be detectable label, enzyme or protein (for example, horse radish peroxidase, alkaline phosphatase, luciferase, beta- galactosidase, and streptavidin), antibody, nucleic acid (for example, DNA, Modified DNA, Locked-DNA, PNA (Peptide Nucleic Acids), RNA, Si-RNA, Micro-RNA, mRNA, RNA- Conjugates/ Modifications), radionucleotides (for example, Fluorine- 18, Gallium-67, Krypton-81m, Rubidium-82, Technetium-99m, Indium-I l l, Iodine-123, Xenon-133, and Thallium-201, Yttrium-90, and Iodine- 131), toxins (for example, Immunotoxins, Ricin, Saporin, Maytansinoid, and Calicheamicin), solid support (for example, Microchannels, Microfluidic Device, Micrarrays, Biosensors, Glass Slides, Glass Chambers, Magnetic Beads, and Gold Nanoparticles), and therapeutic agents (for example, nucleolytic enzymes, antibiotics, and chemotherapeutic agents such as Paclitaxel its derivatives).
[0012] In one embodiment, the generic composition of "S" is
S = X-P-Y in which X can be of NHS (N-Hydroxy-succinimide), sulfo-NHS, CHO, COOH, CN, SCN, epoxide, phosphate and other moieties capable of forming covalent bond with NH2 groups of single-domain antibodies;
Y can be maleimido, NHS, sulfo-NHS, SH, COOH, SCN, NH2, and epoxide, capable of forming a covalent bond with the thiol group of the detectable label;
P can be (CH2CH2O)n, wherein n= 1-500; (CH2)nl, wherein nl = 1-15; (CH2-R-NHCO)n2, wherein n2 = 1-100; nucleic acids; Nylon, polystyrene; polypropylene; protein; and chimeric protein-nucleic acids. [0013] In another aspect, the invention provides a polypeptide having all or a portion of at least two variable antigen-binding (V ab) domains of camelid and or shark single domain heavy chain antibody lacking light chains, and all or a portion of at least one hinge region of camelid and or shark single domain heavy chain antibody lacking light chains, in a single polypeptide chain in which the polypeptide includes at least one binding site for an antigen. In one embodiment, the polypeptide includes at least three, at least four or more variable (Vab) domains of camelid and or shark single domain heavy chain antibody lacking light chain. In some embodiments, the polypeptide may include one or more substitutions or deletions of the native amino acids.
[0014] In one aspect, the invention provides a polypeptide comprising all or a portion of at least one variable (Vab) domain of camelid and or shark single domain heavy chain antibody lacking light chains, and all or a portion of at least one hinge region of camelid and or shark single domain heavy chain antibody. In some embodiments, the polypeptide may include one or more substitutions or deletions of the native amino acids.
[0015] In another aspect, the invention provides a composition having at least two polypeptides, in which each of the polypeptides includes all or a portion of at least one variable (Vab) domain of camelid and or shark single domain heavy chain antibody lacking light chain, all or a portion of at least one hinge region of camelid and or shark single domain heavy chain antibody lacking light chain in which at least one of the polypeptide includes at least one binding site for an antigen, and the polypeptides are linked to each other through at least one linker. The composition has improved biodistribution and retention. In one embodiment, at least one linker is a peptide bond. In another embodiment, at least one linker is other than a peptide bond. In one embodiment, the polypeptides of the composition include at least three, at least four, at least five or more variable antigen-binding (Vab) domains of camelid and or shark single domain heavy chain antibody. In some embodiments, the polypeptide may include one or more substitutions or deletions of the native amino acids.
[0016] In one embodiment of the above aspect, the composition is represented by structure Id in which Vab represents variable antigen binding domain of camelid and or shark single domain heavy chain antibody lacking light chain, "Rn" represents all of portion of hinge region of camelid and/or shark heavy chain only antibody, "Man" represents maleic anhydride. [0017] In one embodiment of the above aspect, the composition is represented by structures 21, 23, and 24 in which at least one of the variable antigen-binding domains is capable of binding to a biomarker associated with a disease. In the structures 21, 23, and 24, Vab represents variable antigen binding domain of came lid and /or shark single domain heavy chain antibody lacking light chain, "A" represents carbon or nitrogen atom, L represents a linker, "Rn" represents all of portion of hinge region of came lid and/or shark single domain heavy chain antibody lacking light chain.
[0018] In one embodiment of the above aspect, composition comprises four variable antigen-binding domains (Vab) of camelid and or shark single domain heavy chain antibody lacking light chain in which the structure of the composition is represented by structures 79 in which at least one of the Vab domains is capable of binding to a biomarker associated with a disease. In the structure 79, CHX may be of all or portion of CHl region of human IgG or cysteine capable of forming s-s bonds, CHY represents CHX-R, where R represents [Vab-
CHX]2 and Z= 1-6; Sl represents a linker such as structure 15, cysteine-s-s-cysteine; and
R represents all of portion of hinge region of camelid and/or shark heavy chain only antibody, N represents at least two amino acids.
[0019] In another aspect the invention provides a polypeptide comprising all or a portion of at least two variable antigen-binding (Vab) domains of camelid and or shark single domain heavy chain antibody lacking light chain, at least ten contiguous amino acids derived from a source other than camelid and/ or shark single-domain heavy chain antibodies lacking light- chains, all or a portion of at least one hinge region of camelid and or shark single domain heavy chain antibody lacking light chain in a single polypeptide chain in which at least two Vab domains bind to at least two different antigens, and the polypeptide has improved biodistribution and retention.
[0020] In one embodiment of all of the above aspects of the invention, the polypeptide includes all or a portion of at least one hinge region of camelid and or shark single domain heavy chain antibody lacking light chain. In one embodiment of all of the above aspects of the invention, the polypeptide includes all or a portion of at least one camelid and or shark single domain heavy chain constant domain 2 (CH2). In one embodiment of all of the above aspects of the invention, the polypeptide includes all or a portion of at least one camelid and or shark single domain heavy chain constant domain 3 (CH3). In one embodiment of all of the above aspects of the invention, at least one amino acid at positions 37, 44, 45, and 47 of the Vab region is selected from the group consisting of serine, glutamine, tyrosine, histidine, asparagine, threonine, aspartic acid, glutamic acid, lysine and arginine. In some embodiments, the polypeptide may include one or more substitutions or deletions of the native amino acids.
[0021] In some embodiments, the polypeptide may include domains from at least two different species such as camelid and shark, or two different camelid species such as llama, camel, alpaca and dromedaries.
[0022] In one embodiment of all of the above aspects of the invention, the polypeptide or the composition is capable of binding specifically to one or more antigens. Exemplary antigens include but not limited to AMACR; TMPRS S2-ERG; EPCA2; PSMA; PSA; HAAH; APP; ALZAS; Tau; gamma secretase; beta secretase; APO-Al; Apo-H; alfa- Synuclein; PV-I PEDF; BDNF; Cystatin C; VGF nerve growth factor inducible; APO-E; GSK-3 binding protein; TEMl; PGD2; EGFR; EGFRT790M; Notch-4; ALDH-I; ESR-I; EGFRT790M; HER-2/neu; P53; RAS; KLKBl; SMAD4; Smad7; TNF-alfa; HPV; tPA; PCA-3; Mucin; Cadherin-2; FcRn alpha chain; cytokerratin 1-20; .Apo-H; Celuloplasmin; Apo All; VGF; Vif; LEDGF/p75; TSlOl; gpl 20; CXCR4; CCR5; HIV protease; HIV integrase; OST-577; HlNl; CD3; CDl Ia; CD20; CD25; CD52; CD133; CD34; CD14; CDl- 340; Protein C5; VEGF; VEGF-A; alfa-4-integrin; Glycoprotein Ilb/IIIA; AP-I; IgG-E; NadD; STDs; TB; Bacillus anthracis protein; Plasmodium falciparum; cGMP directed phosphodiestrase; chain B of Clostridium botulinum neurotroxin type E protein; Borrelia VIsE protein; ACE2 receptor; SFRS4; SAMP; GPA; CD71; biomarkers for: lung cancer; bladder cancer; gastric cancer; brain cancer; breast cancer; prostate cancer; cervical cancer; colorectal cancer; oral cancer; leukemia; childhood neuroblastoma; Non-Hodgkin lymphoma; Alzheimer's disease; Parkinson's disease; AID; and protein markers for Down syndrome: TTHY, AMPB, SAMP, AIAT, AFMN, APOE, and SFRF4.
[0023] In one embodiment of all of the above aspects of the invention, the polypeptide is linked to at least one entity other than an antibody. In one embodiment, the entity can be detectable label, enzyme or protein (for example, horse radish peroxidase, alkaline phosphatase, luciferase, beta-galactosidase, and streptavidin), antibody, nucleic acid (for example, DNA, Modified DNA, Locked-DNA, PNA (Peptide Nucleic Acids), RNA, Si- RNA, Micro-RNA, mRNA, RNA-Conjugates/ Modifications), radionucleotides (for example, Fluorine- 18, Gallium-67, Rrypton-81m,Rubidium-82, Technetium-99m, Indium-I l l, Iodine- 123, Xenon-133, and Thallium-201, Yttrium-90, and Iodine-131), toxins (for example, Immunotoxins, Ricin, Saporin, Maytansinoid, and Calicheamicin), solid support (for example, beads, Microchannels, Microfluidic Device, Micrarrays, Biosensors, Glass Slides, Glass Chambers, Magnetic Beads, and Gold Nanoparticles), and therapeutic agents (for example, nucleolytic enzymes, antibiotics, and chemotherapeutic agents such as Paclitaxel its derivatives).
[0024] In some embodiments of the above aspects of the invention at least ten contiguous amino acids derived from a source other than camelid and/ or shark single-domain heavy chain antibodies lacking light-chains can be all or portions of all or a portion constant domain 1 (CHl) of human heavy chain immunoglobulin G. In other embodiments, at least ten contiguous amino acids derived from a source other than camelid and/ or shark single-domain heavy chain antibodies lacking light-chains can be CHl domain of any immunoglobulin. In another embodiment, at least ten contiguous amino acids can be derived from peptide hormones, signal peptides, interleukins, interferon beta and gamma, growth factors. In some embodiments at least ten amino acids can be derived from the amino acid sequence of SEQ ID NO: 48-97. Exemplary peptide hormones include but not limited luteinizing hormone, follicle-stimulating hormone, prolactin, adrenocorticotrophic hormone, glucocorticoids, and growth hormone. Exemplary growth factors include but not limited to basic fibroblast growth factor, platelet derived growth factor, epidermal growth factor, pigment epithelium derived factor. Exemplary signal peptides include but not limited to peroxisomal targeting signals, nuclear localization signal.
[0025] In some embodiments, the invention provides a method for diagnosing an individual with one or more diseases. The method includes a) obtaining a sample of bodily fluid from the individual, b) detecting the presence or absence of one or more pathological biomarkers for the disease in which the detection includes utilizing the polypeptide or the composition of the above aspects of the invention such that the polypeptide or at least one of the polypeptide in the composition binds specifically to the biomarker, c) determining the level of one or more biomarkers if present in the individual's sample, d) comparing the level of one or more biomarkers to a reference values, and e) identifying the individual as having one or more diseases when the level of one or more biomarkers in the individual's sample is higher than the reference values. In some embodiments, the reference values are the levels of the biomarkers in an individual without such one or more diseases.
[0026] In some embodiments the invention provides a method of preventing, treating, and/or alleviating symptoms associated with one or more diseases by administering to a subject in need thereof one or more polypeptides or the compositions of the above aspects of the invention. In some embodiments, one or more diseases can be Parkinson's disease, Alzheimer's disease, AIDS, Lyme disease, malaria, SARS, Down syndrome, anthrax, bacterial botulism. In some embodiments, one or more polypeptides or the compositions of the above aspects may further include one or more entities selected from the group consisting of therapeutic agent, toxin, and radionucleotide.
[0027] In some embodiments, the invention provides a method of simultaneously diagnosing, preventing, treating, and/or alleviating symptoms associated with an individual. The method includes a) administering to the individual in need thereof the polypeptide or the composition of the above aspects of the invention, b) detecting the presence or absence of a biomarker for the disease in which the detection includes utilizing the polypeptide or the composition of the above aspects of the invention in which the polypeptide or composition binds specifically to a biomarker associated with the disease, c) determining the level of the biomarker if present in the individual's sample, d) comparing the level to a reference value, e) identifying the individual as having the disease when the level of the biomarker in the individual's sample is higher than the reference value, and f) preventing, treating, and/or alleviating symptoms associated with the disease in the individual when the polypeptide or the composition of the above aspects of the invention specifically binds to the biomarker. In one embodiment, the polypeptide or the composition may further include an entity selected from the group consisting of therapeutic agent, toxin, and radionucleotide. In some embodiments, the reference value is the level of the biomarker in an individual without such disease. In some embodiments, the reference value is the level of the biomarker in the same individual measured at a different time. In some embodiments, the reference value is the level of the biomarker from a collected pool of samples from different individuals.
[0028] In some embodiments, the disease may be cancer, Parkinson's disease, Alzheimer's disease, AIDS, Lyme disease, malaria, SARS, Down syndrome, anthrax, salmonella or bacterial botulism, staphylococcus aureus. In some embodiments, the cancer can be lung cancer, bladder cancer, gastric cancer, ovarian cancer, brain cancer, breast cancer, prostate cancer, cervical cancer, ovarian cancer, oral cancer, colorectal cancer, leukemia, childhood neuroblastoma, or Non-Hodgkin's lymphoma.
[0029] In some embodiments, the biomarker can be AMACR, TMPRSS2-ERG, HAAH, APP, Aβ42, ALZAS, Tau, gamma secretase, beta secretase, PEDF, BDNF, Cystatin C, VGF nerve growth factor inducible, APO-E, GSK-3 binding protein, TEMl, PGD2, EGFR, ESR-I, HER-2/neu, P53, RAS, SMAD4, Smad7, TNF-alfa, HPV, tPA, PCA-3, Mucin, Cadherin-2, FcRn alpha chain, cytokerratin 1-20, Apo-H, Celuloplasmin, Apo All, VGF, Vif, LEDGF/p75, TSlOl, gp 120, CCR5, HIV protease, HIV integrase, Bacillus anthracis protein, NadD (Nicotinate Mononucletide Adenyltransferase), Plasmodium falciparum cGMP directed phosphodiestrase, chain B of Clostridium botulinum neurotroxin type E protein, Borrelia VIsE protein, ACE2 receptor, SFRS4, or SAMP.
[0030] In some embodiments, the biomarkers for Alzheimer's disease may be Amyloid- beta, ALZAS, Tau, DJ-I, Bax-1, PEDF, HPX, Cystatin-C, Beta-2-Microglobulin, BDNF, Tau-Kinase, gamma-Sercretase, beta-Secretase, Apo-E4, and VGF-Peptide.
[0031] In some embodiments, the biomarkers associated with Parkinson's Disease may be Apo-H, Cerulopasmin, Chromogranin-B, VDBP, Apo-E, Apo-AII, and alaf-Synuclein.
[0032] In some embodiments, the biomarkers for Brain Cancer may be TEMl , Plasmalemmal Vesicle (PV-I), Prostaglandin D Synthetase, and (PGD-S).
[0033] In some embodiments, the biomarkers for HIVAIDS, wherein said biomarkers for HIVAIDS may be gpl20, Vif, LEDGF/p75, TSlOl, HIV-Integrase, HIV-Reverse Transcriptase, HIV-Protease, CCR5, and CXCR4.
[0034] In some embodiments, the biomarkers for Lung Cancer may be KRAS, Ki67, EGFR, KLKBl, EpCAM, CYFRA21-1, tPA, ProGRP, Neuron-specific Enolase (NSE), and hnRNP.
[0035] In some embodiments, the biomarkers for Prostate Cancer may be AMACR, PCA3, TMPRSS2-ERG, HEPSIN, B7-H3, SSeCKs, EPCA-2, PSMA, BAG-I, PSA, MUC6, hK2, PCA-I, PCNA, RKIP, and c-HGK.
[0036] In some embodiments, the biomarkers for Breast Cancer may be EGFR, EGFRT790M, HER-2, Notch-4, ALDH-I, ESRl, SBEM, HSP70, hK-10, MSA, p53, MMP- 2, PTEN, Pepsinigen-C, Sigma-S, Topo-11-alfauKPA, BRCA-I, BRCA-2, SCGB2A1, and SCGB1D2.
[0037] In some embodiments, the biomarkers for Colorectal Cancer may be SMAD4, EGFR, KRAS, p53, TS, MSI-H, REGIA, EXTL3, plK3CA, VEGF, HAAH, EpCAM, TEM8, TKl, STAT-3, SMAD-7, beta-Catenin, CK20, MMP-I, MMP-2, MMP-7,9,11, and VEGF-D. 0038] In some embodiments, the biomarkers for Ovarian Cancer may be CD24, CD34, EpCAM, hK8, 10, 13, CKB, Cathesin B, M-CAM, c-ETSl, and EMMPRIN.
0039] In some embodiments, the biomarkers for Cervical Cancer may be HPV, CD34, ERCCl, Beta-CF, Id-I, UGF, SCC, pl6, p21WAFl, PP-4, and TPS. 0040] In some embodiments, the biomarkers for Bladder Cancer may be CKl 8, CK20, BLCa-I, BLCA-4, CYFRA21-1, TFT, BTA, Survivin, UCAl, UPII, FAS, and DD23. 0041] In some embodiments, the bacteria or biomarkers associated with a disease causing bacteria can be Clostridium Botulinum (Bacterial Botulism), Bacillus Anthracis (Anthrax), Salmonella Typhi (Typhoid Fever), Treponema Pallidum (Syphilis), Plasmodinum (Malaria), Chlamadyia (STDs), Borrelia B (Lyme disease), Staphyloccus Aureus, Tetanus, Meningococcal Meningitis (Bacterial Meningitis), and Mycobacterium tuberculosis (Tuberculosis, TB), and NadD(Nicotinate Mononucleotide Adenyltransferase, an enzyme involved in inducing resistance to antibiotics );
0042] In some embodiments, disease causing virus or biomarkers associated may be Pandemic Flu Virus HlNl strain, Influenza virus H5N1 strain, Hepatitis B virus (HBV) antigen OSt-577, HBV core antigen HBcAg (HBV), HBV antigen Wnt-1, Hepatitis C Virus (HCV) antigen Wnt-1, and HCV RNA (HCV).
[0043] In some embodiments, a nucleic acid encodes all or portion of a polypeptide having all or a portion of at least one variable (Vab) domain of camelid and or shark single domain heavy chain antibody, all or a portion of at least one constant domain 1 (CHl) of human heavy chain immunoglobulin G in which the polypeptide includes at least one binding site for an antigen. In one embodiment, the polypeptide includes at least two variable (Vab) domains of camelid and or shark single domain heavy chain antibody. In another embodiment, the polypeptide includes at least three, at least four or more variable (Vab) domains of camelid and or shark single domain heavy chain antibody.
[0044] In one embodiment, the nucleic acid is operably linked to one or more expression regulatory element which is capable of modulating the expression of the nucleic acid. Exemplary expression regulatory elements include but are not limited to a promoter, enhancer, 5'- and 3 '-untranslated regions, polyadenylation signal.
[0045] In some embodiments, the invention provides a method for producing a polypeptide of the above aspects of the invention. The method includes transforming a host cell with a recombinant nucleic acid encoding the polypeptide of the above aspects of the invention, and expressing the polypeptide in the host cell. In one embodiment, the host cell is eukaryotic. In another embodiment, the host cell is prokaryotic.
[0046] In another embodiment, the invention provides a method for producing a polypeptide of the above aspects of the invention. The method includes a chemical synthesis of a polypeptide comprising one , two, or more variable antigen-binding (Vab) domains using the parent antibody produced from camelid and /or shark as a starting material for generating the polypeptide with one or more Vab domains. Still in another embodiment, the invention provides a method for generating polypeptides comprising multivalent variable antigen- binding domains improving binding affinity between antibody and its antigen, and to improve it biodistribution and retention. Biological molecules with molecular weight between 15 to 17 KDa, though can enter a cell or cross blood brain barrier (BBB), they are not retained inside the cell to be therapeutically efficacious [Nature Biotechnology, 23, 1126 (2005)]. Conversely, biologicals, such as, conventional mouse monoclonal antibodies are too big (MW- 150 KDa) to enter a cell or cross BBB efficiently. Ideal tumor targeting reagents are intermediate-sized multivalent molecules with molecular weight of- 55 KDa [Nature Biotechnology, 23, 1126 (2005)]. In one embodiment, the invention encompasses the synthesis of a polypeptide with two or more variable antigen-binding domains to generate the polypeptide with a MW - 30 to 60 KDa, more preferably 40 to 60 KDa, but ideally - 55 KDa. The polypeptide comprises camelid Vab domains and /or shark V-NAR domains, in which such constructions/preparations are performed either chemically and/or via recombinant DNA methods.
[0047] In some embodiments of the above aspects, the invention provides a method for detecting the presence or absence of an antigen associated with a disease in a sample. The method includes a) obtaining a sample suspected of having the antigen, b) detecting the level of the antigen in the sample utilizing the polypeptide or composition of the above aspects of the invention in which the polypeptide or composition binds specifically to the antigen. The level of the antigen in the sample is indicative of the presence or absence of the antigen.
[0048] In some embodiments of the above aspects, the invention provides a method for detecting the presence or absence of circulating tumor cells in a sample. The method includes a) obtaining a sample suspected of having circulating tumor cells, b) detecting the level of one or more tumor cell surface receptors utilizing the polypeptide or composition of the above aspects of the invention in which the polypeptide or composition binds specifically to the tumor cell surface receptors. The level of the tumor cell surface receptors in the sample is indicative of the presence or absence of the circulating tumor cell. Exemplary tumor cell surface receptors include but not limited to MUC-I, VCAM-I, EpCAm-I, CD44, CD133, E-Cadherin, VEGF, bFGF, sFASL, CD95, p53, Bcl-2 CyclinDl, Cyclin E, TNF-alfa, TGF-betal, Her-2, EGFR, IGF-I and IGF-IR, IL-2R, Ras, and cMyc.
[0049] In some embodiments of the above aspects, the invention provides a method for detecting the presence or absence of circulating fetal cells in a sample. The method includes a) obtaining a sample suspected of having circulating fetal cells, b) detecting the level of one or more fetal cell surface receptors utilizing the polypeptide or composition of the above aspects of the invention in which the polypeptide or composition binds specifically to the fetal cell surface receptors. The level of the fetal cell surface receptors in the sample is indicative of the presence or absence of the circulating fetal cell. Exemplary tumor cell surface receptors include but not limited to GPA, CD71, CD133, CD34, CD44, ITCAM, ITGBl (Integrin beta-1), Trop-1, Trop-2, HLA-G233, and 6B5.
[0050] In some embodiments, the invention provides a method for detecting an organism or a cell. The method includes obtaining a sample, detecting the presence or absence of one or biomarkers associated with the organism or a cell utilizing the polypeptides or compositions of the above aspects of the invention. The presence of one or more biomarkers in the sample is indicative of the presence of the organism or a cell. In some embodiments, the organism is a pathogenic organism such as bacteria or virus. In some embodiments, the pathogenic organism is selected from the group consisting of Bacillus anthracis, Borrelia burgdorferi, Salmonella typhi, Plasmodium falciparum, Human immune deficiency virus (HIV), Hepatitis B virus (HBV), and severe acute respiratory syndrome virus (SARS). In some embodiments, the cell is selected from the group consisting of circulating fetal cell and circulating tumor cell.
[0051] The term "antibody" as used herein refers to immunoglobulin G (IgG) having only heavy chains without the heavy chain constant domain 1 (CHl) and also lacking the light chain such as in shark IgNAR and came lids IgG2 and IgG3. Antibody can be monoclonal or polyclonal.
[0052] The term "analog" within the scope of the term "antibody" include those produced by digestion with various proteases, those produced by chemical cleavage, chemical coupling, chemical conjugation, and those produced recombinantly, so long as the fragment remains capable of specific binding to a target molecule. Analogs within the scope of the term include antibodies (or fragments thereof) that have been modified in sequence, but remain capable of specific binding to a target molecule, including: interspecies chimeric and humanized antibodies; antibody fusions; heteromeric antibody complexes and antibody fusions, such as diabodies (bispecifϊc antibodies), single-chain diabodies, and intrabodies (see, e.g., Marasco (ed.), Intracellular Antibodies: Research and Disease Applications, Springer-Verlag New York, Inc. (1998) (ISBN: 3540641513). As used herein, antibodies can be produced by any known technique, including harvest from cell culture of native B lymphocytes, harvest from culture of hybridomas, recombinant expression systems, and phage display.
[0053] The terms "heavy chain only antibody" and "single domain heavy chain antibody" has been used herein interchangeably in the context of came lid and shark antibodies and refer to camelid immunoglobulin G (IgG) and shark IgNAR having only heavy chains without the heavy chain constant domain 1 (CHl) and further lacking the light chain such as camelids IgG2 and IgG3 and shark IgNAR. Heavy chain only antibody can be monoclonal or polyclonal.
[0054] The term "improved biodistribution and retention" as used herein in the context of polypeptides, antibodies and its analogs refers to polypeptides, antibodies and its analogs that can cross cell membrane and blood brain barrier (BBB) and have greater thermal and chemical stability than conventional immunoglobulin G with heavy and light chains. Typically such polypeptides, antibodies and its analogs have molecular weight between 25 to 90 KDa, preferably between 30 to 60 KDa. In some embodiments, the molecular weight is at least 25 KDa, 30 KDa, 35 KDa, 40 KDa, 45 KDa, 50 KDa, 55 KDa, 60 KDa, 65 KDa, 70 KDa, 75 KDa, 80 KDa, 85 KDa, or 90 KDa. Although larger and smaller molecular weights are possible.
[0055] The term "specifically binds to" as used herein in the context of an antibody or its analogs refers to binding of an antibody or its analogs specifically to an epitope such that the antibody or its analog can distinguish between two proteins with and without such epitope. [0056] The terms "biomarker" and antigen is used interchangeably and refer to a molecule or group of molecules comprised of nucleic acids, carbohydrates, lipids, proteins, peptides, enzymes and antibodies which is associated with a disease, physiological condition, or an organism. An organism can be pathogenic or nonpathogenic. A biomarker may not necessarily be the reason for a disease or a physiological condition. An amount of a biomarker may be increased or decreased in disease or a physiological condition. [0057] The term "came lid" as used herein refers to members of the biological family Camelidae in the Order: Artiodactyla, Suborder: Tylopoda. Exemplary members of this group include camels, dromedaries, llamas, alpacas, vicunas, and guanacos.
[0058] The term "shark" as used herein refers to members that belong to the super order Selachimorpha in the subclass Elasmobranchii in the class Chondrichthyes. There are more than 400 species of sharks known. Exemplary members of the class Chondrichthyes include great white sharks, houndsharks, cat sharks, hammerhead sharks, blue, tiger, bull, grey reef, blacktip reef, Caribbean reef, blacktail reef, whitetip reef, oceanic whitetip sharks, zebra sharks, nurse sharks, wobbegongs, bramble sharks, dogfish, roughsharks, and prickly sharks.
[0059] The term "a portion of in the context of antibodies such as camelid and shark heavy chain only antibodies and their analogs, or human antibodies means at least 2, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 125, 150, 200, 250, 300, 350, 400 or more amino acids.
[0060] The term "a portion of in the context of hinge region of camelid and shark single domain heavy chain antibodies means at least 1, 2, 5, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 125, 150, 200, 250, 300, 350, 400 or more amino acids of the hinge region.
[0061] The terms "diagnose" or "diagnosis" as used herein refers to the act or process of identifying or determining a disease or condition in an organism or the cause of a disease or condition by the evaluation of the signs and symptoms of the disease or disorder. Usually, a diagnosis of a disease or disorder is based on the evaluation of one or more factors and/or symptoms that are indicative of the disease. That is, a diagnosis can be made based on the presence, absence or amount of a factor which is indicative of presence or absence of the disease or condition. Each factor or symptom that is considered to be indicative for the diagnosis of a particular disease does not need be exclusively related to the particular disease; i.e. there may be differential diagnoses that can be inferred from a diagnostic factor or symptom. Likewise, there may be instances where a factor or symptom that is indicative of a particular disease is present in an individual that does not have the particular disease.
[0062] The term "reference value" as used herein means a value which can be used for comparison with a biomarker under investigation. In one case, a reference value may be the level of a biomarker under investigation from one or more individuals without any known disease. In another case, a reference value may be the level of the biomarker in an idividual's sample collected at a different time. [0063] The terms "treatment," "treating," or "treat" as used herein refers to care by procedures or application that are intended to relieve illness or injury. Although it is preferred that treating a condition or disease will result in an improvement of the condition, the term treating as used herein does not indicate, imply, or require that the procedures or applications are at all successful in ameliorating symptoms associated with any particular condition. Treating a patient may result in adverse side effects or even a worsening of the condition which the treatment was intended to improve.
[0064] "Sample" or "patient sample" as used herein includes biological samples such as cells, tissues, bodily fluids, and stool. "Bodily fluids" may include, but are not limited to, blood, serum, plasma, saliva, cerebral spinal fluid, pleural fluid, tears, lactal duct fluid, lymph, sputum, urine, amniotic fluid, and semen. A sample may include a bodily fluid that is "acellular". An "acellular bodily fluid" includes less than about 1% (w/w) whole cellular material. Plasma or serum are examples of acellular bodily fluids. A sample may include a specimen of natural or synthetic origin.
[0065] The term "body fluid" or "bodily fluid" as used herein refers to any fluid from the body of an animal. Examples of body fluids include, but are not limited to, plasma, serum, blood, lymphatic fluid, cerebrospinal fluid, synovial fluid, urine, saliva, mucous, phlegm and sputum. A body fluid sample may be collected by any suitable method. The body fluid sample may be used immediately or may be stored for later use. Any suitable storage method known in the art may be used to store the body fluid sample; for example, the sample may be frozen at about -2O0C to about -7O0C. Suitable body fluids are acellular fluids. "Acellular" fluids include body fluid samples in which cells are absent or are present in such low amounts that the peptidase activity level determined reflects its level in the liquid portion of the sample, rather than in the cellular portion. Typically, an acellular body fluid contains no intact cells. Examples of acellular fluids include plasma or serum, or body fluids from which cells have been removed.
[0066] The term "enzyme linked immunosorbent assay" (ELISA) as used herein refers to an antibody-based assay in which detection of the antigen of interest is accomplished via an enzymatic reaction producing a detectable signal. ELISA can be run as a competitive or noncompetitive format. ELISA also includes a 2-site or "sandwich" assay in which two antibodies to the antigen are used, one antibody to capture the antigen and one labeled with an enzyme or other detectable label to detect captured antibody-antigen complex. In a typical 2-site ELISA, the antigen has at least one epitope to which unlabeled antibody and an enzyme-linked antibody can bind with high affinity. An antigen can thus be affinity captured and detected using an enzyme-linked antibody. Typical enzymes of choice include alkaline phosphatase or horseradish peroxidase, both of which generated a detectable product upon digestion of appropriate substrates.
[0067] The term "label" as used herein, refers to any physical molecule directly or indirectly associated with a specific binding agent or antigen which provides a means for detection for that antibody or antigen. A "detectable label" as used herein refers any moiety used to achieve signal to measure the amount of complex formation between a target and a binding agent. These labels are detectable by spectroscopic, photochemical, biochemical, immunochemical, electromagnetic, radiochemical, or chemical means, such as fluorescence, chemifluoresence, or chemiluminescence, electro-chemiluminescence or any other appropriate means. Suitable detectable labels include fluorescent dye molecules or fluorophores.
[0068] The terms "polypeptide," "protein," and "peptide" are used herein interchangeably to refer to amino acid chains in which the amino acid residues are linked by peptide bonds or modified peptide bonds. The amino acid chains can be of any length of greater than two amino acids. Unless otherwise specified, the terms "polypeptide," "protein," and "peptide" also encompass various modified forms thereof. Such modified forms may be naturally occurring modified forms or chemically modified forms. Examples of modified forms include, but are not limited to, glycosylated forms, phosphorylated forms, myristoylated forms, palmitoylated forms, ribosylated forms, acetylated forms, ubiquitinated forms, etc. Modifications also include intra-molecular crosslinking and covalent attachment to various moieties such as lipids, flavin, biotin, polyethylene glycol or derivatives thereof, etc. In addition, modifications may also include cyclization, branching and cross-linking. Further, amino acids other than the conventional twenty amino acids encoded by genes may also be included in a polypeptide.
[0069] The term "detectable label" as used herein in the context of antibody or its analogs refers to a molecule or a compound or a group of molecules or a group of compounds associated with a binding agent such as an antibody or its analogs, secondary antibody and is used to identify the binding agent bound to its target such as an antigen, primary antibody. A detectable label can also be used in to detect nucleic acids. In such cases a detectable label may be incorporated into a nucleic acid during amplification reactions or a detectable label may be associated a probe to detect the nucleic acid. [0070] "Detecting" as used herein in context of detecting a signal from a detectable label to indicate the presence of a nucleic acid of interest in the sample (or the presence or absence of a protein of interest in the sample) does not require the method to provide 100% sensitivity and/or 100% specificity. As is well known, "sensitivity" is the probability that a test is positive, given that the person has a genomic nucleic acid sequence, while "specificity" is the probability that a test is negative, given that the person does not have the genomic nucleic acid sequence. A sensitivity of at least 50% is preferred, although sensitivities of at least 60%, at least 70%, at least 80%, at least 90% and at least 99% are clearly more preferred. A specificity of at least 50% is preferred, although specificity of at least 60%, at least 70%, at least 80%, at least 90% and at least 99% are clearly more preferred. Detecting also encompasses assays with false positives and false negatives. False negative rates may be 1%, 5%, 10%, 15%, 20% or even higher. False positive rates may be 1%, 5%, 10%, 15%, 20% or even higher.
[0071] The term "about" as used herein in reference to quantitative measurements or values, refers to the indicated value plus or minus 10%.
[0072] "Nucleic acid" as used herein refers to an oligonucleotide, nucleotide or polynucleotide, and fragments or portions thereof, which may be single or double stranded, and represent the sense or antisense strand. A nucleic acid may include DNA or RNA, and may be of natural or synthetic origin and may contain deoxyribonucleotides, ribonucleotides, or nucleotide analogs in any combination.
[0073] Non- limiting examples of polynucleotides include a gene or gene fragment, genomic DNA, exons, introns, mRNA, tRNA, rRNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, synthetic nucleic acid, nucleic acid probes and primers. Polynucleotides may be natural or synthetic. Polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs, uracyl, other sugars and linking groups such as fluororibose and thiolate, and nucleotide branches. A nucleic acid may be modified such as by conjugation, with a labeling component. Other types of modifications included in this definition are caps, substitution of one or more of the naturally occurring nucleotides with an analog, and introduction of chemical entities for attaching the polynucleotide to other molecules such as proteins, metal ions, labeling components, other polynucleotides or a solid support. Nucleic acid may include nucleic acid that has been amplified (e.g., using polymerase chain reaction). [0074] A fragment of a nucleic acid generally contains at least about 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 200, 300, 400, 500, 1000 nucleotides or more. Larger fragments are possible and may include about 2,000, 2,500, 3,000, 3,500, 4,000, 5,000 7,500, or 10,000 bases.
[0075] "Gene" as used herein refers to a DNA sequence that comprises control and coding sequences necessary for the production of an RNA, which may have a non-coding function (e.g., a ribosomal or transfer RNA) or which may include a polypeptide or a polypeptide precursor. The RNA or polypeptide may be encoded by a full length coding sequence or by any portion of the coding sequence so long as the desired activity or function is retained.
