WO2009140177A2 - Anti-fn14 antibodies and uses thereof - Google Patents
Anti-fn14 antibodies and uses thereof Download PDFInfo
- Publication number
- WO2009140177A2 WO2009140177A2 PCT/US2009/043382 US2009043382W WO2009140177A2 WO 2009140177 A2 WO2009140177 A2 WO 2009140177A2 US 2009043382 W US2009043382 W US 2009043382W WO 2009140177 A2 WO2009140177 A2 WO 2009140177A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antibody
- cdr
- antigen
- binding fragment
- Prior art date
Links
- 210000004027 cell Anatomy 0.000 claims abstract description 244
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 197
- 201000011510 cancer Diseases 0.000 claims abstract description 116
- 238000000034 method Methods 0.000 claims abstract description 76
- 230000022534 cell killing Effects 0.000 claims abstract description 33
- 210000004881 tumor cell Anatomy 0.000 claims abstract description 28
- 230000034994 death Effects 0.000 claims abstract description 6
- 231100000517 death Toxicity 0.000 claims abstract description 6
- 230000027455 binding Effects 0.000 claims description 351
- 239000012634 fragment Substances 0.000 claims description 160
- 108010047041 Complementarity Determining Regions Proteins 0.000 claims description 146
- 241000282414 Homo sapiens Species 0.000 claims description 144
- 239000000427 antigen Substances 0.000 claims description 128
- 108091007433 antigens Proteins 0.000 claims description 126
- 102000036639 antigens Human genes 0.000 claims description 126
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 92
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 77
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 72
- 206010009944 Colon cancer Diseases 0.000 claims description 65
- 229920001184 polypeptide Polymers 0.000 claims description 65
- 208000029742 colonic neoplasm Diseases 0.000 claims description 63
- 206010006187 Breast cancer Diseases 0.000 claims description 57
- 208000026310 Breast neoplasm Diseases 0.000 claims description 55
- 238000001727 in vivo Methods 0.000 claims description 51
- 238000000338 in vitro Methods 0.000 claims description 42
- 150000001413 amino acids Chemical class 0.000 claims description 41
- 210000004602 germ cell Anatomy 0.000 claims description 23
- 239000008194 pharmaceutical composition Substances 0.000 claims description 19
- 241000124008 Mammalia Species 0.000 claims description 9
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 claims description 7
- 239000003937 drug carrier Substances 0.000 claims description 5
- 206010035226 Plasma cell myeloma Diseases 0.000 claims description 4
- 210000003719 b-lymphocyte Anatomy 0.000 claims description 4
- 201000000050 myeloid neoplasm Diseases 0.000 claims description 4
- 230000004565 tumor cell growth Effects 0.000 claims description 4
- 230000001939 inductive effect Effects 0.000 claims description 3
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 33
- 108010021625 Immunoglobulin Fragments Proteins 0.000 abstract description 11
- 102000008394 Immunoglobulin Fragments Human genes 0.000 abstract description 11
- 101100046559 Mus musculus Tnfrsf12a gene Proteins 0.000 abstract 2
- 239000012636 effector Substances 0.000 description 100
- 230000006870 function Effects 0.000 description 96
- 108090000623 proteins and genes Proteins 0.000 description 95
- 102000004169 proteins and genes Human genes 0.000 description 75
- 235000018102 proteins Nutrition 0.000 description 68
- 238000011282 treatment Methods 0.000 description 68
- 230000002829 reductive effect Effects 0.000 description 62
- 235000001014 amino acid Nutrition 0.000 description 59
- 238000006467 substitution reaction Methods 0.000 description 52
- 230000000694 effects Effects 0.000 description 51
- 102000014914 Carrier Proteins Human genes 0.000 description 49
- 108091008324 binding proteins Proteins 0.000 description 49
- 239000003795 chemical substances by application Substances 0.000 description 48
- 230000013595 glycosylation Effects 0.000 description 44
- 238000006206 glycosylation reaction Methods 0.000 description 44
- 230000035772 mutation Effects 0.000 description 44
- 102000009109 Fc receptors Human genes 0.000 description 43
- 108010087819 Fc receptors Proteins 0.000 description 43
- 229940024606 amino acid Drugs 0.000 description 39
- 239000000203 mixture Substances 0.000 description 34
- 238000003556 assay Methods 0.000 description 31
- 125000000539 amino acid group Chemical group 0.000 description 30
- 230000014509 gene expression Effects 0.000 description 30
- 230000001965 increasing effect Effects 0.000 description 30
- 241000699666 Mus <mouse, genus> Species 0.000 description 28
- 238000001356 surgical procedure Methods 0.000 description 28
- 230000004075 alteration Effects 0.000 description 26
- 238000002512 chemotherapy Methods 0.000 description 25
- 210000001519 tissue Anatomy 0.000 description 24
- 239000000556 agonist Substances 0.000 description 23
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 23
- 238000012217 deletion Methods 0.000 description 23
- 230000037430 deletion Effects 0.000 description 23
- 239000003814 drug Substances 0.000 description 23
- 239000013604 expression vector Substances 0.000 description 22
- 238000001959 radiotherapy Methods 0.000 description 21
- 241000700159 Rattus Species 0.000 description 20
- 238000003780 insertion Methods 0.000 description 20
- 230000037431 insertion Effects 0.000 description 20
- 238000012360 testing method Methods 0.000 description 20
- 208000035475 disorder Diseases 0.000 description 19
- 102220530551 ADAMTS-like protein 1_W42A_mutation Human genes 0.000 description 18
- 241001529936 Murinae Species 0.000 description 18
- 210000000481 breast Anatomy 0.000 description 18
- 239000000463 material Substances 0.000 description 18
- 230000004044 response Effects 0.000 description 18
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 17
- 230000000295 complement effect Effects 0.000 description 17
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 17
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 17
- 230000007423 decrease Effects 0.000 description 16
- 229940079593 drug Drugs 0.000 description 16
- 150000007523 nucleic acids Chemical class 0.000 description 16
- 230000004048 modification Effects 0.000 description 15
- 238000012986 modification Methods 0.000 description 15
- 238000002703 mutagenesis Methods 0.000 description 15
- 231100000350 mutagenesis Toxicity 0.000 description 15
- -1 DNAs Chemical class 0.000 description 14
- 235000004279 alanine Nutrition 0.000 description 14
- 230000006698 induction Effects 0.000 description 14
- 239000013642 negative control Substances 0.000 description 14
- 208000024891 symptom Diseases 0.000 description 14
- 230000001225 therapeutic effect Effects 0.000 description 14
- 238000000134 MTT assay Methods 0.000 description 13
- 231100000002 MTT assay Toxicity 0.000 description 13
- 241000699670 Mus sp. Species 0.000 description 13
- 229940127089 cytotoxic agent Drugs 0.000 description 13
- 201000010099 disease Diseases 0.000 description 13
- 102000039446 nucleic acids Human genes 0.000 description 13
- 108020004707 nucleic acids Proteins 0.000 description 13
- 102000011727 Caspases Human genes 0.000 description 12
- 108010076667 Caspases Proteins 0.000 description 12
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 12
- 241000282567 Macaca fascicularis Species 0.000 description 12
- 241000269370 Xenopus <genus> Species 0.000 description 12
- 239000002246 antineoplastic agent Substances 0.000 description 12
- 230000024203 complement activation Effects 0.000 description 12
- 239000002299 complementary DNA Substances 0.000 description 12
- 150000001875 compounds Chemical class 0.000 description 12
- 230000003247 decreasing effect Effects 0.000 description 12
- 230000001404 mediated effect Effects 0.000 description 12
- 102000005962 receptors Human genes 0.000 description 12
- 108020003175 receptors Proteins 0.000 description 12
- 238000002560 therapeutic procedure Methods 0.000 description 12
- 108010021468 Fc gamma receptor IIA Proteins 0.000 description 11
- 241001465754 Metazoa Species 0.000 description 11
- 108091028043 Nucleic acid sequence Proteins 0.000 description 11
- 210000001744 T-lymphocyte Anatomy 0.000 description 11
- 230000008859 change Effects 0.000 description 11
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 11
- 238000002474 experimental method Methods 0.000 description 11
- 230000005855 radiation Effects 0.000 description 11
- 102000004890 Interleukin-8 Human genes 0.000 description 10
- 108090001007 Interleukin-8 Proteins 0.000 description 10
- 150000004676 glycans Chemical class 0.000 description 10
- XKTZWUACRZHVAN-VADRZIEHSA-N interleukin-8 Chemical compound C([C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@@H](NC(C)=O)CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CCSC)C(=O)N1[C@H](CCC1)C(=O)N1[C@H](CCC1)C(=O)N[C@@H](C)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC=1C=CC(O)=CC=1)C(=O)N[C@H](CO)C(=O)N1[C@H](CCC1)C(N)=O)C1=CC=CC=C1 XKTZWUACRZHVAN-VADRZIEHSA-N 0.000 description 10
- 229940096397 interleukin-8 Drugs 0.000 description 10
- 230000004083 survival effect Effects 0.000 description 10
- 238000002626 targeted therapy Methods 0.000 description 10
- 239000013598 vector Substances 0.000 description 10
- 238000002965 ELISA Methods 0.000 description 9
- 108060003951 Immunoglobulin Proteins 0.000 description 9
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 9
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 9
- 108010076504 Protein Sorting Signals Proteins 0.000 description 9
- 230000002378 acidificating effect Effects 0.000 description 9
- 102000018358 immunoglobulin Human genes 0.000 description 9
- 238000004519 manufacturing process Methods 0.000 description 9
- 239000000523 sample Substances 0.000 description 9
- 239000000243 solution Substances 0.000 description 9
- 108010073807 IgG Receptors Proteins 0.000 description 8
- 230000000903 blocking effect Effects 0.000 description 8
- 230000030833 cell death Effects 0.000 description 8
- 230000006240 deamidation Effects 0.000 description 8
- 238000001794 hormone therapy Methods 0.000 description 8
- 230000003993 interaction Effects 0.000 description 8
- 239000002502 liposome Substances 0.000 description 8
- 241000894007 species Species 0.000 description 8
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 8
- 230000001988 toxicity Effects 0.000 description 8
- 231100000419 toxicity Toxicity 0.000 description 8
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 7
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 7
- 108010069112 Complement System Proteins Proteins 0.000 description 7
- 102000000989 Complement System Proteins Human genes 0.000 description 7
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 7
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 7
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 7
- 230000006907 apoptotic process Effects 0.000 description 7
- 238000013459 approach Methods 0.000 description 7
- 239000000872 buffer Substances 0.000 description 7
- 210000001072 colon Anatomy 0.000 description 7
- 238000002648 combination therapy Methods 0.000 description 7
- 238000010494 dissociation reaction Methods 0.000 description 7
- 230000005593 dissociations Effects 0.000 description 7
- 231100000673 dose–response relationship Toxicity 0.000 description 7
- 238000001802 infusion Methods 0.000 description 7
- 239000003999 initiator Substances 0.000 description 7
- 239000007924 injection Substances 0.000 description 7
- 238000002347 injection Methods 0.000 description 7
- 238000011081 inoculation Methods 0.000 description 7
- 229920000642 polymer Polymers 0.000 description 7
- 238000000159 protein binding assay Methods 0.000 description 7
- 230000009467 reduction Effects 0.000 description 7
- 102000003886 Glycoproteins Human genes 0.000 description 6
- 108090000288 Glycoproteins Proteins 0.000 description 6
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 6
- 101000917826 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-a Proteins 0.000 description 6
- 101000917824 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-b Proteins 0.000 description 6
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 6
- 230000004988 N-glycosylation Effects 0.000 description 6
- 108010057466 NF-kappa B Proteins 0.000 description 6
- 102000003945 NF-kappa B Human genes 0.000 description 6
- 230000004913 activation Effects 0.000 description 6
- 238000007792 addition Methods 0.000 description 6
- 239000003153 chemical reaction reagent Substances 0.000 description 6
- 239000013078 crystal Substances 0.000 description 6
- 230000006378 damage Effects 0.000 description 6
- 238000005516 engineering process Methods 0.000 description 6
- 210000004408 hybridoma Anatomy 0.000 description 6
- 238000009169 immunotherapy Methods 0.000 description 6
- 210000004185 liver Anatomy 0.000 description 6
- 210000001165 lymph node Anatomy 0.000 description 6
- 230000037361 pathway Effects 0.000 description 6
- 238000002428 photodynamic therapy Methods 0.000 description 6
- 239000013641 positive control Substances 0.000 description 6
- 238000003259 recombinant expression Methods 0.000 description 6
- 230000028327 secretion Effects 0.000 description 6
- 210000002966 serum Anatomy 0.000 description 6
- 206010006272 Breast mass Diseases 0.000 description 5
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 5
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 5
- 125000000393 L-methionino group Chemical group [H]OC(=O)[C@@]([H])(N([H])[*])C([H])([H])C(SC([H])([H])[H])([H])[H] 0.000 description 5
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 5
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 5
- 238000005481 NMR spectroscopy Methods 0.000 description 5
- 238000010171 animal model Methods 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- 238000004113 cell culture Methods 0.000 description 5
- 238000002052 colonoscopy Methods 0.000 description 5
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 5
- 239000002254 cytotoxic agent Substances 0.000 description 5
- 238000010790 dilution Methods 0.000 description 5
- 239000012895 dilution Substances 0.000 description 5
- 239000002552 dosage form Substances 0.000 description 5
- 238000012377 drug delivery Methods 0.000 description 5
- 229960002949 fluorouracil Drugs 0.000 description 5
- 108020001507 fusion proteins Proteins 0.000 description 5
- 102000037865 fusion proteins Human genes 0.000 description 5
- 206010017758 gastric cancer Diseases 0.000 description 5
- 238000002513 implantation Methods 0.000 description 5
- 239000003446 ligand Substances 0.000 description 5
- 238000002595 magnetic resonance imaging Methods 0.000 description 5
- 239000003550 marker Substances 0.000 description 5
- 229960000485 methotrexate Drugs 0.000 description 5
- 239000002773 nucleotide Substances 0.000 description 5
- 125000003729 nucleotide group Chemical group 0.000 description 5
- 150000002482 oligosaccharides Chemical class 0.000 description 5
- 239000002245 particle Substances 0.000 description 5
- 230000004481 post-translational protein modification Effects 0.000 description 5
- 230000001105 regulatory effect Effects 0.000 description 5
- 238000012216 screening Methods 0.000 description 5
- 239000002904 solvent Substances 0.000 description 5
- 229940124597 therapeutic agent Drugs 0.000 description 5
- 230000009261 transgenic effect Effects 0.000 description 5
- 102000003390 tumor necrosis factor Human genes 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 4
- 108020004414 DNA Proteins 0.000 description 4
- 108010021472 Fc gamma receptor IIB Proteins 0.000 description 4
- 108010074328 Interferon-gamma Proteins 0.000 description 4
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 4
- DEFJQIDDEAULHB-IMJSIDKUSA-N L-alanyl-L-alanine Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(O)=O DEFJQIDDEAULHB-IMJSIDKUSA-N 0.000 description 4
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 4
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 4
- 102100029205 Low affinity immunoglobulin gamma Fc region receptor II-b Human genes 0.000 description 4
- 101710099301 Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 4
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 4
- 108010029485 Protein Isoforms Proteins 0.000 description 4
- 102000001708 Protein Isoforms Human genes 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 4
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 4
- 108010056243 alanylalanine Proteins 0.000 description 4
- 229960001230 asparagine Drugs 0.000 description 4
- 235000009582 asparagine Nutrition 0.000 description 4
- 238000011717 athymic nude mouse Methods 0.000 description 4
- 230000004071 biological effect Effects 0.000 description 4
- 150000001720 carbohydrates Chemical group 0.000 description 4
- 230000009089 cytolysis Effects 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 230000018109 developmental process Effects 0.000 description 4
- 239000006185 dispersion Substances 0.000 description 4
- 230000002255 enzymatic effect Effects 0.000 description 4
- 208000010749 gastric carcinoma Diseases 0.000 description 4
- 239000001963 growth medium Substances 0.000 description 4
- 229940022353 herceptin Drugs 0.000 description 4
- 229940088597 hormone Drugs 0.000 description 4
- 239000005556 hormone Substances 0.000 description 4
- 210000000987 immune system Anatomy 0.000 description 4
- 230000016784 immunoglobulin production Effects 0.000 description 4
- 238000003364 immunohistochemistry Methods 0.000 description 4
- 239000007943 implant Substances 0.000 description 4
- 239000004615 ingredient Substances 0.000 description 4
- 229920001542 oligosaccharide Polymers 0.000 description 4
- 201000002528 pancreatic cancer Diseases 0.000 description 4
- 239000012188 paraffin wax Substances 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 230000002265 prevention Effects 0.000 description 4
- 150000003839 salts Chemical class 0.000 description 4
- 238000002741 site-directed mutagenesis Methods 0.000 description 4
- 230000000638 stimulation Effects 0.000 description 4
- 201000000498 stomach carcinoma Diseases 0.000 description 4
- 238000004448 titration Methods 0.000 description 4
- 229960000575 trastuzumab Drugs 0.000 description 4
- 230000004614 tumor growth Effects 0.000 description 4
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 3
- 108020004635 Complementary DNA Proteins 0.000 description 3
- 102000004127 Cytokines Human genes 0.000 description 3
- 108090000695 Cytokines Proteins 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- 101710182312 High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 3
- 101000891649 Homo sapiens Transcription elongation factor A protein-like 1 Proteins 0.000 description 3
- 101000648505 Homo sapiens Tumor necrosis factor receptor superfamily member 12A Proteins 0.000 description 3
- 102000009490 IgG Receptors Human genes 0.000 description 3
- 102100037850 Interferon gamma Human genes 0.000 description 3
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 3
- 102100029193 Low affinity immunoglobulin gamma Fc region receptor III-A Human genes 0.000 description 3
- 206010025323 Lymphomas Diseases 0.000 description 3
- 102000043131 MHC class II family Human genes 0.000 description 3
- 108091054438 MHC class II family Proteins 0.000 description 3
- 229930012538 Paclitaxel Natural products 0.000 description 3
- 206010057249 Phagocytosis Diseases 0.000 description 3
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 3
- 239000002202 Polyethylene glycol Substances 0.000 description 3
- 108020004511 Recombinant DNA Proteins 0.000 description 3
- 206010039491 Sarcoma Diseases 0.000 description 3
- 238000012300 Sequence Analysis Methods 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 241000700605 Viruses Species 0.000 description 3
- 238000002835 absorbance Methods 0.000 description 3
- 238000010521 absorption reaction Methods 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 229940121363 anti-inflammatory agent Drugs 0.000 description 3
- 239000002260 anti-inflammatory agent Substances 0.000 description 3
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- 230000009286 beneficial effect Effects 0.000 description 3
- 238000001574 biopsy Methods 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 229920001400 block copolymer Polymers 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 210000004556 brain Anatomy 0.000 description 3
- 238000012761 co-transfection Methods 0.000 description 3
- 230000004154 complement system Effects 0.000 description 3
- 239000013068 control sample Substances 0.000 description 3
- 238000004132 cross linking Methods 0.000 description 3
- 239000003431 cross linking reagent Substances 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 231100000433 cytotoxic Toxicity 0.000 description 3
- 231100000599 cytotoxic agent Toxicity 0.000 description 3
- 230000001472 cytotoxic effect Effects 0.000 description 3
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 3
- 229960000975 daunorubicin Drugs 0.000 description 3
- 230000022811 deglycosylation Effects 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 239000000539 dimer Substances 0.000 description 3
- 229960004679 doxorubicin Drugs 0.000 description 3
- 239000003623 enhancer Substances 0.000 description 3
- 229940011871 estrogen Drugs 0.000 description 3
- 239000000262 estrogen Substances 0.000 description 3
- 239000000284 extract Substances 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 230000002496 gastric effect Effects 0.000 description 3
- 238000003384 imaging method Methods 0.000 description 3
- 230000028993 immune response Effects 0.000 description 3
- 230000002163 immunogen Effects 0.000 description 3
- 238000000099 in vitro assay Methods 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 238000007912 intraperitoneal administration Methods 0.000 description 3
- 229960004768 irinotecan Drugs 0.000 description 3
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 3
- SZVJSHCCFOBDDC-UHFFFAOYSA-N iron(II,III) oxide Inorganic materials O=[Fe]O[Fe]O[Fe]=O SZVJSHCCFOBDDC-UHFFFAOYSA-N 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 239000006193 liquid solution Substances 0.000 description 3
- 210000004072 lung Anatomy 0.000 description 3
- 210000002540 macrophage Anatomy 0.000 description 3
- 230000005291 magnetic effect Effects 0.000 description 3
- 238000013507 mapping Methods 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 201000001441 melanoma Diseases 0.000 description 3
- 235000013336 milk Nutrition 0.000 description 3
- 239000008267 milk Substances 0.000 description 3
- 210000004080 milk Anatomy 0.000 description 3
- 210000000822 natural killer cell Anatomy 0.000 description 3
- 238000011275 oncology therapy Methods 0.000 description 3
- 210000000056 organ Anatomy 0.000 description 3
- 229960001592 paclitaxel Drugs 0.000 description 3
- 230000008782 phagocytosis Effects 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 229920001223 polyethylene glycol Polymers 0.000 description 3
- 229920001451 polypropylene glycol Polymers 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 238000004393 prognosis Methods 0.000 description 3
- 230000002035 prolonged effect Effects 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 230000035945 sensitivity Effects 0.000 description 3
- 230000011664 signaling Effects 0.000 description 3
- 239000011734 sodium Substances 0.000 description 3
- 229910052708 sodium Inorganic materials 0.000 description 3
- 238000010561 standard procedure Methods 0.000 description 3
- 239000007929 subcutaneous injection Substances 0.000 description 3
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 3
- 238000001890 transfection Methods 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- 230000003442 weekly effect Effects 0.000 description 3
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 2
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 2
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 2
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 2
- FPQQSJJWHUJYPU-UHFFFAOYSA-N 3-(dimethylamino)propyliminomethylidene-ethylazanium;chloride Chemical compound Cl.CCN=C=NCCCN(C)C FPQQSJJWHUJYPU-UHFFFAOYSA-N 0.000 description 2
- ZMRMMAOBSFSXLN-UHFFFAOYSA-N 4-[4-(2,5-dioxopyrrol-1-yl)phenyl]butanehydrazide Chemical compound C1=CC(CCCC(=O)NN)=CC=C1N1C(=O)C=CC1=O ZMRMMAOBSFSXLN-UHFFFAOYSA-N 0.000 description 2
- 102220530491 ADAMTS-like protein 1_W42F_mutation Human genes 0.000 description 2
- BFYIZQONLCFLEV-DAELLWKTSA-N Aromasine Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CC(=C)C2=C1 BFYIZQONLCFLEV-DAELLWKTSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 208000023275 Autoimmune disease Diseases 0.000 description 2
- 206010004146 Basal cell carcinoma Diseases 0.000 description 2
- 208000031648 Body Weight Changes Diseases 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- 206010006298 Breast pain Diseases 0.000 description 2
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 2
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 2
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 2
- 102000000844 Cell Surface Receptors Human genes 0.000 description 2
- 108010001857 Cell Surface Receptors Proteins 0.000 description 2
- 108091035707 Consensus sequence Proteins 0.000 description 2
- 208000011231 Crohn disease Diseases 0.000 description 2
- 101150074155 DHFR gene Proteins 0.000 description 2
- 108010092160 Dactinomycin Proteins 0.000 description 2
- 102220485790 Destrin_S40R_mutation Human genes 0.000 description 2
- 229940123907 Disease modifying antirheumatic drug Drugs 0.000 description 2
- 102220616749 Double-stranded RNA-specific editase B2_M50A_mutation Human genes 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 208000005189 Embolism Diseases 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 2
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 2
- 208000017891 HER2 positive breast carcinoma Diseases 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 2
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 2
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 2
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- 101710122625 Low affinity immunoglobulin gamma Fc region receptor II Proteins 0.000 description 2
- 241000282560 Macaca mulatta Species 0.000 description 2
- 208000006662 Mastodynia Diseases 0.000 description 2
- 206010027476 Metastases Diseases 0.000 description 2
- 208000008589 Obesity Diseases 0.000 description 2
- 208000002193 Pain Diseases 0.000 description 2
- 239000004698 Polyethylene Substances 0.000 description 2
- 229920001213 Polysorbate 20 Polymers 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 2
- 208000015634 Rectal Neoplasms Diseases 0.000 description 2
- 238000011579 SCID mouse model Methods 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- 238000012288 TUNEL assay Methods 0.000 description 2
- MUMGGOZAMZWBJJ-DYKIIFRCSA-N Testostosterone Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 MUMGGOZAMZWBJJ-DYKIIFRCSA-N 0.000 description 2
- 102000040945 Transcription factor Human genes 0.000 description 2
- 108091023040 Transcription factor Proteins 0.000 description 2
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 2
- 206010053613 Type IV hypersensitivity reaction Diseases 0.000 description 2
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 2
- 208000027418 Wounds and injury Diseases 0.000 description 2
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 208000007502 anemia Diseases 0.000 description 2
- 230000033115 angiogenesis Effects 0.000 description 2
- 230000000259 anti-tumor effect Effects 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 229940041181 antineoplastic drug Drugs 0.000 description 2
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 2
- 230000008033 biological extinction Effects 0.000 description 2
- 239000012472 biological sample Substances 0.000 description 2
- 238000001815 biotherapy Methods 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 239000002981 blocking agent Substances 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 230000004579 body weight change Effects 0.000 description 2
- 238000006664 bond formation reaction Methods 0.000 description 2
- 210000000988 bone and bone Anatomy 0.000 description 2
- 201000008275 breast carcinoma Diseases 0.000 description 2
- 102220358488 c.167G>A Human genes 0.000 description 2
- 102200102393 c.194T>A Human genes 0.000 description 2
- 238000004422 calculation algorithm Methods 0.000 description 2
- 229960004117 capecitabine Drugs 0.000 description 2
- 238000012219 cassette mutagenesis Methods 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 210000003679 cervix uteri Anatomy 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 210000000038 chest Anatomy 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 201000004365 colon carcinoma in situ Diseases 0.000 description 2
- 239000003636 conditioned culture medium Substances 0.000 description 2
- 239000002872 contrast media Substances 0.000 description 2
- 238000013270 controlled release Methods 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 230000009260 cross reactivity Effects 0.000 description 2
- 230000003013 cytotoxicity Effects 0.000 description 2
- 231100000135 cytotoxicity Toxicity 0.000 description 2
- 229960000640 dactinomycin Drugs 0.000 description 2
- 230000007547 defect Effects 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- RGLYKWWBQGJZGM-ISLYRVAYSA-N diethylstilbestrol Chemical compound C=1C=C(O)C=CC=1C(/CC)=C(\CC)C1=CC=C(O)C=C1 RGLYKWWBQGJZGM-ISLYRVAYSA-N 0.000 description 2
- 238000006471 dimerization reaction Methods 0.000 description 2
- 239000002988 disease modifying antirheumatic drug Substances 0.000 description 2
- 239000002612 dispersion medium Substances 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 230000000437 effect on angiogenesis Effects 0.000 description 2
- 210000002919 epithelial cell Anatomy 0.000 description 2
- 210000002744 extracellular matrix Anatomy 0.000 description 2
- 230000005294 ferromagnetic effect Effects 0.000 description 2
- 238000002866 fluorescence resonance energy transfer Methods 0.000 description 2
- 230000005714 functional activity Effects 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 2
- 229960005277 gemcitabine Drugs 0.000 description 2
- 229930195712 glutamate Natural products 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 238000002657 hormone replacement therapy Methods 0.000 description 2
- 102000055458 human TNFRSF12A Human genes 0.000 description 2
- 125000001165 hydrophobic group Chemical group 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 230000003053 immunization Effects 0.000 description 2
- 238000002649 immunization Methods 0.000 description 2
- 230000002757 inflammatory effect Effects 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 208000003243 intestinal obstruction Diseases 0.000 description 2
- 238000001361 intraarterial administration Methods 0.000 description 2
- 238000010255 intramuscular injection Methods 0.000 description 2
- 239000007927 intramuscular injection Substances 0.000 description 2
- 238000007913 intrathecal administration Methods 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 238000002372 labelling Methods 0.000 description 2