[0076] "cDNA" as used herein refers to complementary or copy polynucleotide produced from an RNA template by the action of RNA-dependent DNA polymerase activity (e.g., reverse transcriptase). cDNA can be single stranded, double stranded or partially double stranded. cDNA may contain unnatural nucleotides. cDNA can be modified after being synthesized. cDNA may comprise a detectable label.
[0077] As used herein, "subject" or "individual" is meant a human or any other animal that has cells. A subject can be a patient, which refers to a human presenting to a medical provider for diagnosis or treatment of a disease. A human includes pre and post natal forms.
[0078] The term "patient" as used herein, refers to one who receives medical care, attention or treatment. As used herein, the term is meant to encompass a person diagnosed with a disease as well as a person who may be symptomatic for a disease but who has not yet been diagnosed.
[0079] The term "vector" as used herein refers to a recombinant DNA or RNA plasmid or virus that comprises a heterologous polynucleotide capable of being delivered to a target cell, either in vitro, in vivo or ex-vivo. The heterologous polynucleotide can comprise a sequence of interest and can be operably linked to another nucleic acid sequence such as promoter or enhancer and may control the transcription of the nucleic acid sequence of interest. As used herein, a vector need not be capable of replication in the ultimate target cell or subject. The term vector may include expression vector and cloning vector.
[0080] Suitable expression vectors are well-known in the art, and include vectors capable of expressing a polynucleotide operatively linked to a regulatory sequence, such as a promoter region that is capable of regulating expression of such DNA. Thus, an expression vector refers to a recombinant DNA or RNA construct, such as a plasmid, a phage, recombinant virus or other vector that, upon introduction into an appropriate host cell, results in expression of the inserted DNA. Appropriate expression vectors include those that are replicable in eukaryotic cells and/or prokaryotic cells and those that remain episomal or those which integrate into the host cell genome.
[0081] The term "promoter" as used herein refers to a segment of DNA that controls transcription of polynucleotide to which it is operative Iy linked. Promoters, depending upon the nature of the regulation, may be constitutive or regulated. Exemplary eukaryotic promoters contemplated for use in the practice of the present invention include the SV40 early promoter, the cytomegalovirus (CMV) promoter, the mouse mammary tumor virus (MMTV) steroid-inducible promoter, Moloney murine leukemia virus (MMLV) promoter. Exemplary promoters suitable for use with prokaryotic hosts include T7 promoter, beta- lactamase promoter, lactose promoter systems, alkaline phosphatase promoter, a tryptophan (trp) promoter system, and hybrid promoters such as the lac promoter.
BRIEF DESCRIPTION OF THE FIGURES
[0082] FIG. 1 shows structural differences between camel, shark, and mouse immunoglobulins (IgGs). The notations CH2, CH3, CH4, CH5 represent constant domain 2, 3, 4 of single domain heavy chain antibody of the respective species. The notations Vab and VNAR represent variable domain of camelid and shark single domain heavy chain antibodes respectively.
[0083] FIG. 2 shows an exemplary nucleic acid sequence of variable antigen-binding region (Vab) of camel heavy chain only antibody without the light chains (SEQ ID NO: 3).
[0084] FIG. 3 shows exemplary chemical and/or protease digests of camelid and shark heavy chain only antibodies. The notatio "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
[0085] FIG. 4 A and B shows the structure of exemplary analogs of camelid heavy chain only antibodies: Micro-, Sub-nano-, Nano- antibodies 3-6, and Multimeric Constructs: Bivalent,_7, Trivalent,8, Multivalent 8, Rabbit Ear-Like Bivalent Construct 9, and Bivalent Construct IJ) with and without Val37, Gly44, Leu45, and Trp47 of Vab changed to polar hydrophilic amino acids, namely, Ser, GIn, Tyr., His, Asn, Thr, Asp, Cys, GIu, Lys, and Arg. The notation "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies. [0086] FIG. 5 shows an exemplary scheme of cloning and expression of camelid heavy chain only antibodies and their analogs.
[0087] FIG. 6 shows an exemplary nucleic acid sequence of constant domain 1 (CHl) of human IgG (SEQ ID NO: 7).
[0088] FIG. 7 shows an exemplary scheme of making recombinant bivalent analog of camelid heavy chain only antibodies.
[0089] FIG. 8 shows an exemplary scheme of chemical synthesis of bivalent analog of camelid and shark heavy chain only antibodies. The notation "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
[0090] FIG. 9 shows an alternative exemplary scheme of chemical synthesis of bivalent analog of camelid heavy chain only antibodies. The notation "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
[0091] FIG. 10 shows an exemplary scheme of chemical synthesis of multivalent analog of camelid and shark heavy chain only antibodies. The notation "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
[0092] FIG. 11 shows an exemplary scheme of chemical synthesis of trivalent analog of camelid and shark heavy chain only antibodies. The notation "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
[0093] FIG. 12 A and B shows exemplary camelid heavy-chain only antibodies and its analogs conjugated to various entities for diagnostic and therapeutic applications. Man stands for maleic anhydride. The notation "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
[0094] FIG. 13 shows the exemplary pegylation scheme of camelid heavy-chain only antibodies and its analogs to yield the corresponding pegylated products. The notation "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
[0095] FIG. 14 shows an exemplary conjugation scheme of nucleic acid to camelid and shark heavy chain only antibodies and their analogs. The notation "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
[0096] FIG. 15 outlines the steps involved in immobilization of camelid and shark heavy chain only antibodies and their analogs to solid surfaces. [0097] FIG. 16 shows the comparison of amino acid sequences of VH domains of conventional monoclonal antibody (mAbVH) with Vab (cVab) region of camel IgG3, Vab region of camel IgG2 having shorter hinge region (lVab) and shark V-NAR.
[0098] FIG. 17 shows shark heavy chain only antibody (Structure 2), exemplary analogs (structures 52, 53, 54, 55, 56) and exemplary means of making such analogs. The notations "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies, "D" represents at least two amino acids comprising at least one charged amino acid.
[0099] FIG. 18 shows schematics of chemically making exemplary shark heavy chain only antibody analogs (structures 52-56, 67- 73) and exemplary means of making conjugates with various entities. The notations "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies, "D" represents at least two amino acids comprising at least one charged amino acid.
[0100] FIG. 19 shows schematics of cloning strategy of shark heavy chain only antibody and its analogs.
[0101] FIG. 20 shows an exemplary amino acid sequence of shark IgNAR (SEQ ID NO: 16). Amino acid sequence of the various regions of the protein are underlined and indicated.
[0102] FIG. 21 shows an exemplary nucleic acid sequence of shark IgNAR (SEQ ID NO:
17).
[0103] FIG. 22 shows schematics of chemically linking exemplary hydrophilic linker to shark heavy chain only antibody analog with structure 74. The notation "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
[0104] FIG. 23 shows an exemplary method of making bi-valent analogs of shark heavy chain only antibody. The notation "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
[0105] FIG. 24 shows an exemplary method of making tetra-valent analogs of shark heavy chain only antibody. The notation "Rn" represents all or portion of the hinge region of camelid or shark single domain antibodies.
[0106] FIG. 25 shows an exemplary scheme of capturing and detecting antigens/biomarkers associated with a disease using camelid and shark heavy chain only antibodies and their analogs. [0107] FIG. 26 shows an exemplary scheme of capturing and detecting antigens/biomarkers associated with a disease using camelid and shark heavy chain only antibodies and their analogs using immuno-PCR.
[0108] FIG. 27 shows an exemplary scheme of capturing and detecting rare cells associated with a disease using camelid and shark heavy chain only antibodies and their analogs.
[0109] FIG. 28 shows an exemplary scheme of detecting chromosomal translocation using captured circulating tumor cells using camelid and shark heavy chain only antibodies and their analogs.
[0110] FIG. 29 shows an exemplary scheme of detecting prenatal genetic disorder using captured circulating fetal cells using camelid and shark heavy chain only antibodies and their analogs.
[0111] FIG. 30 shows exemplary amino acid sequences of different biomarkers associated with a disease or pathogen (SEQ ID NOs: 48-97).
DETAILED DESCRIPTION OF THE INVENTION
[0112] Unless otherwise specified, the terms "a" or "an" mean "one or more" throughout this application. The present invention teaches composition of camelid and/or shark single- domain heavy-chain only antibodies and their analogs for efficient cell and blood brain barrier (BBB) permeability for optimal biodistribution and retention for diagnosing and /or treating human diseases, methods for the development of nano-biomedical technology platforms utilizing camelid and/or shark heavy-chain only antibodies and their analogs for in- vitro and in- vivo diagnosis and treatment of human and animal diseases with such antibodies.
Camelid and Shark Antibodies
[0113] The hetero-tetrameric structure exists in humans and most animals but the heavy- chain dimer structure is considered characteristic of camelids and sharks [Holliger P, Hudson PJ, Nature Biotechnology, 23, 1126 (2005)]. These antibodies are relatively simple molecules but with unique characteristics. Their size is about 2/3 rd the size of traditional antibodies, hence a lower molecular weight (About 90 K Da), with similar antigen binding affinity, but with water solubility 100 to 1000 folds higher than the conventional antibodies. Because of the lower molecular weight, the authors of this application call these antibodies as "Heavy-Chain Mini-Antibodies" (mnHCAbs) or simply "Mini- Antibodies" (mnAbs). [0114] Another characteristic of heavy-chain antibodies derived from sharks and camelids, for example, is that they have very high thermal stability compared to the conventional mAbs. For example, camel antibodies can maintain their antigen binding ability even at 900C [Biochim. Biophys. Acta., 141, 7 (1999)]. Furthermore, complementary determining region 3 (CDR3) of camel Vab region is longer, comprising of 16-21 amino acids, than the CDR3 of mouse VH region comprising of 9 amino acids [Protein Engineering, 7, 1129 (1994)]. The larger length of CDR3 of camel Vab region is responsible for higher diversity of antibody repertoire of camel antibodies.
[0115] In addition to being devoid of light chains, the camel heavy-chain antibodies also lack the first domain of the constant region called CHl, though the shark antibodies do have CHl domain and two additional constant domains CH4 and CH5 [ Nature Biotech. 23, 1126 (2005)]. Furthermore, the hinge regions of camel and shark antibodies have an amino acid sequence different from that of normal heterotetrameric conventional antibodies [(S. Muyldermans, Reviews in MoI. Biotech., 74, 277 (2001)]. Without the light chain, these heavy-chain antibodies bind to their antigens by one single domain, the variable antigen- binding domain of the heavy-chain immunoglobulin, is referred to as Vab by the authors of this application (VHH in the literature), to distinguish it from the variable domain VH of the conventional antibodies. The single -domain Vab is amazingly stable by itself without having to be attached to the heavy-chain. This smallest intact and independently functional antigen-binding fragment Vab, with a molecular weight of -12-15 K. Da, derived from a functional heavy-chain full length mini-immunoglobulin, is referred to as nano-antibody by the authors of this application . In the literature, it is known as nanobody [(S. Muyldermans, Reviews in MoI. Biotech., 74, 277 (2001)].
[0116] The genes encoding these full length single-domain heavy-chain antibodies and antibody-antigen binding fragment Vab (camel and shark) can be cloned in phage display vectors, and selection of antigen binders by panning and expression of selected VHH in bacteria offer a very good alternative procedure to produce these antibodies on a large scale. Also, only one domain has to be cloned and expressed to produce in vivo an intact, matured antigen-binding fragment.
[0117] There are structural differences between the variable regions of single domain antibodies and conventional antibodies. Conventional antibodies have three constant domains while camel has two and shark has five constant domains. The largest structural difference is, however, found between a VH (conventional antibodies) and Vab (heavy-chain only antibodies of camel and shark) (see below) at the hypervariable regions. Camelid Vab and shark V-NAR domains each display surface loops which are larger than for conventional murine and human IgGs, and are able to penetrate cavities in target antigens, such as enzyme active sites and canyons in viral and infectious disease biomarkers [PNAS USA., 101, 12444 (2004); Proteins, 55, 187 (2005)]. In human and mouse the VH loops are folded in a limited number of canonical structures. In contrast, the antigen binding loop of Vab possess many deviations of these canonical structures that specifically bind into such active sites, therefore, represent powerful tool to modulate biological activities [( K. Decanniere et al., Structure, 7, 361 (2000)]. The high incidence of amino acid insertions or deletions, in or adjacent to first and second antigen-binding loops of Vab will undoubtedly diversify, even further, the possible antigen-binding loop conformations.
[0118] Though there are structural differences between camel and shark parent heavy-chain antibodies (FIG. 1), the antigen-antibody binding domains, Vab and V-NAR, respectively, are similar . The chemical and/or protease digestion of camel and shark antibodies results in Vab and V-NAR domains, with similar binding affinities to the target antigens [Nature Biotechnology, 23, 1126 (2005)].
[0119] Other structural differences are due to the hydrophilic amino acid residues which are scattered throughout the primary structure of Vab domain. These amino acid substitutions are, for example, Leu 45 to R (arginine) or Leu45 to C (cysteine); Val37 to Y (Tyr); G44 to E( GIu), and W47(Trp) to G (GIy). Therefore, the solubility of Vab is much higher than the Fab fragment of conventional mouse and human antibodies.
[0120] Another characteristic feature of the structure of camelid Vab and shark V-NAR is that it often contains a cysteine residue in the CDR3 in addition to cysteines that normally exist at positions 22 and 92 of the variable region. The cysteine residues in CDR3 form S-S bonds with other cysteines in the vicinity of CDRl or CDR2 [Protein Engineering,^, 1129 (1994)]. CDRl and CDR2 are determined by the germline V gene. They play important roles together with CDR3 in antigenic binding [Nature Structural Biol.,_9, 803 (1996); J. MoI. Biol, 311, 123 (2001)]. Like camel CDR3, shark also has elongated CDR3 regions comprising of 16 -27 amino acids residues [Eur. J. Immunol., 35_, 936 (2005)].
[0121] The germlines of dromedaries and llamas are classified according to the length of CDR2 and cysteine positions in the V region [Nguyen et al., EMBO J., 19, 921 (2000); Harmsen et al., MoI. Immun., 37, 579 (2000)]. [0122] Immunization of camels with enzymes generates heavy-chain antibodies (HCAb) significant proportions of which are known to act as competitive enzyme inhibitors that interact with the cavity of the active site [(M. Lauwereys et al, EMBO, J. JJ, 3512 (1998)]. In contrast, the conventional antibodies that are competitive enzyme inhibitors cannot bind into large cavities on the antigen surface. Camel antibodies, therefore, recognize unique epitopes that are out of reach for conventional antibodies.
[0123] Production of inhibitory recombinant Vab that bind specifically into cavities on the surface of variety of enzymes, namely, lysozyme, carbonic anhydrase, alfa-amylase, and beta- lactamase has been achieved [M. Lauwereys, et al., EMBO, J. J/7, 3512 (1998)]. Hepatitis C protease inhibitor from the camelised human VH has been isolated against an 11 amino acid sequence of the viral protease [F. Martin et al., Prot. Eng., Jj), 607 (1997)].
[0124] Comparison of biological characteristics of camel antibodies, Camel VAB/Shark V- NAR, Bivalent Nano-antibodies and Mouse IgG are shown in Table 1 :
Table 1: Comparison of Biological Characteristics of Camel, Shark V-NAR, Bivalent Nano- Antibodies and Mouse IgG
Figure imgf000030_0001
Camelid Heavy-Chain Antibodies, and Analogs:
[0125] Camelid heavy chain only antibodies comprise a variable antigen-binding (Vab) region , hinge region (HR), and two constant regions CH2 and CH3 as shown in Fig. 1. Exemplary amino acid sequence of camel Vab is disclosed in GenBank accession number ACF49483. The sequence is incorporated herein by reference. Exemplary camel Vab region is listed as SEQ ID NO: 1 and shown below:
DVQLQESGGGSVQAGGSLKLSCAISGYDNDNYCMGWFRQTPGKEREKVAALNIGG GSPVYADFVRGRFTISLDSSKDTLYLLMNAVTPEDTAMYYCAAIRKPQFYTCRMWK PRADFDIWGQGTQVTVSS (SEQ ID NO: 1)
[0126] Amino acid sequence of camel hinge region is disclosed in Nature 1993; 363: 446-8. Exemplary amino acid sequence of camel hinge region is listed as SEQ ID NO: 2 and shown below:
EPKIPQPQPKPQPQPQPQPKPQPKPEPECTCPKCP (SEQ ID NO: 2) [0127] Exemplary nucleic acid sequence of camel Vab region is disclosed in GenBank accession number EU861212. Sequence of which is incorporated herein by reference. Exemplary sequence of camel Vab region is listed as SEQ ID NO: 3 and shown in Fig. 2.
[0128] Exemplary nucleic acid sequence of the hinge region of heavy chain only antibodies deduced from amino acid sequence is listed as SEQ ID NO: 4 and shown below: ggacagaagacaccgcaccaacggccaagaccccacccccaacagcgaccgcagccgagacagcggcagagacacgaaccg gagtgcacgtgtcccagatgtcc (SEQ ID NO: 4)
Production of Heavy-Chain Mini-Antibodies l_(HCmnAbs):
[0129] Camelids such as camels, alpacas, llamas will be immunized with one or more antigens using the biomarkers associated with different diseases and/or organisms to produce the parent antibody (HCmnAbs, Structure 1) and the mRNA, from which the variants and analogs will be derived, either chemically or through recombinant means. Exemplary analogs of camelid heavy chain only antibodies include Ia-Ig, 3-14, 20-21, 23-45 and shown in Fig. 1, 3-4, and 8-14.
Analogs of Camelid Heavy-Chain Only Antibodies
[0130] Several analogs of camelid and shark heavy-chain only antibodies (Structure 1) are proposed in this application, particularly, to improve biodistribution and retention for optimal diagnostic and therapeutic applications.. Monovalent Vab or V-NAR is of very little diagnostic and therapeutic use because it will rapidly cross cell membrane and BBB and it will also rapidly exit the tissues to be of any medicinal value. Divalent, trivalent, tetravalent and pentavalent Vab and/or V-NAR domains are the preferred analogs of this invention due to their potentially higher cellular and BBB intake and retention. The preferred analogs of the invention comprise a polypeptide with two or more variable antigen-binding domains and have a molecular weight in the range of 30-60 KDa. Exemplary analogs include but not limited to structures Ia-Ig, 3-14, 20-21, 23-45 shown in Fig. 1, 3-4, and 8-14. The analogs may be univalent or multivalent such as, divalent, trivalent, tetravalent, pentavalent etc. The analogs may be made by recombinant technology or by chemical means.
Recombinant Production of Micro, Sub-Nano- and Nano-antibodies Ia, Ib, and Ic
[0131] The steps involved in the production of various analogs of camelid single-domain antibodies Ia, Ib, and Ic with and without the constant domain 1 (CHl) of human IgG are outlined in Fig. 5. Exemplary nucleic acid sequence of CHl domain of human IgG is disclosed in GenBank accession number EO 1508. Sequences of which are incorporated herein by reference. Exemplary nucleic acid sequence of CHl domain of human IgG is listed as SEQ ID NO: 7 and shown in Fig. 6.
[0132] Briefly, mRNA from camelid species will be isolated using commercially available kits for example, RNeasy Protect Mini kit, RNeasy Protect Cell Mini kit, QIAamp RNA Blood Mini kit, RNeasy Protect Saliva Mini kit, Paxgene Blood RNA kit from Qiagen; MELT™, RNaqueous®, ToTALLY RNA™, RiboPure™-Blood, Poly(A)Purist™ from Applied Biosystems; TRIZOL® reagent, Dynabeads® mRNA direct kit from Invitrogen.
[0133] Nucleic acid extracted can be amplified using nucleic acid amplification techniques well know in the art. Nucleic acid amplification can be linear or exponential. By way of example, but not by way of limitation these techniques can include the polymerase chain reaction (PCR) and reverse transcriptase polymerase chain reaction (RT-PCR).
[0134] Oligonucleotide primers for use in these methods can be designed according to general guidance well known in the art as described herein, as well as with specific requirements as described herein for each step of the particular methods described.
[0135] In some embodiments, oligonucleotide primers for cDNA synthesis and PCR are 10 to 100 nucleotides in length, preferably between about 15 and about 60 nucleotides in length, more preferably 25 and about 50 nucleotides in length, and most preferably between about 25 and about 40 nucleotides in length. There is no standard length for optimal hybridization or polymerase chain reaction amplification.
[0136] Methods of designing primers have been described in U.S. Patent Application: 10/921482. Primers useful in the methods described herein are also designed to have a particular melting temperature (Tm) by the method of melting temperature estimation. Commercial programs, including Oligo™, Primer Design and programs available on the internet, including Primer3 and Oligo Calculator can be used to calculate a Tm of a polynucleotide sequence useful according to the invention.
[0137] Tm of a polynucleotide affects its hybridization to another polynucleotide (e.g., the annealing of an oligonucleotide primer to a template polynucleotide). In the subject methods, it is preferred that the oligonucleotide primer selectively hybridizes to a target template or polynucleotides derived from the target template (i.e., first and second strand cDNAs and amplified products). Typically, selective hybridization occurs when two polynucleotide sequences are substantially complementary (at least about 65% complementary over a stretch of at least 14 to 25 nucleotides, preferably at least about 75%, more preferably at least about 90% complementary). See Kanehisa, M., Polynucleotides Res. (1984), 12:203, incorporated herein by reference. As a result, it is expected that a certain degree of mismatch at the priming site is tolerated. Such mismatch may be small, such as a mono-, di- or tri-nucleotide. In preferred embodiments, 100% complementarity is preferred.
[0138] Portions of CHl domain of human IgG can be synthesized. Exemplary sequences include SEQ ID NO: 8-15. Restriction enzyme sites (such as Xho 1) can be designed at the 3 '-end of the sequence. Sequences of SEQ ID NO: 8-15 are shown below. The Xho restriction site is underlined.
5'- etc gag gcc tec ace aag ggc etc gag-3' (SEQ ID NO: 8) 5'- gcctccaccaagggcccatc ggtcttcccc-3 ' (SEQ ID NO: 9) 5'-gcctccaccaagggcccatcggtcttccccctggcaccctcc-3' (SEQ ID NO: 10) 5'- gcctccaccaagggcccatcggtcttccccctggcaccctcctccaagag cacctctggg-3 ' (SEQ ID NO: 11) 5'-ggcacagcgg ccctgggctg cctggtcagg gactacttcc ccgaaccggt gacggtgtcg-3 ' (SEQ ID NO: 12) 5'-tggaactcag gcgccctgac cagcggcgtg cacaccttcc cggctgtcct acagtcctca-3 ' (SEQ ID NO: 13) 5'- ggactctact ccctcagcag cgtggtgacc gtgccctcca gcagcttggg cacccagacc-3 ' (SEQ ID NO: 14) 5'-tacatctgca acgtgaatca caagcccagc aacaccaagg tggacaagaa agtt-3' (SEQ ID NO: 15)
[0139] Portions of CHl domain of human IgG can be blunt end ligated to the 3'-end of camelid Vab domain sequence using methods well known in the art. See, Sambrook et al., Molecular Cloning: A Laboratory Manual (2nd Ed.) (1989), Cold Spring Harbor Press, N. Y. The ligated product will be analyzed and purified by agarose gel. The ligated product may be inserted into phage display vectors using standard methods. See, Sambrook et al., Molecular Cloning: A Laboratory Manual (2nd Ed.) (1989), Cold Spring Harbor Press, N. Y.
[0140] Plasmid library will be constructed using the PCR amplicons comprising Vab domains and all possible permutation and combination of all or portions of Hinge region (HR), constant domain 1 of heavy chain of human IgG (CHl), constant domain 2 of camelid or the constant domain 1 (CHl) shark heavy chain only antibody, or constant domain 2 CH2, constant domain 3 of camelid or shark heavy chain only antibody (CH3). In some embodiments, the amplicons may include domains from at least two different species such camelid and shark, or two different camelid species such as llama, camel, alpaca. Exemplary amplicons include but not limited to Vab-HR-CH2-CH3, Vab-HR, Vab-HR-CHl, Vab-CH2- CH3 + AA 45 (amino acid 45 is hydrophilic amino acids such as, Lys, His, Ser, Asn, GIn, Arg, GIn, GIu, Cys, Asp or Thr), Vab-HR-CH1+ AA 45, Vab-HR+AA 45, Vab-HR-Vab, Vab-HR-CHl-Vab, Vab-HR-CH2-Vab, Vab-HR- Vab-HR-Vab, Vab-HR-Vab-HR- Vab-HR- Vab.
Shark Antibodies and Analogs:
[0141] Sharks produce multiple IgG classes including heavy-chain only antibodies missing light-chains [Comp. Biochem. Physiol. B., J_5, 225 (1973)]. Shark heavy-chain only antibodies are also known as immunoglobulins new antigen receptors (IgNAR), their variable domain is designated as V-NAR. The CDR3 region of V-NAR domain is also significantly longer than that of conventional VH domains [Med. Microbiol. Immunol, 198, 157 (2009)].
[0142] The Ig-NAR protein has been found to be a dimer with each chain composed of one variable (V) and five constant (C) domains and shown as structure 2 in Fig. 1. The V regions of NAR proteins conforms to the model of prototypic Ig superfamily domains with the predicted canonical disulfide bond connecting two beta sheets and several other invariants or conserved residues involved in the structural packing. The V-NAR region has been found to be unique in that it has an exceptionally small CDR2 and poor conservation of those amino acid residues responsible for VH/VL domain in typical IgGs and T-cell receptors. Exemplary amino acid sequence of shark Ig-NAR is disclosed in GenBank accession number ABB83616. Sequence of which is incorporated herein by reference. Exemplary amino acid sequence of shark Ig-NAR is listed as SEQ ID NO: 16 and shown in Fig. 20.
[0143] The comparison of amino acid sequences of VH domains of conventional monoclonal antibody (mAb) with camel Vab and shark V-NAR is shown in the Fig. 16.
[0144] Exemplary nucleic acid sequence of shark IgNAR is disclosed in GenBank accession number DQ268538. Sequence of which is incorporated herein by reference. Exemplary sequence of shark IgNAR is listed as SEQ ID NO: 17 and shown in Fig. 21.
[0145] There are striking similarities in the structures of camelid and shark antibodies, in particular the variable regions (see structures 1 and 2) and shown in Fig. 16. Just like Vab of camel antibodies, V-NAR of shark antibodies is also independently stable and functionally active without being attached to the parent antibody. It is advantageous to develop and evaluate the following shark antibodies and their analogs for diagnostics, therapeutics and diagnostics with therapeutic (theranostic) applications. Generation of Shark Parent Antibody and Analogs
[0146] The sharks will be immunized with one or more antigens using the biomarkers associated with different diseases and/or organisms. Shark heavy chain only antibodies and their analogs can be generated by either by protease digestion, recombinant or chemical means. The analogs may be monovalent, divalent or multivalent (e.g., tri-, terra-, penta- valent).
Production of Shark Heavy Chain Only Antibodies and Their Analogs by Recombinant Means
[0147] Shark mRNA encoding heavy chain only antibodies will be isolated from the sharks with or without being immunized with one or more antigens using the biomarkers associated with different diseases and/or organisms. Various analogs will be generated by recombinant means using the standard methodology known in the art. See, Sambrook et al., Molecular Cloning: A Laboratory Manual (2nd Ed.) (1989), Cold Spring Harbor Press, N.Y. Various methods of extraction are suitable for isolating the DNA or RNA. Suitable methods include phenol and chloroform extraction. See Maniatis et al., Molecular Cloning, A Laboratory Manual, 2d, Cold Spring Harbor Laboratory Press, page 16.54 (1989). Numerous commercial kits also yield suitable DNA and RNA including, but not limited to, QIAamp™ mini blood kit, Agencourt Genfind™, Roche Cobas® Roche MagNA Pure® or phenol: chloroform extraction using Eppendorf Phase Lock Gels®, and the NucliSens extraction kit (Biomerieux, Marcy l'Etoile, France). In other methods, mRNA may be extracted using MagNA Pure LC mRNA HS kit and Mag NA Pure LC Instrument (Roche Diagnostics Corporation, Roche Applied Science, Indianapolis, IN). Other published protocols and commercial kits are available including, for example, Qiagen products such as the QiaAmp DNA Blood MiniKit (Cat.# 51104, Qiagen, Valencia, CA), the QiaAmp RNA Blood MiniKit (Cat.# 52304, Qiagen, Valencia, CA); Promega products such as the Wizard Genomic DNA Kit (Cat.# Al 620, Promega Corp. Madison, WI), Wizard SV Genomic DNA Kit (Cat.# A2360, Promega Corp. Madison, WI), the SV Total RNA Kit (Cat.# X3100, Promega Corp. Madison, WI), PolyATract System (Cat.# Z5420, Promega Corp. Madison, WI), or the PurYield RNA System (Cat.# Z3740, Promega Corp. Madison, WI).
[0148] Nucleic acid extracted can be amplified using nucleic acid amplification techniques well know in the art. Nucleic acid amplification can be linear or exponential. By way of example, but not by way of limitation these techniques can include the polymerase chain reaction (PCR) reverse transcriptase polymerase chain reaction (RT-PCR). Oligonucleotide primers for use in these methods can be designed according to general guidance well known in the art as described herein, as well as with specific requirements as described herein for each step of the particular methods described.
Amplification of Shark IgNAR Gene
[0149] All or portions of IgNAR gene can be amplified using different combinations of forward and reverse primers. Sequences of exemplary forward and reverse primers to amplify all or portions of shark IgNAR gene are shown below:
Forward Primers
5'-gcatgggtag accaaacaccaag-3 ' (SEQ ID NO: 18)
5 ' -gcgtcctcagagagagtcccta-3 ' (SEQ ID NO : 19)
5 '-gagacggacgaatcactgaccatc-3 ' (SEQ ID NO: 20)
5 ' - gggtagaccaaacaccaagaacagc-3 ' (SEQ ID NO : 21 ) Reverse Primers
5 '-gttctagccaataggaacgtatag-3 ' (SEQ ID NO: 22)
5'-gtttgcacaagagagtagtctttac-3' (SEQ ID NO: 23)
5 '-cctaaattgtcacagcgaatcatg-3 ' (SEQ ID NO: 24)
5 ' - gtgcagttccctagaagtcttg-3 ' (SEQ ID NO : 25)
Amplification of Shark VNAR-HR-CHl Domains:
[0150] All or portions of VNAR-HR-CHl region can be amplified using the various combinations of forward and reverse primers. Sequences of exemplary forward and reverse primers are shown below:
Forward Primers
5 '-gcatgggtag accaaacaccaag-3 ' (SEQ ID NO: 26)
5 ' -gcgtcctcagagagagtcccta-3 ' (SEQ ID NO : 27)
5 '-gagacggacgaatcactgaccatc-3 ' (SEQ ID NO: 28)
5'- gggtagaccaaacaccaagaacagc-3' (SEQ ID NO: 29)
Reverse Primers
5 '-cacctcttccgacatgaggtcc-3 ' (SEQ ID NO: 30)
S'-gattaaagaaaggaaaccaatgac-S' (SEQ ID NO: 31) 5'-cagctacaaaagtaactcccac-3' (SEQ ID NO: 32)
5'-gagagacaagaagtcaacgtctcat-3' (SEQ ID NO: 33)
Amplification of Shark VNAR-HR-CH1-CH2 Domains:
[0151] All or portions of VNAR-HR-CH 1-CH2 region can be amplified using the various combinations of forward and reverse primers. Sequences of exemplary forward and reverse primers are shown below:
Forward Primers
5'-gcatgggtag accaaacaccaag-3 ' (SEQ ID NO: 34)
5'-gcgtcctcagagagagtcccta-3' (SEQ ID NO: 35)
5'-gagacggacgaatcactgaccatc-3' (SEQ ID NO: 36)
5'- gggtagaccaaacaccaagaacagc-3 ' (SEQ ID NO: 37)
Reverse Primers
5 ' -ggtgagacggtgagaaggtgcg-3 ' (SEQ ID NO : 38)
5 ' -ggaagccaggaatggaaaggtag-3 ' (SEQ ID NO : 39)
5 ' -ccaaaggtaggtaaaatcgacg-3 ' (SEQ ID NO : 40)
5 ' -ggtctaaagaagttgactacctag-3 ' (SEQ ID NO : 41 )
Amplification of Shark VNAR-HR Domains
[0152] All or portions of VNAR-HR region can be amplified using the various combinations of forward and reverse primers. Sequences of exemplary forward and reverse primers are shown below:
Forward Primers
5 '-gcatgggtag accaaacaccaag-3 ' (SEQ ID NO: 42)
5'-gcgtcctcagagagagtcccta-3' (SEQ ID NO: 43)
5 '-gcatgggtag accaaacaccaag-3 ' (SEQ ID NO: 44)
Reverse Primers
5 '-ccacctcttccgacatgaggtcc-3 ' (SEQ ID NO: 45)
5 '-ctcatttcatctgactactgacc-3 ' (SEQ ID NO: 46)
5 ' -tcttccgaacatgaggtccaaagtg-3 ' (SEQ ID NO : 47) Developing Analogs of Single Domain Heavy-Chain Antibodies by Chemical Means
[0153] Analogs may also be generated by chemical and enzymatic treatment of camelid heavy chain only antibodies and analogs thereof. The analogs may be monovalent, divalent or multivalent (e.g., tri-, terra-, penta- valent). Series of novel analogs of heavy-chain antibodies may be generated by chemical means or enzymatic means. Exemplary methods are disclosed in Fig. 8-14 and 17-19.
[0154] In one embodiment, camelid and shark heavy chain only antibodies (structures 1 and ^respectively) will be purified using standard methods of purifying antibodies. Exemplary method of antibody purification is shown in Example 12. Camelid and shark heavy chain only antibodies will then be used to develop several analogs by chemical techniques.
[0155] Protease digestion: In one embodiment, camelid and shark heavy chain only antibodies structures 1 and 2_will be treated with Tris-carboxyethyl phosphine (TCEP) to generate single chain analog of structure Ia and 52 respectively. Alternatively, camelid and shark heavy chain only antibody can be treated with reducing agents such as beta mercaptoethanol or dithiothreitol. In another embodiment, the single chain analog (structures Ia and 52) can be treated with proteolytic enzymes such as pepsin, trypsin or papain to generate analogs of smaller size. For example, single chain analog can be treated with pepsin under controlled condition to generate an analog of structure of structure Ib and 55. In another embodiment, the pepsin digests (structures Ib and 55) can be further subjected to proteolytic treatment, such as with trypsin to generate a smaller fragment such as structures Ic and 53. In another embodiment, structure 53 can be further fragment by protease digest such as pepsin, trypsin, papain under controlled condition to generate shark heavy chain only antibody analog comprising all or portions of NAR and all or portions of HR domains, such as structure 72.
[0156] Chemical methods: Commercial kits are available for protein conjugation, protein crosslinking. Crosslinking can be done with or without spacers of various lengths. Crosslinking can be done for example, between two primary amines using commercially available reagents (e.g., BS(PEG)9, BS(PEG)5, EGS, BSOCOES, DSP, DSG, from Thermo Scientific, Rockford, IL), between a primary amine and a sulfhydryl group using commercially available reagents (e.g., SM(PEG)24, SM(PEG)12, LC-SMCC, Sulfo-SMCC, Sulfo-LC-SPDP, Sulfo-EMCS, SMCC, from Thermo Scientific, Rockford, IL). Proteins can be derivatized to generate new functional groups. For example, N-hydroxysulfosuccinimide (Sulfo-NHS) and its uncharged analog N-hydroxysuccinimide (NHS) are used to convert carboxyl groups to amine -reactive Sulfo-NHS esters. Traut's reagent can be used to generate a sulfhydryl group. Proteins can be pegylated using commercially available reagents. For example, SM(PEG)n, BS(PEG)9, BS(PEG)5 from Thermo Scientific, Rockford, IL.
Genetically Modifying Host Cells by Introducing Recombinant Nucleic Acid
[0157] The recombinant nucleic acid (e.g., cDNA or genomic DNA) encoding at least a portion of a polypeptide may be introduced into host cells thereby genetically modifying the host cell. Host cells may be used for cloning and/or for expression of the recombinant nucleic acid. Host cells can be prokaryotic, for example bacteria. Host cell can be also be eukaryotic which includes but not limited to yeast, fungal cell, insect cell, plant cell and animal cell. In one embodiment, the host cell can be a mammalian cell. In another embodiment host cell can be human cells. Host cells may comprise wild-type genetic information. The genetic information of the host cells may be altered on purpose to allow it to be a permissive host for the recombinant DNA. Examples of such alterations include mutations, partial or total deletion of certain genes, or introduction of non-host nucleic acid into the host cell. Host cells may also comprise mutations which are not introduced on purpose.
[0158] Several methods are known in the art to introduce recombinant DNA in bacterial cells that include but are not limited to transformation, transduction, and electroporation, see Sambrook, et al., Molecular Cloning: A Laboratory Manual (1989), Second Edition, Cold Spring Harbor Press, Plainview, NY. Non- limiting examples of commercial kits and bacterial host cells for transformation include NovaBlue Singles™ (EMD Chemicals Inc, NJ, USA), Max Efficiency® DH5α™, One Shot® BL21 (DE3) E. coli cells, One Shot® BL21 (DE3) pLys E. coli cells (Invitrogen Corp., Carlsbad, CA, USA), XLl-Blue competent cells (Stratagene, CA, USA). Non limiting examples of commercial kits and bacterial host cells for electroporation include Zappers™ electrocompetent cells (EMD Chemicals Inc, NJ, USA), XLl-Blue Electroporation-competent cells (Stratagene, CA, USA), ElectroMAX™ A. tumefaciens LBA4404 Cells (Invitrogen Corp., Carlsbad, CA, USA).
[0159] Several methods are known in the art to introduce recombinant nucleic acid in eukaryotic cells. Exemplary methods include transfection, electroporation, liposome mediated delivery of nucleic acid, microinjection into to the host cell, see Sambrook, et al., Molecular Cloning: A Laboratory Manual (1989), Second Edition, Cold Spring Harbor Press, Plainview, NY. Non- limiting examples of commercial kits and reagents for transfection of recombinant nucleic acid to eukaryotic cell include Lipofectamine™ 2000, Optifect™ Reagent, Calcium Phosphate Transfection Kit (Invitrogen Corp., Carlsbad, CA, USA), GeneJammer® Transfection Reagent, LipoTAXI® Trasfection Reagent (Stratagene, CA, USA). Alternatively, recombinant nucleic acid may be introduced into insect cells (e.g. sf9, sf21, High Five™) by using baculo viral vectors.