- 210000000867 larynx Anatomy 0.000 description 2
- 208000032839 leukemia Diseases 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 230000014759 maintenance of location Effects 0.000 description 2
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 238000009607 mammography Methods 0.000 description 2
- 239000011159 matrix material Substances 0.000 description 2
- 230000009401 metastasis Effects 0.000 description 2
- 230000001394 metastastic effect Effects 0.000 description 2
- 206010061289 metastatic neoplasm Diseases 0.000 description 2
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 2
- 230000003278 mimic effect Effects 0.000 description 2
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 2
- 229960001156 mitoxantrone Drugs 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 238000002625 monoclonal antibody therapy Methods 0.000 description 2
- 201000006417 multiple sclerosis Diseases 0.000 description 2
- 210000003205 muscle Anatomy 0.000 description 2
- 210000004897 n-terminal region Anatomy 0.000 description 2
- 210000002445 nipple Anatomy 0.000 description 2
- 235000020824 obesity Nutrition 0.000 description 2
- 230000003204 osmotic effect Effects 0.000 description 2
- 210000001672 ovary Anatomy 0.000 description 2
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 2
- 229960001756 oxaliplatin Drugs 0.000 description 2
- 239000001301 oxygen Substances 0.000 description 2
- 229910052760 oxygen Inorganic materials 0.000 description 2
- 210000000496 pancreas Anatomy 0.000 description 2
- 208000008443 pancreatic carcinoma Diseases 0.000 description 2
- 230000005298 paramagnetic effect Effects 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 238000002823 phage display Methods 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 229920000233 poly(alkylene oxides) Polymers 0.000 description 2
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 2
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 2
- AQHHHDLHHXJYJD-UHFFFAOYSA-N propranolol Chemical compound C1=CC=C2C(OCC(O)CNC(C)C)=CC=CC2=C1 AQHHHDLHHXJYJD-UHFFFAOYSA-N 0.000 description 2
- 210000002307 prostate Anatomy 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 2
- 206010038038 rectal cancer Diseases 0.000 description 2
- 210000000664 rectum Anatomy 0.000 description 2
- 201000001275 rectum cancer Diseases 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- 206010039073 rheumatoid arthritis Diseases 0.000 description 2
- 102220049912 rs587783525 Human genes 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 230000003248 secreting effect Effects 0.000 description 2
- 238000013207 serial dilution Methods 0.000 description 2
- 238000002579 sigmoidoscopy Methods 0.000 description 2
- 238000009097 single-agent therapy Methods 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 230000006641 stabilisation Effects 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 238000011272 standard treatment Methods 0.000 description 2
- 210000002784 stomach Anatomy 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 238000010254 subcutaneous injection Methods 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 230000008961 swelling Effects 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 229960001603 tamoxifen Drugs 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 238000003325 tomography Methods 0.000 description 2
- 125000000430 tryptophan group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C2=C([H])C([H])=C([H])C([H])=C12 0.000 description 2
- 230000005951 type IV hypersensitivity Effects 0.000 description 2
- 208000027930 type IV hypersensitivity disease Diseases 0.000 description 2
- 210000004291 uterus Anatomy 0.000 description 2
- 230000035899 viability Effects 0.000 description 2
- 229960003048 vinblastine Drugs 0.000 description 2
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 2
- 239000011534 wash buffer Substances 0.000 description 2
- 230000004580 weight loss Effects 0.000 description 2
- 238000001262 western blot Methods 0.000 description 2
- QWPXBEHQFHACTK-KZVYIGENSA-N (10e,12e)-86-chloro-12,14,4-trihydroxy-85,14-dimethoxy-33,2,7,10-tetramethyl-15,16-dihydro-14h-7-aza-1(6,4)-oxazina-3(2,3)-oxirana-8(1,3)-benzenacyclotetradecaphane-10,12-dien-6-one Chemical compound CN1C(=O)CC(O)C2(C)OC2C(C)C(OC(=O)N2)CC2(O)C(OC)\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 QWPXBEHQFHACTK-KZVYIGENSA-N 0.000 description 1
- LJRDOKAZOAKLDU-UDXJMMFXSA-N (2s,3s,4r,5r,6r)-5-amino-2-(aminomethyl)-6-[(2r,3s,4r,5s)-5-[(1r,2r,3s,5r,6s)-3,5-diamino-2-[(2s,3r,4r,5s,6r)-3-amino-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-6-hydroxycyclohexyl]oxy-4-hydroxy-2-(hydroxymethyl)oxolan-3-yl]oxyoxane-3,4-diol;sulfuric ac Chemical compound OS(O)(=O)=O.N[C@@H]1[C@@H](O)[C@H](O)[C@H](CN)O[C@@H]1O[C@H]1[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](N)C[C@@H](N)[C@@H]2O)O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)N)O[C@@H]1CO LJRDOKAZOAKLDU-UDXJMMFXSA-N 0.000 description 1
- FPVKHBSQESCIEP-UHFFFAOYSA-N (8S)-3-(2-deoxy-beta-D-erythro-pentofuranosyl)-3,6,7,8-tetrahydroimidazo[4,5-d][1,3]diazepin-8-ol Natural products C1C(O)C(CO)OC1N1C(NC=NCC2O)=C2N=C1 FPVKHBSQESCIEP-UHFFFAOYSA-N 0.000 description 1
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 1
- VYEWZWBILJHHCU-OMQUDAQFSA-N (e)-n-[(2s,3r,4r,5r,6r)-2-[(2r,3r,4s,5s,6s)-3-acetamido-5-amino-4-hydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-6-[2-[(2r,3s,4r,5r)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]-2-hydroxyethyl]-4,5-dihydroxyoxan-3-yl]-5-methylhex-2-enamide Chemical compound N1([C@@H]2O[C@@H]([C@H]([C@H]2O)O)C(O)C[C@@H]2[C@H](O)[C@H](O)[C@H]([C@@H](O2)O[C@@H]2[C@@H]([C@@H](O)[C@H](N)[C@@H](CO)O2)NC(C)=O)NC(=O)/C=C/CC(C)C)C=CC(=O)NC1=O VYEWZWBILJHHCU-OMQUDAQFSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- 108020005345 3' Untranslated Regions Proteins 0.000 description 1
- NDMPLJNOPCLANR-UHFFFAOYSA-N 3,4-dihydroxy-15-(4-hydroxy-18-methoxycarbonyl-5,18-seco-ibogamin-18-yl)-16-methoxy-1-methyl-6,7-didehydro-aspidospermidine-3-carboxylic acid methyl ester Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 NDMPLJNOPCLANR-UHFFFAOYSA-N 0.000 description 1
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 1
- 108020003589 5' Untranslated Regions Proteins 0.000 description 1
- WYWHKKSPHMUBEB-UHFFFAOYSA-N 6-Mercaptoguanine Natural products N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 1
- VVIAGPKUTFNRDU-UHFFFAOYSA-N 6S-folinic acid Natural products C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-UHFFFAOYSA-N 0.000 description 1
- 208000004998 Abdominal Pain Diseases 0.000 description 1
- 206010000077 Abdominal mass Diseases 0.000 description 1
- 206010000097 Abdominal tenderness Diseases 0.000 description 1
- 206010000234 Abortion spontaneous Diseases 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 1
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 1
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 1
- 208000024827 Alzheimer disease Diseases 0.000 description 1
- BSYNRYMUTXBXSQ-UHFFFAOYSA-N Aspirin Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O BSYNRYMUTXBXSQ-UHFFFAOYSA-N 0.000 description 1
- 101150065175 Atm gene Proteins 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 108091008875 B cell receptors Proteins 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 1
- 108700010154 BRCA2 Genes Proteins 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 206010006002 Bone pain Diseases 0.000 description 1
- 206010049872 Breast discomfort Diseases 0.000 description 1
- 206010006313 Breast tenderness Diseases 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 241000282836 Camelus dromedarius Species 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 238000003731 Caspase Glo 3/7 Assay Methods 0.000 description 1
- 102000047934 Caspase-3/7 Human genes 0.000 description 1
- 108700037887 Caspase-3/7 Proteins 0.000 description 1
- 229940123587 Cell cycle inhibitor Drugs 0.000 description 1
- 206010057248 Cell death Diseases 0.000 description 1
- 231100000023 Cell-mediated cytotoxicity Toxicity 0.000 description 1
- 206010057250 Cell-mediated cytotoxicity Diseases 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 206010008399 Change of bowel habit Diseases 0.000 description 1
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 1
- PTOAARAWEBMLNO-KVQBGUIXSA-N Cladribine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 PTOAARAWEBMLNO-KVQBGUIXSA-N 0.000 description 1
- 206010009900 Colitis ulcerative Diseases 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 108010034753 Complement Membrane Attack Complex Proteins 0.000 description 1
- 206010010774 Constipation Diseases 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 239000004971 Cross linker Substances 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 230000005778 DNA damage Effects 0.000 description 1
- 231100000277 DNA damage Toxicity 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 229920001353 Dextrin Polymers 0.000 description 1
- 239000004375 Dextrin Substances 0.000 description 1
- 206010012735 Diarrhoea Diseases 0.000 description 1
- 102100024746 Dihydrofolate reductase Human genes 0.000 description 1
- 208000006402 Ductal Carcinoma Diseases 0.000 description 1
- 238000008157 ELISA kit Methods 0.000 description 1
- 101150029707 ERBB2 gene Proteins 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 206010016654 Fibrosis Diseases 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 1
- YCKRFDGAMUMZLT-UHFFFAOYSA-N Fluorine atom Chemical compound [F] YCKRFDGAMUMZLT-UHFFFAOYSA-N 0.000 description 1
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 108010031186 Glycoside Hydrolases Proteins 0.000 description 1
- 102000005744 Glycoside Hydrolases Human genes 0.000 description 1
- 229940121672 Glycosylation inhibitor Drugs 0.000 description 1
- 102000051366 Glycosyltransferases Human genes 0.000 description 1
- 108700023372 Glycosyltransferases Proteins 0.000 description 1
- 208000009329 Graft vs Host Disease Diseases 0.000 description 1
- 108010026389 Gramicidin Proteins 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 102000001554 Hemoglobins Human genes 0.000 description 1
- 108010054147 Hemoglobins Proteins 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 1
- 101000574253 Homo sapiens Mitochondrial fission factor Proteins 0.000 description 1
- VSNHCAURESNICA-UHFFFAOYSA-N Hydroxyurea Chemical compound NC(=O)NO VSNHCAURESNICA-UHFFFAOYSA-N 0.000 description 1
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 1
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 1
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 1
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 1
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 1
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 1
- 102000013463 Immunoglobulin Light Chains Human genes 0.000 description 1
- 108010065825 Immunoglobulin Light Chains Proteins 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 239000005517 L01XE01 - Imatinib Substances 0.000 description 1
- 239000005411 L01XE02 - Gefitinib Substances 0.000 description 1
- NNJVILVZKWQKPM-UHFFFAOYSA-N Lidocaine Chemical compound CCN(CC)CC(=O)NC1=C(C)C=CC=C1C NNJVILVZKWQKPM-UHFFFAOYSA-N 0.000 description 1
- 208000000265 Lobular Carcinoma Diseases 0.000 description 1
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 1
- 101710177649 Low affinity immunoglobulin gamma Fc region receptor III Proteins 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 1
- 239000002616 MRI contrast agent Substances 0.000 description 1
- 238000012307 MRI technique Methods 0.000 description 1
- QWPXBEHQFHACTK-UHFFFAOYSA-N Maytansinol Natural products CN1C(=O)CC(O)C2(C)OC2C(C)C(OC(=O)N2)CC2(O)C(OC)C=CC=C(C)CC2=CC(OC)=C(Cl)C1=C2 QWPXBEHQFHACTK-UHFFFAOYSA-N 0.000 description 1
- XOGTZOOQQBDUSI-UHFFFAOYSA-M Mesna Chemical compound [Na+].[O-]S(=O)(=O)CCS XOGTZOOQQBDUSI-UHFFFAOYSA-M 0.000 description 1
- 206010027406 Mesothelioma Diseases 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- 101100015391 Mus musculus Ralgds gene Proteins 0.000 description 1
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 1
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 1
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 1
- QPCDCPDFJACHGM-UHFFFAOYSA-N N,N-bis{2-[bis(carboxymethyl)amino]ethyl}glycine Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(=O)O)CCN(CC(O)=O)CC(O)=O QPCDCPDFJACHGM-UHFFFAOYSA-N 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- 125000000729 N-terminal amino-acid group Chemical group 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 230000004989 O-glycosylation Effects 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 206010033645 Pancreatitis Diseases 0.000 description 1
- 229930040373 Paraformaldehyde Natural products 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 1
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 1
- 241000235648 Pichia Species 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 229920002594 Polyethylene Glycol 8000 Polymers 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 229920001710 Polyorthoester Polymers 0.000 description 1
- 208000037062 Polyps Diseases 0.000 description 1
- 239000004372 Polyvinyl alcohol Substances 0.000 description 1
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102000000850 Proto-Oncogene Proteins c-rel Human genes 0.000 description 1
- 108010001859 Proto-Oncogene Proteins c-rel Proteins 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 230000010799 Receptor Interactions Effects 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 108010039491 Ricin Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 241000235070 Saccharomyces Species 0.000 description 1
- 108010084592 Saporins Proteins 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 206010040943 Skin Ulcer Diseases 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 229920002125 Sokalan® Polymers 0.000 description 1
- 206010041549 Spinal cord compression Diseases 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 208000006011 Stroke Diseases 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 1
- 206010042674 Swelling Diseases 0.000 description 1
- 108700005078 Synthetic Genes Proteins 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 108010014401 TWEAK Receptor Proteins 0.000 description 1
- 102000016946 TWEAK Receptor Human genes 0.000 description 1
- 229940123237 Taxane Drugs 0.000 description 1
- WFWLQNSHRPWKFK-UHFFFAOYSA-N Tegafur Chemical compound O=C1NC(=O)C(F)=CN1C1OCCC1 WFWLQNSHRPWKFK-UHFFFAOYSA-N 0.000 description 1
- BPEGJWRSRHCHSN-UHFFFAOYSA-N Temozolomide Chemical compound O=C1N(C)N=NC2=C(C(N)=O)N=CN21 BPEGJWRSRHCHSN-UHFFFAOYSA-N 0.000 description 1
- FOCVUCIESVLUNU-UHFFFAOYSA-N Thiotepa Chemical compound C1CN1P(N1CC1)(=S)N1CC1 FOCVUCIESVLUNU-UHFFFAOYSA-N 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- IVTVGDXNLFLDRM-HNNXBMFYSA-N Tomudex Chemical compound C=1C=C2NC(C)=NC(=O)C2=CC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)S1 IVTVGDXNLFLDRM-HNNXBMFYSA-N 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- YCPOZVAOBBQLRI-WDSKDSINSA-N Treosulfan Chemical compound CS(=O)(=O)OC[C@H](O)[C@@H](O)COS(C)(=O)=O YCPOZVAOBBQLRI-WDSKDSINSA-N 0.000 description 1
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 1
- 108010078814 Tumor Suppressor Protein p53 Proteins 0.000 description 1
- 102100028786 Tumor necrosis factor receptor superfamily member 12A Human genes 0.000 description 1
- YJQCOFNZVFGCAF-UHFFFAOYSA-N Tunicamycin II Natural products O1C(CC(O)C2C(C(O)C(O2)N2C(NC(=O)C=C2)=O)O)C(O)C(O)C(NC(=O)C=CCCCCCCCCC(C)C)C1OC1OC(CO)C(O)C(O)C1NC(C)=O YJQCOFNZVFGCAF-UHFFFAOYSA-N 0.000 description 1