[0160] Selected positive clones will be used to subclone in both eukaryotic and prokaryotic expression vectors used standard methods known in the art. Exemplary eukaryotic expression vectors include expression vector pCMV SPORT (Invitrogen, Carsbad, CA), pExchange, pCMV-Script, pCMV-Tag (Stratagene). Exemplary prokaryotic expression vectors include pET expression vectors (Novagen®).
Protein Purification:
[0161] Proteins from samples can be isolated using techniques that are well-known to those of skill in the art. The protein isolation methods employed can, e.g., be including, but not limited to, e.g., those described in Harlow & Lane, Antibodies: A Laboratory Manual (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1988), US Patent 6005079, 5759808,. In some embodiments, an antigen protein is extracted from the acellular body fluid sample. Plasma purification methods are known in the art as such. See e.g., Cohn, E.J., et ah, Am. Chem. Soc, 62:3396-3400.(1940); Cohn, E.J., et ah, J. Am. Chem. Soc, 72:465-474 (1950); Pennell, R.B., Fractionation and isolation of purified components by precipitation methods, pp. 9-50. In The Plasma Proteins, Vol. 1, F.W. Putman (ed.). Academic Press, New York (1960); and US Patent No. 5,817,765. In brief, total IgGs will be precipitated from camelid or shark serum using 5M ammonium sulfate. The precipitated mixture of IgGs will be size fractionated on a long (200 cm x 1 cm) Sephadex -G-50 or G- 200 column to fractionate 90 K Da camel mini-antibody from 150 K Da conventional IgG. Any residual contamination of conventional IgG can be removed by magnetic beads coated with protein-G. If needed,. Final purification can be done by affinity purification. The same protocol for isolation and purification of shark mini-antibodies will be used after treating the precipitated total shark IgGs with TCEP.
Characterization of Camelid and Shark Heavy-Chain Only Antibodies and Analogs
[0162] Characterization of the camelid and shark heavy-chain only antibodies and analogs will be done with ELISA, Affinity Determination and Western Blot assays: [0163] ELISA Assay: The specificity and reactivity of the camelid and shark heavy-chain only antibodies and analogs towards the natural and synthetic antigens will be determined using ELISA. ELISA assays will be performed with pre-made reagents purchased from vendors such as Pierce, Sigma, etc., following vendor protocol, using appropriate negative and positive controls will be also be used.
[0164] Affinity Determination: 96-Microwell plates will be coated with heavy-chain only antibodies and their analogs, and conventional mouse monoclonal antibody (as a control) in different concentrations (for example, 1, 20, 40. 80, 160 ng/ul), and will be blocked with BSA overnight. The blocked antibody will be reacted with the peptide antigen conjugated to HRP for 1-2 hours at 37°C. After thoroughly washing the plate with a plate washer with IX PBS containing 0.5% NP-40, enzyme substrate will be added and the plate incubated at RT for 1-2 hours. The optical density of the color generated will be read at an appropriate wave length. The affinity will then be calculated using the method of Beatty et al [J. Immunol. Methods, 100, 173 (1987)].
[0165] Western Blot Assay: Western blot will be performed using methods known in the art. See, Harlow & Lane, Antibodies: A Laboratory Manual (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1988); Sambrook et al., Molecular Cloning: A Laboratory Manual (2nd Ed.) (1989), Cold Spring Harbor Press, N. Y.
Immobilization of Antibodies onto Solid Supports:
[0166] The antibody or a sample may be immobilized on a carrier or solid support by covalent or non-covalent means. Immobilization of the antibodies or its analogs to the solid support may be done prior to, subsequent to, or simultaneously with binding to an antigen. Well-known supports or carriers include, but are not limited to, e.g., glass, microchannels, microfluidic device , polystyrene, polypropylene, polyethylene, latex, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, gabbros, nanop articles, gold, and magnetite. The support material may have any possible configuration including spherical {e.g. bead), cylindrical {e.g. inside surface of a test tube or well, or the external surface of a rod), or flat {e.g. sheet, test strip).
[0167] In preferred embodiments, the solid surface is a bead. In some embodiments, beads or microparticles are substantially the same size. In other embodiments, beads or microparticles are of one or more sizes. In one embodiment, the beads or microparticles may be magnetic. In some embodiments, the preferred surface is microchannels made of glass or any other suitable matrix. These beads or microparticles may be composed of, for example, polystyrene, gold or latex. Beads or microparticles may be approximately 0.1 μm - 10 μm in diameter or may be as large as 50 μm - lOOμm in diameter, however, smaller and larger bead sizes are possible.
[0168] In one embodiment, the solid surface is a streptavidin coated bead. Streptavidin coated beads are available commercially e.g., from Bang laboratories (Catalog No. 214, 217), EMD Biosciences (Catalog No. 70716-3, 70716-4), Dynal beads from Invitrogen Corporation (Catalog No. 658-01D, 602-10).
[0169] In some embodiments, the solid surfaces may have functional groups capable of covalently linking the antibodies or its analogs directly or indirectly through chemical linkers. Examples of functional groups include but not limited to poly L-lysine, aminosilane, epoxysilane, aldehydes, amino groups, epoxy groups, cyano groups, ethylenic groups, hydroxyl groups, thiol groups.
[0170] A preferred method of non-covalently immobilizing antibodies or their analogs to the solid surface is via a "binding pair," which refers herein to two molecules which form a complex through a specific interaction. Thus, the antibodies or its analogs can be captured on the solid support through an interaction between one member of the binding pair linked to the antibodies or its analogs and the other member of the binding pair coupled to the solid support.
[0171] In a preferred embodiment, the binding pair is biotin and avidin, or variants of avidin such as streptavidin, NeutrAvidin™. The solid surface may comprises streptavidin or its variants and the antibodies or its analogs may be modified to consist of biotin. Methods for biotinylating antibodies or its analogs are known in the art (e.g. through primary amine by NHS-PEO 12-Biotin, NHS-LC-LC-Biotin, NHS-SS-PEO4-Biotin from Pierce Chemical Co.; through sulfhydryl group by Maleimide-PEOl 1 -Biotin, Biotin-BMCC Sulfhydryl, Iodacetyl- PEO2-Biotin).
[0172] In other embodiments, the binding pair consists of a ligand-receptor, a hormone- receptor, an antigen-antibody. Examples of such binding pair include but are not limited to digoxigenin and anti-digoxigenin antibody; 6-(2,4-dinitrophenyl) aminohexanoic acid and anti-dinitrophenyl antibody; 5-Bromo-dUTP (BrdUTP) and anti-BrdUTP antibody; N-acetyl 2-aminofluorene (AAF) and anti-AAF antibody. [0173] In another embodiment, the antibodies or their analogs may be anchored to the solid support covalently though chemical coupling using chemical linkers. If covalent bonding between the antibodies or their analogs and the surface is desired, the solid surface will usually be functional or be capable of being functionalized. Examples of functional groups used for linking include but are not limited to carboxylic acids, aldehydes, amino groups, cyano groups, ethylenic groups, hydroxyl groups, thiol groups. In one embodiment, the antibodies and their analogs can be covalently attached to the solid surface derivatized with primary amines through the sulfhydryl group using Sulfo-SMCC using manufacturer's protocol (Pierce Chemical Co.). Alternatively, sulfhydryl group can be introduced into the antibodies and their analogs using Traut's reagent or SATA (Pierce Chemical Co.) and such sulfhydryl group can be used to covalently link with the amine on the solid surface.
[0174] In some embodiments, the solid support may be coated with epoxy group, amino group, mercapto group, polylysine. Coated solid supports are available commercially e.g., beads coated with functional groups are available from Invitrogen Corporation, BD Biosciences; glass slides coated with functional groups are available from Pierce, Asper Biotech, Full Moon Biosystems, ThermoFisher Inc.
Detectable Labels:
[0175] Antibodies may be detectably labeled by methods known in the art. Labels include, radioisotopes, enzymes (e.g., peroxidase, alkaline phosphatase, beta-galactosidase, luciferase, alkaline phosphatase, acetylcholinesterase and glucose oxidase), enzyme substrates, luminescent substances (e.g., luminol), fluorescent substances (e.g., FITC, rhodamine, lanthanide phosphors), biotinyl groups (which can be detected by marked avidin e.g., streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods), predetermined polypeptide epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags) and colored substances. In binding these labeling agents to the antibody, the maleimide method (Kitagawa, T., et al., J. Biochem., 79:233-236 (1976)), the activated biotin method (Hofmann, K., et al., J. Am. Chem. Soc, 100:3585 (1978)) or the hydrophobic bond method, for instance, can be used.
[0176] Detectable labels include but are not limited to fluorophores, isotopes (e.g. 32P, 33P5 35S, 3H, 14C, 125I, 131I), electron-dense reagents (e.g., gold, silver), nanoparticles, enzyme? (e.g., peroxidase, alkaline phosphatase, beta-galactosidase, luciferase, alkaline phosphatase, acetylcholinesterase and glucose oxidase), enzyme substrates, luminescent substances (e.g., luminol), chemiluminiscent compound, colorimetric labels (e.g., colloidal gold), magnetic labels (e.g. , Dynabeads™), biotin, digoxigenin, haptens, proteins for which antisera or monoclonal antibodies are available, ligands, hormones, oligonucleotides capable of forming a complex with the corresponding oligonucleotide complement.
[0177] In a preferred embodiment, the detectable label is a fluorophore. The term "fluorophore" as used herein refers to a molecule that absorbs light at a particular wavelength (excitation frequency), and subsequently emits light of a different, typically longer, wavelength (emission frequency) in response. In one embodiment, the detectable label is a donor fluorophore in close proximity of a quencher moiety.
[0178] Suitable fluorescent moieties include but are not limited to the following fluorophores working individually or in combination:
4-acetamido-4'-isothiocyanatostilbene-2,2'disulfonic acid; acridine and derivatives: acridine, acridine isothiocyanate; Alexa Fluors: Alexa Fluor® 350, Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 555, Alexa Fluor® 568, Alexa Fluor® 594, Alexa Fluor® 647 (Molecular Probes); 5-(2'-aminoethyl)aminonaphthalene-l-sulfonic acid (EDANS); 4-amino-N-[3- vinylsulfonyl)phenyl]naphthalimide-3,5 disulfonate (Lucifer Yellow VS); N-(4-anilino-l- naphthyl)maleimide; anthranilamide; Black Hole Quencher (BHQ ) dyes (biosearch Technologies); BODIPY dyes: BODIPY® R-6G, BOPIPY® 530/550, BODIPY® FL; Brilliant Yellow; coumarin and derivatives: coumarin, 7-amino-4-methylcoumarin (AMC, Coumarin 120),7-amino-4-trifluoromethylcouluarin (Coumarin 151); Cy2®, Cy3®, Cy3.5®, Cy5®, Cy5.5®; cyanosine; 4',6-diaminidino-2-phenylindole (DAPI); 5', 5"-dibromopyrogallol- sulfonephthalein (Bromopyrogallol Red); 7-diethylamino-3-(4'-isothiocyanatophenyl)-4- methylcoumarin; diethylenetriamine pentaacetate; 4,4'-diisothiocyanatodihydro-stilbene-2,2'- disulfonic acid; 4,4'-diisothiocyanatostilbene-2,2'-disulfonic acid; 5- [dimethylamino]naphthalene-l-sulfonyl chloride (DNS, dansyl chloride); 4-(4'- dimethylaminophenylazo)benzoic acid (DABCYL); 4-dimethylaminophenylazophenyl-4'- isothiocyanate (DABITC); Eclipse™ (Epoch Biosciences Inc.); eosin and derivatives: eosin, eosin isothiocyanate; erythrosin and derivatives: erythrosin B, erythrosin isothiocyanate; ethidium; fluorescein and derivatives: 5-carboxyfluorescein (FAM), 5-(4,6-dichlorotriazin-2- yl)amino fluorescein (DTAF), 2',7'-dimethoxy-4'5'-dichloro-6-carboxyfluorescein (JOE), fluorescein, fluorescein isothiocyanate (FITC), hexachloro-6-carboxyfluorescein (HEX), QFITC (XRITC), tetrachlorofluorescein (TET); fluorescamine; IR144; IR1446; lanthamide phosphors; Malachite Green isothiocyanate; 4-methylumbelliferone; ortho cresolphthalein; nitrotyrosine; pararosaniline; Phenol Red; B-phycoerythrin, R-phycoerythrin; allophycocyanin; o-phthaldialdehyde; Oregon Green®; propidium iodide; pyrene and derivatives: pyrene, pyrene butyrate, succinimidyl 1 -pyrene butyrate; QSY® 7; QSY® 9; QS Y® 21; QSY® 35 (Molecular Probes); Reactive Red 4 (Cibacron® Brilliant Red 3B-A); rhodamine and derivatives: 6-carboxy-X-rhodamine (ROX), 6-carboxyrhodamine (R6G), lissamine rhodamine B sulfonyl chloride, rhodamine (Rhod), rhodamine B, rhodamine 123, rhodamine green, rhodamine X isothiocyanate, riboflavin, rosolic acid, sulforhodamine B, sulforhodamine 101, sulfonyl chloride derivative of sulforhodamine 101 (Texas Red); terbium chelate derivatives; N,N,N',N'-tetramethyl-6-carboxyrhodamine (TAMRA); tetramethyl rhodamine; tetramethyl rhodamine isothiocyanate (TRITC). Medical Applications:
Development of Nano-biomedical Technology Platforms Using Heavy-Chain Antibodies and Analogs:
[0179] Novel analogs of single-domain heavy-chain only camelid and shark antibodies can be used for developing Nano-biomedical Technology Platforms to overcome problems of the conventional antibodies: i)the conventional antibodies neither have the specificity, nor sensitivity, nor thermal and chemical stability that allows the use of stringent assay development conditions to optimize detection sensitivity and specificity; ii) they are unable to cross cell membrane and blood brain barrier (BBB); iii) they are immunogenic; and iv) high toxicity due to cross-reactivity. The shark and camelid antibodies, particularly, their analogs do not have the shortcomings of conventional mAbs. First, these antibodies are small enough to cross cell and BBB to diagnose and treat most diseases that so far have been impossible to diagnose and treat without invasive and risky procedures. Second, they are highly specific and have very little to none cross-reactivity. Third, these antibodies have extremely low immunogenicity, and can be further humanized to take care of any residual toxicity.
[0180] Biodistribution studies in solid tumors have shown that whole IgG molecules are too large to enter the cell while the smaller antigen-binding camel Vab fragments (MW ~ 12-17 KDa) rapidly clears from the body [Nature Medicine, 9, 129 (2003)]. So the large molecular weight (-150 KDa) and small molecular weight (~15 KDa) biological molecules are not suitable for treating diseases of the brain and cancer. The best tumor targeting reagents comprise an intermediate-sized multivalent molecules (MW-55 KDa), providing rapid tissue penetration, high target retention, and rapid blood clearance [Nature Medicine, 9, 129 (2003)]. That is why, most of the analogs of shark and camelid heavy chain antibodies of this application have been carefully designed so as to have molecular weight in the range of 30 to 60 KDa for optimal biodistribution and retention, though analogs with molecular weight between 60 to 90 KDa will also be studied to explore their hitherto unknown and unstudied properties to cross cell membrane and BBB.
Applications of Shark and Camelid Heavy Chain Only Antibodies and Their Analogs
[0181] Shark and camelid heavy chain only antibodies and their analogs can be used in diagnostics, therapy and simultaneous diagnosis and treatment. Exemplary areas of applications include:
1. In-Vitro Diagnostics: a. Immunodiagnostics of human diseases b. DNA-Probes Based Diagnostics of human diseases.
2. In-vivo Diagnostics a. Neuroimaging and whole body scan
3. Rare Cell Capture a. Circulating Tumor Cells (CTCs) for interrogation b. Circulating fetal cells for non-invasive prenatal diagnosis of genetic disorders
4. Integrated Diagnostics and Therapeutics (Theranostics) a. Cancer b. Neurodegenerative diseases c Brain cancer and brain disorders d. Diseases of immune disorder e. Infectious diseases f. Metabolic diseases g Biological warfare, Anthrax, SARS etc. h. Cardiac diseases
5. Drug Transport
[0182] Exemplary applications of the shark and camelid heavy chain only antibodies and their analogs in diagnosing, treating, and simultaneous diagnosis and treatment are shown in Examples 18-22 and Fig. 25-29. Neuro-Imaging and Whole Body Scan
[0183] Since shark and camelid antibodies are known to cross cell wall and blood brain barrier, shark and camelid heavy chain only antibodies and their analogs against the biomarkers of brain diseases and the cytoplasmic markers of cancer will be useful in scanning the whole body for early detection of cancer, Alzheimer's disease, Parkinson's disease and other brain diseases. For example, breast and lung cancers can be screened and diagnosed with a mixture of nano-antibodies against HER-2, p53, EGFR, and Ras. Brain cancer and Alzheimer's diseases can be detected and treated, in principle, with BBB permeable mixture of nano-antibodies against TEMl (tumor endothelial marker- 1) , amyloid-β42, , Tau protein, beta- and gamma-secretases. [0184] Neuroimaging of brain diseases will be done with detectably labeled (e.g., radiolabel) antibodies and their analogs which will be administered intravenously and detected using appropriate methodology for example, the brain scanned under PET scanner after a short time thereafter.
Capture of Circulating Fetal Cells for Non-Invasive Prenatal Diagnosis of Genetic Disorders
[0185] In one embodiment, fetal cells from the blood of pregnant women will be captured with shark and camelid heavy chain only antibodies and their analogs against the fetal cell surface antigens such as, CD71, glycophorin -A (GPA), CD133, CD34, HLA-G233, and Trop-1, which is/are bound to solid matrixes such as micro-channels and beads. The red blood cells will be lysed using commercial RBC lysis buffer. The cells will then be pelleted and passed through micro-fluidic device coated with a mixture of the above antibodies. The captured cells will be analyzed by FISH probes for chromosomes 21, 13 and 18. Exemplary schematics of the capture of circulating fetal cells by shark and camelid heavy chain only antibodies and their analogs is shown in Fig. 29.
Detecting Cell-Free Tumor DNA:
[0186] In one embodiment, shark and camelid heavy chain only antibodies and their analogs can be used in isolation of cell free nucleic acids circulating in bodily fluids, blood, marrow, urine, saliva, CSF and cervical mucus. It is known that cell free DNA is elevated in the blood of cancer patients [T.L. Wu, et al, Clin. Chim. Acta., 321, 77 (2002)]. Though the cell free DNA in blood is known for many years, its clinical utility has not been established in spite of the fact that cell- free DNA has exhibited all the characteristics as the tumor DNA [P. Anker, et al., Cancer Metastasis Rev.,J_8, 65 (1999)]. Accordingly, shark and camelid heavy chain only antibodies and their analogs can be used, for example tumor biomarkers. against HER-2 (implicated in breast cancer), TMRESS2-ERG gene (implicated in prostate cancer), K-ras (pancreatic carcinoma) will provide a non-invasive method for diagnosing these diseases without undergoing invasive painful biopsies.
Shark and Camelid Heavy Chain Only Antibodies and Their Analogs in Diagnostics and Therapy
[0187] Shark and camelid heavy chain only antibodies and their analogs have tremendous potential to overcome the shortcomings of classical antibodies such as lack of specificity, toxicity, immunogenicity and inability to cross cell membrane and BBB. Their smaller size, unusual stability to low pH and high temperatures, higher binding affinity, very little to none cross -reactivity but above all, their ability to cross cell-membrane and BBB make these molecules the most versatile molecules of this century for medical diagnostics and therapeutics. Generation of shark and camelid heavy chain only antibodies and their analogs against all known biomarkers and therapeutic targets will dramatically improve the medical benefits of antibodies. Their ability to enter the cell and cross BBB provides for the first time ever an opportunity to develop simultaneous diagnosis and treatment (theranostics) of human diseases.
Diagnostic Markers:
[0188] Camelid or shark can be immunized with the pathogenic proteins associated with the disease discussed above. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be made from the parent single-domain heavy-chain only antibodies using various methods such as, protease digestion, recombinant DNA technology and chemical means as described above. Such antibodies and their analogs can be used in in-vitro diagnostics of human diseases, capture of circulating fetal cells for prenatal diagnosis, and capture of tumor cells for studying gene expression of key proteins pre- and post treatment.
Prostate Cancer:
[0189] Prostate cancer is a disease in which cancer develops in the prostate, a gland in the male reproductive system. Rates of prostate cancer vary widely across the world. According to the American Cancer Society, prostate cancer is least common among Asian men and most common among black men, with figures for European men in-between. However, these high rates may be affected by increasing rates of detection. Prostate cancer develops most frequently in men over fifty. It is the most common type of cancer in men in the United States, where it is responsible for more male deaths than any other cancer, except lung cancer. However, many men who develop prostate cancer never have symptoms, undergo no therapy, and eventually die of other causes.
[0190] Camelid or shark can be immunized with the biomarkers associated with prostate cancer. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be made using various methods such as, protease digestion, recombinant DNA technology and chemical means as described above. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be used in diagnosis, prognosis and/or treatment of prostate cancer. Exemplary prostate cancer biomarkers are shown in Table 2.
Table 2: Biomarkers s Associated with Prostate Cancer
Figure imgf000049_0001
Figure imgf000050_0001
Figure imgf000051_0001
Breast Cancer:
[0191] Breast cancer is a cancer of the breast tissue. Worldwide, it is the most common form of cancer in females - affecting, at some time in their lives, approximately 192,000 new cases of breast cancer will be diagnosed in the US in 2009, and estimated 41,000 women will lose their lives to the disease this year. According to the United Nations World Health Organization, it is the leading cause of cancer deaths among women in the US and worldwide. Because the breast is composed of identical tissues in males and females, breast cancer also occurs in males, though it is far less common.
[0192] Came lid or shark can be immunized with the biomarkers associated with breast cancer. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be made using various methods such as, protease digestion, recombinant DNA technology and chemical means as described above. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be used in diagnosis, prognosis and/or treatment of breast cancer. Exemplary breast cancer biomarkers are shown below:
PIP: highly expressed for breast cancer. It has been identified in most breast cancer biopsies.
SCGB2A1 : found in breast tumors.
SCGB 1D2: highly expressed in breast tumor.
SBEM protein: expressed in >90% of invasive ductal carcinoma. ESRl : is expressed in about 67% of all breast cancers and thus is known as the main discriminator in breast tumor classification. ESRl is the main mediator of endocrine therapy, Tamoxifen, and its detection in breast tumors is thus of considerable clinical significance.
NKRD30A, C-B726P, NY-BR-I.
6-PGDH-HCAb (6-phosphogluconate dehydrogenase)
• A better prognostic indicator in primary breast cancer than estrogen receptor status. PMID: 3797962
17HSD-HCAb (17beta-hydroxysteroid dehydrogenase type 1)
• An independent prognostic marker in breast cancer. PMID: 15492288 17HSD 14-HCAb
• A prognostic marker in estrogen receptor-positive breast cancer. PMID: 17145895 44-3A6-HCAb
• May serve as an important marker in the differentiation of normal breast epithelium into an atypical or malignant lesion. PMID: 1660186 aHIF-HCAb
• In our series of breast cancer patients, aHIF, and not HIF-I alpha transcript, is a marker of poor prognosis. PMID: 14580258
AP-HCAb for Alkaline Phosphatase (ALP)
• Skeletal ALP could represent a valid marker for bone metastases in association with mucinous markers in the follow-up of patients operated for breast cancer. PMID: 7629426
BRCAl-HCAb
• A marker for inherited breast and ovarian cancers. BRCA2-HCAb
• A marker for inherited breast and ovarian cancers.
Alpha-Lactalbumin-HCAb
• Serum levels of alpha-lactalbumin may be useful as a marker for monitoring breast cancer. PMID: 2337516
AMAS-HCAb (anti-malignin antibody in serum)
• More sensitive (97%) in detecting breast cancer than CEA (0%), CA 15-3 (10%), CA 19-5 (5%) or CA 125 (16%) in the same patients. PMID: 10680591
AR-HCAb for Androgen Receptor (AR) • AR immunohistochemistry could serve as a marker to increase sensitivity for identifying breast cancer in skin metastasis of unknown primary sites. PMID: 10697267
ANX7-HCAb for ANX7
• Has prognostic value for predicting survival of breast cancer patients, is a bio- marker in prostate and breast cancer progression. PMID: 11673658
Bcl-2-HCAb for detecting Bcl-2.
• An independent predictor of breast cancer outcome and seems to be useful as a prognostic adjunct to the NPI, particularly in the first 5 years after diagnosis. PMID: 16638854
Beta 1-6 branched oligosaccharides-HCAb
• A marker of tumor progression in human breast and colon neoplasia. PMID: 1985789
Beta-Catenin
• Can be involved in breast cancer formation and/or progression and may serve as a target for breast cancer therapy. PMID: 10759547
BNIP3-HCAb for BNIP
• A progression marker in primary human breast cancer; opposing functions in in- situ versus invasive cancer. PMID: 17255267
CA IX-HCAb for detecting CAlX
• A marker of poor prognosis in premenopausal breast cancer patients and it is an independent predictor of survival in patients with one to three positive lymph nodes. PMID: 17085655
CAXII- HCAb for Carbonic Anhydrase XII (CA- 12)
• A marker of good prognosis in invasive breast carcinoma. PMID: 12671706 CA 15.3-HHCAb for CAl 5-3
• Can predict survival in primary breast cancer. PMID: 12452445
• Most widely used as a serum tumor marker in follow-up and detection of breast cancer recurrence. PMID: 11192831
• Highly useful in the diagnosis, differential diagnosis, and monitoring of metastases and recurrences of breast cancer, and is superior to CEA. PMID: 10920962
• A tumor marker associated with mammary tumors. PMID: 1563679 • Significantly better than CEA in the detection of breast cancer metastases. PMID: 2065278
• May thus be the first independent prognostic serum marker in breast cancer. PMID: 11192829
CA27.29-HHCAb for CA27.29
• Suitable for routine use in the management of patients with breast cancer. PMID: 11239757
CA549-HHCAb for CA549
• A new tumor marker for breast cancer. PMID: 8479100
• A marker for breast cancer. PMID: 8160638 CaR-HCAb for calcium-sensing receptor
• Expression is common in a selected group of patients with advanced primary breast cancers. PMID: 16564154
Carcinoembryonic antigen-HCAb for CEA
• CEA monitoring should be considered an expensive and inefficient method of follow-up evaluation for breast cancer patients, and it provides no additional value when used in combination with CA 15.3. PMID: 11489813
CD24-HCAb for CD24
• CD24 expression in primary breast cancer as detected by immunohistochemistry might be a new marker for a more aggressive breast cancer biology. PMID: 14581365
• A useful marker for human breast carcinoma and play a role in facilitating metastasis by the interaction between tumor cells and platelets or endothelial cells. PMID: 10465342
CD44-HHCAb for CD44s
• CD44s detection by immunohistochemistry is useful in distinguishing intraductal papillomas from papillary carcinomas of the breast. PMID: 10690183
C-erbB2-HHCAb for C-erbB2 oncoprotein
• Prognostic marker in breast cancer. PMID: 16286993
• Overexpression of c-erbB2 in the primary tumor is an independent marker of relative resistance to first-line endocrine therapy in patients with advanced breast cancer. PMID: 10098763
CK-BB-HCAb for Creatine kinase-BB • CSF activity of CK-BB appears to be a contribution in the diagnosis of MC secondary to breast cancer and seems superior to protein and LDH. PMID: 2632253
Cyclin A-HCAb for Cyclin A
• A good marker for tumor proliferation and prognosis in breast cancer. PMID: 16091759
Cyclin E-HCAb for Cyclin E
• In breast cancer, the alterations in cyclin E expression become progressively worse with increasing stage and grade of the tumor, suggesting its potential use as a new prognostic marker. PMID: 7903908
CYFRA 21-1-HCAb for cytokeratin-19 fragments
• A useful tumor marker for detecting disease relapse and assessing treatment efficacy in breast cancer. PMID: 15280913
D2-40-HCAb for D2-40 antigen
• Identifies lymphatic invasion in breast tumors and is a significant predictor of outcome in breast cancer. PMID: 17206106
DAP-kinase-HCAb for death associated protein-kinase
• Loss of DAP -kinase expression negatively correlates to survival and positively correlates to the probability of recurrence in a very significant manner. DAP- kinase thus constitutes a novel and independent prognosis marker for breast cancer. PMID: 15131053
Endoglin-HCAb for CD 105
• A marker of breast carcinoma-induced neo-vascularization. PMID: 9858949 ER-beta-HCAb for estrogen receptor beta
• ER-alpha is more dysregulated in breast cancer, and thereby ER-beta is more tightly regulated in the tumor. PMID: 16289616
ErbB-2-HCAb for C-erbB-2 oncogene protein
• A prognostic marker of breast carcinoma, and serum ErbB-2 is a preoperative prognostic marker and may be useful for monitoring tumor recurrence of the breast. PMID: 17044019
• The determination of ErbB-2 in tissue extracts of breast carcinoma may be useful for assessing c-erbB-2 protein expression in the primary tissue and indicates that serum ErbB-2 may be a sensitive marker for monitoring tumor relapse. PMID: 10956406 Ets- 1-HCAb for Ets- 1 antigen
• A strong, independent predictor of poor prognosis in breast cancer. PMID: 12466970
EZH2-HCAb for enhancer of zeste homologue 2
• A marker of aggressive breast cancer. PMID: 16489070
• Significantly associated with increased tumor cell proliferation and is a marker of aggressive breast cancer. PMID: 16489070
• A marker of aggressive breast cancer and promotes neoplastic transformation of breast epithelial cells. PMID: 14500907
Ferritin-HCAb for Ferritin
• A marker of therapeutic response in stage III and IV breast cancer. PMID: 2137790
GATA3-HCAb for GATA3
• May be the basis for a new clinically applicable test to predict tumor recurrence early in the progression of breast cancer. PMID: 16357129
GCDFP- 15-HCAb for GCDFP- 15
• A specific marker for breast cancer and is superior to ALA in this respect. PMID: 2542151
GCDFP-24-HCAb for GCDFP-24
• Could well be a good biochemical marker for monitoring the response to androgenic and antiestrogenic compounds in the therapy of advanced breast cancer. PMID: 2351114
Glut- 1-HCAb for Glut- 1
• TMA analysis for Glut-1 expression may be useful to predict disease free survival but it does not predict race specific recurrence. PMID: 16228617
GST-HCAb for glutathione S-transferase
• Measurement of GST Bl or GST B2 in lung lavage fluid could be a useful aid in the diagnosis of lung malignancy. PMID: 2302756
HER2/Neu-HCAb for HER2/Neu
• A predictor of prognosis in breast cancer and a potential marker for selecting the optimal adjuvant chemotherapy. PMID: 16137437 • An important independent prognostic factor in early stage breast cancer. PMID: 10066073
• Coexistence of HER2 over-expression and p53 protein accumulation is a strong prognostic molecular marker in breast cancer. PMID: 14680497
HSP70-HCAb for HSP70
• nuclear share of hsp70 is associated with various biological characteristics of malignant breast tumors, while the occurrence of cytoplasmatic hsp70 influences OS and SR. PMID: 12820347
HIF-HCAb for Hypoxia inducible factor- 1 alpha
• a prognostic marker in premenopausal patients with intermediate to highly differentiated breast cancer but not a predictive marker for tamoxifen response. PMID: 16381002-hK-HCAb for Human kallikrein 10 (hK10)
• A predictive marker for breast cancer. PMID: 16800732 IGFBP2-HCAb for IGFBP-2
• A marker for antiestrogen resistant breast cancer cell lines, although IGFBP-2 was not a major contributor to the resistant cell growth. PMID: 16893667
KAI-HCAb for KAI-I
• In addition to its role in human prostate, pancreatic and non-small cell lung cancer, KAIl may also be a useful marker for staging human breast disease. PMID: 9570365
Ki-67-HCAb for Ki-67
• A prognostic marker in early breast cancer. PMID: 17453008
• Tumor proliferative activity as evaluated by the monoclonal antibody Ki-67 seems to be an effective indicator of prognosis in breast cancer for DFS and OS. PMID: 8508358
KL6-HCAb for KL-6
• Serum KL-6 may be helpful for clinical use as a tumor marker for breast cancer, and it may play an important role, especially in the surveillance of disease relapse. PMID: 11051258
KLK15-HCAb for KLK15
• An independent and favorable prognostic marker for breast cancer. PMID: 12439720
KPNA2-HCAb for KPNA2 (karyopherin alpha2) • A potential novel prognostic marker in breast cancer. PMID: 16818692 Laminin-HCAB for Laminin
• Serum determination of laminin could be a useful diagnostic tool in breast cancer and a valuable parameter in the prediction of metastasis. PMID: 10356660
Leptin-HCAb for Leptin
• A marker of breast cancer progression: possible role of obesity-related stimuli. PMID: 16533767
LY6K-HCAb for LY-6K
• Not only a target antigen for HNSCC but also a significant new molecular marker for diagnosis and gene therapy in patients with breast cancer. PMID: 17089039
M3/M21-HCAb for M3/M21
• The detection of breast cancer recurrence with CA 15-3 is improved by combination with M3/M21. PMID: 8920765 MAGEA-HCAb for MAGE-A (Melanoma antigen gene A).
• gene expression may be used for the surveillance of circulating breast carcinoma cells after primary therapy by RT-nested PCR using MMRPs. PMID: 15937912
MAM6-HCAb for MAM-6 antigen
• A new serum marker for breast cancer monitoring. PMID: 3697998 MAM-HCAb for Mammaglobin (MAM)
• As measured by the ELISA, holds significant promise for breast cancer screening with the realistic potential to impact management of this disease. PMID: 16166429
• hMAM mRNA detection by RT-PCR is a specific assay potentially suitable for identification of occult cancer cells in peripheral blood of BC patients. PMID: 16110760
• MAM gene expression on leukapheresis products of high-risk breast cancer patients is an indicator of poor prognosis. PMID: 15447988
• Detection of mammaglobin protein and mRNA in clinical samples may be a useful marker for primary, metastatic, and occult breast cancer. PMID: 11193781
• RT-PCR using mammaglobin B gene could therefore be a useful tool for detection of micrometastases of breast cancer. PMID: 10674878
• A novel marker of minimal residual disease in early stages breast cancer. PMID: 15254674 • One of the first relatively mammary- specific and mammary-sensitive markers. Mammaglobin and BRST-2 appear to represent useful markers for breast cancer and should be used as a component of panels evaluating tumors of unknown primary sites. PMID: 14521461
MCA-HCAb for MCA (mucinous carcinoma associated antigen)
• A promising tumor marker in breast cancer. Especially high values may have diagnostic significance. PMID: 3178156
• The new tumor marker antigen MCA reacts with breast cancer cells in paraffin sections. It might be used in identification of cancer cells in tissue sections. MCA can also be used as a weak indicator of aggressiveness of the tumor. PMID: 1695077
Mcm-HCAb for Mcm-2
• May be of utility as a prognostic marker to refine the prediction of outcome in breast cancer, for example when combined with parameters currently used in the NPI. PMID: 14645419
MDM2-HCAb for MDM2
• A negative prognostic marker in breast carcinoma. PMID: 16258514 MGBl-HCAb for MGBl
• Can serve as a differential molecular marker. In practice, prospective examination, using the nine cases with a history of breast cancer, confirmed the usefulness of MGBl in differential diagnosis. PMID: 15096563
MIB-HCAb for MIB-I
• The growth fraction of a tumor as determined by the MIB-I labelling index is an important prognostic factor in patients with primary breast cancer. PMID: 9716027
MMPl for MMP-I
• A candidate marker that may be useful for identification of breast lesions that can develop into cancer. PMID: 15864312
MMP2-HCAb for MMP-2
• MMP-2 immunoreactive protein has been associated strongly with a shortened survival independent of major prognostic indicators in patients with primary breast carcinoma, increasing the risk of death 3.6-fold during the first 10 years of follow-up. PMID: 9740080 MMPD-HCAb for MMP-13
• Primarily expressed by myofibroblasts in human breast carcinoma and that expression in DCIS lesions often are associated with microinvasive events. PMID: 11585740
MSA-HCAb for MSA (Mammary serum antigen)
• Serum levels do not allow discriminating benign from malignant breast diseases and MSA is 2.5 to 3 times more sensitive for the prediction of early stages breast cancer compared to CA 15-3, TPA and CEA. PMID: 9082702
• MSA levels are elevated in patients with breast cancer and may provide a useful means of following the clinical course of patients with this disease. PMID: 3355770
• MSA levels may therefore be of some use for the monitoring of breast cancer patients, and as a diagnostic aid to screen populations for breast cancer. PMID: 3609486
NCCST-HCAb for NCC-ST-439
• The NCC-ST-439 level, especially in combination with the CEA level, may be useful for the early detection and the monitoring of relapses in breast cancer patients. PMID: 2232168
Nectin4-HCAb for Nectin-4
• A 66-kDa adhesion molecule of the Nectin family, which is a valuable new histological and serological marker for breast carcinoma. PMID: 15784625
Neu-HCAb for Neu (c-erbB-2)
• A tumor marker in carcinoma of the female breast. PMID: 1981830 NRPl-HCAb for NRP-I (neuropilin-1)
• A marker of axillary lymph node breast metastases. PMID: 10451484
• May be a multiple function protein in human breast and may be involved in the induction of local invasiveness of neoplasia and angiogenesis and have direct relevance to the progression of breast cancer. PMID: 12216067
P53-HCAb for p53
• Immunohistochemically detected p53 protein accumulation was an independent marker of shortened survival and was seen more often in familial than in sporadic carcinomas. PMID: 1317462 • p53 positive Bcl-2 negative phenotype is an independent marker of prognosis in breast cancer. PMID: 17187363