- GBOGMAARMMDZGR-UHFFFAOYSA-N UNPD149280 Natural products N1C(=O)C23OC(=O)C=CC(O)CCCC(C)CC=CC3C(O)C(=C)C(C)C2C1CC1=CC=CC=C1 GBOGMAARMMDZGR-UHFFFAOYSA-N 0.000 description 1
- 201000006704 Ulcerative Colitis Diseases 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 229940122803 Vinca alkaloid Drugs 0.000 description 1
- 101710136524 X polypeptide Proteins 0.000 description 1
- 210000001015 abdomen Anatomy 0.000 description 1
- 238000002679 ablation Methods 0.000 description 1
- 238000010317 ablation therapy Methods 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 229960001138 acetylsalicylic acid Drugs 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 208000024340 acute graft versus host disease Diseases 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 238000009098 adjuvant therapy Methods 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 230000009824 affinity maturation Effects 0.000 description 1
- 230000000735 allogeneic effect Effects 0.000 description 1
- 150000001408 amides Chemical group 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 239000003708 ampul Substances 0.000 description 1
- XCPGHVQEEXUHNC-UHFFFAOYSA-N amsacrine Chemical compound COC1=CC(NS(C)(=O)=O)=CC=C1NC1=C(C=CC=C2)C2=NC2=CC=CC=C12 XCPGHVQEEXUHNC-UHFFFAOYSA-N 0.000 description 1
- 229960001220 amsacrine Drugs 0.000 description 1
- 206010002026 amyotrophic lateral sclerosis Diseases 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000003110 anti-inflammatory effect Effects 0.000 description 1
- 230000002555 anti-neurodegenerative effect Effects 0.000 description 1
- 238000009175 antibody therapy Methods 0.000 description 1
- 230000005290 antiferromagnetic effect Effects 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 229960005475 antiinfective agent Drugs 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 229940087620 aromasin Drugs 0.000 description 1
- 239000003886 aromatase inhibitor Substances 0.000 description 1
- 229940046844 aromatase inhibitors Drugs 0.000 description 1
- 238000003491 array Methods 0.000 description 1
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 238000003149 assay kit Methods 0.000 description 1
- 125000004429 atom Chemical group 0.000 description 1
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 1
- 150000001540 azides Chemical class 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 210000000013 bile duct Anatomy 0.000 description 1
- 229920000249 biocompatible polymer Polymers 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 238000004820 blood count Methods 0.000 description 1
- 238000009534 blood test Methods 0.000 description 1
- RSIHSRDYCUFFLA-DYKIIFRCSA-N boldenone Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 RSIHSRDYCUFFLA-DYKIIFRCSA-N 0.000 description 1
- 238000002725 brachytherapy Methods 0.000 description 1
- 201000003714 breast lobular carcinoma Diseases 0.000 description 1
- 239000008366 buffered solution Substances 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 238000002619 cancer immunotherapy Methods 0.000 description 1
- 230000005773 cancer-related death Effects 0.000 description 1
- 229960004562 carboplatin Drugs 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 208000002458 carcinoid tumor Diseases 0.000 description 1
- 229960005243 carmustine Drugs 0.000 description 1
- 238000005277 cation exchange chromatography Methods 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 238000001516 cell proliferation assay Methods 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 230000005890 cell-mediated cytotoxicity Effects 0.000 description 1
- 230000005889 cellular cytotoxicity Effects 0.000 description 1
- 230000002032 cellular defenses Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 229960005395 cetuximab Drugs 0.000 description 1
- NDAYQJDHGXTBJL-MWWSRJDJSA-N chembl557217 Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CC=3C4=CC=CC=C4NC=3)NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CC=3C4=CC=CC=C4NC=3)NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CC=3C4=CC=CC=C4NC=3)NC(=O)[C@@H](C(C)C)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](C(C)C)NC(=O)[C@H](C)NC(=O)[C@H](NC(=O)CNC(=O)[C@@H](NC=O)C(C)C)CC(C)C)C(=O)NCCO)=CNC2=C1 NDAYQJDHGXTBJL-MWWSRJDJSA-N 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 230000000973 chemotherapeutic effect Effects 0.000 description 1
- 239000012829 chemotherapy agent Substances 0.000 description 1
- 229940044683 chemotherapy drug Drugs 0.000 description 1
- 235000013330 chicken meat Nutrition 0.000 description 1
- 230000035606 childbirth Effects 0.000 description 1
- 208000011654 childhood malignant neoplasm Diseases 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 229960002436 cladribine Drugs 0.000 description 1
- WDDPHFBMKLOVOX-AYQXTPAHSA-N clofarabine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1F WDDPHFBMKLOVOX-AYQXTPAHSA-N 0.000 description 1
- 229960000928 clofarabine Drugs 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 238000009096 combination chemotherapy Methods 0.000 description 1
- 238000011284 combination treatment Methods 0.000 description 1
- 230000007748 combinatorial effect Effects 0.000 description 1
- 230000001447 compensatory effect Effects 0.000 description 1
- 230000009137 competitive binding Effects 0.000 description 1
- 238000005094 computer simulation Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 229950006799 crisantaspase Drugs 0.000 description 1
- 238000000315 cryotherapy Methods 0.000 description 1
- 239000011549 crystallization solution Substances 0.000 description 1
- 238000002447 crystallographic data Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- GBOGMAARMMDZGR-TYHYBEHESA-N cytochalasin B Chemical compound C([C@H]1[C@@H]2[C@@H](C([C@@H](O)[C@@H]3/C=C/C[C@H](C)CCC[C@@H](O)/C=C/C(=O)O[C@@]23C(=O)N1)=C)C)C1=CC=CC=C1 GBOGMAARMMDZGR-TYHYBEHESA-N 0.000 description 1
- GBOGMAARMMDZGR-JREHFAHYSA-N cytochalasin B Natural products C[C@H]1CCC[C@@H](O)C=CC(=O)O[C@@]23[C@H](C=CC1)[C@H](O)C(=C)[C@@H](C)[C@@H]2[C@H](Cc4ccccc4)NC3=O GBOGMAARMMDZGR-JREHFAHYSA-N 0.000 description 1
- 206010052015 cytokine release syndrome Diseases 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 239000000824 cytostatic agent Substances 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- RSIHSRDYCUFFLA-UHFFFAOYSA-N dehydrotestosterone Natural products O=C1C=CC2(C)C3CCC(C)(C(CC4)O)C4C3CCC2=C1 RSIHSRDYCUFFLA-UHFFFAOYSA-N 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- CFCUWKMKBJTWLW-UHFFFAOYSA-N deoliosyl-3C-alpha-L-digitoxosyl-MTM Natural products CC=1C(O)=C2C(O)=C3C(=O)C(OC4OC(C)C(O)C(OC5OC(C)C(O)C(OC6OC(C)C(O)C(C)(O)C6)C5)C4)C(C(OC)C(=O)C(O)C(C)O)CC3=CC2=CC=1OC(OC(C)C1O)CC1OC1CC(O)C(O)C(C)O1 CFCUWKMKBJTWLW-UHFFFAOYSA-N 0.000 description 1
- 230000000779 depleting effect Effects 0.000 description 1
- 230000002074 deregulated effect Effects 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 235000019425 dextrin Nutrition 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 238000002059 diagnostic imaging Methods 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000000378 dietary effect Effects 0.000 description 1
- 229960000452 diethylstilbestrol Drugs 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 108020001096 dihydrofolate reductase Proteins 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 230000035622 drinking Effects 0.000 description 1
- 238000009510 drug design Methods 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 230000009881 electrostatic interaction Effects 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 230000002124 endocrine Effects 0.000 description 1
- 230000012202 endocytosis Effects 0.000 description 1
- 230000003511 endothelial effect Effects 0.000 description 1
- 210000003038 endothelium Anatomy 0.000 description 1
- 108010048367 enhanced green fluorescent protein Proteins 0.000 description 1
- 229960001904 epirubicin Drugs 0.000 description 1
- 210000003238 esophagus Anatomy 0.000 description 1
- 102000015694 estrogen receptors Human genes 0.000 description 1
- 108010038795 estrogen receptors Proteins 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 230000008020 evaporation Effects 0.000 description 1
- 230000005713 exacerbation Effects 0.000 description 1
- 229960000255 exemestane Drugs 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 230000002550 fecal effect Effects 0.000 description 1
- 230000004761 fibrosis Effects 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- 238000002875 fluorescence polarization Methods 0.000 description 1
- 239000011737 fluorine Substances 0.000 description 1
- 229910052731 fluorine Inorganic materials 0.000 description 1
- 125000001153 fluoro group Chemical group F* 0.000 description 1
- 239000011888 foil Substances 0.000 description 1
- VVIAGPKUTFNRDU-ABLWVSNPSA-N folinic acid Chemical compound C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-ABLWVSNPSA-N 0.000 description 1
- 235000008191 folinic acid Nutrition 0.000 description 1
- 239000011672 folinic acid Substances 0.000 description 1
- 230000037433 frameshift Effects 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- 210000000232 gallbladder Anatomy 0.000 description 1
- XGALLCVXEZPNRQ-UHFFFAOYSA-N gefitinib Chemical compound C=12C=C(OCCCN3CCOCC3)C(OC)=CC2=NC=NC=1NC1=CC=C(F)C(Cl)=C1 XGALLCVXEZPNRQ-UHFFFAOYSA-N 0.000 description 1
- 229960002584 gefitinib Drugs 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 238000001641 gel filtration chromatography Methods 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000003209 gene knockout Methods 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 230000009395 genetic defect Effects 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 229940084910 gliadel Drugs 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 229930182470 glycoside Natural products 0.000 description 1
- 150000002338 glycosides Chemical class 0.000 description 1
- 108700014210 glycosyltransferase activity proteins Proteins 0.000 description 1
- 150000002344 gold compounds Chemical class 0.000 description 1
- 208000024908 graft versus host disease Diseases 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 235000004280 healthy diet Nutrition 0.000 description 1
- 238000011134 hematopoietic stem cell transplantation Methods 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 235000021192 high fiber diet Nutrition 0.000 description 1
- 229920001519 homopolymer Polymers 0.000 description 1
- 108700005872 human Fv Proteins 0.000 description 1
- 102000056549 human Fv Human genes 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 229960001330 hydroxycarbamide Drugs 0.000 description 1
- XXSMGPRMXLTPCZ-UHFFFAOYSA-N hydroxychloroquine Chemical compound ClC1=CC=C2C(NC(C)CCCN(CCO)CC)=CC=NC2=C1 XXSMGPRMXLTPCZ-UHFFFAOYSA-N 0.000 description 1
- 229960004171 hydroxychloroquine Drugs 0.000 description 1
- 229960000908 idarubicin Drugs 0.000 description 1
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 1
- 229960001101 ifosfamide Drugs 0.000 description 1
- KTUFNOKKBVMGRW-UHFFFAOYSA-N imatinib Chemical compound C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 KTUFNOKKBVMGRW-UHFFFAOYSA-N 0.000 description 1
- 229960002411 imatinib Drugs 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 230000003832 immune regulation Effects 0.000 description 1
- 108010023260 immunoglobulin Fv Proteins 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 239000003018 immunosuppressive agent Substances 0.000 description 1
- 229940124589 immunosuppressive drug Drugs 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000005462 in vivo assay Methods 0.000 description 1
- 238000011503 in vivo imaging Methods 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 230000006882 induction of apoptosis Effects 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 238000012482 interaction analysis Methods 0.000 description 1
- 229960003130 interferon gamma Drugs 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 208000030776 invasive breast carcinoma Diseases 0.000 description 1
- 206010073096 invasive lobular breast carcinoma Diseases 0.000 description 1
- 230000005865 ionizing radiation Effects 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 210000002429 large intestine Anatomy 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 229960001691 leucovorin Drugs 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 238000012917 library technology Methods 0.000 description 1
- 229960004194 lidocaine Drugs 0.000 description 1
- 239000008297 liquid dosage form Substances 0.000 description 1
- INHCSSUBVCNVSK-UHFFFAOYSA-L lithium sulfate Inorganic materials [Li+].[Li+].[O-]S([O-])(=O)=O INHCSSUBVCNVSK-UHFFFAOYSA-L 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 229960002247 lomustine Drugs 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 235000015263 low fat diet Nutrition 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 206010025135 lupus erythematosus Diseases 0.000 description 1
- 230000000527 lymphocytic effect Effects 0.000 description 1
- 239000006249 magnetic particle Substances 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 210000005075 mammary gland Anatomy 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- WKPWGQKGSOKKOO-RSFHAFMBSA-N maytansine Chemical class CO[C@@H]([C@@]1(O)C[C@](OC(=O)N1)([C@H]([C@@H]1O[C@@]1(C)[C@@H](OC(=O)[C@H](C)N(C)C(C)=O)CC(=O)N1C)C)[H])\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 WKPWGQKGSOKKOO-RSFHAFMBSA-N 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000009245 menopause Effects 0.000 description 1
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- 229960004635 mesna Drugs 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000000386 microscopy Methods 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 208000015994 miscarriage Diseases 0.000 description 1
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- AEMBWNDIEFEPTH-UHFFFAOYSA-N n-tert-butyl-n-ethylnitrous amide Chemical compound CCN(N=O)C(C)(C)C AEMBWNDIEFEPTH-UHFFFAOYSA-N 0.000 description 1
- 229920005615 natural polymer Polymers 0.000 description 1
- 230000004770 neurodegeneration Effects 0.000 description 1
- 208000015122 neurodegenerative disease Diseases 0.000 description 1
- 230000000955 neuroendocrine Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 230000014207 opsonization Effects 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 230000027758 ovulation cycle Effects 0.000 description 1
- 230000036407 pain Effects 0.000 description 1
- 238000002638 palliative care Methods 0.000 description 1
- 210000004923 pancreatic tissue Anatomy 0.000 description 1
- 229920002866 paraformaldehyde Polymers 0.000 description 1
- 229960005079 pemetrexed Drugs 0.000 description 1
- QOFFJEBXNKRSPX-ZDUSSCGKSA-N pemetrexed Chemical compound C1=N[C]2NC(N)=NC(=O)C2=C1CCC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 QOFFJEBXNKRSPX-ZDUSSCGKSA-N 0.000 description 1
- 229960001639 penicillamine Drugs 0.000 description 1
- 210000003899 penis Anatomy 0.000 description 1
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 1
- 229960002340 pentostatin Drugs 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 108010011613 phagocytosis receptor Proteins 0.000 description 1
- 229940124531 pharmaceutical excipient Drugs 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 230000003285 pharmacodynamic effect Effects 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- XVNVFKZODWAQKN-UHFFFAOYSA-N phosphoric acid;heptahydrate Chemical compound O.O.O.O.O.O.O.OP(O)(O)=O XVNVFKZODWAQKN-UHFFFAOYSA-N 0.000 description 1
- 239000003504 photosensitizing agent Substances 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 210000002381 plasma Anatomy 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 238000007747 plating Methods 0.000 description 1
- 229960003171 plicamycin Drugs 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920000570 polyether Polymers 0.000 description 1
- 239000004633 polyglycolic acid Substances 0.000 description 1
- 239000004626 polylactic acid Substances 0.000 description 1
- 229920000193 polymethacrylate Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 208000022131 polyp of large intestine Diseases 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 235000019422 polyvinyl alcohol Nutrition 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 238000002600 positron emission tomography Methods 0.000 description 1
- 231100000683 possible toxicity Toxicity 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000007112 pro inflammatory response Effects 0.000 description 1
- 229960004919 procaine Drugs 0.000 description 1
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 1
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 1
- 229960000624 procarbazine Drugs 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 239000000583 progesterone congener Substances 0.000 description 1
- 229940095055 progestogen systemic hormonal contraceptives Drugs 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 150000003147 proline derivatives Chemical class 0.000 description 1
- 229960003712 propranolol Drugs 0.000 description 1
- 238000011471 prostatectomy Methods 0.000 description 1
- 230000004850 protein–protein interaction Effects 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 229950010131 puromycin Drugs 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000000163 radioactive labelling Methods 0.000 description 1
- 239000000700 radioactive tracer Substances 0.000 description 1
- 238000011363 radioimmunotherapy Methods 0.000 description 1
- 229960004432 raltitrexed Drugs 0.000 description 1
- 230000025915 regulation of apoptotic process Effects 0.000 description 1
- 230000008439 repair process Effects 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 238000002702 ribosome display Methods 0.000 description 1
- 229960004641 rituximab Drugs 0.000 description 1
- 102220018750 rs80358450 Human genes 0.000 description 1
- 150000003873 salicylate salts Chemical class 0.000 description 1
- 238000009738 saturating Methods 0.000 description 1
- 239000008299 semisolid dosage form Substances 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 231100000019 skin ulcer Toxicity 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000007909 solid dosage form Substances 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 210000000278 spinal cord Anatomy 0.000 description 1
- 208000000995 spontaneous abortion Diseases 0.000 description 1
- 230000002269 spontaneous effect Effects 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 230000010473 stable expression Effects 0.000 description 1
- 238000012289 standard assay Methods 0.000 description 1
- 239000010421 standard material Substances 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 201000011549 stomach cancer Diseases 0.000 description 1
- 229960001052 streptozocin Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 235000011149 sulphuric acid Nutrition 0.000 description 1
- 208000014794 superficial urinary bladder carcinoma Diseases 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 229920001059 synthetic polymer Polymers 0.000 description 1
- 229940037128 systemic glucocorticoids Drugs 0.000 description 1
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- DKPFODGZWDEEBT-QFIAKTPHSA-N taxane Chemical class C([C@]1(C)CCC[C@@H](C)[C@H]1C1)C[C@H]2[C@H](C)CC[C@@H]1C2(C)C DKPFODGZWDEEBT-QFIAKTPHSA-N 0.000 description 1
- 229960004964 temozolomide Drugs 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- RBTVSNLYYIMMKS-UHFFFAOYSA-N tert-butyl 3-aminoazetidine-1-carboxylate;hydrochloride Chemical compound Cl.CC(C)(C)OC(=O)N1CC(N)C1 RBTVSNLYYIMMKS-UHFFFAOYSA-N 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 229960003604 testosterone Drugs 0.000 description 1
- 229960002372 tetracaine Drugs 0.000 description 1
- GKCBAIGFKIBETG-UHFFFAOYSA-N tetracaine Chemical compound CCCCNC1=CC=C(C(=O)OCCN(C)C)C=C1 GKCBAIGFKIBETG-UHFFFAOYSA-N 0.000 description 1
- 230000004797 therapeutic response Effects 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- 229960001196 thiotepa Drugs 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 210000001685 thyroid gland Anatomy 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- MNRILEROXIRVNJ-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=NC=N[C]21 MNRILEROXIRVNJ-UHFFFAOYSA-N 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 229960000303 topotecan Drugs 0.000 description 1
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 238000011277 treatment modality Methods 0.000 description 1
- 229960003181 treosulfan Drugs 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- QAEDZJGFFMLHHQ-UHFFFAOYSA-N trifluoroacetic anhydride Chemical compound FC(F)(F)C(=O)OC(=O)C(F)(F)F QAEDZJGFFMLHHQ-UHFFFAOYSA-N 0.000 description 1
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 1
- 238000013414 tumor xenograft model Methods 0.000 description 1
- MEYZYGMYMLNUHJ-UHFFFAOYSA-N tunicamycin Natural products CC(C)CCCCCCCCCC=CC(=O)NC1C(O)C(O)C(CC(O)C2OC(C(O)C2O)N3C=CC(=O)NC3=O)OC1OC4OC(CO)C(O)C(O)C4NC(=O)C MEYZYGMYMLNUHJ-UHFFFAOYSA-N 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 229940121358 tyrosine kinase inhibitor Drugs 0.000 description 1
- 239000005483 tyrosine kinase inhibitor Substances 0.000 description 1
- 238000002604 ultrasonography Methods 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 201000003365 uterine corpus sarcoma Diseases 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 238000009777 vacuum freeze-drying Methods 0.000 description 1
- 210000001215 vagina Anatomy 0.000 description 1
- 238000010200 validation analysis Methods 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- 229960004355 vindesine Drugs 0.000 description 1
- UGGWPQSBPIFKDZ-KOTLKJBCSA-N vindesine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(N)=O)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1N=C1[C]2C=CC=C1 UGGWPQSBPIFKDZ-KOTLKJBCSA-N 0.000 description 1
- GBABOYUKABKIAF-GHYRFKGUSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-GHYRFKGUSA-N 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- 229920002554 vinyl polymer Polymers 0.000 description 1
- 210000003905 vulva Anatomy 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 229920003169 water-soluble polymer Polymers 0.000 description 1
- 238000002424 x-ray crystallography Methods 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
- 229910000859 α-Fe Inorganic materials 0.000 description 1
- 229910006297 γ-Fe2O3 Inorganic materials 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- TWEAK tumor-necrosis factor
- Fnl4 a TWEAK receptor, is a growth factor-regulated immediate-early response gene that decreases cellular adhesion to the extracellular matrix and reduces serum-stimulated growth and migration (Meighan-Mantha et al., J. Biol. Chem. 274:33166-33176 (1999)).
- the invention is based, at least in part, on the identification and characterization of antibodies that bind to FnI 4 and induce death of tumor cells.
- the antibodies are effective in animal models of cancer at low doses and with a prolonged effect in preventing tumor growth.
- the invention features an isolated Fnl4-binding protein (e.g., an isolated antibody or antigen-binding fragment thereof) that (i) selectively binds to the polypeptide of SEQ ID NO:1, when expressed on the surface of a cell, at an epitope that includes the amino acid residue tryptophan at position 42 of SEQ ID NO: 1 , and (ii) induces or enhances cell killing of cancer cells (e.g., WiDr colon cancer cells) in vivo or in vitro.
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen-binding fragment thereof
- selective binds refers to binding of the Fnl4-binding protein to its target protein (e.g., the polypeptide of SEQ ID NO:1) in a manner that exhibits specificity to the target protein when present in a population of heterogeneous proteins (i.e., "selective" binding does not encompass non-specific protein- protein interactions).
- target protein e.g., the polypeptide of SEQ ID NO:1
- binding refers to the ability of an antibody or antigen-binding fragment thereof to selectively bind to the wild-type human Fn 14 protein of SEQ ID NO: 1 but the inability to significantly bind to a mutant of SEQ ID NO:1 that contains an alanine substituted for tryptophan at position 42.
- binding to a mutant of SEQ ID NO: 1 that contains an alanine substituted for tryptophan at position 42 may occur at a level that is less than 50%, less than 40%, less than 30%, less than 20%, or less than 10% the level of binding that occurs to the wild-type human Fnl4 protein of SEQ ID NO:1 under the same assay conditions.
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen- binding fragment thereof
- an isolated Fnl4-binding protein that (i) selectively binds to the polypeptide of SEQ ID NO: 1 , when expressed on the surface of a cell, and crossblocks binding of the monoclonal antibody P4A8, P2D3, or P3G5 to SEQ ID NO:1, and (ii) induces or enhances cell killing of cancer cells (e.g., WiDr colon cancer cells) in vivo or in vitro.
- cancer cells e.g., WiDr colon cancer cells
- An Fnl4-binding protein crossblocks binding of a monoclonal antibody (e.g., P4A8 or P3G5 or P2D3) to FnH when the Fnl4-binding protein's prior binding to Fnl4 inhibits later binding of the monoclonal antibody to Fn 14 at the same level at which the monoclonal antibody's prior binding to FnI 4 inhibits later binding of the identical monoclonal antibody to Fnl4.
- a monoclonal antibody e.g., P4A8 or P3G5 or P2D3
- an Fnl4-binding protein crossblocks binding of P4A8 to Fnl4 when the Fnl4-binding protein's prior binding to Fnl4 inhibits later binding of P4A8 to Fnl4 at the same level at which P4A8's prior binding to Fn 14 inhibits later binding of the identical monoclonal antibody to FnI 4.
- an Fnl4-binding protein crossblocks the binding of P4A8 to human FnI 4 to a level that is at least about 30%, 50%, 70%, 80%, 90%, 95%, 98% or 99% of crossblocking achieved by P4A8 of itself.
- an Fnl4-binding protein crossblocks the binding of P4A8 to human FnI 4 to a higher degree than another anti- FnH antibody (e.g., ITEM-I, ITEM-2, ITEM-3 or ITEM-4) crossblocks the binding of P4A8 to human FnI 4.
- another anti- FnH antibody e.g., ITEM-I, ITEM-2, ITEM-3 or ITEM-4
- P4A8 crossblocks the binding of an Fnl4-binding protein to human Fnl4 to a level that is at least about 30%, 50%, 70%, 80%, 90%, 95%, 98% or 99% of crossblocking achieved by the Fnl4-binding protein of itself.
- an Fnl4-binding protein crossblocks the binding of P4A8 to human Fnl4
- P4A8 crossblocks the binding of the Fnl4-binding protein to human Fnl4.
- Complete crossblocking both ways indicates that the two antibodies have the same footprint, i.e., bind to the same epitope.
- crossblocking one way or both ways is not complete, but partial, e.g., to a level that is at least about 30%, 50%, 70%, 80%, 90%, 95%, 98% or 99% of crossblocking achieved by the antibody itself.
- a partial crossblocking one way or both ways indicates that the footprints of the two antibodies are not identical, but may be overlapping or in close proximity.
- Fnl4-binding proteins can also be described as set forth above but relative to P3G5 or P2D3, instead of P4A8.
- Crossblocking experiments may be conducted with the test Fnl4-binding protein being present at or above saturating concentrations for Fnl4 binding based on its binding affinity.
- an Fn-14-binding protein binds to the same epitope or substantially the same epitope as that of P4A8, P3G5, or P2D3, as characterized by one or more of the experiments described herein, e.g., crossblocking experiments and the binding experiments to various Fnl4 species and mutated Fnl4 proteins.
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen- binding fragment thereof
- an isolated Fnl4-binding protein that (i) selectively binds to the polypeptide of SEQ ID NO:1, when expressed on the surface of a cell, and crossblocks binding to SEQ ID NO: 1 of a monoclonal antibody comprising the VH and VL domains of P4A8, a monoclonal antibody comprising the VH and VL domains of P3G5, or a monoclonal antibody comprising the VH and VL domains of P2D3, and (ii) induces or enhances cell killing of cancer cells (e.g., WiDr colon cancer cells) in vivo or in vitro.
- cancer cells e.g., WiDr colon cancer cells
- an isolated antibody or antigen-binding fragment thereof that (i) selectively binds to the polypeptide of SEQ ID NO:1, when expressed on the surface of a cell, (ii) comprises a mutation in a constant region of the antibody that results in reduced or absent effector function, and (iii) induces or enhances cell killing of cancer cells (e.g., WiDr colon cancer cells) in vivo or in vitro.
- the antibody or antigen-binding fragment thereof binds to the polypeptide of SEQ ID NO:1 at an epitope that includes the amino acid residue tryptophan at position 42 of SEQ ID NO: 1.
- effector function refers to the functional ability of the Fc or constant region of an antibody to bind proteins and/or cells of the immune system.
- Antibodies having reduced effector function and methods for engineering such antibodies are well-known in the art (see, e.g., WO 05/18572, WO 05/03175, and US 6,242,195) and are described in further detail herein.
- Typical effector functions include the ability to bind complement protein (e.g., the complement protein CIq), and/or an Fc receptor (FcR) (e.g., Fc ⁇ RI, Fc ⁇ RII, Fc ⁇ RIIa, Fc ⁇ RIIb, Fc ⁇ RIII, Fc ⁇ RIIIa, and/or Fc ⁇ RIIIb).
- a decrease in effector function refers to a decrease in one or more of the biochemical or cellular activities induced at least in part by binding of Fc to its cognate receptor or to a complement protein or effector cell, while maintaining the antigen-binding activity of the variable region of the antibody (or fragment thereof), albeit with reduced, similar, identical, or increased binding affinity.
- Decreases in effector function e.g., Fc binding to an Fc receptor or complement protein
- fold reduction e.g., reduced by 1.5-fold, 2-fold, and the like
- percent reductions in binding activity determined using binding assays known in the art (see, for example, WO
- Fc-mediated receptor hypercrosslinking can also be a factor that enhances activity.
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen- binding fragment thereof
- P4A8, P3G5, or P2D3 or a monoclonal antibody comprising the VH and VL domains of P4A8, a monoclonal antibody comprising the VH and VL domains of P3G5, or a monoclonal antibody comprising the VH and VL domains of P2D3
- induces or enhances cell killing of cancer cells e.g., WiDr colon cancer cells
- binding of an Fnl4-binding protein e.g., an isolated antibody or antigen-binding fragment thereof
- binding may be decreased by a factor of at least about 10%, 30%, 50%, 70%, 80%, 90%, 95%, or 100%.
- TWEAK binding to FN14 can be measured in various cell based systems. For example, cells can be transfected with a vector encoding Fn 14 and TWEAK binding to the transfected cells can be measured by contacting the cells with a soluble TWEAK protein linked to a detectable marker. An Fnl4-binding protein can be added to the cells prior to addition of the soluble TWEAK protein to determine whether the Fnl4-binding protein blocks or decreases binding of TWEAK to Fnl4.