• p53 expression status was a significant molecular marker as well as the response to first-line endocrine therapy for predicting TTEF in recurrent breast cancer with hormone-sensitive disease. PMID: 17180510
• Mutant p53 protein in serum could be used as a molecular marker in human breast cancer. PMID: 16525651
• Nuclear p53 protein expression may represent an adverse prognostic marker in inflammatory breast cancer (IBC) and may provide a valuable tool for selecting treatment for this aggressive disease. PMID: 15448010
P63-HCAb for p63
• As part of the diagnostic workup of challenging spindle cell tumors of the breast as a highly specific marker for metaplastic carcinomas. PMID: 15489655
P120-HCAb for P120
• A prognostic marker in node-negative breast cancer. PMID: 7940158 Pepsinogen-HCAb for Pepsinogen C
• A new prognostic factor for early recurrence and death in both node-positive and node-negative breast cancer. PMID: 7799043
PINP-HCAb for PINP
• Serum marker of metastatic spread to the bone in breast cancer patients. PMID: 16033050
PKC-alfa-HCAb for PKC alpha (Protein Kinase C alpha)
• A marker for antiestrogen resistance and as a promising therapeutic target in the treatment of tamoxifen resistant breast cancer. PMID: 17061041
PA-HCAb for Plasminogen Activator
• Can be used as an effective functional marker for hormone dependence in human breast cancer. PMID: 3082829
GaINAC-HCAb for ppGalNAc-T6
• Could be a specific marker applicable to the molecular diagnosis of breast cancer cells dissemination. PMID: 16596643
• a new immunohistochemical breast cancer marker. PMID: 16260590 pS2-HCAb and c-ER-HCAb for pS2 and ER antigens • Are useful tools for predicting tumor regression with neoadjuvant tamoxifen in post-menopausal breast carcinoma patients. PMID: 8855985
PSA-HCAb for PSA antigen
• Might be useful as a marker for a subset of breast cancers with better prognosis, which could respond to endocrine therapy, in correlation with other prognostic markers. PMID: 16575473
PSE-HCAb for PSE (Prostate Specific Ets)
• A potentially informative novel marker for detection of metastatic breast cancer in axillary lymph nodes, and should be included in any study that involves molecular profiling of breast cancer. PMID: 11953821
PTA-HCAb for PTA (prothymosin alpha)
• A potential prognostic marker for primary breast cancer. PMID: 10682670 PTEN-HCAb for PTEN
• Might play an important and major role in its HER2/PI3K/Akt-mediated antitumor effect, and could be a useful biomarker for predicting the efficacy of trastuzum- Ab in the treatment of breast cancer. PMID: 16404430
PTTG-HCAb for PTTG (pituitary tumor-transforming gene)
• Expression in primary tumors of the breast is a powerful tool for the assessment of potential tumor aggressiveness. PMID: 14759723
RCP-HCAb for RCP (riboflavin carrier protein)
• Measurement of circulatory RCP and the immunohistochemical staining pattern of RCP in biopsy specimens could be exploited as an additional marker in diagnosis/prognosis of breast cancer in women. PMID: 11494224
SigmaS-HCAb for Sigma S
• A measure of reactive sulfur groups of immunoglobulin G, is a sensitive tumor marker discriminating different stages of breast cancer. PMID: 1913474
SNCG-HCAb for SNCG
• Expected to be a useful marker for breast cancer progression and a potential target for breast cancer treatment. PMID: 16821081
SNSE-HCAb for S-NSE (serum neuron-specific enolase)
• May be a useful marker for monitoring treatment and predicting relapse in patients with Small cell lung cancer (SCLC). PMID: 2155054
S 14-HCAb for Spot 14 (S 14) • A marker of aggressive breast cancer and a potential therapeutic target. PMID: 16809441
• Identifies a subset of high-risk breast cancers that is not specified by analysis of sex steroid receptors, Her2/neu, or cyclin Dl, and provides a molecular correlate to histologic features that predict recurrence. PMID: 16552628
ST439-HCAb for ST-439
• A useful tumor marker not only in monitoring the recurrence, but also in the diagnosis of primary breast cancer. PMID: 2069399
STC-I for STC-I (Stanniocalcin 1)
• Is proposed as a novel, specific, and clinically useful molecular marker for detecting occult breast cancer cells in the BM and blood. PMID: 12684415
S-HCAb for Survivin
• Might be used as a new marker to stratify breast cancer patients for more optimal treatment modalities, or it could be a promising new target for therapy. PMID: 15364883
TAG 12-HCAb for TAG 12 (Tumor associated glycoprotein 12)
• a new tumor marker in breast cancer. PMID: 11326666 TEM8-HCAb for TEM-8 antigen
• A useful marker for identifying tumor associated micro-vessels and that elevated levels are associated with disease progression, which may have some bearing on the prognostic outcome in breast cancer. PMID: 17016666
T-HCAb for Thioesterase II
• May be a useful serum marker for mammary cancer. PMID: 3524817 Thmb-HCAb for Thrombomodulin (TM)
• Might play an active role in cancer invasion and metastasis, and serve as a new prognostic factor in invasive breast cancer. PMID: 9216709
TIMP-I (tissue inhibitor of metalloproteinase-1)
• A prognostic marker in primary breast cancer. PMID: 15073104
• May be useful as a prognostic marker in combination with uPA/PAI-1 and adds substantial positive information on the use of TIMP-I as a prognostic marker in breast cancer. PMID: 15073104 tP A-HCAb for Tissue -type plasminogen activator
• A new prognostic marker in breast cancer. PMID: 3124957 Topol lalfa-HCAb for Topo LI-alpha
• Overexpression appears to be linked with cellular dedifferentiation and potentially aggressive tumor phenotype in invasive breast cancer. PMID: 11174071
TPt3-HCAb for TP53
• TP53 mutation is a strong marker for the prediction of overall and disease-free survival in breast cancer, irrespective of nodal status. PMID: 10987229
TPpa-HCAb for TPpA (Tissue polypeptide antigen)
• A marker of central nervous system metastases of breast cancer. PMID: 2041052 TPS-HCAb for TPS (Serum tissue polypeptide specific antigen)
• A complementary tumor marker to CA 15-3 in the management of breast cancer. PMID: 11678313
• Serum TPS at admission had a significant predictive value with regard to survival up to 12 months in breast cancer patients. PMID: 8687149
TRACP-HCAb for TRACP
• A useful marker of metastatic bone disease and response to treatment in breast cancer patients. PMID: 10650803
• c-TRACP-5b-HCAb for TRACP 5b
• Tartrate-resistant acid phosphatase 5b activity is a useful bone marker for monitoring bone metastases in breast cancer patients after treatment. PMID: 16537696. PMID: 15701839
• Diagnostic sensitivity and specificity of TRAP 5b as a marker of skeletal metastases in patients with breast cancer were 82 and 87%, respectively. PMID: 15514730
• TRACP 5b activity can be considered a surrogate indicator of bone metastasis in breast cancer patients. PMID: 15153786
• uKPA-HCAb for UK-PA (Urokinase plasminogen activator)
• Appears to be a new and independent prognostic marker in breast cancer. PMID: 2119883
• uPA expression in breast cancer patients is under epigenetic control via methylation of its promoter. Determination of uPA promoter methyl ation can therefore serve as an early reliable indicator of uPA production in breast cancer patients. PMID: 15131040
YBl-HCAb for YB-I (Y-box binding protein 1) • A marker of tumor aggressiveness and response to adjuvant chemotherapy in breast cancer. PMID: 15703814
YKL40-HCAb for YKL-40
• Determination of serum YKL-40 can be used as a prognostic marker related to the extent of disease and survival of patients with recurrence of breast cancer. PMID: 7577068
Other HCAbs for Breast Cancer Markers
• FDGPET for FDG-PET for detecting recurrent breast cancer suspected from asymptomatically elevated tumor markers levels and has an important clinical impact on the management of these patients. PMID: 12324574
• FBL for detecting FBL is associated with early manifestation of breast cancer and may be considered as a tool for the screening of breast cancer in high risk women. PMID: 9232610
• Urinary testosterone is a prognostic indicator of early breast cancer recurrence in node-positive patients. PMID: 8400317
Colorectal Cancer:
[0193] Colorectal cancer, also called colon cancer or bowel cancer, includes cancerous growths in the colon, rectum and appendix. It is the third most common form of cancer and the second leading cause of death among cancers in the Western world. Many colorectal cancers are thought to arise from adenomatous polyps in the colon. These mushroom-like growths are usually benign, but some may develop into cancer over time. The majority of the time, the diagnosis of localized colon cancer is through colonoscopy. Therapy is usually through surgery, which in many cases is followed by chemotherapy.
[0194] Camelid or shark can be immunized with the biomarkers associated with colon cancer. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be made using various methods such as, protease digestion, recombinant DNA technology and chemical means as described above. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be used in diagnosis, prognosis and/or treatment of colon cancer. Exemplary colon cancer biomarkers are shown below.
AFU (alpha-L-fucosidase)
• Serum AFU activity appears to be a good prognostic factor of tumor recurrence in colorectal carcinoma. PMID: 12457030 AM-3
• A marker of dysplasia in the colonic adenoma-carcinoma sequence. PMID: 1350509 Annexin II and Tenascin-C
• Are overexpressed in advanced colorectal carcinoma and that they may be related to the progression and metastatic spread of colorectal carcinoma. PMID: 11745218
ANAX3
• overexpressed in colorectal tumoral tissues Arginase
• Demonstrate higher clinical value in the early diagnosis of colorectal liver metastases than CEA and Ca 19-9. PMID: 15074017
Bcl-2
• A useful prognostic marker in Dukes' B colon cancer. PMID: 11456053 Beta Catenin
• Nuclear beta catenin expression is a potential prognostic factor in patients with colorectal cancer, and together with CK20, it could be used to identify colorectal carcinoma in the Hong Kong population. PMID: 14645698
BMP4
• over-expressed in colorectal tumoral tissues. CA-50
• A clinically useful tool for monitoring of patients with colorectal cancer. PMID: 2451612
CA 125
• A clinically useful tumor marker in the management of colorectal carcinoma metastatic to the liver in patients with normal carcinoembryonic antigen. PMID: 10776987
CA- 195
• Can be applied as complementary tumor marker in colorectal cancer. PMID: 2634457 CA 242
• Possible utility of CA 242 in monitoring the disease status, providing a rationale for future studies focusing on the longitudinal monitoring of colorectal cancer patients. PMID: 10365107
Caspase 7
• A new immunohistochemical marker of colonic neoplasia. PMID: 11381362 CCAT25 • Represents a highly promising marker for early detection of colorectal cancer in hereditary nonpolyposis colorectal cancer (HNPCC) germ line mutation carriers. PMID: 16166278
CCSP-2 (Colon cancer secreted protein-2)
• A novel candidate for development as a diagnostic serum marker of early stage colon cancer. PMID: 15580307
CDC25B
• A novel independent prognostic marker of colorectal carcinoma and that it may be clinically useful for selecting patients who could benefit from adjuvant therapy. PMID: 10850455
CDX-2
• A reliable marker of colorectal adenocarcinoma metastases to the lungs. PMID: 12548159
CEA (carcinoembryonic antigen)
• The measurement of CEA levels might be useful in monitoring chemotherapeutic response and in predicting the prognosis of patients with metastatic colorectal cancer. PMID: 11995458
• Intraoperative determination of carcinoembryonic antigen levels in peritoneal washes could be a potentially predictive factor of a poor prognosis in patients with colorectal cancer. PMID: 12845971
• CEA concentration in colonic effluent is a simple and practical biomarker for identification of patients at high risk for colorectal carcinoma (CRC). PMID: 10975292
CMUlO
• A marker for colonic carcinoma and precancerous conditions. PMID: 7748075 CR-I (CCripto-1)
• Plasma CR-I might represent a novel biomarker for the detection of breast and colon carcinomas. PMID: 16951234
Cyclooxygenase-2
• Expression in the primary lesion may be a useful marker for evaluating prognosis and liver metastasis in patients with colorectal cancer. PMID: 11786771
DD (plasma D-dimer)
• Measurement of the preoperative DD level is thus considered to be useful for the preoperative staging of colorectal cancer. PMID: 9590700 DDHN-MA
• Urinary DHN-MA is a useful noninvasive biomarker for determining the risk of preneoplastic lesions associated with heme iron consumption and should be further investigated as a potential biomarker of colon cancer risk. PMID: 17119057
DiAcSpm (di-acetyl spermine)
• Urine DiAcSpm predicted the prognosis after colorectal cancer surgery more exactly than serum CEA. PMID: 15164601
Dipeptidase 1
• A candidate tumor-specific molecular marker in colorectal carcinoma. /span> PMID: 15145522
DPD (Dihydropyrimidine Dehydrogenase)
• A useful marker for use with adjuvant chemotherapy with oral fluoropyrimidines after curative resection of colorectal cancer. PMID: 15309506
• Tumor DPD level is an efficacious marker in oral 5 -FU based-adjuvant chemotherapy for colorectal cancer; however, low tumor DPD predicts reduced survival in patients treated with curative surgery alone. PMID: 14744539
E-Cadherin
• Would be important predictive markers for lymph node metastasis in submucosal invasive colorectal carcinoma. PMID: 15785891
E-selectin
• The elevation of E-selectin alone or both E-selectin and sialyl Lewis A may be one of the useful indexes for more precise diagnosis of hematogenous metastases of human colorectal cancer. PMID: 11777210
GGalectin-3
• An independent factor for prognosis in colorectal cancer. PMID: 16080575 GCC (Guanylyl cyclase C)
• Reverse transcriptase PCR is a sensitive and specific technique for identifying tumor cells in extraintestinal sites and may be useful for staging and postoperative surveillance of patients with colorectal cancer. PMID: 16149873
GLUTl glucose transporter
• Associated strongly with neoplastic progression in the colon, and assessment of the extent of GLUTl immunostaining in colorectal carcinoma identifies patients with a poorer prognosis. PMID: 9655290
GST-pi • A possible new marker for immunohistochemical detection of human colonic carcinoma and some adenomas. PMID: 3084412
HECA (homologue of the Drosophila headcase protein)
• May be an early-stage classifier of colorectal cancer that can discriminate between late- and early- stage disease. PMID: 16525680
KKeratin 20
• A specific marker of submicroscopic lymph node metastases in colorectal cancer: PMID: 10767714
Ki67
• Ki-67 labeling index in the mucosa adjacent to cancer might be a good marker for metastasis in colorectal cancer. PMID: 11876549
Ll
• A new target gene for nt/beta-catenin-TCF signaling, is associated with tumor progression and poor survival in patients with colorectal cancer and may be clinically useful as a marker for poor prognosis. PPMID: 17211730
Lactoferrin
• A new marker for inflammatory gastrointestinal disorders and colon cancer. PMID: 8001286
LCN2
• Over-expressed in colorectal tumoral tissues. Metallothionein
• Early marker in the carcinogenesis of ulcerative colitis-associated colorectal carcinoma. PMID: 12053227
MMP-I
• A prognostic marker for hematogenous metastasis of colorectal cancer. PMID: 10794801
MMP-2/MMP-7/ MMP-9/MMP-11
• Activities of active MMP-2, MMP-7, MMP- 11 and proMMP-9 in the bile may be useful markers for predicting liver metastasis in colorectal cancer. PMID: 11594775
MnSOD (Manganese superoxide dismutase)
• Immunohistochemical expression of MnSOD can give auxiliary clinical information for malignant potential of colorectal carcinoma. PMID: 12469142
MUCl • Mature MUCl mucins become ectopically expressed in colorectal carcinoma progressed to the metastatic stages and that mature MUC 1 mucins may be a useful marker for advanced colorectal carcinoma. PMID: 7905449
MYCLl
• A useful prognostic factor of poor outcomes in colorectal cancer. PMID: 15014029 NCC-ST 439o:p>
• The determination of serum NCC-ST 439 in large bowel cancer might be useful in cancer staging and that NCC-ST 439, if used in combination with CEA, is particularly useful in diagnosing recurrences because of its improved diagnostic accuracy. PMID: 1914727
• Serum NCC-ST-439 value was clinically useful for the diagnosis and monitoring for patients with colorectal cancers as a new distinct tumor marker. PMID: 2782914, PMID: 2549882
NNMT (nicotinamide N-methyltransferase)
• Serum levels may have significance in the early detection and in the management of patients with colorectal cancer. PMID: 16166432
Osteopontin
• Identified as colon cancer tumor progression marker. PMID: 14744111
• A lead marker of colon cancer progression, using pooled sample expression profiling. PMID: 11929952 p53
• Detection of serum p53 antibody is expected to serve as a new genetic marker, determined by serological analyses, for aiding in the early diagnosis of superficial colorectal cancer and indicating its local curability after endoscopic treatment. PMID: 11706527
PAI-I (plasminogen activator inhibitor- 1)
• Might serve as a new parameter for the prediction of prognoses in colorectal cancer (CRC). PMID: 16091756
PGP9.5
• Expression is related to tumor progression and may be useful as a marker for invasive colorectal cancer. PMID: 11801558
PKC (Protein kinase C)
• A biological marker of risk of developing colorectal cancer or risk of bearing an asymptomatic tumor. PMID: 1860726 pKi-67
• Quantitatively determined pKi-67 mRNA can be a good and new prognostic indicator for primary resected colorectal carcinoma. PMID: 15449182
PMEPAl
• A transforming growth factor-beta-induced marker of terminal colonocyte differentiation whose expression is maintained in primary and metastatic colon cancer. PMID: 12670906 pp53
• Accumulation of p53 protein might have a favorable prognostic value in colorectal cancer, but it is not an independent prognostic factor. PMID: 17021749
PRL-3
• Expected to be a promising biomarker for identifying colorectal cancer patients at high risk for distant metastases. PMID: 15534108 pS2
• A possible diagnostic marker of colorectal carcinoma in ulcerative colitis. PMID: 10671663
PSME3
• A novel serum tumor marker for colorectal cancer (CRC) that may have significance in the detection and in the management of patients with this disease. PMID: 16893879
SS100A4
• Expression is associated with adverse clinical outcome. Inclusion of S 100 A4 expression status may enhance our accuracy to prognosticate in patients with colorectal cancer. PMID: 16615153
SERCA2
• May be a molecular determinant in the development and progression of colorectal cancer (CRC). PMID: 16861967
SSKI
• Amplification of SKI is a negative prognostic marker in early-stage colorectal cancer. PMID: 15153332
SMAD4
• A prognostic marker in colorectal cancer. PMID: 15814640
• A predictive marker for 5-fluorouracil-based chemotherapy in patients with colorectal cancer. PMID: 12237773
SMAD7 • A prognostic marker in patients with colorectal cancer. PMID: 12584741 STAT3
• Expression of p-STAT3 is an important factor related to tumor invasion and poor prognosis of human colorectal adenocarcinoma. PMID: 16685378
STRAP
• A strong predictive marker of adjuvant chemotherapy benefit in colorectal cancer. PMID: 15720808
Sucrase-isomaltase (SI)
• An independent prognostic marker for colorectal carcinoma. PMID: 7497836 TA90-IC
• Anew marker for advanced colon cancer. PMID: 10864342 TAG-72
• A novel tumor marker for colorectal cancer patients. /span> PMID: 1892526 TTCR gamma (T-cell receptor gamma)
• A microsatellite marker for colorectal cancer. PMID: 11833498 Telomerase
• Useful both as a diagnostic as well as a predictive factor in colorectal cancer. PMID: 15190417
TEM-8
• A marker that identifies tumor associated micro-vessels in colon cancer. The levels of expression of TEM-8 in invasive colon cancer are linked to disease progression. This suggests that TEM-8 has significant prognostic and therapeutic values in colon cancer. PMID: 15498639
Tetranectin (TN)
• May be valuable as a prognostic variable in future studies evaluating new treatment strategies for colorectal cancer. PMID: 12529016
TGF-betal
• Active TGF-betal might be used as a tumor marker for colorectal cancer. PMID: 11802214
Thymidine Kinase 1 (TKl)
• TKl-LI showed more potential as a proliferating marker in colorectal carcinoma than PCNA-LI, especially for evaluating high-risk tumor grade and advanced stage in colorectal carcinoma. PMID: 11205225
VEGF (vascular endothelial growth factor) • A useful complementary tumor marker in patients with colorectal cancer. PMID: 16741643. PMID: 16645748
• A predictive marker of rectal tumor response to preoperative radiotherapy. PMID: 16222693
VEGF-D
• VEGF-D expression, but not that of its receptor VEGFR-3, is an independent prognostic indicator in colorectal carcinomas (CRC). PMID: 11912138
Vitamin D receptor
• The level of vitamin D receptor correlates with the degree of differentiation in human colon cancer cell lines and may serve as a useful biological marker in predicting clinical outcome in patients. PMID: 8393379
Other Colorectal Cancer Markers
• Detection of circulating tumor cells erioperatively by immunobead-PCR provides a sensitive prognostic marker for recurrent and metastatic colorectal cancer. PMID: 8612201
• Methylation of serum DNA is an independent prognostic marker in colorectal cancer. PMID: 17189406
• A combination of serum hepatocyte growth factor and carcinoembryonic antigen tests might be useful for selecting patients with aggressive diseases in Dukes A and B colorectal cancer classification. PMID: 16990975
• This innovative membrane array technique with a multiple mRNA marker panel can significantly improve the diagnosis rate of early colorectal cancer. PMID: 16391796
• A mini-array of multiple TAAs which includes Calnuc might provide a novel noninvasive approach to enhance antibody detection for colon cancer diagnosis. PMID: 17390015
• An increment of soluble FAS/soluble FASL ratio after treatment could be an excellent marker of chemosensitivity in colorectal cancer. PMID: 16000573
• Fecal sphingomyelinase activity could really reflect the human intestinal mucosa enzyme level and could represent a new marker for human colorectal adenocarcinoma, mainly taking into account its early appearance in intestinal neoplasms. PMID: 15824156
• 6 months postoperatively serum CEA is a better prognostic marker than corresponding serum and plasma VEGF. However, high serum VEGF within high serum CEA was an even better predictor of overall survival than high serum CEA alone. PMID: 14968945
• An assay of fecal DNA integrity may be a useful biomarker for the detection of colorectal cancer (CRC). PMID: 12816901
• Lipid peroxidation as additional marker in patients with colorectal cancer. Results of a preliminary study. PMID: 12364818
• Hyaluronic acid (HA) may provide additional information to that given by other biochemical markers currently used in colorectal cancer. PMID: 11122186
• The evaluation of circulating testosterone could be a new and more sensitive assay for diagnosis and follow-up of colorectal carcinoma in males, especially in patients with normal levels of carcinoembryonic antigen. PMID: 8295527
• Tumor Budding is a reliable biological prognostic variable to identify higher malignancy potential. Scoring system using tumor budding and N stage showed better prognostic stratification in stage-III rectal carcinoma. PMID: 17216219
• Budding is a pathological marker suggesting high malignant potential and decreased postoperative survival in patients with colorectal mucinous carcinoma. PMID: 12451038
• Mandibular osteomas are probably genetic markers of the development of sporadic colorectal carcinoma. PMID: 8381556
Ovarian Cancer:
[0195] Ovarian cancer is a malignant ovarian neoplasm (an abnormal growth located on the ovaries). Often, this cancer is detected at an advanced stage when it is too late to treat. Early detection is a must for early intervention of a disease. Came lid and shark heavy chain only antibodies and their analogs may be used to detect ovarian cancer biomarkers.
[0196] Camelid or shark can be immunized with the biomarkers associated with ovarian cancer. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be made using various methods such as, protease digestion, recombinant DNA technology and chemical means as described above. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be used in diagnosis, prognosis and/or treatment of ovarian cancer. Exemplary ovarian cancer biomarkers are shown below.
Alpha 1 AT
• A useful tumor marker in diagnosing ovarian cancer (OC). PMID: 2472494 Alpha(v)-integrin
• A novel prognostic marker in advanced-stage ovarian carcinoma. PMID: 11751504 Alpha (v) beta(6) Integrin
• Associated with epithelial ovarian cancer and that a gradual increase in the expression of the molecule may be a correlative index of the progression of this disease. PMID: 12364570
ATP7B
• May be considered as a novel chemoresistance marker and that inhibitor(s) of ATP7B might be useful, in patients with ovarian carcinoma treated with cisplatin-based chemotherapy. PMID: 12216079
B2M (Beta-2-Microglobulin)
• Combination of b2m and CA- 125 tumor markers seems to be a suitable tool for follow-up ovarian cancer patients under and after treatment. PMID: 1585745
Beta III Tubulin
• Assessment of beta III tubulin could be useful to identify poor prognosis ovarian cancer patients to more aggressive and/or targeted therapy. PMID: 16675570
CA54/61
• Is of clinical value as a new tumor marker for ovarian cancers, including mucinous tumors. PMID: 1737381
CA 72-4
• Measurement of CA 72-4 be combined with measurement of CA 125, so as to provide a better sensitivity and specificity in monitoring an ovarian cancer. PMID: 2232183
CA125 (tumor marker Cancer Antigen 125)
• Currently widely applied in the management of patients with ovarian cancer. PMID: 12088336
• Though not ovarian cancer specific, is widely used for the evaluation of suspected and under-treated ovarian cancer. PMID: 15668638. PMID: 16126266
• The combination of FDG-PET and CAl 25 titer is useful for the accurate detection of recurrence for epithelial ovarian cancer. PMID: 16515575
• A mucin commonly employed as a diagnostic marker for epithelial ovarian cancer. PMID: 12734200
• A rise in CA 125 during or after treatment, however, is almost always associated with progression of the disease (ovarian cancer). PMID: 9477746 • A glycoprotein and a commonly used tumor marker in ovarian carcinoma. PMID: 16724349
• Useful to follow-up of patients whose ovarian carcinoma had already been diagnosed and suffered surgery procedures followed for chemotherapy. PMID: 8731596
• The most sensitive marker for epithelial ovarian cancer, but the concomitant measurement of TATI could be of benefit in both differential diagnosis of adnexal masses and monitoring of response of epithelial ovarian cancer to treatment. PMID: 1780685
• Determination of serum CA 125 should be mandatory in the follow-up investigation of women with epithelial ovarian carcinomas. PMID: 3480655
• Chemotherapy alone is capable of lowering CA- 125 serum levels. This tumor marker may be of great advantage in diagnosis and follow-up of ovarian malignancy. PMID: 3479814
• Practical application of CAl 25 proved to be useful for the early detection of ovarian cancer and confirmation of the complete disappearance of any tumor. PMID: 3461071
• Routine determination of CA 125 appears advisable in the control of patients with ovarian carcinoma on account of the high sensitivity and specificity during follow-up. PMID: 2408962
• The measurement of CA125 in sera was considered to be significant in the diagnosis of ovarian cancer. PMID: 6595320
• An excellent marker in the management of patients with epithelial ovarian cancers. PMID: 2737852
CA125 II
• Has higher precision than that of CAl 25 when it is used for the screening test. In conclusion, CAl 25 II is a better tumor marker than conventional CAl 25. PMID: 7737582
CA602
• May be a useful serum tumor marker for ovarian cancer as a substitute for CA125. PMID: 2170549 caGT (cancer-associated galactosyltransferase antigen)
• Will be a useful tumor marker for ovarian cancers, especially for clear cell carcinoma. PMID: 2105162
CASA or YKL-40 • Low serum levels of tetranectin, or high serum levels of CASA or YKL-40, are associated with increased risk of second-line chemoresistance in patients with ovarian cancer. PMID: 17013795
Cathepsin B
• Serum cathepsin B-like activity may be helpful in the preoperative differential diagnosis between ovarian carcinomas and benign ovarian or uterine tumors. PMID: 9166974
CD24
• Expressed in ovarian cancer and is a new independent prognostic marker of patient survival. PMID: 12368195
CD34
• A useful marker in determining tumor neovascularisation which might be of prognostic relevance in patients with ovarian cancer. PMID: 10470188 c-Ets 1
• A promising marker in epithelial ovarian cancer. PMID: 11836635 CKB (creatine kinase B)
• Up-regulated in ovarian cancer cells in vitro and in vivo and that CKB enzyme activity is significantly elevated in sera from ovarian cancer patients, including those with stage I disease. These findings suggest a potential role for CKB as a marker for early diagnosis. PMID: 15589584
COX-I
• A suitable marker for the monitoring and diagnosis of ovarian cancer patients, when used alone or in combination with CA 125. PMID: 7589737
EMMPRIN (extracellular matrix metalloproteinase inducer)
• A novel marker of poor outcome in serous ovarian carcinoma. PMID: 12705637 Ep-CAM (epithelial cell adhesion molecule)
• An independent prognostic marker for reduced survival of patients with epithelial ovarian cancer. PMID: 16678891
Ets-1
• A novel marker of poor survival in ovarian carcinoma. PMID: 11297247 GAT (galactosyltransferase associated with tumor)
• A newly developed tumor marker of ovarian carcinoma. PMID: 8129392, PMID: 8434966 • The lower positive rate of GAT in endometriosis, when compared with the positive rate of other markers, suggests the usefulness of GAT in distinguishing malignant ovarian tumors from benign ovarian tumors. The use of GAT in a combination assay is expected to overcome the disadvantages of CA602 or CAl 25. PMID: 8434967
GEP (Granulin-epithelin precursor)
• A novel prognostic marker in epithelial ovarian carcinoma. PMID: 15139056 GT-II (Galactosyltransferase isozyme II)
• A new tumor marker for ovarian cancers—especially for clear cell carcinoma. PMID: 2511259
HER-2
• Appeared to influence the outcome of advanced ovarian cancer patients included in a clinical trial with prolonged follow-up, thereby suggesting that HER-2 is a potential target for treatment of this cancer. PMID: 14679128 hK8 (Human kallikrein 8)
• An independent marker of favorable prognosis in ovarian cancer. PMID: 16533772 hK10 (Human kallikrein)
• May be a potential new serological marker for ovarian cancer diagnosis and monitoring. PMID: 11282101 hK13 (Human kallikrein 13)
• An independent marker of favorable prognosis in ovarian cancer. PMID: 14966091 HLA-G
• Aprognostic indicator in advanced-stage ovarian cancer in effusions. PMID: 15589578
HNF-lbeta
• Is likely to be helpful for the diagnosis of CCC in the peritoneal fluid. PMID: 17351940
IAP (immunosuppressive acidic protein)
• May also be a useful follow-up marker for patients with ovarian cancer (particularly, for the early detection of recurrence). PMID: 3701144
• Not only an excellent clear cell carcinoma (CCC)-specifϊc molecular marker but also a molecular target for therapy of ovarian clear cell carcinoma (OCCC). PMID: 14633622
IGFBP-2 • May therefore be an important additional prognostic marker in ovarian cancer. PMID: 15014034
KLK9 (kallikrein gene 9)
• A potential new independent favorable prognostic marker for early stage, low-grade, optimally debulked ovarian cancer patients. PMID: 11691797
M-CAM (melanoma cell adhesion molecule)
• A marker of poor prognosis in epithelial ovarian cancer (EOC). PMID: 16804906 M-CSF (Macrophage colony-stimulating factor)
• A marker for ovarian cancer. Determination of serum levels can be useful in detecting ovarian cancer, particularly in combination with CA 125. PMID: 8233270
Mesothelin
• A new tumor marker for the differential diagnosis of epithelial ovarian carcinoma and a prognostic factor for the outcome of epithelial ovarian carcinoma patients. PMID: 17214332
MMP-2 (matrix metalloproteinase-2)
• A potential marker of prognosis for epithelial ovarian cancer. PMID: 11748988 nm23-Hl
• May serve as a potentially valuable marker for ovarian tumors. PMID: 7763042 p53
• Could be used as a marker for predicting the response to chemotherapy of ovarian cancer. PMID: 9797696
P-III-P (type III procollagen peptide)
• Very useful as tumor marker in diagnosis of malignant ovarian tumors, while it was not aided to detect the early cancers. PMID: 2778385
P-glycoprotein
• A predictor of response and survival in a uniformly treated and followed cohort of advanced ovarian cancer patients. PMID: 10810398
PP-4 (Placental protein 4)
• A possible tumor marker in ovarian tumors. PMID: 1836196 Progesterone
• May be used as a tumor marker in "nonendocrine" ovarian tumors. PMID: 6884825 Progesterone Receptor (PR)
• An independent marker, with its overexpression associated with a favorable prognosis in women with ovarian cancer. PMID: 15721410 Prostasin
• Overexpressed in epithelial ovarian cancer and should be investigated further as a screening or tumor marker, alone and in combination with CA 125. PMID: 11584061
PUMP-I
• Frequently overexpressed in ovarian tumors and may contribute to its invasive nature or growth capacity. PMID: 10050107 sialyl SSEA-I antigen
• Appears to be a useful tumor marker for the diagnosis of ovarian cancer, especially when measured simultaneously with CA125, CA19-9, TPA, ferritin and IAP. PMID: 2566639
SM047
• Strongly expressed in most ovarian serous adenocarcinomas and in other female genital tract adenocarcinomas, with the exception of ovarian mucinous tumors. The antibody may be useful in confirming the ovarian origin of an adenocarcinoma when used as part of a larger panel. PMID: 11422498
STN antigen (serum sialyl Tn antigen)
• A positive STN antigen level in sera is an independent predictor of poor prognosis in ovarian cancer. PMID: 1541859
• Positive STN antigen level in sera is an independent predictor of poor prognosis in epithelial ovarian cancer. PMID: 1678592
TAG-72
• Might be considered a (progression) marker between the subgroup of benign and malignant serous ovarian tumors. PMID: 9167042
Thymidine Phosphorylase (TP)
• Might be useful in diagnostic characterization of ovarian cancer. PMID: 15262124 TNF Receptors
• In peritoneal fluid, measurement of soluble TNF receptors, and particularly of p75, has an increased sensitivity and accuracy over CAl 25 in distinguishing ovarian cancer from benign pelvic masses. PMID: 7729731
Topoisomerase II
• a prognostic marker for survival in ovarian cancer. PMID: 11426969 tPA (tissue plasminogen activator) • High concentration of plasma tPA was an independent marker for poor prognosis in patients with ovarian cancer in our study. Plasma tPA did, however, not discriminate between benign and malignant adnexal lesions. PMID: 14529669
VSGP/F-spondin
• A potential diagnostic marker or target for developing therapeutic strategies to treat ovarian carcinoma. PMID: 16103746
WT-I
• A highly sensitive and specific marker of serous carcinomas of ovarian surface epithelial origin. PMID: 15354736
• In assessment of effusion specimens with metastatic carcinoma, nuclear reactivity for WTl is highly suggestive of an ovary primary tumor. PPMID: 11954027
• Expression of WTl gene may be indicative of an unfavorable prognosis in patients with advanced serous epithelial ovarian carcinoma. PMID: 16606472
YB-I (Y box-binding protein- 1) and P-gp (P-glycoprotein)
• Co-expression of YB-I and P-gp emerged as a promising relevant biomarker for unfavorable prognosis in ovarian cancer. PMID: 15099935
YKL-40
• A prognostic tumor marker in recurrent ovarian cancer. PMID: 12694127 Other Ovarian Cancer Markers
• FDG-PET is a useful technique to detect recurrent ovarian cancers for patients suspected of recurrent ovarian cancers due to asymptomatically elevated serum levels of CA- 125 antigen. PMID: 12458332
• Indoleamine 2,3-dioxygenase screened with the GeneChip was positively associated with paclitaxel resistance and with impaired survival in patients with serous-type ovarian cancer. PMID: 16115948
Cervical Cancer:
[0197] Cervical cancer is a malignancy of the cervix. It may present with vaginal bleeding but symptoms may be absent until the cancer is in its advanced stages, which has made cervical cancer the focus of intense screening efforts utilizing the Pap smear. Most scientific studies have found that human papilloma virus (HPV) infection is responsible for virtually all cases of cervical cancer. Treatment consists of surgery (including local excision) in early stages and chemotherapy and radiotherapy in advanced stages of the disease. [0198] Came lid or shark can be immunized with the biomarkers associated with cervical cancer. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be made using various methods such as, protease digestion, recombinant DNA technology and chemical means as described above. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be used in diagnosis, prognosis and/or treatment of cervical cancer. Exemplary cervical cancer biomarkers are shown below.
Beta-CF (Beta-core fragment)
• A fragment of the hCG beta-subunit missing its carboxyterminal peptide. The determination of urinary beta-CF may provide a useful tool in monitoring the response to treatment in patients with cervical cancer. PMID: 1545171
CD34
• A marker for evaluating angiogenesis in cervical cancer. PMID: 15991838 CDH1/CDH13
• Detection of aberrant methylation of CDH1/CDH13 may be of potential use as a marker for selecting cervical cancer patients at high risk for relapse who could benefit from additional systemic therapy. PMID: 14750164
ERCCl
• A molecular marker of cisplatin resistance in human cervical tumor cells. PMID: 11008208
HIF-I alpha
• a strong independent prognostic marker in early stage cervical cancer. PMID: 10987269
HPV- 16 Ll
• Antibodies to HPV- 16 Ll were found to be an independent prognostic factor for overall survival in patients with cervical cancer. PMID: 11967495
HPV DNA
• Serum HPV DNA might be a useful additional marker for early detection of recurrence in cervical cancer patients. PMID: 14643453
• In patients with cervical cancer, an approach based on a PCR test for HPV DNA in tumor- free regional lymph nodes may allow early identification of women at high risk for relapse who should receive adjuvant treatment. PMID: 9166495
Id-I
• An independent prognostic marker in early-stage cervical cancer. PMID: 11479201 pl6
• A useful marker for the detection of the adenocarcinoma of the cervix uteri and its precursors. PMID: 12548164 p21WAFl/CIPl
• Expression of p2 IWAFl /CIPl correlated with a favorable prognosis for patients with cervical adenocarcinoma and may serve as a useful marker of survival in cases of this disease. PMID: 9635534