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen-binding fragment thereof
- an isolated Fnl4-binding protein that selectively binds to the polypeptide of SEQ ID NO:1, when expressed on the surface of a cell, and that mimics at least one biological activity resulting from binding of TWEAK to Fnl4, e.g., induction of IL-8, induction of cleavage of a caspase, and/or induction of NFkB activity (e.g., an agonist antibody).
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen-binding fragment thereof
- an isolated Fnl4-binding protein that selectively binds to the polypeptide of SEQ ID NO: 1 , when expressed on the surface of a cell, and that also binds significantly (or detectably) to cynomolgus, mouse and rat FnI 4.
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen-binding fragment thereof
- an isolated Fnl4-binding protein that selectively binds to the polypeptide of SEQ ID NO:1, when expressed on the surface of a cell, and is internalized into the cell following its binding to FnI 4 on the surface of the cell.
- Antibodies or antigen binding fragments thereof that selectively bind to the polypeptide of SEQ ID NO: 1 , when expressed on the surface of a cell, and that kill tumor cells include antibodies having any combination of characteristics described herein, e.g., (i) agonist activity or mimicking of at least some of the biologic effects resulting from binding of TWEAK to FnI 4, (ii) significant blocking of TWEAK binding to FnI 4, (iii) binding to an epitope of human FnI 4 that includes W42, (iv) significant binding to human, cynomolgus, rat and mouse FnI 4, and (iv) lack of or reduced induction of at least some effector functions.
- an FnI 4 antibody is an agonist antibody that blocks TWEAK binding to FnI 4.
- the antibody may further bind to an epitope of FnI 4 encompassing W42 and/or have an Fc region that has reduced effector function.
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen-binding fragment thereof
- an isolated Fnl4-binding protein that selectively binds to the polypeptide of SEQ ID NO:1, when expressed on the surface of a cell, and induces or enhances cell killing is not an antibody that is known in the art, e.g., ITEM-I, ITEM-2, ITEM-3 or ITEM-4, as described, e.g., in Nakayama et al. (2003) J. Immunol. 170: 341, Nakayama et al. (2003) BBRC 306:819 and Harada et al. (2002) BBRC 299:488.
- the antibody or antigen binding fragment thereof has dissociation kinetics in the range of 10 "2 to 10 "6 s “1 , typically 10 "2 to 10 "5 s “1 , e.g., 10 "2 to 10 "3 s “1 , such as 1 x 10 "3 to 5 x 10 "3 s “1 (see also Example 14).
- the antibody binds to human Fnl4, with an affinity and/or kinetics similar to (e.g., within a factor of five or ten of) monoclonal antibody P4A8, or modified forms thereof, e.g., chimeric forms or humanized forms thereof (e.g., a humanized form described herein).
- the affinity and binding kinetics of the anti- Fnl4 antibody can be tested, e.g., using biosensor technology (BIACORETM).
- the antibody or antigen binding fragment thereof has dissociation kinetics in the range of 10 "2 to 10 "6 s "1 , typically 10 "2 to 10 "5 s "1 .
- the antibody binds to human Fnl4, with an affinity and/or kinetics similar to (e.g., within a factor of five or ten of) monoclonal antibody P2D3, or modified forms thereof, e.g., chimeric forms or humanized forms thereof (e.g., a humanized form described herein).
- the antibody or antigen binding fragment thereof has dissociation kinetics in the range of 10 "2 to 10 "6 s “1 , typically 10 "2 to 10 "5 s “1 .
- the antibody binds to human Fnl4, with an affinity and/or kinetics similar to (e.g., within a factor of five or ten of) monoclonal antibody P3G5, or modified forms thereof, e.g., chimeric forms or humanized forms thereof (e.g., a humanized form described herein).
- the antibody or antigen binding fragment thereof has association kinetics in the range of 10 5 to 10 7 M “1 s "1 , such as 5 x 10 5 to 5 x 10 6 M “1 s "1 , e.g., 7 x 10 5 to 3 x 10 6 M '1 s '1 (see Example 14).
- the antibody or antigen binding fragment thereof has an association constant of 10 to 10 7 M “ s " , such as 5 x 10 to 5 x 10 M “ s “ , e.g., 7 x 10 to 3 x 10 M ' s " and a dissociation constant of 10 ' to 10 " s “ , such as 1 x 10 " to 5 x 10 " s “ l .
- Antibodies or antigen binding fragments thereof may have an affinity constant of 10 "10 , 10 "9 or 10 "8 M or lower, such as in the range of 10 "10 M to 10 "9 , e.g., 5 x 10 "10 to 5 x 10 "9 M or 1 x 10 "9 to 5 x 10 "9 M (see Example 14).
- kinetic parameters may be characteristic of binding of the antibody or antigen binding fragment thereof to a soluble FnI 4 protein, such as soluble human Fnl4 protein, e.g., consisting essentially of the extracellular or cysteine rich region of human Fnl4 (e.g., about amino acids 28-68, 69, 70 or 80, or from about amino acid 28 to about an amino acid from amino acid 68 to 80 of human Fnl4).
- the antibody or antigen binding fragment thereof interacts with one or more of residues C49, W42, K48, D51, R58, A57, H60, R56, L46, and M50 of human Fnl4.
- an anti-Fnl4 antibody binds substantially to the same epitope as that to which P4A8, P3G5 or P2D3 binds. Whether two antibodies bind substantially to the same epitope can be determined by a competition assay. Such an assay may be conducted by labeling a control antibody (e.g., P4A8 or other antibody described herein) with a detectable label, such as biotin. The intensity of the bound label to Fn 14 is measured. If the labeled antibody competes with the unlabeled (test antibody) by binding to an overlapping epitope, the intensity will be decreased relative to the binding by negative control unlabeled antibody.
- a control antibody e.g., P4A8 or other antibody described herein
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen- binding fragment thereof
- an isolated Fnl4-binding protein that (i) selectively binds to the polypeptide of SEQ ID NO: 1 , when expressed on the surface of a cell, (ii) comprises a VH domain that is at least 80% identical to the amino acid sequence of SEQ ID NO:2, SEQ ID NO:3, or SEQ ID NO:4, and (iii) induces or enhances cell killing of cancer cells (e.g., WiDr colon cancer cells) in vivo or in vitro.
- the VH domain is at least 90% identical to the amino acid sequence of SEQ ID NO:2, SEQ ID NO:3, or SEQ ID NO:4.
- the VH domain is at least 95% identical to the amino acid sequence of SEQ ID NO:2, SEQ ID NO:3, or SEQ ID NO:4. In some embodiments, the VH domain is identical to the amino acid sequence of SEQ ID NO:2, SEQ ID NO:3, or SEQ ID NO:4.
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen- binding fragment thereof
- an isolated Fnl4-binding protein that (i) selectively binds to the polypeptide of SEQ ID NO:1, when expressed on the surface of a cell, (ii) comprises a VL domain that is at least 80% identical to the amino acid sequence of SEQ ID NO:5, SEQ ID NO:6, or SEQ ID NO:7, and (iii) induces or enhances cell killing of cancer cells (e.g., WiDr colon cancer cells) in vivo or in vitro.
- the VL domain is at least 90% identical to the amino acid sequence of SEQ ID NO:5, SEQ ID NO:6, or SEQ ID NO:7.
- the VL domain is at least 95% identical to the amino acid sequence of SEQ ID NO:5, SEQ ID NO:6, or SEQ ID NO:7. In some embodiments, the VL domain is identical to the amino acid sequence of SEQ ID NO:5, SEQ ID NO:6, or SEQ ID NO:7.
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen- binding fragment thereof
- an isolated Fnl4-binding protein that (i) selectively binds to the polypeptide of SEQ ID NO: 1 , when expressed on the surface of a cell, (ii) comprises a VH domain that is at least 80% identical to the amino acid sequence of SEQ ID NO:2, SEQ ID NO:3, or SEQ ID NO:4, (iii) comprises a VL domain that is at least 80% identical to the amino acid sequence of SEQ ID NO:5, SEQ ID NO:6, or SEQ ID NO:7, and (iv) induces or enhances cell killing of cancer cells (e.g., WiDr colon cancer cells) in vivo or in vitro.
- cancer cells e.g., WiDr colon cancer cells
- the VH domain is at least 90% identical to the amino acid sequence of SEQ ID NO:2, SEQ ID NO:3, or SEQ ID NO:4, and (ii) the VL domain is at least 90% identical to the amino acid sequence of SEQ ID NO:5, SEQ ID NO:6, or SEQ ID NO:7. In some embodiments, (i) the VH domain is at least 95% identical to the amino acid sequence of SEQ ID NO:2, SEQ ID NO:3, or SEQ ID NO:4, and (ii) the VL domain is at least 95% identical to the amino acid sequence of SEQ ID NO:5, SEQ ID NO:6, or SEQ ID NO:7.
- VH domain is identical to the amino acid sequence of SEQ ID NO:2, SEQ ID NO:3, or SEQ ID NO:4, and (ii) the VL domain is identical to the amino acid sequence of SEQ ID NO:5, SEQ ID NO:6, or SEQ ID NO:7.
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen- binding fragment thereof
- an isolated Fnl4-binding protein that (i) selectively binds to the polypeptide of SEQ ID NO:1, when expressed on the surface of a cell, (ii) comprises a VH domain that is at least 80% identical to the amino acid sequence of SEQ ID NO: 11 or SEQ ID NO: 12, and (iii) induces or enhances cell killing of cancer cells (e.g., WiDr colon cancer cells) in vivo or in vitro.
- the VH domain is at least 90% identical to the amino acid sequence of SEQ ID NO: 11 or SEQ ID NO: 12.
- the VH domain is at least 95% identical to the amino acid sequence of SEQ ID NO:11 or SEQ ID NO: 12. In some embodiments, the VH domain is identical to the amino acid sequence of SEQ ID NO:11 or SEQ ID NO:12.
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen- binding fragment thereof
- an isolated Fnl4-binding protein that (i) selectively binds to the polypeptide of SEQ ID NO: 1, when expressed on the surface of a cell, (ii) comprises a VL domain that is at least 80% identical to the amino acid sequence of SEQ ID NO:13, SEQ ID NO:14, or SEQ ID NO:15, and (iii) induces or enhances cell killing of cancer cells (e.g., WiDr colon cancer cells) in vivo or in vitro.
- the VL domain is at least 90% identical to the amino acid sequence of SEQ ID NO:13, SEQ ID NO:14, or SEQ ID NO:15.
- the VL domain is at least 95% identical to the amino acid sequence of SEQ ID NO:13, SEQ ID NO:14, or SEQ ID NO:15. In some embodiments, the VL domain is identical to the amino acid sequence of SEQ ID NO: 13, SEQ ID NO: 14, or SEQ ID NO: 15.
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen- binding fragment thereof
- an isolated Fnl4-binding protein that (i) selectively binds to the polypeptide of SEQ ID NO: 1 , when expressed on the surface of a cell, (ii) comprises a VH domain that is at least 80% identical to the amino acid sequence of SEQ ID NO: 11 or SEQ ID NO: 12, (iii) comprises a VL domain that is at least 80% identical to the amino acid sequence of SEQ ID NO: 13, SEQ ID NO: 14, or SEQ ID NO:15, and (iv) induces or enhances cell killing of cancer cells (e.g., WiDr colon cancer cells) in v/vo or in vitro.
- cancer cells e.g., WiDr colon cancer cells
- the VH domain is at least 90% identical to the amino acid sequence of SEQ ID NO:11 or SEQ ID NO: 12 and (ii) the VL domain is at least 90% identical to the amino acid sequence of SEQ ID NO: 13, SEQ ID NO: 14, or SEQ ID NO: 15. In some embodiments, (i) the VH domain is at least 95% identical to the amino acid sequence of SEQ ID NO: 11 or SEQ ID NO: 12, and (ii) the VL domain is at least 95% identical to the amino acid sequence of SEQ ID NO:13, SEQ ID NO:14, or SEQ ID NO:15.
- the VH domain is identical to the amino acid sequence of SEQ ID NO: 11 or SEQ ID NO: 12 and (ii) the VL domain is identical to the amino acid sequence of SEQ ID NO: 13, SEQ ID NO: 14, or SEQ ID NO: 15.
- the heavy chain comprises SEQ ID NO:37 or SEQ ID NO:39 and the light chain comprises SEQ ID NO:41, SEQ ID NO:43, or SEQ ID NO:45.
- the heavy chain comprises SEQ ID NO:37 and the light chain comprises SEQ ID NO:43.
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen- binding fragment thereof
- a VH domain comprising (a) a first heavy chain complementarity determining region (CDR) that is at least 90% identical to CDR-Hl of SEQ ID NO:2 or SEQ ID NO:3, a second heavy chain CDR that is at least 90% identical to CDR-H2 of SEQ ID NO:2 or SEQ ID NO:3, and a third heavy chain CDR that is at least 90% identical to CDR-H3 of SEQ ID NO:2 or SEQ ID NO:3, or (b) a first heavy chain CDR that is at least 90% identical to CDR-Hl of SEQ ID NO:4, a second heavy chain CDR that is at least 90% identical to CDR-H2 of SEQ ID NO:4, and a third heavy chain CDR that is at least 90% identical to
- the first heavy chain CDR is identical to CDR-Hl of SEQ ID NO:2 or SEQ ID NO:3
- the second heavy chain CDR is identical to CDR- H2 of SEQ ID NO:2 or SEQ ID NO:3
- the third heavy chain CDR is identical to CDR-H3 of SEQ ID NO:2 or SEQ ID NO:3.
- the first heavy chain CDR is identical to CDR-Hl of SEQ ID NO:4
- the second heavy chain CDR is identical to CDR-H2 of SEQ ID NO:4
- the third heavy chain CDR is identical to CDR-H3 of SEQ ID NO:4.
- an isolated Fnl4-binding protein (e.g., an isolated antibody or antigen- binding fragment thereof) that (i) selectively binds to the polypeptide of SEQ ID NO:1, when expressed on the surface of a cell, (ii) comprises a VL domain comprising (a) a first light chain CDR that is at least 90% identical to CDR-Ll of SEQ ID NO:5 or SEQ ID NO:6, a second light chain CDR that is at least 90% identical to CDR-L2 of SEQ ID NO:5 or SEQ ID NO:6, and a third light chain CDR that is at least 90% identical to CDR-L3 of SEQ ID NO:5 or SEQ ID NO:6, or (b) a first light chain CDR that is at least 90% identical to CDR-Ll of SEQ ID NO:7, a second light chain CDR that is at least 90% identical to CDR-L2 of SEQ ID NO:7, and a third light chain CDR that is at least 90% identical to CDR-L3 of
- the first light chain CDR is identical to CDR-Ll of SEQ ID NO:5 or SEQ ID NO:6, the second light chain CDR is identical to CDR-L2 of SEQ ID NO:5 or SEQ ID NO:6, and the third light chain CDR is identical to CDR-L3 of SEQ ID NO:5 or SEQ ID NO:6.