PP-4 (placental protein 4)
• A recently characterized glycoprotein from human placenta, can be regarded as a tumor associated protein which most likely can serve as tumor marker in cervical and endometrial cancer. PMID: 1833844
SCC antigen (squamous cell carcinoma antigen)
• A new tumor marker for cervical carcinoma. PMID: 2591447
• Might be helpful in the control of the primary therapy and follow-up of cervical cancer patients. PMID: 2777050
• Proved to be a valuable tumor marker for the follow up of cervical, vaginal, and vulvar cancer. PMID: 2721888
Tn antigen (Tn-Ag)
• A combination of estimations of the degree of cancer involvement in the cervical stroma and Tn-Ag expression seems the most useful for predicting the prognosis of patients with cervical cancer. PMID: 8508399
TPS
• Especially in the combination with SCC may be useful in the diagnosis and estimation of stage of disease of patients with cervical carcinoma. PMID: 11320545
Tu M2-PK
• Can be used as a tumor marker in follow-up of patients with cervical carcinoma. PMID: 15210041
UGF (urinary gonadotropin fragment) and SCC (squamous cell carcinoma antigen)
• Both UGF and SCC be used to monitor therapy and to detect recurrences of cervical and vulvar cancers. PMID: 2354828
Bladder Cancer:
[0199] Bladder Cancer refers to any of several types of malignant growths of the urinary bladder. It is a disease in which abnormal cells multiply without control in the bladder. The most common type of bladder cancer begins in cells lining the inside of the bladder and is called urothelial cell or transitional cell carcinoma (UCC or TCC). Approximately 20% of bladder cancers occur in patients without predisposing risk factors. Bladder cancer is not currently believed to be heritable (i.e., does not "run in families" as a consequence of a specific genetic abnormality).
[0200] Camelid or shark can be immunized with the biomarkers associated with bladder cancer. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be made using various methods such as, protease digestion, recombinant DNA technology and chemical means as described above. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be used in diagnosis, prognosis and/or treatment of bladder cancer. Exemplary bladder cancer biomarkers are shown below.
Beta-hCG (beta human chorionic gonadotrophin)
• For T2-T4 bladder tumors, an elevated pre-treatment level of urinary beta-hCG is a marker of poor prognosis and may prove useful in deciding appropriate therapy. PMID: 8653319
• Measurement of serum and/or urine beta HCG appears to be an efficient diagnostic marker for the presence of distant metastases in bladder carcinoma. PMID: 2478247
Beta-2-microglobulin
• A differentiation marker in bladder cancer. PMID: 3534313 BLCA-I
• A urine based marker of bladder cancer which may be useful for the detection of this disease. PMID: 15947579
BLCA-4
• A bladder cancer specific biomarker, is present in urine samples from patients with bladder cancer, but not in samples from healthy individuals. PMID: 16360453
• A bladder cancer marker that is highly specific and occurs early in the development of the disease. PMID: 14977841
• Urinary BLCA-4 determination appears to have high potential as a test for screening and monitoring bladder cancer in the general population and in groups at high risk for the disease, such as those with spinal cord injury. PMID: 10953114
BTA (Bladder tumor antigen)
• In combination with urine cytology is a more useful way for diagnosing TCC of the bladder. PMID: 1891992 CAl 9-9 (Carbohydrate antigen 19-9)
• Promising for use as a biomarker for the detection and monitoring of low-grade and low-stage bladder cancer, with the proviso that patients to be tested should be free of infection. PMID: 15764245 c-erbB-2
• The use of c-erbB-2 gene amplification, together with tumor grade and stage, could provide an accurate basis for determining the prognosis of bladder cancer. PMID: 10792078
Clusterin
• Serum and urine clusterin can differ between bladder cancer patients and the control group. Urine clusterin could be the possible laboratory marker of bladder cancer. PMID: 16830064
CYFRA 21-1
• Patients with transitional cell cancer of the bladder with evidence of distant metastases showed a significant increase in serum CYFRA 21-1. During chemotherapy CYFRA 21-1 appears to be a potentially sensitive and useful indicator for monitoring treatment response. PMID: 16217281
Cytokeratin-18 (CKl 8)
• It is clear that serum cytokeratin-18 level increases in patients with bladder cancer. However, it can only be useful as a tumor marker in the diagnosis of T(3) and higher staged tumors. This study indicated that cytokeratin-18 does not have any diagnostic value in lower stage bladder cancers. PMID: 12135697
Cytokeratin-20 (CK20)
• A potential marker for bladder cancer, and is significantly more sensitive than urinary cytology. PMID: 9817302
DD23
• Quantification in single cells may be particularly useful in targeting cystoscopic intervention for recurrence monitoring and, because of its high specificity, could be a tool for bladder cancer screening in high-risk groups. PMID: 8959319
• Expression can be used as an adjunct to cytopathologic evaluation to enhance the sensitivity of urinary cytology detection of TCC. PMID: 12639642
EMA (Epithelial membrane antigen)
• Could be a valuable indicator for histological grading or staging in pathological diagnosis and for predicting the survival of bladder cancer patients. PMID: 3303592 ERCCl
• A novel prognostic marker in advanced bladder cancer patients receiving cisplatin- based chemotherapy. PMID: 17229776
F-actin
• Could be an early and sensitive marker for bladder cancer detection and risk prognostication. PMID: 2032215
FAS
• a promising novel urinary marker for the detection of recurrent superficial bladder cancer. PMID: 16541433
FBP (fucose-binding proteins)
• Degree of expression of FBP binding sites correlates with the increased metastatic potential of bladder cancer and with poor patient survival times. PMID: 8339222
GNASl
• A novel independent prognostic marker for clinical outcome supporting a functional role of G(alpha)s in bladder cancer progression. PMID: 15824158
H19
• Can be used as a tumor marker in human bladder carcinoma, where its expression indicates a more malignant potential. PMID: 7855987
• Hyaluronic acid (HA), a glycosaminoglycan and known to promote tumor cell adhesion and migration, and its small fragments stimulate angio genesis, is a new sensitive and specific urine marker for bladder cancer. PMID: 9044859
Hyaluronan (HA)
• HA in addition to being one of the best markers for the initial evaluation of bladder carcinoma can be used to determine the presence of a residual tumor. This is associated with poor prognosis. PMID: 16310928
Hyaluronidase
• A diagnostic urine marker for high-grade bladder cancer. PMID: 9044860 hTERT
• Expression in urine sediments represents a reliable tool for the detection of primary urothelial neoplasms, equally specific, yet far more sensitive, than conventional cytology. PMID: 12893365
Lewis X antigen
• Lewis X antigen on exfoliated bladder cells enhances the detection of urothelial tumor cells, particularly from low grade and low stage neoplasms. PMID: 2405185 MMP-2 (matrix metalloproteinase-2)
• MMP-2 protein overexpression may be an independent prognostic biomarker for bladder cancer progression. PMID: 14624933
Neutral Endopeptidase
• WIl serve as a new tumor marker for bladder cancer as well as acute lymphatic leukemia. PMID: 7627835
NMP22 (Nuclear Matrix Protein 22)
• Recurrence marker in bladder cancer. PMID: 10900760
• Urinary NMP22 is a useful tool for the screening of urothelial cancer in patients with microscopic hematuria. PMID: 9170522. PMID: 9170521
• Urinary NMP22 is a useful diagnostic marker as a substitute for voided-urine cytology for the surveillance of urothelial cancer. PMID: 9076459
OCT-4
• An embryonic stem cell marker, is highly expressed in bladder cancer. PMID: 17205510 p53
• Can be used as a tumor marker for bladder cancer. PMID: 15503000
• p53 nuclear immunostaining yields clinically relevant information and may be a useful tool for selecting patients with superficial bladder cancer who might be resistant to BCG. PMID: 15041112
Prothymosin-alpha
• Urine prothymosin-alpha has the potential of being a useful tumor marker for the detection and follow-up of bladder cancer. PMID: 16461079
Survivin
• A sensitive marker for the noninvasive diagnosis of bladder cancer. PMID: 14713774 T antigen
• Useful to predict the response of bladder tumors to treatment with bacillus Calmette- Guerin and interleukin-2. PMID: 2477561
Telomerase
• An important marker in the diagnosis of bladder cancer. PMID: 15153335
• The presence of telomerase in bladder washes may be a specific marker of bladder cancer, especially in low-grade tumors. PMID: 9533519 • Can be determined in voided urine samples of patients with superficial bladder cancer. It has a higher sensitivity and specificity than conventional urinary cytology and is a good marker for diagnosis and follow-up of these patients. PMID: 10851728
Thymidine Kinase 1 (TK-I)
• A proliferation marker for determining prognosis and monitoring the surgical outcome of primary bladder carcinoma patients. PMID: 16391869
Thymidine Phosphorylase (TP)
• A prognostic marker for predicting recurrence in primary superficial bladder cancer. PMID: 16820903
TPA (Tissue polypeptide antigen)
• A useful marker not for the early detection of bladder cancer but for the monitoring of the efficacy of a treatment. PMID: 8694544
Transferrin Receptors (TFR)
• TFR activity in low grade superficial bladder tumors is a useful marker for predicting the recurrence rate. PMID: 2004229
UCAl (urothelial carcinoma associated 1)
• Avery sensitive and specific unique marker for bladder cancer. PMID: 16914571 Uroplakin II (UP II)
• Might be a more useful marker than CK 20 for detecting micrometastases of bladder cancer in the pelvic lymph nodes, although a greater number of patients and longer follow-up are needed to come to a definitive conclusion. PMID: 16280744
XIAP
• A prognostic marker of early recurrence of nonmuscular invasive bladder cancer. PMID: 17439739
Other Bladder Cancer Markers
• Resting NOR had a predictive value in the prognosis of patients with invasive bladder tumor. PMID: 11564895
• Microvessel density (MVD) in bladder carcinoma correlates with grade, stage and malignant potential of the tumor. PMID: 15783115
• Hydronephrosis is a prognostic marker in bladder cancer in a cystectomy-only series. PMID: 16904815
• The Ce6-PVP formulation appeared to have the potential as a fluorescent marker for fluorescence diagnosis of human bladder cancer. PMID: 16516376 Circulating Tumor Cells (CTCs):
[0201] Camelid or shark can be immunized with the biomarkers associated with circulating tumor cell. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be made using various methods such as, protease digestion, recombinant DNA technology and chemical means as described above. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be used in diagnosis, prognosis and/or treatment of cancer. Exemplary bladder cancer biomarkers are shown below.
Antigens Application
MUC-I Metastatic Breast Cancer
VCAM-I Breast Cancer
EpCAM Breast, Colon, Stomach, Pancreatic, lung and Gastric Carcinoma
CD44 Gastric and colon cancers E-Cadherin Gastric cancer. Therapeutic applications for breast cancer
VEGF Colon and breast cancers
bFGF Breast, head, and neck cancers sFasL Bladder and Gastric Carcinomas sFas (CD95) Leukemia, colon, breast and bladder cancers
p53 HCAb Breast, lung, colon, gastric, oral, and lymphoreticular cancers
Bcl-2 Protein Thyroid, prostate, colon, uterine cervix, bladder, and breast cancers
Cyclin Dl Ductal breast cancer, head and neck carcinoma
Cyclin E Breast cancer
TGF-betal Bladder cancer, ovarian carcinoma, live cancer, and prostate cancer
TNF-alfa Pancreatic cancer C-erbB2 (HER-2) Breast, ovarian, gastric, endometrial carcinoma, adenocarcinoma, and prostate cancer
EGFR Breast, brain, bladder, and head cancer.
Therapeutic target for c-HCAb
IGF-I and IGF-IR Breast, prostate, colon and lung cancers. IGF-IR is a therapeutic target
IL-2R Breast cancer, leukemia, head and neck cancer
Ras Protein Colon, bladder, gastric, and pancreatic cancers.
Ovarian, endometrial, and duodenal adenocarcinomas
C-Myc Colon carcinoma and adenomatous
BrainTumors / Lesions / Plaques:
[0202] A brain tumor is any intracranial tumor created by abnormal and uncontrolled cell division, normally either found in the brain itself (neurons, glial cells (astrocytes, oligodendrocytes, ependymal cells), lymphatic tissue, blood vessels), in the cranial nerves (myelin-producing Schwann cells), in the brain envelopes (meninges), skull, pituitary and pineal gland, or spread from cancers primarily located in other organs (metastatic tumors). Primary (true) brain tumors are commonly located in the posterior cranial fossa in children and in the anterior two-thirds of the cerebral hemispheres in adults, although they can affect any part of the brain. In the United States in the year 2000, it was estimated that there were 16,500 new cases of brain tumors which accounted for 1.4 percent of all cancers, 2.4 percent of all cancer deaths, and 20-25 percent of pediatric cancers. Ultimately, it is estimated that there are 13,000 deaths / year in the USA due to brain tumors.
[0203] Alzheimer's disease (AD) is sixth leading cause of death in the US. There are estimated 5.3 million Alzheimer's patients, with one new case being diagnosed every 70 seconds. AD is one of the most devastating diseases which deteriorate brain slowly but progressively to the point that the patient becomes non-functional. Neither there is a diagnostic test for AD nor any treatment.
[0204] Other brain diseases include: Parkinson's disease, Lyme's disease and Cysticercosis. Detecting Fetal Down Syndrome Biomarkers
[0205] In one embodiment, shark and camelid heavy chain only antibodies and their analogs can be used in capturing circulating fetal cells in a pregnant women's blood and diagnosing genetic disorders of the fetus such. Exemplary genetic disorder includes Down syndrome. Arginine/serine rich splicing factor 4 (RS SF4) is one of the biomarkers found only in the amniotic fluid of Down syndrome fetuses and not in normal pregnancies (Michael PE et al., Electrophoresis, 27, 1169 (2006)], transthyretin (TTHY), alpha- 1 -macro globulin (AMP), ataman (FAN) and Apo lipoprotein (APE) [Prenatal Diag., 28, 691 (2008)]. Other serum proteins which are upregulated in Down pregnancies are serum amyloid P-component (SAMP) and alfa-1- antitrypsin (ANITA). Accordingly, detecting one or more of the biomarkers such as RSSF4, TTHY, AMP, FAN, APE, SAMP, ANITA will provide a unique marker for diagnosing Down syndrome the same day the pregnant mother visits her doctor without having to wait for karyotyping results which can take up to three weeks. The detection of these biomarkers will facilitate the development of a non-invasive, safe test for Down syndrome.
Detection and Treatment of Brain Diseases;
[0206] Camelid or shark can be immunized with the biomarkers associated with BrainTumors / Lesions / Plaques. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be made using various methods such as, protease digestion, recombinant DNA technology and chemical means as described above. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be used in diagnosis, prognosis and/or treatment of BrainTumors / Lesions / Plaques. Exemplary BrainTumors / Lesions / Plaques biomarkers are shown below.
[0207] Exemplary biomarkers for brain tumor include:
Endosialin (tumor endothelial marker 1, TEMl)
Abundantly expressed in highly malignant and invasive brain tumors. PMID: 15624764 PGD-S (Prostaglandin D synthetase)
A 30 kDa glycoprotein also known as beta-trace protein that catalyzes the formation of prostaglandin D2 (PGD2) from PGH2, is a potentially useful marker for brain tumor. PMID: 9844724 PV-I (Plasmalemmal vesicle associated protein- 1) represents a novel marker of brain tumor angiogenesis and integrity of the blood-brain barrier and is a potential therapeutic target. PMID: 16278383 [0208] Exemplary biomarkers for Alzheimer's disease include:
ALZAS, Aβ42, Tau, DJ-I, Apo-E, GSK-3, Cystatain, Apo-Al, VGF Protein, beta and gamma-secretases and Bax-1
Cyto keratin 1 through 20:
[0209] In one embodiment, the invention provides a method for the development of shark and camelid heavy chain only antibodies and their analogs for use as immunohistochemical agents for cell surface, cytoplasmic and/or nuclear proteins for the identification of pathological cells from bodily fluids (blood, urine, saliva, semen, mucus, tears, etc) and tissues, but not limited to, cancer cells, bacterial cells including anthrax, viral cells, including SARS, HIV, HBV, and HPV, neurological cells, cardiac cells, fetal cells and cells of the autoimmune diseases. It is known that all epithelial neoplasms express cytoskeleton proteins of the cytokeratin (CK) family. Shark and camelid heavy chain only antibodies and their analogs for CKl through CK20 will be developed to distinguish between normal and neoplastic cells with much higher sensitivity and specificity than the conventional monoclonal antibodies.
[0210] High serum levels of CD44 have been detected in some solid tumors such as advanced gastric, colon, ovarian cancers, and non-Hodgkin lymphoma and B-cell chronic lymphocytic leukemia. CD44 is a adhesion molecule present on leukocytes. In other embodiment of the invention, single-domain antibodies for cell adhesion molecules including, but not limited to, CD44, VCAM-I, and ICAM- l(aka: EpCAM) will be developed to improve sensitivity and specificity of detection of various forms of cancer.
Camel and Shark Mini-, Micro-, and Nano-Antibodies against Cell- Adhesion Molecules for isolating and identifying Rare Cells (Cancer and Fetal Cells).
[0211] In other embodiments, the invention provides camelid and shark heavy chain only antibodies and their analogs for all the cell surface molecules known as cell adhesion molecules or the cluster of differentiation proteins (often abbreviated as CD). These proteins are used for the identification and investigation of cell surface molecules present on leukocytes. CD molecules can act in numerous ways, often acting as receptors or ligands (the molecule that activates a receptor) important to the cell. A signal cascade is usually initiated, altering the behavior of the cell. Some CD proteins do not play a role in cell signaling, but have other functions, such as cell adhesion. Approximately, 320 CD cell surface proteins are known as of today which are involved in various physiological functions.
[0212] Monoclonal antibodies (mAbs) have been generated by different laboratories around the world against epitopes on the surface molecules of leukocytes and nucleated erythrocytes. Since then, its use has expanded to many other cell types, and more than 320 CD unique clusters and subclusters have been identified. The proposed surface molecule is assigned a CD number once two specific monoclonal antibodies (mAb) are shown to bind to the molecule. If the molecule has not been well-characterized, or has only one mAb, it is usually given the provisional indicator "w" (as in "CDwI 86").
[0213] Anti-CD antibodies are also used as cell markers. For example, anti-CD34 antibody is used to capture and label embroynic cells, and anti-CD45 antibody for capturing and labeling leukocytes. The usefulness of these antibodies is obvious to anybody who is skillful biochemist or biologist. The table below illustrates the cell surface markers of some of the cells.
Table 3: CDs as Cell Markers
Figure imgf000093_0001
Type of cell CD markers
Thrombocyte CD45+, CD61+
Natural killer cell CD 16+. CD56+, CD3-
Camel and Shark Heavy Chain-Only Antibodies and Their Analogs as Therapeutic Agents:
[0214] Their ability to enter cells and cross blood brain barrier (BBB) make camelid and shark heavy chain-only antibodies and their analogs unprecedented biomolecules to treat human and animal diseases, including solid tumors and neurodegenerative diseases which so far have not been treatable. In particular, micro-, subnano- and nano-antibodies (exemplary structures include 2-4, and their bivalent and multivalent constructs 5-8, and analogs) are potential therapeutic agents for the treatment of diseases, namely, viral, bacterial, cancer, neurological, cardiac, metabolic, and diseases of immune disorders. Specifically, all analogs with Val37, Gly44, Leu45 and Trp47 of Vab domain substituted by one of the hydrophilic amino-acids, namely, lysine, histidine, etc., containing few 1-10 hydrophilic amino acid residues from the hinge -region, because of their higher solubility and stability to low pH and proteases, constitute the most vital therapeutic agents which might be orally administrable.
[0215] Due to their ability to enter the cell and cross BBB, the camelid and shark antibodies and analogs represent an unprecedented class of biological molecules to detect and treat all human diseases, including, but not limiting to solid tumors, infectious diseases, diseases of brain, metabolic system and autoimmune disorders. Therapeutic applications of camelid and shark heavy chain-only antibodies and their analogs may include inhibition of cellular uptake of pathogens, for example, HIV by blocking the CCR5 and CXCR4 host co-receptor the virus uses for entry into the cell. These antibodies and their analogs may also be directed to interfere with the function of key proteins involved in the pathogenesis of the diseases. For example, HIV viral envelope proteins, namely vif, LEDGF/p75, TSAlOl, gpl20 and gp41. In another example, the development of camelid and shark heavy chain-only antibodies and their analogs may be directed to inhibit/retard the function of a cancer causing proteins, for example, to inhibit the function of HER-2, a protein involved in the metastases of breast cancer. HER-2- positive breast cancer is a breast cancer that tests positive for a protein called human epidermal growth factor receptor-2 (HER-2), which promotes the growth of cancer cells. In about one of every three breast cancers, the cancer cells make an excess of HER2 due to a gene mutation. This gene mutation can occur in many types of cancer — not only breast cancer. Single-domain Herceptin might be more beneficial than the conventional Herceptin due to the fact that these antibodies are highly specific with none to low toxicity. Likewise, anti-Aβ42-nano-antibody, produced either in shark and /or camel, is likely to have superior performance to detect and treat Alzheimer's disease to classical mAbs.
[0216] Camelid and shark heavy-chain antibodies and analogs can be used against deadly toxin Clostridium botulinum (CB), a causative agent of botulism, against S. typhi, a causative agent of Typhoid fever, Bacillus anthracis a causative agent of anthrax, against Borrelia burgdorferi, a causative agent of Lyme disease, against Plasmodium falciparum, a causative agent of malaria.
Improving the Therapeutic Efficacy of Existing Anti-Cancer Antibodies
[0217] The present invention describes the production and use of camelid and shark heavy chain-only antibodies and their analogs for improving the therapeutic efficacy of existing FDA approved therapeutic antibodies for the treatment of cancer and few other diseases. Because of their small size, low molecular weight, higher specificity, solubility, stability, bio- distribution, and higher binding affinity than the conventional antibodies, these single-domain antibodies are the embodiment of the present invention for pharmaceutical applications. For example, Herceptin, developed by Genentech, FDA approved, has become a major therapeutic option for patients with HER-2 positive metastatic breast cancer. Despite its dramatic benefits, cardiac toxicity remains a limiting factor for Herceptin's chemotherapy use. Because of the higher specificity of shark and camelid heavy chain only antibodies and their analogs in general, single-domain Herceptin will potentially have far fewer side effects than the conventional antibodies. Accordingly, this invention provides a method for producing antibodies such as Herceptin in camelids and shark for medical diagnostics and pharmaceuticals. Such antibodies include but not limited to the antibodies listed below:
[0218] Single-Domain Antibodies and Analogs for Improving Efficacy of the Existing FDA Approved Therapeutic Antibodies:
HCAb Therapeutic Application
Herceptin Breast Cancer (HER-2 positive)
Zevalin Non-Hodgkin Lymphoma Carnpath Chronic Lymphocytic Leukemia
Mylotarg Acute Myeloid Leukemia
Rituxan Non-Hodgkin Lymphoma
Gemtuzumab Relapsed Acute Myeloid Leukemia
Alemtuzumab B Cell Leukemia
Abciximab Cardiac: Prevention of coagulation in coronary angioplasty
Crofab Rattlesnake Antidote
Synagis Respiratory Syncytial Virus
Remicade Crohn's Disease, Rheumatoid Arthritis
Zenapax Transplant rejection
Other Therapeutic Applications of Camelid and Shark Heavy Chain-Only Antibodies and Their Analogs
[0219] In still other embodiments, invention includes developing therapeutic camelid and shark heavy chain-only antibodies and their analogs that specifically binds to various disease biomarkers. Exemplary diseases include, but not limited to:
Viral, Cardiac, Neurological, Bacterial (STDs and Anthrax), Autoimmune Disorders, Organ Transplant Rejection.
Viral: HIV
[0220] HIV-I entry is mediated by the binding of the viral envelope protein to a specific receptor, CD4, which is expressed on the cell surface of T-lymphocytes and certain monocyte/macrophage populations. However, in contrast to other retroviruses, HIV also requires other co-receptors, such as, CCR5 and CXCR4, for entry into cell. Heavy chain- only antibodies and their analogs against these receptors to prevent HIV-I entry into the cell will be developed. Like, single-domain antibodies against the gpl20 envelope protein of HIV and V3 loop and gp41 will be developed to neutralize HIV-I.
[0221] Camelid or shark can be immunized with the biomarkers associated with HIV. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be made using various methods such as, protease digestion, recombinant DNA technology and chemical means as described above. Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be used in diagnosis, prognosis and/or treatment of HIV/ AIDS. Exemplary HIV/ AIDS biomarkers are shown below.
CD4 binding site of gp 120 LEDGF/p75
V3 1oop of gpl20 TSAlOl gp41 Viral Proteases vif Viral Reverse Transcriptase
CCR5 Viral Integrases
CXCR4
HBV:
[0222] In yet other embodiment, the invention provides Heavy chain-only antibodies and their analogs for the treatment of chronic hepatitis B by developing the antibodies and their analogs against the surface antigens. As a precedent, conventional antibody against the surface antigen, OST-577, has resulted in reduction of HBV DNA by 75% in a small patient pool. Camelid and shark heavy chain-only antibodies and their analogs antibody against the surface antigens of HBV, including OST-577, will be evaluated against HBV.
SARS:
[0223] SARS stands for severe acute respiratory syndrome. It is considered a bioterrorism weapon with mortality rates reaching over 40%. Fast and accurate diagnosis and treatment is of paramount importance to minimize causalities.
[0224] The SARS agent has been unambiguously identified as a new coronavirus member and named as SARS-coronavirus (SARS-CoV). Coronaviruses are enveloped, RNA viruses with the largest RNA genome known (About 30 kb). SARS-CoV pathogen causes fever, pulmonary edema, and diffuse alveolar damage in affected individuals leading to severe morbidity and mortality in humans.
[0225] The virus (represented as yellow sphere with spikes in the figure below) uses ACE2 receptor (shown as blue Y in the figure below) for internalization. Camelid or shark can be immunized with ACE2. Heavy chain-only antibodies and their analogs that specifically bind to ACE2 will be used to prevent SARS infection. In addition, Camelid or shark Heavy chain- only antibodies and their analogs will be developed against the SARS-CoV proteins, U122, S-protein and N-protein to therapeutically neutralize the virus. [0226] Heavy chain-only antibodies and their analogs that specifically bind to these biomarkers can be used in diagnosis, prognosis and/or treatment of SARS.
Camelid and Shark Heavy Chain-Only Antibodies and Their Analogs as Integrated Diagnostics and Therapeutics (theranostics) Agents:
[0227] One of the embodiments of the invention is to tie the diagnostics with the therapeutics by using the same heavy-chain antibody for neutralizing the disease as used for its detection. In other words, the diagnostic biomarker is also the therapeutic target. Such an approach is only possible when the tracer molecule is cell and BBB permeable and is not toxic. EGFR is a epidermal growth factor receptor that is over expressed in several carcinomas, such as, carcinoma of lungs, breast, bladder, prostate, etc. Heavy-chain antibody and their analogs, specifically, radionuclide labeled nano-antibody against EGFR can be used to scan breast or lung cancer using a PET scanner. Let us assume that tissues in the lungs turned out to be positive, and biopsy confirmed the scanning results. Receptor- mediated endocytosis will internalize the heavy-chain antibody and whatever (radionuclide and toxins, e.g., ricin) attached to it, specifically the ones with lower molecular weight. Once internalized, the toxin or radionuclide attached to the HCAb will destroy the cell. Thus, the antibody used for tracing the disease will be the one to neutralize the disease. Table 4 below lists some examples of heavy-chain antibodies against the diagnostic biomarkers which can also serve as therapeutic targets (also known as theranostics).
Table 4: Integrated Diagnostic and Therapeutic Biomarkers
Biomarker for Diagnostic Disease Reference and Therapeutic Target
1. B7- H3 Prostate Cancer Am. J. Pathol..167. 465 (2005)
2. CTLA-4 Prostate Cancer MSKCC.org/prostate cancer
(Medarex, Inc., and Bristol-Meyer Squibb jointly
developing a human anti-CTLA- 4
(MDX-OlO) for the treatment of
prostate cancer. 3. SSeCKS Prostate Cancer Defense Technical Info Center
Annual Report, Jan.3, 2000
4. AMACR Prostate Cancer Cancer Res., 62, 4427 (2002)
5. TMPRSS2-ERG Prostate Cancer Science, 310, 644 (2005)
6. PCA3 Prostate Cancer Clin. Chem., 52, 1089 (2006)
7. EPCA-2 Prostate Cancer J. Urolology, 174, 514 (2005)
8. HEPSIN Prostate Cancer J. Urol, 171, 187 (2004)
9. BAG-I Prostate Cancer The prostate, 45, 801 (2006)
10. HER-2 Breast Cancer Semin. Oncol, 28, 43 (2001)
11. Notch-4 Breast Cancer Stem Cell Rev., 3, 169 (2007)
12. ALDH-I Breast Cancer Stem Cell, J_, 555 (2007)
13. CXCR4 Breast Cancer Cell Proliferation, 36, 59 (2003)
14. RS/DJ-1 Breast Cancer Clin. Cancer Res.,7, 3328 (2001)
15. EGFR Colorectal Cancer Cancer Res., 57, 4838 (1997)
16. SMAD4 Colorectal Cancer Clin. Cancer Res., ϋ, 2606 (2005)
17. KRAS & BRAF Colorectal Cancer Nature Rev., 9, 489 9 (2009)
18. p53,TS, MSI-H Colorectal Cancer 2009 Gastrointestinal Cancer Symp.
19. REGlA and EXTL3 Colorectal Cancer AACR Meeting Abs. Sept. 12, 2006
20. TIMP-I Colorectal Cancer Edwards et al. (Eds.), The Cancer
Degradome, Springer Science, 2008
21. P1K3CA Colorectal Cancer J. Clin. Oncology, 27, 1477 (2009)
23. VEGF Colorectal Cancer Korean J. Gastro., 53, 68 (2009)
24. HAAH Colon Cancer J. Biomed. Biotech. 4, 175 (2004) 25 EpCAM Colorectal Cancer Endoc. Related CancerJJ., (2004)
26 • gpl20 HIV/AIDS Antiviral Res., 80, 251 92008)
27 Vif HIV/AIDS J. Virol, 66, 6489 (1992)
28 LEDGF/p75 HIV/AIDS J. Virol, 78, 9524 (2004)
29 TSlOl HIV/AIDS Antiviral Res., 78, Al 8 (2004)
30 Ki67, Ras and EGFR Lung Eur. Respir. J., 19, 1151 (2002)
31 Bax and plβ ™ Lung Eur. Respir. J. \9, 134 (2002)
32 Amyloid-beta Alzheimer's J. Clin. Invest., 115, 1121 (2005)
Disease (AD)
33 Tau AD Neurology, 68, 1718 (2005)
34. DJ-I AD Neurobiol Dis., 28, 122 (2007)
35. Gamma-Secretase AD J. Clin. Psychiatry, 70, 281 (2009)
36. ALZAS AD J. Cell. MoI Med., 12,1094 (2008)
37 ApoE AD J. Cell. MoI Med., 12,1094 (2008)
38. Cystatain AD J. Alzheimer's Dis., 8, 377 (2005)
39. VGF Protein AD J. Alzheimer's Dis., 8, 377 (2005)
40. Apo Al AD J. Alzheimer's Dis., 8, 377 (2005)
41. Kininogen Precursor AD J. Alzheimer's Dis., 8, 377 (2005)
42. Apo-H Parkinson's Neurology of Dis., xxx(2008) Disease (PD)
43. BDNF PD Neurology of Dis., xxx(2008) 44. IL-8 PD Neurology of Dis., xxx(2008)
45. VDBP PD Neurology of Dis., xxx(2008)
46. Beta2 -Microglobulin PD Neurology of Dis., xxx(2008)
47. Alfa-Synuclein PD Neurology of Dis., xxx(2008)
48. TEMl Brain Tumor PMID: 15624764
49. PV-I Brain Tumor PMID: 16278383
50. EGFR Multiple Cancers Korean J. Gastro., 53, 68 (2009)
[0228] Amino acid sequences of the exemplary biomarkers are listed as SEQ ID NO: 48-97 and shown in Fig. 30.
Nano-antibodies as Drug Delivery Vehicles:
[0229] Most drugs, particularly macromolecules, including conventional monoclonal antibodies, cannot enter the cell and/ or cross blood brain barrier (BBB) due to the presence of specialized endothelial tissue (aka BBB) between the brain and rest of the body. The delivery of therapeutic across the BBB is one of the biggest challenges of the pharmaceutical sciences in developing treatment for brain diseases. Currently, brain drug delivery approaches include both invasive and non-invasive procedures. Invasive procedures include cisternal, intracerebro ventricular, and intracerebral injections as well as cell and tissue grafting. Non-invasive strategies take advantage of receptors that selectively express on brain endothelium that help mediate transcytosis of proteins essential for normal brain function across the BBB, including transferring, insulin-like growth factors (IGF), and low density lipoprotein [Broadwell RD, and Banks WA, In The Blood Brain Barrier (Pardridge WJ., ed.), pp 156-199, Raven Press, New York ]. Delivery of macromolecules to the brain can be achieved by coupling peptides, proteins, and nucleic acids to antibody "vectors' that bind to these transporters or receptors and undergo receptor-mediated transcytosis. Proof-of- principle for this approach has been obtained by using an anti-transferrin receptor antibody chemically coupled to peptides such as endorphin, VIP (vasoactive intestinal polypeptide), and brain-derived neurotrophic factor [Pardridge WM, Drug delivery to brain, J. Cereb. Blood Flow Metab., 17, 713 (1997)], or oligonucleotides and plasmid DNA [Boado RJ et al, J. Pharm. Sci, 87, 1308 (1998)]. Unfortunately, only a small percentage of drugs gets delivered to the brain via receptor-mediated transcytosis across the BBB [Moos T, et al., Cell MoI. Neurobiol.,^0, 77 (200_?)]. [0230] Nano-antibodies and their multivalent constructs against receptors on human cerebromicrovascular endothelial cells (HCECs) will constitute novel drug delivery vectors to transport drugs across the BBB. Because of their small sizes and high specificity, nano- antibodies (and their analogs) against the HCEC receptors, when covalently coupled to other drugs such as antibodies (Nano- and classical antibodies), gene delivery vectors, small- interfering RNA (Si-RNA), micro-RNA, antisense-oligonucleotides, enzymes, proteins, peptides, nano-particles, and lipids, etc, will serve as novel vehicles to deliver drugs across the BBB and solid tumors.
[0231] The present inventions also contemplate diagnostic systems in kit form. A diagnostic system of the present inventions may include a kit which contains, in an amount sufficient for at least one assay, any antibody or its analogs against an antigen, buffers in a packaging material. Typically, the kits will also include instructions recorded in a tangible form (e.g., contained on paper or an electronic medium) for using the packaged antibodies and their analogs in a detection assay for determining the presence or amount of an antigen in a sample.
[0232] The various components of the diagnostic systems may be provided in a variety of forms. For example, required enzymes, antibodies and their analogs may be provided as a lyophilized reagent. These lyophilized reagents may be pre -mixed before lyophilization so that when reconstituted they form a complete mixture with the proper ratio of each of the components ready for use in the assay. In addition, the diagnostic systems of the present inventions may contain a reconstitution reagent for reconstituting the lyophilized reagents of the kit.
[0233] Some preferred kits may further comprise to a solid support for anchoring the antibody or its analogs of interest on the solid support. Examples of such solid support include but are not limited to beads, microparticles (for example, gold and other nano particles), microarray, microwells, multiwell plates and microchannels. The solid surfaces may comprise a first member of a binding pair and the antibody or its analogs may comprise a second member of the binding pair. Binding of the binding pair members will anchor the antibody or its analogs to the solid surface. Examples of such binding pairs include but are not limited to biotin/streptavidin, hormone/receptor, ligand/receptor, antigen/antibody.
[0234] Typical packaging materials would include solid matrices such as glass, plastic, paper, foil, micro-particles and the like, capable of holding within fixed limits antibodies and their analogs of the present invention. Thus, for example, the packaging materials can include glass vials used to contain sub-milligram (e.g., picogram or nanogram) quantities of antibodies or their analogs or they can be microtiter plate wells to which antibodies or their analogs of the present inventions have been operatively affixed, i.e., linked so as to be capable of participating in detection method.
[0235] The instructions will typically indicate the reagents and/or concentrations of reagents and at least one assay method parameter which might be, for example, the relative amounts of reagents to use per amount of sample. In addition, such specifics as maintenance, time periods, temperature, and buffer conditions may also be included.
Example 1
Production of Parent Heavy-Chain Mini- Antibodies (HCmnAbs) of Structure 1
[0236] Host animals such as camel, llama, or alpaca will be immunized with the desired antigen(s), for example B7-H3, a biomarker for prostate cancer or Amyloid-beta peptide antigenic peptide for detecting amyloid plaque, following the procedures described by Murphy et al, in 1989 [Am. J. Vet. Res., 50, 1279 (1989)], but with slight modification. Typically, immunization of camels is done with 50-100 ug immunogen per injection but 250 ug or higher amount of peptide per injection will be used, followed by 4 booster shots every two weeks after the initial injection. For baby sharks, 10 ug antigen/injection will be used. One antigen per animal for immunization will be used, though it may be feasible to immunize an animal simultaneously with multiple antigens to raise an immune response to each antigen separately, which can make the production cost effective [EMBO, J., 17, 3512 (1998); J. Immunol. Methods, 240,185 (2000)].
[0237] After immunization, 100 ml camel blood (or 5 ml from shark) will be withdrawn from the animal and the total IgGs will be precipitated out using ammonium sulfate precipitation procedure. Using size exclusion chromatography over Sephadex G-25, the conventional IgGs, MW 150 K Da, will be isolated from the mini-IgG with MW of 90 to 100 K Da. Affinity purification to obtain high affinity HCmnAb will be done by magnetic beads coated with antigenic peptide. Example 2 Recombinant Production of Micro, Sub-Nano- and Nano-antibodies Ia, Ib, and Ic
[0238] mRNA Isolation: Nano-antibody Jx will be produced by recombinant means which will involve using 10 ml blood from immunized camels, isolating total RNA from peripheral blood lymphocytes (PBLs). mRNA will then be isolated using Nucleotrap® mRNA kit. About 10 ug mRNA will be used for preparing first strand of cDNA after oligo (dT) priming using high fidelity reverse transcriptase.
[0239] cDNA Preparation: DNA fragments encoding nano-antibody Jx (Vab-hinge region) will be amplified by PCR using 1.0 ug cDNA , 80 to 100 pmol of Vab primer SEQ ID NO: 5 and hinge-region specific SEQ ID NO: 6, respectively, 0.2 mM dNTPs, 1 mM MgC12, , 5 ul of 1OX PCR buffer, and 0.6 ul Taq DNA Polymerase. After a first denaturation round of 94°C for 10 minutes, 35 to 36 cycles of amplification will be performed under conditions as described below:
Denaturation: 20 seconds at 94°C
Annealing: 30 Seconds at 56°C
Extension: 50 seconds at 72°C.
Final Extension: 10 min, 72°C
[0240] The sequence of the primers used for PCR amplification are as follows:
5 ' - gcaggagtctggaggaggc-3 ' (SEQ ID NO : 5) 5'- ggacatctgggacacgtgcac-3 ' (SEQ ID NO: 6)
[0241] Restriction sites such as Xho-1, Kpn-1, Bam-Hl, Sac, etc., will be built in the forward primer that are compatible with the vector of choice for inserting the PCR amplified product in the vector. The PCR product will be sized and purified on 1.5% agarose gel. The PCR product of the nano-antibody Ic gene may be reamplifϊed using 0.1 ug of the product using above conditions to improve the quality of the amplicon. The PCR amplicon will again be size selected and purified for restriction endonuclease digestion. Schematics of the cloning strategy is shown in Fig. 5. Example 3
Library or Plasmid Construction
[0242] Prior to cloning the PCR amplicon encoding Vab-CH2-CH3 fragments of micro- antibody, vector and the amplicon DNA will be digested with Sfϊl and Notl (Roche) following the cocktail:
Vab-CH2-CH3 Vector (ϋJTl)
DNA 5 ug 10 ug
1OX Restriction Buffer 5 ul 5 ul
Sfil (lOU/ul) 8 ul 4 ul
Water to 50 ul 50 ul
Incubate 500C for 8 hour
Notl 35U 30U
Reaction Buffer 4.5 ul 4.5 ul
Water to 60 ul 60 ul
Incubate at 37°C for 4-5 hours.
Ethanol Precipitate at -700C Pellet Pellet
Water 50 ul 50 ul
Agarose gel (1.5%) purification Pure DNA Pure Vector DNA
Encoding micro-HCAb
[0243] Library Ligation Vab-CH2-CH3 DNA = 200 ng Vector DNA = 1000 ng
1OX Ligase Buffer = 5 ul
T4 DNA Ligase = 1O U Water to = 50 ul
[0244] The reaction mixture will be incubated for 15 hours at 4°C, followed by ethanol precipitate at -700C. The pellet will be suspended in 10 ul. Phage Display Vectors used will be either pFARBER (NFCR) or pLUCK (Pharmacia) or pJTl (Sigma) Electroporation
[0245] 250 ul of E. CoIi TGl cells will be made electrocompetent with BRL Cell-Porator® following vendor protocol.
Example 4
Selection of Phage-Displayed Antibody Analog Library:
[0246] Electroporated TGl cells will be transfected with the vector-Vab-CH2-CH3 DNA or vector-Vab-HR-CHl or vector- Vab-HR-CH2. Approximately, 1010 cells will be grown to mid-logarithmic phase before injection with M13K07 helper phages. Virions will be prepared as described in the literature [Andris-Widhopf J., et al, J. Immunology Methods, 242, 159 (2002)] and will be used for panning at a titre of 1013/ml. Specific Vab-CH2-CH3, or Vab-HR-CHl or Vab-HR-CH2 antibody against the antigenic peptide will be enriched by five consecutive rounds of panning using magnetic beads conjugated with antigenic peptide. Bound phage particles will be eluted with 100 mM TEA (pH 10.00), and immediately neutralized with IM Tris.HCl (pH 7.2) and will be used to reinfect exponentially growing E. CoIi TGl cells.
[0247] The enrichment of phage particles carrying antigen-specific Vab-CH2-CH3, or Vab- HR-CHl or Vab-HR-CH2 will be assessed by ELISA before and after five rounds of panning. After the fifth panning, individual colonies will be picked up to analyze the presence of the virion binding by anti-M13-HRP conjugate.
Example 5
Phage-Displayed Micro-Antibody Library with Amino Acid 45 substituted by
Hydrophilic Amino acids
[0248] Phage-Displayed Micro-Antibody Library will also be developed to substitute amino acid at position 45 with Lys, His, Ser, Asn, GIn, Arg, GIn, GIu, Cys, Asp, Thr, and will be screened as described above. These changes will be made by substituting appropriate nucleotide codons in place of Ieu45 codons. This will help to study the structure -activity relationship. Example 6
Expression and Purification of the Heavy-Chain Single -Domain Nano-Antibody Fragments (Vab-HR-CHl Human IgG):
[0249] The selected positive clones will be used to infect a new bacterial strain, HB 2151 , a non-suppressor strain that recognizes the amber codon as a stop codon for soluble protein production. The HB2151 cell harboring the recombinant phagemids will be grown at 28°C in 250 ml 2X YT-ampicillin, 1% glucose in culture flasks until OU6oo 0.7. The cells will be washed and resuspended in 250 ml 2X YT-ampicillin, supplemented with ImM isopropyl- BD-thiogalactopyranoside (IPTG), and will be incubated over night at 22°C to induce protein expression. Before adding IPTG to the cultures, a portion will be spotted on an LB/ampicillin plate for future analysis of the clones. The culture will be then be centrifuged at 4000 RPM for 15 minutes to pellet the bacterial cells. The culture supernatant will then be screened by ELISA for antigen-specific binding.
Example 7
Recombinant Production of Micro-antibody Ia, and Sub-nano-antibody Ib
[0250] The procedure will be similar to the one described above for micro-nano-antibody except the PCR primers will be different. Briefly, mRNA will be isolated from peripheral blood mononuclear cells (PBMs) and cDNA will be cloned by reverse transcriptase-PCR with oligo-dT promoter. Vab gene carrying the hinge region and CH2 will be amplified with PCR primers SEQ ID NO: 5 and 98 specific for amplifying Vab and CH2 domain to obtain amplicon encoding for sub-nano-antibody Vab-HR-CH2, Ib.
Forward primer: 5'-gcaggagtctggaggaggc-3' (SEQ ID NO: 5)
Reverse primer: 5'-ggtccagctgctcgagtctgg-3'(SEQ ID NO: 98)
To amplify the DNA for micro-antibody Ia, primers pairs SEQ ID NO: 5 and 99 will be used to produce PCR product encoding the Vab-CH2-CH3 gene
Forward primer: 5'-gcaggagtctggaggaggc-3' (SEQ ID NO: 5) Reverse primer: 5'-tagtgcaccaccatcaccatcactaa-3' (SEQ ID NO: 99) The PCR products will be purified on agarose gel, reamplifϊed using nested PCR primers containing restriction site on both ends of the gene. The final PCR product will be cloned into the phagemid vector and transformed in electro-competent E. coli TGI cells. The sub- nano Vab repertoire of structure 3 will be expressed on phage after infection with M13K07 helper phages. Specific virions against the antigen will be enriched by three consecutive rounds of in- vitro selection on 96-well plates coated with antigen. The bound virions from antigen coated plated will be eluted with 0. IM Tris.HCl, pH 7.4, and will be used to infect exponentially growing E. coli cells. After three round of panning, polyclonal phage ELISA will be performed to monitor the success of selection. Pools of virions from each round will be incubated on antigen coated and non-coated wells. Binding will be detected using an anti- M13-HRP conjugate. Monoclonal phage ELISA will be used to identify individual positive clones, which will be then resequenced to identify Vab-Henge-CH2 gene. This gene will then be cloned and expressed in the periplasm. Purification of Vab-Hinge-CH2, 3, sub-nano- antibody will be done by affinity chromatography. The antibody will then be tested for recognition in ELISA.
[0251] Procedure for the production of Nano-antibody without the human CHl Domain will be the same except the human CHl domain will not be ligated to the PCR amplified Vab-HR DNA.
Example 8
Expression and Purification of the Heavy-Chain Single -Domain Micro- Antibody, Ia,
Fragments and Analogs
[0252] The selected positive clones of Vab-CH2-CH3 , Vab-HR, Vab-HR-CH 1 with substituted amino acid at position 45, Vab-CH2-CH3 with substituted amino acid at position 45, Vab-HR with substituted amino acid at position 45 will be used to infect a new bacterial strain, HB 2151, a non-suppressor strain that recognizes the amber codon as a stop codon for soluble protein production. The HB2151 cell harboring the recombinant phagemids will be grown at 28°C in 250 ml 2X YT-ampicillin, 1% glucose in culture flasks until OD600 0.7. The cells will be washed and resuspended in 250 ml 2X YT-ampicillin, supplemented with ImM isopropyl-BD-thiogalactopyranoside (IPTG), and incubated over night at 22°C to induce protein expression. Before adding IPTG to the cultures, a portion was spotted on an LB/ampicillin plate for future analysis of the clones. The culture will be then be centrifuged at 4000 RPM for 15 minutes to pellet the bacterial cells. The culture supernatant will then be screened by ELISA for antigen-specific binding. Example 9
Production of Bivalent Nano-antibody (Vab-CHl-CHl-Vab) using Recombinant DNA
Technology
[0253] The recombinant nano-antibody , Vab-CHl, from example 6 will be digested with
Vab CHl cat y restriction nucleaseNcol to obtain ^^^^^ J]16 restriction site Ncol will be built in the PCR primers.
[0254] Meanwhile, the gene encoding the CHl -Vab (human CHl-camelid Vab) will be constructed and digested with Ncol, the restriction site for which is built at the 5 '-end of
C H l V a b
PCR primer spanning the CHI of human IgG to obtain 3 "g ta c c
The ligation of these two gene constructs will give rise to Vab-CHl -CHl -Vab where Vab represents variable antigen-binding domain of came lid and or shark antibodies. Amplification of this bivalent construct will be done using PCR primers SEQ ID NO: 5 and SEQ ID NO: 100.
Forward primer: S'-gcaggagtctggaggaggc-S' (SEQ ID NO: 5) Reverse primer: 5'-tgcctaacggcgtgtcattatg-3'(SEQ ID NO: 100)
The PCR product will be gel purified and inserted into the phagemid as described using restriction sites built in at both extremities of the amplified fragment as shown in Fig. 7.
[0255] Finally, the recombinant plasmid and the PCR fragment will be mixed and ligated using T4 DNA ligase. The ligated product, containing the bivalent nano-antibody gene construct will be used to transfect E. CoIi WK6 electrocompetent cells. The clones containing the bivalent construct were screened by PCR using forward and reverse universal primers. Clone that will give rise to an amplified product of -1000 bp will be sequenced using HCABI Prism 677) to confirm the bivalent gene insert. After expression, the encoded protein will be tested by ELISA.
Example 10
Chemical Synthesis of Analogs of Single-Domain Camel Antibodies Heavy-Chain Micro- Antibody Ia:
[0256] Micro-antibody J_a will be prepared by treating mini-antibody 1 (2 mg) with 1.0 ml of 10 mM TCEP (tris-carboxyethyl-phosphine) in 20 mM Phosphate/150 mM NaCl, pH7.4 at room temperature (RT) for one hour. The resulting micro-antibody J_a will be desalted on centricon-3 to remove the excess reagent and the buffer and stored at 40C in IX PBS.
Heavy-chain Sub-nano-antibody l_b:
[0257] Micro-antibody j_a_will be treated with trypsin or pepsin under controlled conditions to cleave the CH2-CH3 domains from the antibody. After deactivation of the proteolytic enzyme with fetal calf serum, the subnano-antibody l_b will be isolated using size exclusion chromato graphy .
Heavy-chain Nano-antibody Ic:
[0258] Sub-nano-antibody l_b will be treated with pepsin at a low pH of 4.5 in 2M sodium acetate buffer under mild conditions for 1-8 hours to cleave the CH2-CH3 domains from the antibody. After deactivation of the proteolytic enzyme with fetal calf serum, the nano- antibody Jx will be isolated using size exclusion chromatography.
Bivalent Nano-antibody _ld:
[0259] Nano-antibody Jx will be treated with NHS-PEG-MaI, 17, in 50 mM MOPS/150 mM NaCl, pH 6.8, at RT for 1 hour to obtain the pegylated conjugate JJ. (Fig. 8) which will be purified by dialysis on C-3 Amicon filters. Also, nano-antibody Jx will be modified with Traust's Reagent following manufacturer protocol to obtain thiolated nano-antibody J_2. Conjugation of JJ_ with J_2 in pH 6.5 buffer for 2 hours at RT will give, after dialysis on C-3 Centricon membranes, the dimeric conjugate Id which will then be analyzed by ELISA and Western blot assays. An exemplary reaction schematics is shown in Fig. 8.
[0260] Alternatively, dimer Jji will be obtained by oxidation with iodine or sodium periodate as shown in below in Fig. 5. Briefly, the sub-nano-antibody, Vab-CHl, Jx, (1 mg), will be dissolved in 1.0 ml of 20 mM phosphate/NaCl, pH 7.4 (PBS), and treated with a solution of 10 mM sodium periodate in 90% PBS/10% DMF for 2 hours. The dimer id obtained will then be purified by size exclusion chromatography. An exemplary reaction schematics is shown in Fig. 9.
Multivalent Analogs
[0261] Chemical synthesis of trivalent, tetravalent and multivalent analogs of Vab domain of came lid antibodies lacking the light-chains will be developed as shown below in Fig. 10, 11, 24. Protocol for Developing Trivalent and Tetravalent Vab Antibodies:
[0262] Bivalent Vab antibodies, Id, prepared by oxidative dimerization or chemical ligation, will be conjugated with NHS-(PEG)3-MaI (10 folds excess) in MOPS buffer at pH 7.0 for 1 hour at RT. Chemical ligation of the resulting dimeric and monomeric pegylated products J_3 and J_4 will with thiolated nano-antibody Vab-HR, lc.i (figure 3) will be carried out by combining the two at pH 6.8 buffer containing 5 mM EDTA and allowing the reaction to occur at RT for at least 2 hours. The so formed trivalent, lei, and tetravalent Vab, Ie, constructs will be purified by size exclusion chromatography and stored at 4°C in PBS containing 0.02% NaN3.
[0263] Pentavalent and higher analogs of nano-antibodies (Vab domains of camel antibodies) can be similarly prepared.
[0264] Trivalent nano-antibodies can also be readily prepared from symmetrical cyclic or acylic triamines, such as, 1, 5, 9-triamine-cyclododecane Jj), or triazine like triamines of structure 22, or tris-isopropyl- amine like derivatives, 24, by treatment of the starting amine with n-hydroxy-succinimide (NHS)- analogs of nano-antibodies, such as 20_(Fig. 11). Purification can be accomplished by HPLC on a C4 or C 8 column.
Example 11
Conjugates of Analogs of Single-Domain Camelid Antibodies
[0265] Conjugates of analogs of single-domain camelid antibodies can be prepared for diagnostic and therapeutic purposes. Examples of some conjugates are shown in Fig. 12.
[0266] Heavy-chain antibodies, 1,1a, Ib, Ic, (1 mg each, approximately 22, 44, 66, 132 nmols, respectively) in 1.0 ml PBS, pH 7.0, will be treated with freshly prepared commercial.
[0267] 10 mM NHS-PEG-Maleimide at room temperature for one hour with gentle rocking of the reaction mixture. After neutralizing the excess reagent with 10 ul of 0.1 M glycine, pH 7.0. The reaction mixture will be desalted by dialysis on centricon-10 to remove the hydrolysed reagent and excess glycine. The corresponding pegylated antibodies will then be conjugated with thiolated haptens, fluorophores, enzymes and proteins to obtain conjugates of haptens, proteins, enzymes and antibodies of structures 25, 26, 27, and 28, respectively (Fig. 12A). After desalting as described above, the conjugate can be further purified by affinity purification if needed. [0268] Similarly, bivalent and trivalent constructs of nano-antibodies will be first pegylated and subsequently treated with thiolated haptens, fluorophores, enzymes and proteins to obtain their corresponding hapten, fluorophores, enzymes and protein conjugates of structures 29, 30, 31, and 32, respectively (Fig. 12B).
[0269] Nucleic acid conjugates of mini- and nano-antibodies j_a - j_g will also be prepared using their pegylated conjugates followed by treatment with the thiolated-DNA/RNA molecules of interest. Fig. 13 shows the pegylation of mini-, micro-, sub-nano- and nano- antibodies to yield the corresponding pegylated products 33 , 34, 35, 36, and 37, respectively as shown in Fig. 13. Though not shown, pegylation of Ie, If, and j_g will be performed as described above. Fig. 14 shows the conjugation of thiolated DNA/RNA (synthetic, recombinant or natural) to obtain mini-and nano-antibodies conjugated with DNA/RNA (nucleic acids) with the structures 38, 39, 4O141, 4I1 4I1 44. and 45.
Example 12
Immobilization of Camelid Single-Domain Antibodies and Analogs onto Solid Matrixes
[0270] Immobilization of heavy-chain only antibodies, j_a through j_g, onto solid matrixes, such as gold particles, magnetic particles, microchannels, glass particles and other solid surfaces will be accomplished using the steps outlined in Fig. 15. Aminated solid matrix 46 will first be derivatized with NHS-PEGn-MaI 47, where n= 1-100, (20 fold molar excess) at pH 7.0 for 1 hour at RT. The solid matrix will then be washed thoroughly with the same buffer (50 mM MOPS/150 mM NaCl, pH 7.0). Any unconjugated amine groups will be masked with sulfo-NHS-Acetate (Pierce) by incubated the solid matrix with 40 fold excess of the reagent at Ph 7.0 for 30 minutes. After washing off the excess masking reagent, the pegylated matrix 48 will then be conjugated with thiolated heavy-chain antibody 50 (2.5 X excess) over the starting amine concentration. The conjugation will be performed at pH 6.5 for 2 hours at RT with gentle shaking of the matrix. The unused antibody will be recovered, and the matrix very well washed with IX PBS /0.5% Tween-20 to obtain complex 5J_ in which nano-antibody is covalently bound to a solid matrix. The activity of the bound heavy- chain antibody will be measured using ELISA.
[0271] Direct labeling of heavy-chain antibodies with ligands and fluorophores can also be accomplished by treating the corresponding NHS analog of the hapten, such as, NHS-X-R, with the heavy-chain nano-antibody at neutral pH as described Above. Ligand can be animated or thiolated or carboxylated. Anyone who is skilled in the art would know how to conjugate bifunctional linkers with amines, carboxyls and thiols.
Example 13
Production of Heavy-Chain Single-Domain Shark IgNAR (Structure 2)
[0272] Immunization of Sharks and Isolation of Shark IgNAR: Baby sharks will be immunized with the desired antigen(s), for example ALZAS, Tau, Abeta42 peptide which are the potential biomarkers for Alzheimer's disease, following the protocol described by Suran et al [J. Immunology, 99, 679 (1967)]. Briefly, the antigen (20ug per kg animal weight), dissolved in 20 mg/ml keyhole limpet hemocyanin (KLH) supplemented with 4 mg /ml complete Freund's adjuvant, will be injected intramuscularly. Four booster shots every two weeks four weeks after the initial injection will be administered.
[0273] After immunization, 3-5 ml shark blood will be withdrawn from the animal and the total IgGs will be precipitated out using 50% ammonium sulfate, followed by centrifugation at 2000 RPM for 10 minutes. After discarding supernatant, the precipitate will be dissolved in 20 mM PBS/150 mM NaCl containing 0.02% sodium azide and size fractionated on Sephadex G-200. The conventional IgGs, MW -230 KDa, will be separated out from the shark IgNAR with MW of -180 K Da. Alternatively, the conventional IgG fraction will first be depleted with protein G bound to magnetic beads, followed by isolation of V-NAR protein with magnetic beads coated with protein-A. Affinity purification to obtain high affinity shark Ig-NAR 2 will be done by magnetic beads coated with antigenic peptide. After determining the amino acid sequence of the IgNAR, nucleic acid sequence will be derived based on amino acid sequence and recombinant DNA protocols will be established to produce the antibody on a large scale . A schematics for the method of developing several analogs are shown in Fig. 17 and 18.
Example 14
Isolation of RNA from Immunized Shark's Lymphocytes and Cloning:
[0274] Isolation of total RNA from immunized sharks will be done from 3-5 ml of shark blood using commercially available RNA extraction kits such as Bio-Rad's AquaPure® RNA Isolation kit. Reverse transcription using oligo-dT primer will be achieved by PCR using high fidelity DNA polymerase to obtain the IgNAR cDNA 58 shown in Fig. 19.
Ill Example 15
Recombinant Production of Shark Heavy Chain Only Antibodies and Their Analogs
[0275] An exemplary cloning strategy is shown in Fig. 19. Amplicons for IgNAR cDNA 5Ji and its analogs will be performed using the following protocol:
IgNAR cDNA = 1.0 ug
Primers Mix = 10 pmol (forward and reverse primers)
I mM dTNPs = 10 ul
10 mM MgC12 = 5 ul
1OX PCR Buffer = 5 ul
Taq DNA Polymerase = 0.6 ul
Water to = 50 ul
[0276] After first denaturation round of 94°C for 10 minutes, 35 to 36 cycles of amplification will be performed under conditions as described below:
Denaturation: 20 seconds at 94°C
Annealing : 30 Seconds at 56°C
Extension: 50 seconds at 72°C
Final Extension: 10 min, 72°C
[0277] All or portions of IgNAR cDNA using different combinations of the following forward and reverse primers.
Forward primers
5 ' -gcatgggtag accaaacaccaag-3 ' (SEQ ID NO : 18)
5 ' -gcgtcctcagagagagtcccta-3 ' (SEQ ID NO : 19)
5'-gagacggacgaatcactgaccatc-3' (SEQ ID NO: 20)
5'- gggtagaccaaacaccaagaacagc-3 ' (SEQ ID NO: 21)
Reverse primers
5 '-gttctagccaataggaacgtatag-3 ' (SEQ ID NO: 22)
5'-gtttgcacaagagagtagtctttac-3' (SEQ ID NO: 23)
5 '-cctaaattgtcacagcgaatcatg-3 ' (SEQ ID NO: 24)
5 ' - gtgcagttccctagaagtcttg-3 ' (SEQ ID NO : 25) [0278] After amplification, the amplicon will be purified on 1.5% agarose. The amplicon will be extracted from the gel and its 5 '-end kinased with gamma- ATP for blunt-end ligation with the phage-display vector using T4 DNA-ligase following standard ligation protocols.
[0279] Library or Plasmid Construction: Prior to cloning, the PCR amplicon encoding IgNAR gene will be digested with Sfϊl and Notl (Roche) following the cocktail:
V-NAR-CH2-CH3- Vector
DNA 5 ug 10 ug
1OX Restriction Buffer 5 ul 5 ul
Sfil (lOU/ul) 8 ul 4 ul
Water to 50 ul 50 ul
Incubate 5O0C for 8 hour
Notl 35U 30U
Reaction Buffer 4.5 ul 4.5 ul
Water to 60 ul 60 ul
Incubate at 370C for 4-5 hours.
Ethanol Precipitate at -700C Pellet Pellet
Water 50 ul 50 ul
Agarose gel (1.5%) purification Pure DNA Pure Vector DNA
Encoding micro-HCAb
Vector Ligation:
IgNAR DNA = 200 ng
Vector DNA = 1000 ng
1OX Ligase Buffer = 5 ul
T4 DNA Ligase = 1O U
Water to 50 ul
Incubate 15 hours at 4°C.
Ethanol Precipitate at -700C
Suspend pellet in 10 ul.
Electroporation :
[0280] 250 ul of E. CoIi TGl cells will be made electrocompetent with BRL Cell-Porator® following vendor protocol. [0281] Panning of Phage-Displayed IgNAR- Antibody 2 Library: Electroporated TGl cells will be transfected with the phagemid-IgNAR DNA insert. Approximately, 1010 cells will be grown to mid- logarithmic phase before injection with M13K07 helper phages. Virions will be prepared as described in the literature [Andris-Widhopf J., et al, J. Immunology Methods, 242, 159 (2002)] and used for panning at a titer of 1013/ml. Specific IgNAR antibody against the antigenic peptide will be enriched by five consecutive rounds of panning using magnetic beads conjugated with antigenic peptide. Bound phage particles will be eluted with 100 mM TEA (pH 10.00), and immediately neutralized with IM Tris.HCl (pH 7.2) and will be used to reinfect exponentially growing E. CoIi TGl cells.
[0282] The enrichment of phage particles carrying antigen-specific IgNAR antibody will be assessed by ELISA before and after five rounds of panning. After the fifth panning, individual colonies will be picked up to analyze the presence of the virion binding by anti- M13-HRP conjugate.
Example 16
Expression and Purification of the Single -Domain IgNAR 2:
[0283] The selected positive clones will be used to infect a new bacterial strain, HB 2151 , a non-suppressor strain that recognizes the amber codon as a stop codon for soluble protein production. The HB2151 cell harboring the recombinant phagemids will be grown at 28°C in 250 ml 2X YT-ampicillin, 1% glucose in culture flasks until OD6Oo 0.7. The cells will be washed and resuspended in 250 ml 2X YT-ampicillin, supplemented with ImM isopropyl- BD-thiogalactopyranoside (IPTG), and incubated over night at 22°C to induce protein expression. Before adding IPTG to the cultures, a portion will be spotted on an LB/ampicillin plate for future analysis of the clones. The culture will be then be centrifuged at 4000 RPM for 15 minutes to pellet the bacterial cells. The culture supernatant will then be screened by ELISA for antigen-specific IgNAR protein 2.
Example 17
Chemical Synthesis of Shark Heavy Chain Only Antibodies and Their Analogs TCEP Treatment:
[0284] Shark IgNAR Mini-antibody 52 will be prepared by treating parent antibody 2 (2 mg) with 1.0 ml of 10 mM TCEP (tris-carboxyethyl-phosphine) in 20 mM phosphate/150 mM NaCl, pH7.4 at room temperature (RT) for one hour as shown in Fig. 18. The resulting mini-antibody 52 will be desalted on centricon-10 filters to remove the excess reagent and the buffer and stored at 4°C in IX PBS containing 0.05% NaN3.
Chemical Synthesis of Micro- Antibody, 55:
[0285] Mini-antibody 52 will be treated with pepsin under controlled conditions to cleave the CH3-CH4-CH5 domain from the antibody. After deactivation of the proteolytic enzyme with fetal calf serum, the micro-antibody 5_5 will be isolated using size exclusion chromatography and stored at 4°C in PBS containing 0.05% NaN3.
Chemical Production of Shark Sub-Nano- Antibody, 53:
[0286] Micro-antibody 5_5 will be treated with trypsin under milder conditions at pH 4.5 to cleave the CH2 domain from the antibody 5_5. After deactivation of the proteolytic enzyme with fetal calf serum, the sub-nano-antibody 53_ (V-NAR-HR-CHl) will be isolated using size exclusion chromatography and stored at 4°C in PBS containing 0.05% sodium azide.
Chemical Production of Shark Nano- Antibody, 72:
[0287] Mini-antibody 53. will be treated with tropism /papain/pepsin under milder conditions at pH 4.5 to cleave the CHl domain from the antibody 53. After deactivation of the proteolytic enzyme with fetal calf serum, the nano-antibody 72 (V-NAR-HR-CHl) will be isolated using size exclusion chromatography and stored at 4°C in PBS containing 0.05% sodium azide.
Attachment of Hydrophilic Linker to Shark Antibodies 2, 52, 53, 54, 55, and 72:
[0288] Shark antibody (5 nM), produced using cloning techniques and/or chemical methods, will be dissolved in 0.5 ml of 50 mM MOPS/150 mM NaCl, pH 7.0, and treated with NHS-(PEG)n-Maleimide (50 nM, 10X) at RT for 1 hour with gentle shaking of the reaction contents. The reaction mixture will then be dialyzed/concentrated on centricon-3 to remove excess of the reagent to obtain antibody analogs 67, 68^1 69, 70, and 72 shown by their general structures in Fig. 18. The conjugation schematics are shown in Fig. 22.
Chemical Synthesis of Bivalent V-NAR 78
[0289] V-NAR 74 will be treated with NHS-PEG-MaI in 50 mM MOPS/150 mM NaCl, pH 6.8, at RT for 1 hour to obtain the pegylated conjugate 76 (figure 17) which will be desalted by dialysis on C-3 Amicon filters. Also, nano-antibody 74 will be modified with Traust's Reagent following manufacturer protocol to obtain thiolated nano-antibody 77. Conjugation of 76 with 177 in pH 6.5 buffer for 2 hours at RT will give, after dialysis on C-3 Centricon membranes, the dimeric conjugate 78 which will then be tested by ELISA and Western blot assays. The reaction schematics are shown in Fig. 23.
Chemical Synthesis of Multivalent V-NARs:
[0290] Tetravalent and pentavalent shark antibodies can be generated from the bivalent analog, 78. Bivalent V-NAR 78 will be treated with short NHS-PEG3-Mal as described above. After the reaction is over, the pegylated dimer will be dialyzed on centricon-10, followed by treatment with the thiolated V-NAR nano-antibody 77. The tetravalent conjugate 79 so obtained will be purified by size exclusion chromatography. The reaction schematics are shown in Fig. 24.
Example 18
Capture and Detection of Pathogenic Antigens/Proteins Using Shark and Camel Single- Domain Antibodies (sdAbs)
[0291] Serum from patient blood (10 ml), collected in EDTA tubes will be treated with shark and camelid heavy chain only antibodies and their analogs coated magnetic beads for 1- 2 hours on a rotator with gentle rotation to bind the antigen. The beads will be separated using a magnetic rack and subsequently washed very well with PBS/1% BSA. The antigen- micro-antibody complex so formed will be treated with complex, detection antibody bound to an enzyme (AP, HRP, Luciferase, beta-galactosidase, gold particles) or DNA to sandwich the antigen between the shark and camelid heavy chain only antibodies and their analogs and the detection antibody forming the complex which will be detected either using an enzyme substrate or AgNO3 if the detection antibody is conjugated to gold particles. Exemplary schematics of the process is shown in Fig. 25. Alternatively, the detection antibody could be conjugated to DNA molecules which can then be amplified by PCR to obtain detection sensitivity equivalent to the detection of DNA by PCR as shown in Fig. 26.
Example 19
Capture and Detection of Rare Cells Using Shark and Camelid Heavy Chain Only
Antibodies and Their Analogs
[0292] Fresh 5 ml patient blood will be diluted with 20 ml lXPBS/1 %BSA to 25 ml. To capture circulating tumor cells (CTCs), this sample will then be passed through a micro- fluidic device coated with an appropriate shark and camelid heavy chain only antibodies and their analogs, such as, anti-EpCAM-mini-antibody following flow rate recommended by the manufacturer. To ensure that antibody or its analogs does not lose any activity upon conjugation, all solid matrixes will first be coated with a hydrophilic polymer, such as, NHS- PEG-MaI (MW 5000). The conjugation of the thiolated shark and camelid heavy chain only antibodies and their analogs with maleimido-group of the polymer will be achieved at pH 6.8 in a buffer containing 5% EDTA. An exemplary schematics of the process is shown in Fig. 27.
[0293] Alternatively, magnetic beads coated with EpCAM can be used. EpCAM (epithelial cell adhesion molecules) is frequently over expressed by carcinomas of lung, colorectal, breast, prostate, head and neck, liver, and is absent from hematological cells. The captured cells will be washed with 1%PBS (no BSA). The cell will be fixed with methanol, and then DAPI stained following CK8 or CKl 8 and CD45. Identification and enumeration will be done by fluorescence microscopy based upon the morphological characteristics, cell size, shape, and nuclear size. DAPI+, CK+, and CD45" cells will be classified as CTCs.
[0294] Method for capturing fetal cells will be the same except the antibody used for coating micro-fluidic device will be different, for example, anti-CD71 -mini-antibody, an antibody that recognize transferrin receptor on fetal cells. The captured cells can be enumerated by FISH or PCR.
[0295] Alternative Strategies to Capture Circulating Tumor Cells (CTCs): CTCs will be captured as shown by the steps outlined in platform 3. Patient's blood (2-3 ml) (or urine 15- 20 ml after centrifugation to pellet down the cells and suspending them in 1-2 ml HBSS media) will be incubated with an appropriate mini-HCAb (1.5 ug/ml blood sample) at 4°C for one hour. For example, to capture epithelial cancer cells, such as from breast, prostate, and ovarian cancers, biotinylated- anti-EpCAM-mini-antibody (camel antibody against EpCAM antigens) will be used to label the circulating cancer cells in the blood. After diluting with HBSS or RPMI- 1640 media or 1XPBS/2.5%BSA to lower the sample viscosity, the diluted blood is then passed through a microfluidic device coated with streptavidin at a flow rate allowing maximum cell capture. The captured CTCs can then be fixed by fixing with methanol, followed by fixing with 1% PFA using any standard cell fixing procedures. Enumeration will then be done by DAPI staining followed by immunohistochemical staining with commonly used mouse mHCAb such as CK-7 but more preferably mini-CK-7 for higher specificity. CTCs have to be CD45 negative. [0296] Alternatively, most of the RBCs from the blood sample can be first lysed using ammonium chloride solution (155 mM NH4Cl / 10 mM NaHCO3). After pelleting, the washed cells will be suspended in HBSS media (1-2 ml) and passed through the microfluidic device coated with heavy-chain antibody specific for the cell type one needs to capture and analyze.
[0297] Alternatively, the diluted blood sample after incubation with the biotinylated-anti- EpCAM -mini-antibody or micro-antibody will be treated with the streptavidin coated magnetic particles (Miltenyl) for 30 minutes at 4°C while the sample is being gently rotated on a rotating wheel. After pulling down the magnetic particles with a magnet, the CTCs bound to the particles will be washed with PBS/1 %BSA. The CTCs can then be enumerated by spreading them in a unilayer on a glass slide, drying them for one to two hours, followed by fixing with methanol, 1% PFA and staining the CTCs with CK-7.
[0298] Furthermore, these captured CTCs can be analyzed for the gene expression. For example, in case of prostate cancer patient, one can look for TMPRSS2-ERG translocation using PCR primers. TMPRSS2-ERG transcript is present in about 50% of the prostate cancer patients. Similarly, one can look for HER-2 expression in case of breast cancer.
Capture of Fetal Cells:
[0299] Blood samples (10-15 ml) from pregnant mothers (7 to 12 weeks gestation) will be collected in Cytochex blood collection tubes and transported for overnight delivery at 4°C. Upon arrival, samples will be incubated with a mixture of biotinylated-mini- or micro-anti- CD34, CD133, Trop-1,CD71 and 6B5 antibodies (1 ug each /ml blood) at 4°C for one hour during which time the sample will be gently rotated. After diluting with HBSS or RPMI- 1640, the blood sample will be passed through a microfluidic device (microchannels) coated with hydrophilic polymer (PEG, MW 500 to 5000, or a short oligonucleotide fragment 4 to 20 bases long or a short peptide, etc) and streptavidin. The captured cells will be fixed with methanol followed by fixation with 1% PFA. After staining with epsilon- and gamma- hemoglobins, the cells will be subjected to fluorescence in-situ hybridization with Vysis FISH probes for chromosomes X, Y, 13, 18 and 21. Fetal male gender will be readily detected by the appearance of X and Y fluorescence signals under the fluorescence microscope. XX cells stained with epsilon- hemoglobin will be classified as female fetal cells. Trisomy signals will be evident from three identical FISH signals under the microscope. [0300] Alternatively, most of the RBCs can either be carefully lysed using a mild treatment with ammonium chloride lysis reagent (155 mM NH4Cl / 10 mM NaHCO3) to enrich for fetal nucleated red blood cells (fnRBCs) before incubating the sample with a mixture of biotinylated antibodies.
[0301] Still another option will be the use of a density gradient such as Ficol 1.073 or Percol 1.073. The buffy coat can then be processed as above to yield fetal nRBCs.
Example 20
Detection of Chromosomal Translocations from Captured Circulating Tumor Cells (CTCs) Using Shark and Camelid Heavy Chain Only Antibodies and Their Analogs
[0302] Cells will be captured as described above and also shown in Fig. 27-28. Enumeration will be done using an appropriate FISH probes. For example, while investigating TMPRES S2-ERG translocation in case of prostate cancer, FISH probes designed to hybridize with the junction region will be used. Similarly, in case of CML, bcr- AbI FISH probe will be used. An exemplary schematics of the process is shown in Fig. 28.
Example 21
Detection of Non-Invasive Prenatal Genetic Disorders from Captured Circulating Fetal
Cells (CFCs) Using Heavy-Chain Antibodies
[0303] Blood (10 ml) from a pregnant woman will be treated at RT for 1 hour with sdAb conjugated to magnetic beads, with gentle shaking. The beads will be allowed to settle down in a magnetic rack and then subsequently washed with a wash buffer containing 20 mM PO4
_2 / 150 mM NaCl/0.1%Triton X-100 (3 x 2 ml) to ensure complete removal of blood and serum. The beads will then be washed with IX PBS to remove triton. The bound DNA will then be eluted by hot 10 mM Tris.HCl, pH7.0 or by protease digestion.
[0304] This fetal DNA will then be analyzed by real-time PCR using Y-chromosome primers to test the gender and by chromosome 21 primers to test for Down syndrome.
[0305] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. All nucleotide sequences provided herein are presented in the 5' to 3' direction. [0306] The inventions illustratively described herein may suitably be practiced in the absence of any element or elements, limitation or limitations, not specifically disclosed herein. Thus, for example, the terms "comprising", "including," containing", etc. shall be read expansively and without limitation. Additionally, the terms and expressions employed herein have been used as terms of description and not of limitation, and there is no intention in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention claimed.
[0307] Thus, it should be understood that although the present invention has been specifically disclosed by preferred embodiments and optional features, modification, improvement and variation of the inventions embodied therein herein disclosed may be resorted to by those skilled in the art, and that such modifications, improvements and variations are considered to be within the scope of this invention. The materials, methods, and examples provided here are representative of preferred embodiments, are exemplary, and are not intended as limitations on the scope of the invention.
[0308] The invention has been described broadly and generically herein. Each of the narrower species and subgeneric groupings falling within the generic disclosure also form part of the invention. This includes the generic description of the invention with a proviso or negative limitation removing any subject matter from the genus, regardless of whether or not the excised material is specifically recited herein.
[0309] In addition, where features or aspects of the invention are described in terms of Markush groups, those skilled in the art will recognize that the invention is also thereby described in terms of any individual member or subgroup of members of the Markush group.
[0310] All publications, patent applications, patents, and other references mentioned herein are expressly incorporated by reference in their entirety, to the same extent as if each were incorporated by reference individually. In case of conflict, the present specification, including definitions, will control.
[0311] Other embodiments are set forth within the following claims.