- the first light chain CDR is identical to CDR-Ll of SEQ ID NO:7
- the second light chain CDR is identical to CDR-L2 of SEQ ID NO:7
- the third light chain CDR is identical to CDR-L3 of SEQ ID NO:7.
- an isolated Fnl4-binding protein (e.g., an isolated antibody or antigen- binding fragment thereof) that (i) selectively binds to the polypeptide of SEQ ID NO:1, when expressed on the surface of a cell, (ii) comprises a VH domain comprising (a) a first heavy chain CDR that is at least 90% identical to CDR-Hl of SEQ ID NO:2 or SEQ ID NO:3, a second heavy chain CDR that is at least 90% identical to CDR-H2 of SEQ ID NO:2 or SEQ ID NO:3, and a third heavy chain CDR that is at least 90% identical to CDR-H3 of SEQ ID NO:2 or SEQ ID NO:3, or (b) a first heavy chain CDR that is at least 90% identical to CDR-Hl of SEQ ID NO:4, a second heavy chain CDR that is at least 90% identical to CDR-H2 of SEQ ID NO:4, and a third heavy chain CDR that is at least 90% identical to CDR-H3 of SEQ
- the first heavy chain CDR is identical to CDR-Hl of SEQ ID NO:2
- the second heavy chain CDR is identical to CDR- H2 of SEQ ID NO:2
- the third heavy chain CDR is identical to CDR-H3 of SEQ ID NO:2
- the first light chain CDR is identical to CDR-Ll of SEQ ID NO:5
- the second light chain CDR is identical to CDR-L2 of SEQ ID NO:5
- the third light chain CDR is identical to CDR-L3 of SEQ ID NO:5.
- the first heavy chain CDR is identical to CDR-Hl of SEQ ID NO:3
- the second heavy chain CDR is identical to CDR-H2 of SEQ ID NO:3
- the third heavy chain CDR is identical to CDR-H3 of SEQ ID NO:3
- the first light chain CDR is identical to CDR-Ll of SEQ ID NO:6
- the second light chain CDR is identical to CDR-L2 of SEQ ID NO:6
- the third light chain CDR is identical to CDR-L3 of SEQ ID NO:6.
- the first heavy chain CDR is identical to CDR-Hl of SEQ ID NO:4, the second heavy chain CDR is identical to CDR-H2 of SEQ ID NO:4, and the third heavy chain CDR is identical to CDR-H3 of SEQ ID NO:4, and (ii) the first light chain CDR is identical to CDR-Ll of SEQ ID NO:7, the second light chain CDR is identical to CDR- L2 of SEQ ID NO:7, and the third light chain CDR is identical to CDR-L3 of SEQ ID NO:7.
- VH domain comprises amino acids 1-121 of SEQ ID NO: 8.
- VL domain comprises amino acids 1-111 of SEQ ID NO: 9.
- VH domain comprises amino acids 1-121 of SEQ ID NO: 8 and the VL domain comprises amino acids 1-111 of SEQ ID NO:9.
- the heavy chain comprises SEQ ID NO:8 and the light chain comprises SEQ ID NO:9.
- the heavy chain comprises SEQ ID NO: 16.
- the heavy chain comprises SEQ ID NO: 16 and the light chain comprises SEQ ID NO:9.
- An antibody or antigen-binding fragment thereof described herein can optionally contain framework regions that are collectively at least 90% identical (or at least 95, 98, or 99% identical) to human germline framework regions. The term "collectively" means that all frameworks are considered together in the sequence comparison, rather than individual framework regions.
- an antibody or antigen-binding fragment thereof described herein can comprise VH domain framework regions that are collectively at least 90% identical (or at least 95, 98, or 99% identical) to the framework regions of the VH domain of SEQ ID NO: 11 or SEQ ID NO: 12.
- an antibody or antigen-binding fragment thereof described herein can comprise VL domain framework regions that are collectively at least 90% identical (or at least 95, 98, or 99% identical) to the framework regions of the VL domain of SEQ ID NO: 13, SEQ ID NO: 14, or SEQ ID NO: 15.
- an antibody or antigen- binding fragment thereof described herein can comprise (i) VH domain framework regions that are collectively at least 90% identical to the framework regions of the VH domain of SEQ ID NO: 11 or SEQ ID NO: 12, and (ii) VL domain framework regions that are collectively at least 90% identical to the framework regions of the VL domain of SEQ ID NO:13, SEQ ID NO:14, or SEQ ID NO: 15.
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen- binding fragment thereof
- an isolated Fnl4-binding protein that (i) selectively binds to the polypeptide of SEQ ID NO:1, when expressed on the surface of a cell, (ii) comprises a VH domain comprising SEQ ID NO:11, and (iii) comprises a VL domain comprising SEQ ID NO: 13.
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen- binding fragment thereof
- (i) selectively binds to the polypeptide of SEQ ID NO: 1 , when expressed on the surface of a cell
- (ii) comprises a VH domain comprising CDRs that are identical to the CDRs of SEQ ID NO:11 or wherein each CDR differs from the corresponding CDR of SEQ ID NO:11 in at most one, two, three, or four alterations (e.g., substitutions, deletions, or insertions), wherein the framework regions are collectively at least 90, 95, 97, 98, or 99% identical to the framework regions of SEQ ID NO: 11
- (iii) comprises a VL domain comprising CDRs that are identical to the CDRs of SEQ ID NO: 13 or wherein each CDR differs from the corresponding CDR of SEQ ID NO: 13 in at most one, two, three, or four alterations (e.g., substitutions
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen- binding fragment thereof
- an isolated Fnl4-binding protein that (i) selectively binds to the polypeptide of SEQ ID NO: 1, when expressed on the surface of a cell, (ii) comprises a VH domain comprising SEQ ID NO:11, and (iii) comprises a VL domain comprising SEQ ID NO: 14.
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen- binding fragment thereof
- (i) selectively binds to the polypeptide of SEQ ID NO:1, when expressed on the surface of a cell
- (ii) comprises a VH domain comprising CDRs that are identical to the CDRs of SEQ ID NO: 11 or differ from the CDRs of SEQ ID NO: 11 in at most one, two, three, or four alterations (e.g., substitutions, deletions, or insertions), wherein the framework regions are collectively at least 90, 95, 97, 98, or 99% identical to the framework regions of SEQ ID NO: 11
- (iii) comprises a VL domain comprising CDRs that are identical to the CDRs of SEQ ID NO:14 or differ from the CDRs of SEQ ID NO:14 in at most one, two, three, or four alterations (e.g., substitutions, deletions, or insertions), wherein the framework regions are collective
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen- binding fragment thereof
- an isolated Fnl4-binding protein that (i) selectively binds to the polypeptide of SEQ ID NO: 1 , when expressed on the surface of a cell, (ii) comprises a VH domain comprising SEQ ID NO: 11 , and (iii) comprises a VL domain comprising SEQ ID NO: 15.
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen- binding fragment thereof
- a VH domain comprising CDRs that are identical to the CDRs of SEQ ID NO: 11 or differ from the CDRs of SEQ ID NO: 11 in at most one, two, three, or four alterations (e.g., substitutions, deletions, or insertions), wherein the framework regions are collectively at least 90, 95, 97, 98, or 99% identical to the framework regions of SEQ ID NO:11
- (iii) comprises a VL domain comprising CDRs that are identical to the CDRs of SEQ ID NO: 15 or differ from the CDRs of SEQ ID NO: 15 in at most one, two, three, or four alterations (e.g., substitutions, deletions, or insertions), wherein the framework regions are collectively
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen- binding fragment thereof
- an isolated Fnl4-binding protein that (i) selectively binds to the polypeptide of SEQ ID NO: 1 , when expressed on the surface of a cell, (ii) comprises a VH domain comprising SEQ ID NO: 12, and (iii) comprises a VL domain comprising SEQ ID NO: 13.
- an isolated Fnl4-binding protein (e.g., an isolated antibody or antigen- binding fragment thereof) that (i) selectively binds to the polypeptide of SEQ ID NO: 1 , when expressed on the surface of a cell, (ii) comprises a VH domain comprising CDRs that are identical to the CDRs of SEQ ID NO: 12 or differ from the CDRs of SEQ ID NO: 12 in at most one, two, three, or four alterations (e.g., substitutions, deletions, or insertions), wherein the framework regions are collectively at least 90, 95, 97, 98, or 99% identical to the framework regions of SEQ ID NO: 12, and (iii) comprises a VL domain comprising CDRs that are identical to the CDRs of SEQ ID NO:13 or differ from the CDRs of SEQ ID NO:13 in at most one, two, three, or four alterations (e.g., substitutions, deletions, or insertions), wherein the framework regions are collective
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen- binding fragment thereof
- an isolated Fnl4-binding protein that (i) selectively binds to the polypeptide of SEQ ID NO: 1 , when expressed on the surface of a cell, (ii) comprises a VH domain comprising SEQ ID NO: 12, and (iii) comprises a VL domain comprising SEQ ID NO: 14.
- an isolated Fnl4-binding protein (e.g., an isolated antibody or antigen- binding fragment thereof) that (i) selectively binds to the polypeptide of SEQ ID NO: 1, when expressed on the surface of a cell, (ii) comprises a VH domain comprising CDRs that are identical to the CDRs of SEQ ID NO: 12 or differ from the CDRs of SEQ ID NO: 12 in at most one, two, three, or four alterations (e.g., substitutions, deletions, or insertions), wherein the framework regions are collectively at least 90, 95, 97, 98, or 99% identical to the framework regions of SEQ ID NO: 12, and (iii) comprises a VL domain comprising CDRs that are identical to the CDRs of SEQ ID NO: 14 or differ from the CDRs of SEQ ID NO: 14 in at most one, two, three, or four alterations (e.g., substitutions, deletions, or insertions), wherein the framework regions are collectively at least 90
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen- binding fragment thereof
- an isolated Fnl4-binding protein that (i) selectively binds to the polypeptide of SEQ ID NO: 1, when expressed on the surface of a cell, (ii) comprises a VH domain comprising SEQ ID NO: 12, and (iii) comprises a VL domain comprising SEQ ID NO: 15.
- an isolated Fnl4-binding protein e.g., an isolated antibody or antigen- binding fragment thereof
- a VH domain comprising CDRs that are identical to the CDRs of SEQ ID NO: 12 or differ from the CDRs of SEQ ID NO: 12 in at most one, two, three, or four alterations (e.g., substitutions, deletions, or insertions), wherein the framework regions are collectively at least 90, 95, 97, 98, or 99% identical to the framework regions of SEQ ID NO: 12, and
- (iii) comprises a VL domain comprising CDRs that are identical to the CDRs of SEQ ID NO: 15 or differ from the CDRs of SEQ ID NO: 15 in at most one, two, three, or four alterations (e.g., substitutions, deletions, or insertions), wherein the framework regions are collectively at
- the antibody or antigen-binding fragment includes three or all six CDRs from P4A8 or closely related CDRs, e.g., CDRs that are identical or have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions), or other CDR described herein.
- the antibody or antigen-binding fragment includes three or all six CDRs from P3G5 or closely related CDRs, e.g., CDRs that are identical or have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions), or other CDR described herein.
- the antibody or antigen-binding fragment includes three or all six CDRs from P2D3 or closely related CDRs, e.g., CDRs that are identical or have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions), or other CDR described herein.
- amino acids of an anti-Fnl4 antibody or antigen-binding fragment thereof that interact with the Fn 14 protein are preferably not mutated (or, if mutated, replaced by a conserved amino acid residue).
- residue S32 of CDR Ll is not changed.
- residue Y34 of CDR Ll is not changed.
- residue Y36 of CDR Ll is not changed.
- residue Y54 of CDR L2 is not changed.
- residue R96 of CDR L3 is not changed.
- residue D31 of CDR Hl is not changed.
- residue Y32 of CDR Hl is not changed.
- residue S52 of CDR H2 is not changed.
- residue Y54 of CDR H2 is not changed.
- residue N55 of CDR H2 is not changed.
- residue Y57 of CDR H2 is not changed.
- residue YlOl of CDR H3 is not changed.
- residue Yl 05 of CDR H3 is not changed.
- residue Yl 06 of CDR H3 is not changed.
- the antibody or antigen-binding fragment is as described herein with the proviso that at least 1, 2, 3, 4, 5 or 6 of the CDRs or 1 or 2 of the variable chains is not from a known antibody, e.g., ITEM-I, ITEM-2, ITEM-3 or ITEM-4.
- the antibody or antigen-binding fragment does not cross-react with other TNF and TNFR family members.
- An antibody or antigen-binding fragment described herein can be, for example, a humanized antibody, a fully human antibody, a monoclonal antibody, a single chain antibody, a monovalent antibody, a polyclonal antibody, a chimeric antibody, a multispecific antibody (e.g., a bispecific antibody), a multivalent antibody, an F ⁇ fragment, an F( ⁇ ) 2 fragment, an F ab ' fragment, an F sc fragment, or an F v fragment.
- An antibody or antigen-binding fragment described herein may be "multispecific,” e.g., bispecific, trispeciflc or of greater multispecif ⁇ city, meaning that it recognizes and binds to two or more different epitopes present on one or more different antigens (e.g., proteins) at the same time.
- a binding molecule is "monospecfic” or “multispecific,” e.g., "bispecific,” refers to the number of different epitopes with which the binding molecule reacts.
- Multispecific antibodies may be specific for different epitopes of an FnI 4 protein, or may be specific for FnI 4 as well as for a heterologous epitope, such as a heterologous polypeptide or solid support material.
- valent refers to the number of potential binding domains, e.g., antigen binding domains, present in a binding molecule. Each binding domain specifically binds one epitope. When a binding molecule comprises more than one binding domain, each binding domain may specifically bind the same epitope (for an antibody with two binding domains, termed “bivalent monospecific") or to different epitopes (for an antibody with two binding domains, termed “bivalent bispecific”). An antibody may also be bispecific and bivalent for each specificity (termed “bispecific tetravalent antibodies”). In another embodiment, tetravalent mmibodies or domain deleted antibodies can be made.
- Bispecific bivalent antibodies, and methods of making them are described, for instance in U.S. Pat Nos. 5,731,168; 5,807,706; 5,821,333; and U.S. Application Publication Nos. 2003/020734 and 2002/0155537, the disclosures of all of which are incorporated by reference herein.
- Bispecific tetravalent antibodies, and methods of making them are described, for instance, in WO 02/096948 and WO 00/44788, the disclosures of both of which are incorporated by reference herein. See generally, PCT publications WO 93/17715; WO 92/08802; WO
- an anti-Fnl4 antibody e.g., one or the two heavy chains of the antibody, is linked to one or more scFv to form a bispecific antibody.