Claims

What is claimed is:
1. A polypeptide comprising all or a portion of at least one variable antigen-binding (Vab) domain of camelid and/ or shark single-domain heavy chain antibodies lacking light- chains, at least ten contiguous amino acids derived from a source other than camelid and/ or shark single-domain heavy chain antibodies lacking light-chains, wherein said polypeptide comprises at least one binding site for an antigen.
2. The polypeptide of claim 1, further comprising all or a portion of at least one hinge region of camelid and/or shark single-domain heavy chain antibodies lacking light-chains.
3. The polypeptide of claim 1, further comprising all or a portion of at least one camelid and/or shark constant domain 2 (CH2) of single-domain heavy chain antibodies lacking light- chains.
4. The polypeptide of claim 1, further comprising all or a portion of at least one camelid and/or shark constant domain 3 (CH3) of single-domain heavy chain antibodies lacking light- chains.
5. The polypeptide of claim 1, wherein the at least one amino acid at positions 37, 44, 45, and 47 of said Vab region is selected from the group consisting of serine, glutamine, tyrosine, histidine, asparagine, threonine, aspartic acid, glutamic acid, lysine and arginine.
6. The polypeptide of claim 1, wherein said polypeptide is capable of binding specifically with an antigen, wherein said antigen is selected from the group consisting of AMACR, EPCA-2, PSMA, PSA, TMPRSS2-ERG, PCA3, HAAH, APP, ALZAS, Tau, gamma secretase, beta secretase, Apo-Al, Apo-H, alfa-Synuclein, PV-I, PEDF, BDNF, Cystatin C, VGF nerve growth factor inducible, APO-E, GSK-3 binding protein, TEMl, PGD2, EGFR, EGFRT790M, Notch-4, ALDH-I, ESR-I, HER-2/neu, P53, RAS, KLKBl, SMAD4, Smad7, TNF-alfa, HPV, tPA, , Mucin, Cadherin-2, FcRn alpha chain, TNF-alfa, Thrombin, cytokerratin 1-20, , Celuloplasmin, Apo All, VGF, Vif, LEDGF/p75, TSlOl, gpl20, CCR5, CXCR4, HIV protease, HIV integrase, OST-577, HlNl, CD3, CDl Ia, CD20, CD33, CD25, CD52, Protein C5, VEGF, alfa-4-integrin, Glycoprotein Ilb/IIIA, AP-I, VEGF- A, , IgG-E, Bacillus anthracis protein, NadD (Nicotinate Mononucleotide Adenyltransferase, a enzyme implicated in drug-resistant bacteria), Plasmodium falciparum, STDs, TB, cGMP directed phosphodiestrase, chain B of Clostridium botulinum neurotroxin type E protein, Borrelia VIsE protein, ACE2 receptor, TTHY, AIAT,, AFMN, APO-E, SFRS4, SAMP, CD 71, GPA, epsilon- and gamma-glycophorins, TIMP-I, RGIA, EXTL3, biomarkers for: lung cancer, bladder cancer, gastric cancer, brain cancer, breast cancer, prostate cancer, cervical cancer, colorectal cancer, oral cancer, leukemia, childhood neuroblastoma, Non-Hodgkin lymphoma, Alzheimer's disease, Parkinson's disease, and AIDS.
7. The polypeptide of claim 1, wherein said polypeptide is linked to at least one entity other than an antibody.
8. The polypeptide of claim 7, wherein said entity is selected from a group consisting of solid support, radioisotope, an enzyme, detectable label, ligand, fluorophore, biotin, digoxegenin, avidin, streptavidn, Fc region of IgGs, a therapeutic agent, toxin, hormone, peptide, protein, antibody , vector, siRNA, micro-RNA and nucleic acid.
9. The polypeptide of claim 8, wherein said solid support is selected from the group consisting of beads, glass, gold, nanoparticles, microchannels, microarrays, and micro fluidic devices.
10. The polypeptide of claim 1 comprising at least two variable antigen-binding (Vab) domains of camelid and/or shark single domain heavy chain antibody lacking the light chains.
11. A polypeptide comprising all or a portion of at least two variable antigen-binding (Vab) domains of camelid and/ or shark single-domain heavy chain antibodies lacking light- chains, at least ten contiguous amino acids derived from a source other than camelid and/ or shark single-domain heavy chain antibodies lacking light-chains, all or a portion of at least one hinge region of camelid and/ or shark single-domain heavy chain antibodies lacking light-chains in a single polypeptide chain, wherein said at least two Vab domains bind to at least two different antigens, and wherein said polypeptide has improved biodistribution and retention.
12. The polypeptide of claim 11, wherein said polypeptide is capable of binding specifically with an antigen, wherein said antigen is selected from the group consisting of AMACR, EPCA-2, PSMA, PSA, TMPRSS2-ERG, PCA3, HAAH, APP, ALZAS, Tau, gamma secretase, beta secretase, Apo-Al, Apo-H, alfa-Synuclein, PV-I, PEDF, BDNF, Cystatin C, VGF nerve growth factor inducible, APO-E, GSK-3 binding protein, TEMl, PGD2, EGFR, EGFRT790M, Notch-4, ALDH-I, ESR-I, HER-2/neu, P53, RAS, KLKBl, SMAD4, Smad7, TNF-alfa, HPV, tPA, , Mucin, Cadherin-2, FcRn alpha chain, TNF-alfa, Thrombin, cytokerratin 1-20, , Celuloplasmin, Apo All, VGF, Vif, LEDGF/p75, TSlOl, gpl20, CCR5, CXCR4, HIV protease, HIV integrase, OST-577, HlNl, CD3, CDl Ia, CD20, CD33, CD25, CD52, Protein C5, VEGF, alfa-4-integrin, Glycoprotein Ilb/IIIA, AP-I, VEGF- A, , IgG-E, Bacillus anthracis protein, NadD (Nicotinate Mononucleotide Adenyltransferase, a enzyme implicated in drug-resistant bacteria), Plasmodium falciparum, STDs, TB, cGMP directed phosphodiestrase, chain B of Clostridium botulinum neurotroxin type E protein, Borrelia VIsE protein, ACE2 receptor, TTHY, AIAT,, AFMN, APO-E, SFRS4, SAMP, CD 71, GPA, epsilon- and gamma-glycophorins, TIMP-I, RGIA, EXTL3, biomarkers for: lung cancer, bladder cancer, gastric cancer, brain cancer, breast cancer, prostate cancer, cervical cancer, colorectal cancer, oral cancer, leukemia, childhood neuroblastoma, Non-Hodgkin lymphoma, Alzheimer's disease, Parkinson's disease, and AIDS.
13. The polypeptide of claim 1, wherein the said polypeptide has composition and structure Ia -Ig, 2-14, 20-24, 25-45, 50-79, 81-M, 87-91, 93- 97, of figures 3-5, 8-15, 17-19, and 22-29, and structures shown below, wherein "CHX" represents all or a portion of at least constant domain 1 (CHl) of human heavy chain immunoglobulin G, "S" represents a linker, "Rn" represents all or a portion of at least one camelid or shark hinge region of single-domain heavy chain antibodies lacking light-chains, L represents an entity linked to said polypeptide, "D" represents at least two amino acids comprising at least one charged amino acid, VNAR represents shark variable region of single domain heavy chain antibody, and Vab represents camelid variable region of single domain heavy chain antibody, CH2 and CH3 represent constant domains 2 and 3 respectively of camelid and or shark single domain antibody lacking light chains, CH4 and CH5 represent constant domains 4 and 5 respectively of shark single domain heavy chain antibody lacking light chains.
Figure imgf000125_0001
- i- i
Figure imgf000126_0001
S? Sl 73
14. The polypeptide of claim 1, wherein the generic composition of said polypeptide is represented by: [Vab]m- S2-R9, wherein
Vab = Variable antigen-binding domain of camelid and/or shark single domain heavy chain antibodies, m = 1 to 10, preferably 2 to 5,
S2 is selected from the group consisting of groups I and II, wherein group I is selected from 1-20 amino acids of the hinge region of camelid and /or shark single domain heavy chain antibodies comprising at least one lysine and /or cysteine, and group II is hetrobifunctional linker with one end being capable of covalent binding with amino- or aldehyde group of single-domain antibodies, and the other end with an entity selected from the group consisting of detectable label, solid support, enzyme, antibody, and nucleic acid,
R9 represents an entity selected from the group consisting of detectable label, enzyme, antibody, nucleic acid, radionucleotides, toxins, solid support, and therapeutic agents.
15. The polypeptide of claim 14, wherein the generic composition of "S2" is S2 = X-P-Y; wherein X is selected from the group consisting of NHS (N-Hydroxy-succinimide), sulfo- NHS, CHO, COOH, CN, SCN, epoxide, phosphate and other moieties capable of forming covalent bond with NH2 groups of single-domain antibodies;
Y is selected from the group consisting of maleimido, NHS, sulfo-NHS, SH, COOH, SCN, NH2, and epoxide, capable of forming a covalent bond with the thiol group of the detectable label;
P is selected from the group consisting Of (CH2CH2O)U, wherein n= 1-500; (CH2)nl, wherein nl = 1-15; (CH2-R-NHCO)n2, wherein n2 = 1-100; nucleic acids; Nylon, polystyrene; polypropylene; protein; and chimeric protein-nucleic acids.
16. The polypeptide of claim 14, wherein R is selcted from the group consisting of Rl, R2, R3, R4, R5, R6, R7 and R8; wherein
Rl is selcted from the group consisting of Horse Radish Peroxidase, Alkaline Phosphatase, Luciferase, Beta-Galactosidase, and Streptavidin;
R2 is selected from the group consisting of Microchannels, Micro fluidic Device, Micrarrays, Biosensors, Glass Slides, Glass Chambers, Magnetic Beads, and Gold Nanoparticles;
R3 is selcted from the group consisting of Nucleic Acids, DNA, Modified DNA, Locked- DNA, PNA (Peptide Nucleic Acids), RNA, Si-RNA, Micro-RNA, mRNA, RNA-Conjugates, modified RNA;
R4 is selcted from the group consisting of Fluorine- 18, Gallium-67, Krypton- 81m,Rubidium-82, Technetium-99m, Indium-111, Iodine-123, Xenon-133, and Thallium- 201;
R5 is selected from the group consisting of, Yttrium-90, and Iodine-131;
R6 is selcted from the group consisting of Immunotoxins, Ricin, Saporin, Maytansinoid, and Calicheamicin;
R7 is selected from the group consisting of Nucleolytic Enzymes, antibiotics, and Chemotherapeutic Agents;
R8 is selected from the group consisting Peptides, Proteins, Enzymes, and antibodies.
17. The polypeptide of claim 11 comprising all or a portion of at least three and more variable antigen-binding (Vab) domains of camelid and/or shark single-domain heavy chain antibody, wherein said polypeptide has improved biodistribution and retention.
18. A composition comprising at least two polypeptides, wherein each of said polypeptides comprises variable domain (Vab) of camelid and/or shark single-domain heavy chain only antibody, all or a portion of at least one hinge region of camelid and/or shark heavy chain only antibody, wherein at least one of said polypeptide comprises at least one binding site for an antigen, wherein said composition has improved biodistribution and retention, and wherein said polypeptides are linked to each other through at least one linker.
19. The composition of claim 18 comprising at least four of said polypeptides.
20. The composition of claim 18, wherein at least one of said linker is a peptide bond.
21. The composition of claim 18, wherein at least one of said linker is other than peptide bond.
22. The composition of claim 18 comprising at least five of said polypeptides.
23. The composition of claim 18, wherein at least one of said polypeptides is capable of binding specifically with an antigen, wherein said antigen is selected from the group consisting of AMACR; TMPRSS2-ERG; EPCA2; PSMA; PSA; HAAH; APP; ALZAS; Tau; gamma secretase; beta secretase; APO-Al; Apo-H; ; alfa-Synuclein; PV-I PEDF; BDNF; Cystatin C; VGF nerve growth factor inducible; APO-E; GSK-3 binding protein; TEMl; PGD2; EGFR; EGFRT790M; Notch-4; ALDH-I; ESR-I; EGFRT790M; HER-2/neu; P53; RAS; KLKBl; SMAD4; Smad7; TNF-alfa; HPV; tPA; PCA-3; Mucin; Cadherin-2; FcRn alpha chain; cytokerratin 1-20; .Apo-H; Celuloplasmin; Apo All; VGF; Vif; LEDGF/p75; TSlOl; gpl20; CXCR4; CCR5; HIV protease; HIV integrase; OST-577; HlNl; CD3;
CDl Ia; CD20; CD25; CD52; ; CD133; CD34; CD14; CDl-340; Protein C5; VEGF; VEGF- A; alfa-4-integrin; Glycoprotein Ilb/IIIAΛ; AP-I; IgG-E; NadD; STDs; TB; Bacillus anthracis protein; Plasmodium falciparum; cGMP directed phosphodiestrase; chain B of Clostridium botulinum neurotroxin type E protein; Borrelia VIsE protein; ACE2 receptor; SFRS4; SAMP; GPA; CD71; biomarkers for: lung cancer; bladder cancer; gastric cancer; brain cancer; breast cancer; prostate cancer; cervical cancer; colorectal cancer; oral cancer; leukemia; childhood neuroblastoma; Non-Hodgkin lymphoma; Alzheimer's disease; Parkinson's disease; AID; and protein markers for Down syndrome selected from the group consisting of TTHY, AMPB, SAMP, AIAT, AFMN, APOE, and SFRF4.
24. A nucleic acid encoding all or portion of said polypeptide of claim 1.
25. The nucleic acid of claim 24, wherein said nucleic acid is operably linked to one or more expression regulatory element.
26. A nucleic acid encoding all or portion of said polypeptide of claim 11.
27. The nucleic acid of claim 26, wherein said nucleic acid is operably linked to one or more expression regulatory element.
28. A method for producing a polypeptide of claim 1, said method comprising transforming a host cell with a recombinant nucleic acid encoding said polypeptide, and expressing said polypeptide in said host cell.
29. The method of claim 28, wherein said host cell is prokaryotic.
30. The method of claim 29, wherein said host cell is eukaryotic.
31. A method for producing a polypeptide of claim 11 , said method comprising transforming a host cell with a recombinant nucleic acid encoding said polypeptide, and expressing said polypeptide in said host cell.
32. The method of claim 32, wherein said host cell is prokaryotic.
33. The method of claim 31, wherein said host cell is eukaryotic.
34. The composition of claim 18, wherein the structure of the composition is represented by structure Id, wherein Vab represents variable antigen binding domain of camelid and or shark single domain heavy chain antibody, "Rn" represents all of portion of hinge region of camelid and/or shark heavy chain only antibody, Man represents maleic anhydride.
Figure imgf000130_0001
Id
35. The composition of claim 18, wherein the composition and structure of is represented by structures 21, 23-24, and wherein at least one of the variable antigen-binding domains is capable of binding to a biomarker associated with a disease, wherein Vab represents variable antigen binding domain of camelid and/or shark single domain heavy chain antibody, "A" represents carbon or nitrogen atom, "Rn" represents all of portion of hinge region of single domain camelid and/or shark heavy chain antibody.
Figure imgf000130_0002
36. The composition of claim 18, where in the composition comprises four variable antigen-binding domains (Vab), wherein the structure of said composition is represented by structures 79, wherein Vab represents variable antigen binding domain of camelid and/or shark single domain heavy chain antibody, "Rn" represents all of portion of hinge region of camelid and/or shark single domain heavy chain antibody, wherein at least one of said Vab domains is capable of binding to a biomarker associated with a disease, Vab Va b
Figure imgf000131_0001
22 and wherein
CHX is selected from the group consisting of all or portion of CHl region of human IgG, and Cysteine capable of forming s-s bonds, CHY represents CHX-R1, wherein R1 represents
[Vab-CHX]Z and Z= 1-6
S 1 represents a linker selected from the group consisting of structure .15
Figure imgf000131_0002
ft = SU* 4, &s a^ 1 St9 2S4
and cysteine-s-s-cysteine, and H represents all of portion of hinge region of camelid and/or shark heavy chain only antibody.
37. A method for detecting the presence or absence of an antigen associated with a disease in a sample comprising: a) obtaining a sample suspected of having said antigen, b) detecting the level of said antigen in said sample utilizing a polypeptide claim 1 , wherein said polypeptide binds specifically to said antigen, wherein the level of said antigen in said sample is indicative of the presence or absence of said antigen.
38. The method of claim 37, wherein said polypeptides have structures selected from the group consisting of structures 2-14, 20-24,25-45, 50-79, 81-84, 87-91 and 93-97.
39. A method for diagnosing an individual with a disease, said method comprising: a) obtaining a sample from said individual b) detecting the presence or absence of a biomarker for said disease, wherein said detecting comprises utilizing a polypeptide claim 1 , wherein said polypeptide binds specifically to said biomarker; c) determining the level of said biomarker if present in said individual's sample; d) comparing said level to a reference value; and e) identifying said individual as having said disease when the level of said biomarker in said individual's sample is higher than said reference value.
40. A method for detecting the presence or absence of at least two antigens associated with a disease in a sample comprising: a) obtaining a sample suspected of having said antigen, b) detecting the level of said antigens in said sample utilizing a polypeptide claim 11 , wherein said polypeptide binds specifically to said antigens, wherein the level of said antigens in said sample is indicative of the presence or absence of said antigens.
41. The polypeptide of claim 39, wherein the said polypeptide is capable of binding specifically with an antigen selected from the group consisting of: biomarkers associated with Alzheimer's Disease, wherein said biomarkers for Alzheimer's disease is selected from the group consisting of Amyloid-beta, ALZAS, Tau, DJ-I, Bax-1, PEDF, HPX, Cystatin-C, Beta-2-Microglobulin, BDNF, Tau-Kinase, gamma- Sercretase, beta-Secretase, Apo-E4, and VGF-Peptide; biomarkers associated with Parkinson's Disease, wherein said biomarkers for Parkinson's disease is selected from the group consisting of Apo-H, Cerulopasmin, Chromogranin-B, VDBP, Apo-E, Apo-AII, and alaf-Synuclein; biomarkers associated with Brain Cancer, wherein said biomarkers for Brain cancer is selected from the group consisting of TEMl, Plasmalemmal Vesicle (PV-I), Prostaglandin D Synthetase, and (PGD-S); biomarkers associated with HIV/AIDS, wherein said biomarkers for HIV/ AIDS is selected from the group consisting of gpl20, Vif, LEDGF/p75, TSlOl, HIV-Integrase, HIV- Reverse Transcriptase, HIV-Protease, CCR5, and CXCR4; biomarkers associated with Lung Cancer, wherein said biomarkers for lung cancer is selcted from the group consisting of KRAS, Ki67, EGFR, KLKBl, EpCAM, CYFRA21-1, tPA, ProGRP, Neuron-specific Enolase (NSE), and hnRNP; biomarkers associated with Prostate Cancer, wherein said biomarkers for prostate cancer is selected from the group consisting of AMACR, PCA3, TMPRSS2-ERG, HEPSIN, B7-H3, SSeCKs, EPCA-2, PSMA, BAG-I, PSA, MUC6, hK2, PCA-I, PCNA, RKIP, and c-HGK; biomarkers associated with Breast Cancer, wherein said biomarkers for breast cancer is selected from the group consisting of EGFR, EGFRT790M, HER-2, Notch-4, ALDH-I, ESRl, SBEM, HSP70, hK-10, MSA, p53, MMP-2, PTEN, Pepsinigen-C, Sigma-S, Topo-11- alfauKPA, BRCA-I, BRCA-2, SCGB2A1, and SCGB1D2; biomarkers associated with Colorectal Cancer, wherein said biomarkers for colorectal cancer is selected from the group consisting of SMAD4, EGFR, KRAS, p53, TS, MSI-H, REGIA, EXTL3, plK3CA, VEGF, HAAH, EpCAM, TEM8, TKl, STAT-3, SMAD-7, beta- Catenin, CK20, MMP-I, MMP-2, MMP-7,9,11, and VEGF-D; biomarkers associated with Ovarian Cancer, wherein said biomarkers for ovarian cancer is selected from the group consisting of CD24, CD34, EpCAM, hK8, 10, 13, CKB, Cathesin B, M-CAM, c-ETSl, and EMMPRIN; biomarkers associated with Cervical Cancer, wherein said biomarkers for cervical cancer is selected from the group consisting of HPV, CD34, ERCCl, Beta-CF, Id-I, UGF, SCC, p 16, p2 IWAFl, PP-4, and TPS; biomarkers associated with Bladder Cancer is selected from the group consisting of CK18, CK20, BLCa-I, BLCA-4, CYFRA21-1, TFT, BTA, Survivin, UCAl, UPII, FAS, and DD23; biomarkers associated with a disease causing bacteria, wherein said bacteria or biomarker associated with disease causing bacteria is selected from the group consisting of Clostridium Botulinum, Bacillus Anthracis, Salmonella Typhi, Treponema Pallidum, Plasmodinum, Chlamadyia, Borrelia B, Staphyloccus Aureus,Tetanus, Meningococcal Meningitis, and Mycobacterium tuberculosis, and Nicitinate Mononuceleotide adenyltransferase (NadD); biomarkers associated with a disease causing virus, wherein said virus or biomarker associated with a disease causing virus is selected from the group consisting of Pandemic Flu Virus HlNl strain, Influenza virus H5N1 strain, Hepatitis B virus (HBV) antigen OSt-577, HBV core antigen HBcAg (HBV), HBV antigen Wnt-1, Hepatitis C Virus (HCV) antigen Wnt-l, and HCV RNA.
42. A method for detecting the presence or absence of circulating tumor cells in a sample comprising a) obtaining a sample suspected of having circulating tumor cell, b) detecting the level of one or more tumor cell surface receptors in said sample utilizing a polypeptide claim 1, wherein at least one of said Vab domain binds specifically to tumor cell surface receptor, wherein the said receptor is selected from a group consisting of MUC-I, VCAM-I, EpCAm-I, CD44, CD133, E-Cadherin, VEGF, bFGF, sFASL, CD95, p53, Bcl-2 CyclinDl, Cyclin E, TNF-alfa, TGF-betal, Her-2, EGFR, IGF-I and IGF-IR, IL- 2R, Ras, and cMyc, wherein the level of said tumor cell surface receptor in said sample is indicative of the presence or absence of circulating tumor cells.
43. A method for detecting the presence or absence of circulating rare fetal cells in a sample comprising a) obtaining a sample suspected of having circulating rare fetal cells, b) detecting the level of one or more tumor cell surface receptors in said sample utilizing a polypeptide claim 1 , wherein at least one of said Vab domain binds specifically to fetal cells cell surface receptors, wherein the said receptors is selected from a group consisting of GPA, CD71, CD133, CD34, CD44, ITCAM, ITGBl (Integrin beta-1), Trop-1, Trop-2, HLA-G233, and 6B5, wherein the level of said fetal cell surface receptor in said sample is indicative of the presence or absence of circulating fetal cells.
44. A method for detecting the presence or absence of an antigen associated with a disease in a sample comprising: a) obtaining a sample suspected of having said antigen, b) detecting the level of said antigen in said sample utilizing a composition of claim 17, wherein said polypeptide binds specifically to said antigen, wherein the level of said antigen in said sample is indicative of the presence or absence of said antigen.
45. A method for diagnosing an individual with a disease, said method comprising: a) obtaining a sample from said individual b) detecting the presence or absence of a biomarker for said disease, wherein said detecting comprises utilizing a composition of claim 17, wherein at least one of said polypeptides binds specifically to said biomarker; c) determining the level of said biomarker if present in said individual's sample; d) comparing said level to a reference value; and e) identifying said individual as having said disease when the level of said biomarker in said individual's sample is higher than said reference value.
46. The polypeptide of claim 11, wherein said polypeptide is linked to an entity other than an antibody.
47. The polypeptide of claim 46, wherein said entity is selected from a group consisting of solid support, radioisotope, an enzyme, detectable label, a therapeutic agent, toxin, hormone, and nucleic acid.
48. The polypeptide of claim 47, wherein said solid support is selected from the group consisting of microchannels, micro fluidic device, micrarrays, biosensors, glass slides, glass chambers, magnetic beads, and gold nanoparticles.
49. The polypeptide of claim 1, wherein said polypeptide is linked to an entity other than an antibody.
50. The polypeptide of claim 49, wherein said entity is selected from a group consisting of solid support, radioisotope, an enzyme, detectable label, a therapeutic agent, toxin, hormone, and nucleic acid.
51. The polypeptide of claim 50, wherein said solid support is selected from the group consisting of microchannels, microfluidic device, micrarrays, biosensors, glass slides, glass chambers, magnetic beads, and gold nanoparticles.
52. The polypeptide of claim 11 comprising all or a portion of at least three variable domain of camelid and/or shark single domain heavy chain antibody.
53. The polypeptide of claim 1, wherein said at least 10 amino acids are derived from all or a portion constant domain 1 (CHl) of human heavy chain immunoglobulin G.
54. The polypeptide of claim 11, wherein said at least 10 amino acids are derived from all or a portion constant domain 1 (CHl) of human heavy chain immunoglobulin G.
55. The composition of claim 18, wherein at least one of said polypeptide further comprise at least ten contiguous amino acids derived from a source other than camelid and/ or shark single-domain heavy chain antibodies lacking light-chains.
56. The composition of claim 18, wherein at least one of said polypeptide is linked to an entity other than an antibody.
57. The polypeptide of claim 56, wherein said entity is selected from a group consisting of solid support, radioisotope, an enzyme, detectable label, a therapeutic agent, toxin, hormone, and nucleic acid.
58. The polypeptide of claim 57, wherein said solid support is selected from the group consisting of microchannels, microfluidic device, micrarrays, biosensors, glass slides, glass chambers, magnetic beads, and gold nanoparticles.
59. A method of simultaneously diagnosing, preventing, treating, and/or alleviating symptoms associated with a disease in an individual, said method comprising: a) administering to said individual in need thereof said polypeptide of claim 1, b) detecting the presence or absence of a biomarker for said disease, wherein said detecting comprises utilizing a polypeptide claim 1 , wherein said polypeptide binds specifically to a biomarker associated with said disease; c) determining the level of said biomarker if present in said individual's sample; d) comparing said level to a reference value; e) identifying said individual as having said disease when the level of said biomarker in said individual's sample is higher than said reference value; and f) preventing, treating, and/or alleviating symptoms associated with said disease in said individual when said polypeptide specifically binds to said biomarker.
60. A method of simultaneously diagnosing, preventing, treating, and/or alleviating symptoms associated with a disease in an individual, said method comprising: a) administering to said individual in need thereof said polypeptide of claim 11 , b) detecting the presence or absence of a biomarker for said disease, wherein said detecting comprises utilizing a polypeptide claim 11 , wherein said polypeptide binds specifically to a biomarker associated with said disease; c) determining the level of said biomarker if present in said individual's sample; d) comparing said level to a reference value; e) identifying said individual as having said disease when the level of said biomarker in said individual's sample is higher than said reference value; and f) preventing, treating, and/or alleviating symptoms associated with said disease in said individual when said polypeptide specifically binds to said biomarker.
61. A method of simultaneously diagnosing, preventing, treating, and/or alleviating symptoms associated with a disease in an individual, said method comprising: a) administering to said individual in need thereof said composition of claim 18, b) detecting the presence or absence of a biomarker for said disease, wherein said detecting comprises utilizing said composition of claim 18, wherein said polypeptide binds specifically to a biomarker associated with said disease; c) determining the level of said biomarker if present in said individual's sample; d) comparing said level to a reference value; e) identifying said individual as having said disease when the level of said biomarker in said individual's sample is higher than said reference value; and f) preventing, treating, and/or alleviating symptoms associated with said disease in said individual when said polypeptide specifically binds to said biomarker.
PCT/US2009/057681 2008-09-22 2009-09-21 Antibodies, analogs and uses thereof Ceased WO2010033913A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US19273208P 2008-09-22 2008-09-22
US61/192,732 2008-09-22

Publications (1)

Publication Number Publication Date
WO2010033913A1 true WO2010033913A1 (en) 2010-03-25

Family

ID=42039904

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2009/057681 Ceased WO2010033913A1 (en) 2008-09-22 2009-09-21 Antibodies, analogs and uses thereof

Country Status (2)

Country Link
US (1) US20100092470A1 (en)
WO (1) WO2010033913A1 (en)

Cited By (40)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8012479B2 (en) * 1996-08-23 2011-09-06 Health Protection Agency Recombinant toxin fragments
CN102230938A (en) * 2011-06-22 2011-11-02 中国科学院武汉病毒研究所 Kit and method for detecting influenza A virus based on immune magnetic bead enrichment
WO2011133504A3 (en) * 2010-04-20 2012-03-01 University Of Florida Research Foundation, Inc. Nanozymes, methods of making nanozymes, and methods of using nanozymes
WO2012122528A1 (en) * 2011-03-10 2012-09-13 Hco Antibody, Inc. Bispecific three-chain antibody-like molecules
WO2012174392A1 (en) 2011-06-17 2012-12-20 Cytodyn, Inc. Methods of treating retroviral infections in felines
US20130177568A1 (en) * 2012-01-09 2013-07-11 Icb International, Inc. Blood-brain barrier permeable peptide compositions
CN103204937A (en) * 2013-04-26 2013-07-17 山西德丰信成生物科技有限公司 Single-domain heavy chain antibody T10 aiming at immune globulin Fc segment
WO2013139956A1 (en) 2012-03-22 2013-09-26 Thrombogenics Nv Antibodies abrogating cell binding to lactadherin
WO2013160359A1 (en) 2012-04-24 2013-10-31 Thrombogenics N.V. Anti-pdgf-c antibodies
CN103421111A (en) * 2013-09-04 2013-12-04 吉日木图 Isolation, Purification and Identification of Heavy Chain Antibody from Camel Milk
US20140193834A1 (en) * 2012-01-09 2014-07-10 Icb International, Inc. Blood-brain barrier permeable peptide compositions
US8815508B2 (en) 2008-08-12 2014-08-26 Zinfandel Pharmaceuticals, Inc. Method of identifying disease risk factors
US8846315B2 (en) 2008-08-12 2014-09-30 Zinfandel Pharmaceuticals, Inc. Disease risk factors and methods of use
WO2014160133A3 (en) * 2013-03-13 2014-11-27 The Board Of Trustees Of The University Of Arkansas Anti-(+) --methamphetamine monoclonal antibodies
RU2548759C2 (en) * 2013-08-20 2015-04-20 Федеральное Государственное Бюджетное Учреждение Науки Институт Молекулярной Биологии Им. В.А. Энгельгардта Российской Академии Наук (Имб Ран) Diagnostic technique for alzheimer disease by measuring chemically modified forms of metal-binding beta-amyloid domain in biological fluids
US9102666B2 (en) 2011-01-10 2015-08-11 Zinfandel Pharmaceuticals, Inc. Methods and drug products for treating Alzheimer's disease
US9303092B2 (en) 2000-04-20 2016-04-05 The Board Of Trustees Of The University Of Arkansas Methamphetamine-like hapten compounds, linkers, carriers and compositions and uses thereof
WO2016077840A3 (en) * 2014-11-14 2016-07-28 Ossianix, Inc. Variable new antigen receptors (vnars) directed against transferrin receptor (tfr) and their use
CN105968204A (en) * 2016-02-03 2016-09-28 中国人民解放军第三军医大学第附属医院 Single-domain heavy chain antibody for anti-prostate specific membrane antigen
CN106619651A (en) * 2016-12-23 2017-05-10 江苏大学 Application of PGD2 (prostaglandin D2) in preparation of drug for treating stomach cancer
JP2017513475A (en) * 2014-04-17 2017-06-01 テラクロン アイディーエフ エセ エレTeraclon Idf, S.L. Recombinant monoclonal antibody vNAR that neutralizes vascular endothelial growth factor (VEGF)
EP3203233A3 (en) * 2008-10-29 2017-10-18 ICB International, Inc. Methods for using antibodies and analogs thereof
CN107427574A (en) * 2015-01-09 2017-12-01 阿达尔塔私人有限公司 Cxcr4 binding molecules
EP3209685A4 (en) * 2014-10-23 2018-01-24 Singh Biotechnology, LLC Single domain antibodies directed against intracellular antigens
CN108794626A (en) * 2018-06-18 2018-11-13 上海大学 A kind of polypeptide and the gold nano antibody that HIV envelope proteins gp120 can be targeted
WO2018224636A1 (en) 2017-06-09 2018-12-13 Vib Vzw Glutamine dehydrogenase inhibitors for use in muscle regeneration
WO2019016123A1 (en) 2017-07-17 2019-01-24 Vib Vzw Targeting synaptogyrin-3 in tauopathy treatment
CN109943572A (en) * 2017-11-07 2019-06-28 香港城市大学 The method for producing antibody fragment
WO2019158579A1 (en) 2018-02-13 2019-08-22 Vib Vzw Targeting minimal residual disease in cancer with rxr antagonists
US10538757B2 (en) 2013-08-14 2020-01-21 University Of Florida Research Foundation, Inc. Nanozymes, methods of making nanozymes, and methods of using nanozymes
WO2020115039A1 (en) 2018-12-03 2020-06-11 Vib Vzw Cancer regression by inducing a regeneration-like response
WO2021028837A1 (en) * 2019-08-13 2021-02-18 Waters Technologies Corporation Affinity resins and sample preparation devices based on cartilaginous fish ignar derived binding domains
US11097010B2 (en) 2016-08-06 2021-08-24 Ossianix, Inc. In vivo methods for selecting peptides that cross the blood brain barrier, related compositions and methods of use
US11214626B2 (en) 2015-11-02 2022-01-04 Singh Biotechnology, Llc Single domain antibodies directed against arachidonate 12-lipoxygenase
US11498978B2 (en) 2020-05-05 2022-11-15 Bio-Y A/S YKL-40 antibody
CN116239695A (en) * 2022-05-09 2023-06-09 华兰基因工程有限公司 Antibody specifically binding to PV-1 protein or its antigen-binding fragment HLPV-P11 and application thereof
WO2024160756A1 (en) 2023-01-30 2024-08-08 Vib Vzw Suppressors of tauopathies
CN119060173A (en) * 2024-09-19 2024-12-03 苏州东抗生物科技有限公司 Specific antibodies against HPV-18 type E protein and uses thereof
US12351642B2 (en) 2018-09-14 2025-07-08 Ossianix, Inc. TFR-specific binding moieties and transcytosis method to select VNARs that cross cellular barriers
CN120329430A (en) * 2024-01-18 2025-07-18 上海奥普生物医药股份有限公司 Antibodies or antigen-binding fragments thereof targeting NMP22 and their applications

Families Citing this family (39)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1871809A2 (en) * 2005-04-22 2008-01-02 Morphotek, Inc. Antibodies with immune effector activity and that internalize in endosialin-positive cells
CA2682726C (en) * 2007-04-05 2017-05-09 Morphotek, Inc. Methods for inhibiting the binding of endosialin to ligands
TWI622402B (en) 2010-02-24 2018-05-01 免疫遺傳股份有限公司 Folate receptor 1 antibodies and immunoconjugates and their use
US20130164307A1 (en) * 2010-06-17 2013-06-27 The Johns Hopkins University Use of camelid-derived variable heavy chain variable regions (vhh) targeting human cd18 and icam-1 as a microbicide to prevent hiv-1 transmission
CN102147413A (en) * 2010-12-08 2011-08-10 武汉生之源生物科技有限公司 A small particle size homogeneous sol particle type cystatin C assay kit and its preparation method
TWI487911B (en) * 2010-12-22 2015-06-11 Univ Nat Sun Yat Sen Method and system for detecting bladder cancer in vivo
BR112013025415B1 (en) 2011-04-01 2021-03-16 Immunogen, Inc use of a folate antireceptor immunoconjugate 1 (folr1)
AU2012275390A1 (en) 2011-06-28 2014-01-16 Whitehead Institute For Biomedical Research Using sortases to install click chemistry handles for protein ligation
US20140235492A1 (en) * 2011-09-20 2014-08-21 Institut National De La Sante Et De La Recherche Medicate (Inserm) Methods for preparing single domain antibody microarrays
TWI443108B (en) 2011-12-28 2014-07-01 Ind Tech Res Inst Anti-human epidermal growth factor receptor antibody and application thereof
EP2825560A1 (en) * 2012-03-13 2015-01-21 Universiteit Utrecht Holding BV Bi-specific adapters
US9200073B2 (en) 2012-08-31 2015-12-01 Immunogen, Inc. Diagnostic assays and kits for detection of folate receptor 1
US9499621B2 (en) 2013-04-08 2016-11-22 Cytodyn, Inc. Felinized antibodies and methods of treating retroviral infections in felines
SG10201803748VA (en) * 2013-05-08 2018-06-28 Clene Nanomedicine Inc Methods and treatment for certain demyelination and dysmyelination-based disorders and/or promoting remyelination
EP2994491A4 (en) 2013-05-10 2016-12-07 Whitehead Inst Biomedical Res IN VITRO PRODUCTION OF RED GLOBULES WITH PROTEINS THAT CAN BE MEDIATED BY SORTASE
WO2014183066A2 (en) 2013-05-10 2014-11-13 Whitehead Institute For Biomedical Research Protein modification of living cells using sortase
CN113150145B (en) 2013-08-30 2025-02-14 伊缪诺金公司 Antibodies and assays for detecting folate receptor 1
US10556024B2 (en) 2013-11-13 2020-02-11 Whitehead Institute For Biomedical Research 18F labeling of proteins using sortases
EP2899208A1 (en) * 2014-01-28 2015-07-29 F.Hoffmann-La Roche Ag Camelid single-domain antibody directed against phosphorylated tau proteins and methods for producing conjugates thereof
WO2015187779A1 (en) 2014-06-03 2015-12-10 Xbiotech, Inc. Compositions and methods for treating and preventing staphylococcus aureus infections
US9982057B2 (en) 2014-11-17 2018-05-29 Pelican Therapeutics, Inc. Human TNFRSF25 antibody
CN116440279B (en) 2015-09-17 2026-02-24 伊缪诺金公司 Therapeutic combinations comprising anti-FOLR 1 immunoconjugates
US12048753B2 (en) * 2015-10-01 2024-07-30 Whitehead Institute For Biomedical Research Labeling of antibodies
CN109219620B (en) 2016-06-09 2023-01-31 派立卡恩治疗公司 Anti-TNFRSF25 antibody
KR102697393B1 (en) * 2017-02-13 2024-08-21 삼성전자주식회사 Method and apparatus for performing handover according to the type of a base station in wireless communication
EP3610266A4 (en) * 2017-04-12 2021-04-21 Massachusetts Eye and Ear Infirmary TUMOR SIGNATURE FOR METASTASIS, COMPOSITIONS OF MATERIAL AND THEIR METHODS OF USE
US11103163B2 (en) * 2017-04-21 2021-08-31 2Pi-Sigma Corporation Test cartridge and lancet for automated medical sample collection and testing
US10928411B2 (en) 2017-04-21 2021-02-23 2Pi-Sigma Corporation Automated medical sample collection and testing
WO2019032744A1 (en) * 2017-08-11 2019-02-14 Panacea Pharmaceticals Inc. Haah and mmp-9 are complementary cancer biomarkers and predictors of metastasis when combined
US10572352B2 (en) * 2017-11-01 2020-02-25 Vmware, Inc. Byzantine fault tolerance with verifiable secret sharing at constant overhead
WO2019161129A1 (en) 2018-02-14 2019-08-22 Mayo Foundation For Medical Education And Research Rescuing cancer patients from resistance to treatment with inhibitors of pd-1/pd-l1 interactions
WO2020092839A1 (en) 2018-10-31 2020-05-07 Mayo Foundation For Medical Education And Research Methods and materials for treating cancer
EP3873540A4 (en) 2018-10-31 2022-07-27 Mayo Foundation for Medical Education and Research METHODS AND MATERIALS FOR THE TREATMENT OF CANCER
KR102157813B1 (en) * 2019-01-29 2020-09-18 재단법인 아산사회복지재단 CCSP-2 Specific Monoclonal Antibody and Use thereof
CA3178663A1 (en) * 2020-05-15 2021-11-18 Alejandro Rojas One-step fast gradient method for nanoantibody generation
CN111679073B (en) * 2020-06-17 2021-10-19 南京市妇幼保健院 Application of KLK13 in the preparation of detection kit for diagnosis of cervical adenocarcinoma
WO2022060900A1 (en) * 2020-09-15 2022-03-24 The Henry M. Jackson Foundation For The Advancement Of Military Medicine, Inc. Shark-derived binding molecules for sars-cov-2 coronavirus and uses thereof
CN114996022B (en) * 2022-07-18 2024-03-08 山西华美远东科技有限公司 A multi-channel big data real-time decision-making system
CN116298319B (en) * 2023-04-06 2023-09-22 施康培医药科技(武汉)有限公司 A test strip for joint detection of human Tg and Cyfra21-1

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040137570A1 (en) * 2001-04-24 2004-07-15 Erasmus Universiteit Rotterdam Immunoglobulin 2
US20050037421A1 (en) * 2001-09-13 2005-02-17 Institute For Antibodies Co., Ltd Methods of constructing camel antibody libraries
US20050136493A1 (en) * 2001-08-02 2005-06-23 The Regents Of The University Of Michigan AMACR cancer markers
US20060246477A1 (en) * 2005-01-31 2006-11-02 Ablynx N.V. Method for generating variable domain sequences of heavy chain antibodies
US20070248604A1 (en) * 2006-02-10 2007-10-25 Genentech, Inc. Anti-fgf19 antibodies and methods using same

Family Cites Families (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US580526A (en) * 1897-04-13 Planter and cultivator
US6005079A (en) * 1992-08-21 1999-12-21 Vrije Universiteit Brussels Immunoglobulins devoid of light chains
US6765087B1 (en) * 1992-08-21 2004-07-20 Vrije Universiteit Brussel Immunoglobulins devoid of light chains
DK1621554T4 (en) * 1992-08-21 2012-12-17 Univ Bruxelles Immunoglobulins devoid of light chains
ES2162863T3 (en) * 1993-04-29 2002-01-16 Unilever Nv PRODUCTION OF ANTIBODIES OR FRAGMENTS (FUNCTIONALIZED) OF THE SAME DERIVED FROM HEAVY CHAIN IMMUNOGLOBULINS OF CAMELIDAE.
SE9301582D0 (en) * 1993-05-07 1993-05-07 Kabi Pharmacia Ab PURIFICATION OF PLASMA PROTEINS
US6010961A (en) * 1998-02-26 2000-01-04 Micron Technology, Inc. Methods of establishing electrical communication with substrate node locations, semiconductor processing methods of forming dynamic random access memory (DRAM) circuitry, and semiconductor assemblies
GB9812545D0 (en) * 1998-06-10 1998-08-05 Celltech Therapeutics Ltd Biological products
US8043868B2 (en) * 2001-12-21 2011-10-25 Imec Method and apparatus for detecting an analyte
EP1539811A4 (en) * 2002-09-16 2006-05-24 Elusys Therapeutics Inc Production of bispecific molecules using polyethylene glycol linkers
US20040146512A1 (en) * 2002-10-09 2004-07-29 Arnon Rosenthal Methods of treating Alzheimer's disease using antibodies directed against amyloid beta peptide and compositions thereof
CN101410530B (en) * 2003-04-18 2013-03-27 贝克顿·迪金森公司 Immuno-amplification
DE602004017726D1 (en) * 2003-06-30 2008-12-24 Domantis Ltd Pegylated single-domain antibodies (dAb)
US7371381B2 (en) * 2003-12-12 2008-05-13 Amgen Inc. Anti-galanin antibodies and uses thereof
TW200607523A (en) * 2004-06-01 2006-03-01 Domantis Ltd Drug compositions, fusions and conjugates
JP2008511286A (en) * 2004-06-02 2008-04-17 ダイアテック・ピーティワイ・リミテッド Binding components based on the IgNAR domain of sharks
WO2006030013A1 (en) * 2004-09-13 2006-03-23 Vib Vzw The modulation of phagocytosis in neurons
WO2006040153A2 (en) * 2004-10-13 2006-04-20 Ablynx N.V. Single domain camelide anti -amyloid beta antibodies and polypeptides comprising the same for the treatment and diagnosis of degenarative neural diseases such as alzheimer's disease
US20100323905A1 (en) * 2005-09-23 2010-12-23 Academisch Ziekenhuis Leiden Vhh for the Diagnosis, Prevention and Treatment of Diseases Associated with Protein Aggregates
PE20091163A1 (en) * 2007-11-01 2009-08-09 Wyeth Corp ANTIBODIES FOR GDF8

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040137570A1 (en) * 2001-04-24 2004-07-15 Erasmus Universiteit Rotterdam Immunoglobulin 2
US20050136493A1 (en) * 2001-08-02 2005-06-23 The Regents Of The University Of Michigan AMACR cancer markers
US20050037421A1 (en) * 2001-09-13 2005-02-17 Institute For Antibodies Co., Ltd Methods of constructing camel antibody libraries
US20060246477A1 (en) * 2005-01-31 2006-11-02 Ablynx N.V. Method for generating variable domain sequences of heavy chain antibodies
US20070248604A1 (en) * 2006-02-10 2007-10-25 Genentech, Inc. Anti-fgf19 antibodies and methods using same

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
HARMSEN ET AL.: "Properties, production, and applications of camelid single-domain antibody fragments.", APPL. MICROBIOL. BIOTECHNOL., vol. 77, no. 1, November 2007 (2007-11-01), pages 13 - 22 *
HOLLIGER ET AL.: "Engineered antibody fragments and the rise of single domains.", NAT. BIOTECHNOL., vol. 23, no. 9, September 2005 (2005-09-01), pages 1126 - 1136 *

Cited By (77)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8012479B2 (en) * 1996-08-23 2011-09-06 Health Protection Agency Recombinant toxin fragments
US9303092B2 (en) 2000-04-20 2016-04-05 The Board Of Trustees Of The University Of Arkansas Methamphetamine-like hapten compounds, linkers, carriers and compositions and uses thereof
US8846315B2 (en) 2008-08-12 2014-09-30 Zinfandel Pharmaceuticals, Inc. Disease risk factors and methods of use
US8815508B2 (en) 2008-08-12 2014-08-26 Zinfandel Pharmaceuticals, Inc. Method of identifying disease risk factors
US10865449B2 (en) 2008-08-12 2020-12-15 Zinfandel Pharmaceuticals, Inc. Method of identifying disease risk factors
US11021751B2 (en) 2008-08-12 2021-06-01 Zinfandel Pharmaceuticals, Inc. Disease risk factors and methods of use
EP3203233A3 (en) * 2008-10-29 2017-10-18 ICB International, Inc. Methods for using antibodies and analogs thereof
WO2011133504A3 (en) * 2010-04-20 2012-03-01 University Of Florida Research Foundation, Inc. Nanozymes, methods of making nanozymes, and methods of using nanozymes
US10081542B2 (en) 2010-04-20 2018-09-25 University of Florida Research Foundation, lnc. Nanozymes, methods of making nanozymes, and methods of using nanozymes
US9724339B2 (en) 2011-01-10 2017-08-08 Zinfandel Pharmaceuticals, Inc. Methods and drug products for treating alzheimer's disease
US9102666B2 (en) 2011-01-10 2015-08-11 Zinfandel Pharmaceuticals, Inc. Methods and drug products for treating Alzheimer's disease
US11179375B2 (en) 2011-01-10 2021-11-23 Zinfandel Pharmaceuticals, Inc. Methods and drug products for treating Alzheimer's disease
WO2012122528A1 (en) * 2011-03-10 2012-09-13 Hco Antibody, Inc. Bispecific three-chain antibody-like molecules
WO2012174392A1 (en) 2011-06-17 2012-12-20 Cytodyn, Inc. Methods of treating retroviral infections in felines
CN102230938A (en) * 2011-06-22 2011-11-02 中国科学院武汉病毒研究所 Kit and method for detecting influenza A virus based on immune magnetic bead enrichment
US20140193834A1 (en) * 2012-01-09 2014-07-10 Icb International, Inc. Blood-brain barrier permeable peptide compositions
EP3309171A1 (en) * 2012-01-09 2018-04-18 ICB International, Inc. Blood-brain barrier permeable peptide compositions
US10112988B2 (en) 2012-01-09 2018-10-30 Icb International, Inc. Methods of assessing amyloid-beta peptides in the central nervous system by blood-brain barrier permeable peptide compositions comprising a vab domain of a camelid single domain heavy chain antibody against an anti-amyloid-beta peptide
EP2754670A1 (en) * 2012-01-09 2014-07-16 ICB International, Inc. Blood-brain barrier permeable peptide compositions
EP3590963A1 (en) * 2012-01-09 2020-01-08 ICB International, Inc. Blood-brain barrier permeable peptide compositions
US20130177568A1 (en) * 2012-01-09 2013-07-11 Icb International, Inc. Blood-brain barrier permeable peptide compositions
EP2664625A3 (en) * 2012-01-09 2014-05-07 ICB International, Inc. Blood-brain barrier permeable peptide compositions
US10112987B2 (en) 2012-01-09 2018-10-30 Icb International, Inc. Blood-brain barrier permeable peptide compositions comprising a vab domain of a camelid single domain heavy chain antibody against an amyloid-beta peptide
US10738109B2 (en) 2012-01-09 2020-08-11 Icb International, Inc. Blood-brain barrier permeable peptide compositions comprising a VAB domain of an anti-amyloid-beta camelid single-domain heavy-chain only antibody
WO2013139956A1 (en) 2012-03-22 2013-09-26 Thrombogenics Nv Antibodies abrogating cell binding to lactadherin
US9884910B2 (en) 2012-04-24 2018-02-06 Thrombogenics Nv Anti-PDGF-C antibodies
WO2013160359A1 (en) 2012-04-24 2013-10-31 Thrombogenics N.V. Anti-pdgf-c antibodies
WO2014160133A3 (en) * 2013-03-13 2014-11-27 The Board Of Trustees Of The University Of Arkansas Anti-(+) --methamphetamine monoclonal antibodies
US9023353B2 (en) 2013-03-13 2015-05-05 The Board Of Trustees Of The University Of Arkansas Anti-(+)—methamphetamine monoclonal antibodies
CN103204937A (en) * 2013-04-26 2013-07-17 山西德丰信成生物科技有限公司 Single-domain heavy chain antibody T10 aiming at immune globulin Fc segment
US10538757B2 (en) 2013-08-14 2020-01-21 University Of Florida Research Foundation, Inc. Nanozymes, methods of making nanozymes, and methods of using nanozymes
RU2548759C2 (en) * 2013-08-20 2015-04-20 Федеральное Государственное Бюджетное Учреждение Науки Институт Молекулярной Биологии Им. В.А. Энгельгардта Российской Академии Наук (Имб Ран) Diagnostic technique for alzheimer disease by measuring chemically modified forms of metal-binding beta-amyloid domain in biological fluids
CN103421111A (en) * 2013-09-04 2013-12-04 吉日木图 Isolation, Purification and Identification of Heavy Chain Antibody from Camel Milk
JP2017513475A (en) * 2014-04-17 2017-06-01 テラクロン アイディーエフ エセ エレTeraclon Idf, S.L. Recombinant monoclonal antibody vNAR that neutralizes vascular endothelial growth factor (VEGF)
KR20180021205A (en) * 2014-10-23 2018-02-28 싱 바이오테크놀로지, 엘엘씨 Single domain antibodies directed against intracellular antigens
KR102207381B1 (en) * 2014-10-23 2021-01-27 싱 몰레큘러 메디신, 엘엘씨 Single domain antibodies directed against intracellular antigens
KR102207382B1 (en) 2014-10-23 2021-01-27 싱 몰레큘러 메디신, 엘엘씨 Single domain antibodies directed against intracellular antigens
KR101831123B1 (en) 2014-10-23 2018-02-22 싱 바이오테크놀로지, 엘엘씨 Single domain antibodies directed against intracellular antigens
AU2015335600B2 (en) * 2014-10-23 2019-04-04 Singh Molecular Medicine, Llc Single domain antibodies directed against intracellular antigens
AU2019204614B2 (en) * 2014-10-23 2020-10-22 Singh Molecular Medicine, Llc Single domain antibodies directed against intracellular antigens
TWI664289B (en) * 2014-10-23 2019-07-01 美商辛分子醫藥有限公司 Single domain antibody against intracellular antigen
EP3209685A4 (en) * 2014-10-23 2018-01-24 Singh Biotechnology, LLC Single domain antibodies directed against intracellular antigens
KR20190107199A (en) * 2014-10-23 2019-09-18 싱 몰레큘러 메디신, 엘엘씨 Single domain antibodies directed against intracellular antigens
KR102023289B1 (en) * 2014-10-23 2019-09-19 싱 몰레큘러 메디신, 엘엘씨 Single domain antibodies directed against intracellular antigens
KR20190108646A (en) * 2014-10-23 2019-09-24 싱 몰레큘러 메디신, 엘엘씨 Single domain antibodies directed against intracellular antigens
EP4006052A1 (en) * 2014-10-23 2022-06-01 Singh Molecular Medicine, LLC Single domain antibodies directed against intracellular antigens
AU2015346045B2 (en) * 2014-11-14 2021-08-26 Ossianix, Inc. Variable new antigen receptors (VNARs) directed against transferrin receptor (TfR) and their use
WO2016077840A3 (en) * 2014-11-14 2016-07-28 Ossianix, Inc. Variable new antigen receptors (vnars) directed against transferrin receptor (tfr) and their use
US11918647B2 (en) 2014-11-14 2024-03-05 Ossianix, Inc. TfR selective binding compounds and related methods
US10722576B2 (en) 2014-11-14 2020-07-28 Ossianix, Inc. TfR selective binding compounds and related methods
EP3218411B1 (en) * 2014-11-14 2022-01-12 Ossianix, Inc. Variable new antigen receptors (vnars) directed against transferrin receptor (tfr) and their use
CN107427574A (en) * 2015-01-09 2017-12-01 阿达尔塔私人有限公司 Cxcr4 binding molecules
CN114478773A (en) * 2015-01-09 2022-05-13 阿达尔塔有限公司 CXCR4 binding molecules
US11214626B2 (en) 2015-11-02 2022-01-04 Singh Biotechnology, Llc Single domain antibodies directed against arachidonate 12-lipoxygenase
CN105968204B (en) * 2016-02-03 2020-01-21 中国人民解放军第三军医大学第一附属医院 Single-domain heavy chain antibody for resisting prostate specific membrane antigen
CN105968204A (en) * 2016-02-03 2016-09-28 中国人民解放军第三军医大学第附属医院 Single-domain heavy chain antibody for anti-prostate specific membrane antigen
US11766482B2 (en) 2016-08-06 2023-09-26 Ossianix, Inc. In vivo methods for selecting peptides that cross the blood brain barrier, related compositions and methods of use
US11097010B2 (en) 2016-08-06 2021-08-24 Ossianix, Inc. In vivo methods for selecting peptides that cross the blood brain barrier, related compositions and methods of use
CN106619651A (en) * 2016-12-23 2017-05-10 江苏大学 Application of PGD2 (prostaglandin D2) in preparation of drug for treating stomach cancer
WO2018224636A1 (en) 2017-06-09 2018-12-13 Vib Vzw Glutamine dehydrogenase inhibitors for use in muscle regeneration
WO2019016123A1 (en) 2017-07-17 2019-01-24 Vib Vzw Targeting synaptogyrin-3 in tauopathy treatment
CN109943572A (en) * 2017-11-07 2019-06-28 香港城市大学 The method for producing antibody fragment
US11180544B2 (en) * 2017-11-07 2021-11-23 City University Of Hong Kong Method of producing antibody fragment
CN109943572B (en) * 2017-11-07 2022-06-03 香港城市大学 Method for producing antibody fragment
WO2019158579A1 (en) 2018-02-13 2019-08-22 Vib Vzw Targeting minimal residual disease in cancer with rxr antagonists
CN108794626A (en) * 2018-06-18 2018-11-13 上海大学 A kind of polypeptide and the gold nano antibody that HIV envelope proteins gp120 can be targeted
CN108794626B (en) * 2018-06-18 2021-10-12 上海大学 Polypeptide and gold nanobody capable of targeting HIV envelope protein gp120
US12351642B2 (en) 2018-09-14 2025-07-08 Ossianix, Inc. TFR-specific binding moieties and transcytosis method to select VNARs that cross cellular barriers
WO2020115039A1 (en) 2018-12-03 2020-06-11 Vib Vzw Cancer regression by inducing a regeneration-like response
US11414785B2 (en) 2019-08-13 2022-08-16 Waters Technologies Corporation Affinity resins and sample preparation devices based on cartilaginous fish IgNAR derived binding domains
WO2021028837A1 (en) * 2019-08-13 2021-02-18 Waters Technologies Corporation Affinity resins and sample preparation devices based on cartilaginous fish ignar derived binding domains
US11498978B2 (en) 2020-05-05 2022-11-15 Bio-Y A/S YKL-40 antibody
CN116239695A (en) * 2022-05-09 2023-06-09 华兰基因工程有限公司 Antibody specifically binding to PV-1 protein or its antigen-binding fragment HLPV-P11 and application thereof
CN116239695B (en) * 2022-05-09 2024-03-22 华兰基因工程(河南)有限公司 Antibodies or antigen binding fragments thereof HLPV-P11 that specifically bind to PV-1 protein and uses thereof
WO2024160756A1 (en) 2023-01-30 2024-08-08 Vib Vzw Suppressors of tauopathies
CN120329430A (en) * 2024-01-18 2025-07-18 上海奥普生物医药股份有限公司 Antibodies or antigen-binding fragments thereof targeting NMP22 and their applications
CN119060173A (en) * 2024-09-19 2024-12-03 苏州东抗生物科技有限公司 Specific antibodies against HPV-18 type E protein and uses thereof

Also Published As

Publication number Publication date
US20100092470A1 (en) 2010-04-15

Similar Documents

Publication Publication Date Title
US20100092470A1 (en) Antibodies, analogs and uses thereof
EP2350655B1 (en) Methods for using antibodies and analogs thereof
US8357783B2 (en) Human anti-mesothelin monoclonal antibodies
WO2016171242A1 (en) Detection of epha2
JP6239503B2 (en) Novel anti-CXCR4 antibody and its use for cancer detection and diagnosis
US20110020344A1 (en) Human monoclonal antibodies specific for cd22
WO2020094120A1 (en) Anti-b7-h3 antibody, preparation method therefor, conjugate and application thereof
US9676846B2 (en) Human monoclonal antibodies that bind insulin-like growth factor (IGF) I and II
JP2023527937A5 (en)
KR20230016212A (en) Anti-CLDN18.2 Antibodies and Diagnostic Uses Thereof
Prantner et al. Anti-mesothelin nanobodies for both conventional and nanoparticle-based biomedical applications
JP6977105B2 (en) IGF-1R antibody and its use for the diagnosis of cancer
CN103429617B (en) Comprise the anti-marker of CK8/18 mixture autoantibody and the purposes of diagnosing cancer thereof
CN111316102A (en) Method for diagnosing pancreatic cancer using methionyl-tRNA synthetase and pancreatic cancer diagnostic kit using the same
WO2018135653A1 (en) Anti-epha2 antibody and immunological detection of epha2 using same
EP3552014A1 (en) Incompatible blood group antigen for cancer detection and treatment
WO2021030450A1 (en) Novel lox-1 antibody compositions, lox1 neutralization assay and methods of treatment using same
WO2017155355A1 (en) Antibody specifically binding to aimp2-dx2 protein
JPWO2013015367A1 (en) Antibody for detecting epithelial ovarian cancer marker and method for determining epithelial ovarian cancer
JP7019609B2 (en) Monoclonal antibodies, compositions and methods for detecting mucin-like proteins (MLPs) as biomarkers for ovarian and pancreatic cancers
TWI782000B (en) Anti gpr20 antibodies, preparation method and application thereof
WO2013059206A2 (en) Monospecific and bispecific human monoclonal antibodies targeting insulin-growth factor ii (igf-ii)
CN110891977A (en) Monoclonal antibody specifically binding to MRS
US20110171216A1 (en) Monoclonal antibodies specific for pancreatic neoplasia cells
CN119487068A (en) Anti-CLDN18.2 antibodies and their diagnostic uses

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 09815332

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 4029/DELNP/2010

Country of ref document: IN

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 09815332

Country of ref document: EP

Kind code of ref document: A1