- an anti-Fnl4 antibody is in the form of an scFv that is linked to an antibody to form a bispecific molecule.
- Antibody-scFv constructs are described, e.g., in WO 2007/109254.
- the heavy and light chains of the antibody can be substantially full-length.
- the protein can include at least one, and optionally two, complete heavy chains, and at least one, and optionally two, complete light chains or can include an antigen-binding fragment.
- the antibody has a heavy chain constant region chosen from, e.g., IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE.
- the heavy chain constant region is human or a modified form of a human constant region.
- the antibody has a light chain constant region chosen from, e.g., kappa or lambda, particularly, kappa (e.g., human kappa).
- antibodies or antigen binding fragments thereof results in cross-linking or clustering of the FnI 4 receptor on the cell surface.
- antibodies or antigen-binding fragments thereof may form a multimer, e.g., by binding to protein A, or may be multivalent.
- An antibody or antigen-binding fragment described herein can be modified to enhance effector function, e.g., so as to enhance antigen-dependent cell-mediated cytotoxicity (ADCC) and/or complement dependent cytotoxicity (CDC) of the antibody or enhance cross-linking of the target receptor/Fnl4. This may be achieved by introducing one or more amino acid substitutions in an Fc region of the antibody.
- ADCC antigen-dependent cell-mediated cytotoxicity
- CDC complement dependent cytotoxicity
- cysteine residue(s) may be introduced in the Fc region, thereby allowing interchain disulfide bond formation in this region.
- the homodimeric antibody thus generated may have improved internalization capability and/or increased complement-mediated cell killing and antibody-dependent cellular cytotoxicity (ADCC).
- Homodimeric antibodies with enhanced anti-tumor activity may also be prepared using heterobifunctional cross-linkers as described in Wolff et al. Cancer Research 53 :2560-2565 (1993).
- an antibody can be engineered which has dual Fc regions and may thereby have enhanced complement lysis and ADCC capabilities. See Stevenson et al. Anti-Cancer Drug Design 3:219-230 (1989).
- an antibody can be defucosylated such that the modified antibody exhibits enhanced ADCC as compared to the non-defucosylated form of the antibody. See, e.g., WO2006089232.
- nucleic acids e.g., DNAs, encoding an antibody or antigen binding fragment thereof, described herein. Nucleic acids that are at least about 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to or hybridize under stringent hybridization conditions to these nucleic acids are also encompassed herein. Also disclosed is an isolated cell that produces an antibody or antigen-binding fragment described herein. Also provided herein are cells, e.g., isolated cells, comprising a nucleic acid encoding a protein described herein. The cell can be, for example, a fused cell obtained by fusing a mammalian B cell and myeloma cell.
- composition comprising an antibody or antigen- binding fragment described herein and a pharmaceutically acceptable carrier.
- the invention features a method of inducing death of a tumor cell, the method comprising contacting a tumor cell that expresses FnI 4 with an amount of an antibody or antigen-binding fragment described herein effective to induce death of the tumor cell.
- Also disclosed is a method of preventing or reducing tumor cell growth comprising administering to a mammal having a tumor a pharmaceutical composition comprising an amount of an antibody or antigen-binding fragment described herein effective to prevent or reduce tumor cell growth.
- Also disclosed is a method of treating a cancer comprising administering to a mammal having a cancer a pharmaceutical composition comprising a therapeutically effective amount of an antibody or antigen-binding fragment described herein.
- the cancer can be, for example, a colon cancer or a breast cancer.
- the mammal treated according to the methods described herein can be, e.g., a human, a mouse, a rat, a cow, a pig, a dog, a cat, or a monkey.
- FIG. 1 is a graph showing that treatment of WiDr colon cancer cells in vitro with anti-
- Fnl4 monoclonal antibodies P2D3, P4A8, P23G5, and P3D8 results in reduced cell viability, as measured by an MTT assay.
- FIGS. 2 A and 2B are a line graph (FIG. 2A) and a bar graph (FIG. 2B) showing that an anti-Fnl4 monoclonal antibody (P4A8) can induce apoptosis of Widr colon cancer cells in vitro, as measured by a TUNEL assay.
- FIG. 3 is a graph showing an example of FnI 4+ breast tumor line (MDA-MB231) resistant to Fnl4 monoclonal antibodies P2D3, P4A8, and P3G5 in vitro, as measured by an MTT assay.
- FIG. 4 is a graph showing that Fn 14 monoclonal antibodies P4A8, P2D3, P3G5, and P3D8 are agonists in an IL-8 induction assay, as measured by ng/ml IL-8 over various antibody concentrations.
- FIG. 5 is a line graph (top) and bar graph (bottom) showing that anti-Fnl4 monoclonal antibodies P2D3, P3G5, and P4A8 are efficacious in vivo to treat Widr cell colon tumors, as measured by tumor volume (mm 3 ) on days post tumor inoculation (top) or by tumor weight (grams) on day 45.
- FIG. 6 is a graph showing no obvious toxicities in animals treated with anti-Fnl4 monoclonal antibodies P2D3, P3G5, and P4A8, as measured by weight (g) on days post tumor implantation.
- FIG. 7 is a graph showing the efficacy of various doses and timings of dosing of anti- FnI 4 monoclonal antibody P4A8 in treating large Widr tumors, as measured by tumor volume (mm ) on days post tumor inoculation.
- FIG. 8 is a graph showing the dose response of Widr tumors to P4A8 anti-Fnl4 monoclonal antibody, as measured by tumor volume (mm 3 ) on days post tumor inoculation.
- FIG. 9 is a graph showing the dose response of Widr tumors to P4A8 anti-Fnl4 monoclonal antibody, as measured by percent test/control on days post tumor inoculation.
- FIG. 10 is a graph showing no obvious toxicities in animals treated with various doses of anti-Fnl4 monoclonal antibody P4A8, as measured by percent body weight change on days post tumor implantation.
- FIG. 11 is a graph showing that anti-Fnl4 monoclonal antibodies P2D3 and P4A8 are efficacious in vivo to treat MDA-MB231 breast cell tumors, as measured by tumor volume (mm 3 ) on days post tumor inoculation.
- FIG. 12 is a graph showing that anti-Fnl4 monoclonal antibodies P4A8 and P2D3 are cross-reactive to FnI 4 from multiple species (human (hu), murine (mu), and cynomolgus monkey (cyno).
- FIG. 13 is a histogram showing that P4A8 binds significantly less well to human FnI 4 having a W42A mutation relative to wildtype FnI 4.
- FIGS 14A-14F are DNA sequences of the VH domain of the P4A8 antibody (FIG. 14A), the VH domain of the P3G5 antibody (FIG. 14B), the VH domain of the P2D3 antibody (FIG. 14C), the VL domain of the P4A8 antibody (FIG.
- FIG. 15 is a graph showing that hP4A8IgGl and a multimeric version of hP4A8IgGl kill
- WiDr colon cancer cells in vitro as measured by an MTT assay.
- FIG. 16 is a graph showing that the anti-Fnl4 monoclonal antibodies P2D3, P3D8, P3G5 and P4A8 bind to human and cynomolgus monkey surface FnI 4 with similar EC50 values.
- FIG. 17 is a graph showing that the anti-Fnl4 monoclonal antibodies P2D3, P3D8, P3G5 and P4A8 bind to murine surface FnI 4 with similar EC50 values.
- FIG. 18A and FIG. 18B are graphs showing that variants of huP4A8 with different heavy chain effector function bind to human (FIG. 18A) and rat (FIG. 18B) Fnl4 with similar EC50 values.
- FIG. 19A is a histogram showing that P4A8 binds to human, cynomolgus monkey, and mouse surface Fnl4, but not Xenopus Fnl4.
- FIG. 19B is a histogram showing that the Fc-huTWEAK fusion protein binds to human, cynomolgus monkey, mouse and Xenopus surface FnI 4.
- FIG. 19C is a histogram showing that the muFc-muTWEAK fusion protein binds to human, cynomolgus monkey, mouse and Xenopus surface Fnl4.
- FIG. 20 is a gapped alignment of the FnI 4 ectodomain.
- FIG. 21 A is a histogram showing Fc-TWEAK binds to all Fnl4 W42A mutants.
- FIG. 21B is a histogram showing that P4A8 binding to Fn 14 is abrogated by mutation to W42A
- FIG. 22 is a histogram showing that P4A8 binding to Fnl4 is restored to normal when residue W42 is mutated to large hydrophobic residues W42F or W42Y.
- FIG. 23 A is a histogram showing Fc-TWEAK binding to a panel of human Fn 14 point mutants.
- FIG. 23B is a histogram showing P4A8 binding to a panel of human FnI 4 point mutants.
- FIG. 23C is a histogram showing P3G5 binding to a panel of human Fnl4 point mutants.
- FIG. 23D is a histogram showing P2D3 binding to a panel of human Fnl4 point mutants.
- FIG. 23 E is a histogram showing ITEM-I binding to a panel of human Fn 14 point mutants.
- FIG. 23 F is a histogram showing ITEM-4 binding to a panel of human Fn 14 point mutants.
- FIG. 23 G is a histogram showing ITEM-2 binding to a panel of human Fn 14 point mutants.
- FIG. 23H is a histogram showing ITEM-3 binding to a panel of human FnI 4 point mutants.
- FIG. 24 is a graph showing that different versions of huP4A8 are equivalent to chP4A8 as assayed by FACS dilution titration direct binding to surface human Fn 14 transiently overexpressed in 293 E cells.
- FIG 25 is a graph showing that different versions of huP4A8 retained Fnl4 binding affinities essentially equivalent to chP4A8 assayed by competition ELISA.
- FIG. 26 is a graph showing activation of Caspases 3/7 in WiDr cells in response to stimulation with hP4A8 and a multimeric version of hP4A8 (hP4A8-multi).
- FIG. 27 is a graph showing induction of NFkB transcription factors in WiDr cells in response to P4 A8.
- FIG. 28 is a graph showing ADCC activity of hP4A8.IgGl and Fc-crippled versions of P4A8 (hP4A8-IgGlagly and hP4A8.IgG4Pagly).
- FIG. 29 is a graph showing the results of in vivo administration of P4A8 hlgGl and P4A8hIgG4Pagly in the WiDr and MDA-MB231 assays.
- FIG. 30, FIG. 31 5 and FIG. 32 are graphs showing the in vivo efficacy of the P4A8.hIgGl antibody administered at various doses to WiDr human colon tumor-bearing athymic nude mice.
- FIG. 33 and FIG. 34 are graphs showing the in vivo efficacy of the P4A8.hIgGl antibody administered at various doses to MDA-MB-231 breast carcinoma tumor-bearing SCID mice.
- FIG. 35 is a graph showing the efficacy of humanized P4A8 IgGl in the Hs746T gastric carcinoma xenograft model.
- FIGS. 36A and 36B are graphs showing the efficacy of humanized P4A8 IgGl in the Hs746T (FIG. 36A) and N87 (FIG. 36B) gastric carcinoma xenograft models.
- FIG. 37 is a graph showing the in vivo efficacy of the P4A8.hIgGl antibody administered at various dosing schedules to WiDr human colon tumor-bearing athymic nude mice.
- FIG. 38A is a graph depicting the ability of a panel of antibodies to crossblock binding of the antibody P2D3 to human Fnl4.
- FIG. 38B is a graph depicting the ability of a panel of antibodies to crossblock binding of the antibody P3G5 to human Fnl4.
- FIG. 38C is a graph depicting the ability of a panel of antibodies to crossblock binding of the antibody P4A8 to human FnI 4.
- FIG. 38D is a graph depicting the ability of a panel of antibodies to crossblock binding of the antibody ITEM-4 to human FnI 4.
- FIG. 38E is a graph depicting the ability of a panel of antibodies to crossblock binding of the antibody ITEM-3 to human Fn 14.
- P4A8, P2D3, P3G5, and P3D8 are exemplary antibodies that specifically bind to human Fn 14 and agonize FnI 4 activity or mimic at least some of the activities resulting from binding of TWEAK to Fnl4 on a cell surface.
- P2D3 and P3D8 have been found to have the same amino acid sequences.
- the anti-Fnl4 antibodies described herein induce cell killing, e.g., by apoptosis, such as caspase-dependent apoptosis, and/or endogenous TNF-alpha mediated cell death, and can be used to treat or prevent diseases such as cancer, in which Fn 14 is expressed.
- FnI 4 is an FGF-inducible receptor. It is often expressed at low levels on cells of normal tissues, and can be upregulated in injury or disease, or on cancer (e.g., tumor) cells. Without being bound by theory, it is believed that stimulation of FnI 4 by an FnI 4 ligand (e.g., TWEAK) can induce tumor cell death, and that an anti-Fnl4 antibody will also be effective in killing tumor cells. It is also believed that Fnl4 is overexpressed in human tumors. An anti-Fnl4 antibody can trigger tumor cell death and therefore be therapeutically beneficial in treating cancer.
- the sequence of human Fnl4 is shown as:
- Additional Fnl4 protein sequences include: mouse Fnl4 (e.g., NCBI accession no. AAF07882 or NP_038777 or Q9CR75 or AAH25860), human Fnl4 (e.g., NCBI accession no. NP_057723 or BAA94792 or Q9NP84 or AAH02718 or AAF69108); rat Fnl4 (e.g., NCBI accession no. NP_851600 or AAH60537); and Xenopus Fnl4 (e.g., NCBI accession no. AAR21225 or NP_001083640). These Fnl4 proteins can be used, e.g., as an immunogen to prepare anti-Fnl4 antibodies. Anti-Fnl4 antibodies can then be screened to identify agonist antibodies, as described herein.
- mouse Fnl4 e.g., NCBI accession no. AAF07882 or NP_038777 or Q9CR75 or A
- anti-Fnl4 agonist antibodies such as P4A8, P2D3, P3G5, and P3D8.
- Particular antibodies, such as these can be made, for example, by preparing and expressing synthetic genes that encode the recited amino acid sequences or by mutating human germline genes to provide a gene that encodes the recited amino acid sequences.
- these antibodies and other anti-Fnl4 antibodies e.g., agonist antibodies
- One exemplary method includes screening protein expression libraries, e.g., phage or ribosome display libraries.
- Phage display is described, for example, U.S. 5,223,409; Smith (1985) Science 228:1315-1317; WO 92/18619; WO 91/17271; WO 92/20791; WO 92/15679; WO 93/01288; WO 92/01047; WO 92/09690; and WO 90/02809.
- the display of Fab' s on phage is described, e.g., in U.S. Pat. Nos. 5,658,727; 5,667,988; and 5,885,793.
- Fnl4-binding antibody In addition to the use of display libraries, other methods can be used to obtain a Fnl4-binding antibody.
- the Fnl4 protein or a peptide thereof can be used as an antigen in a non-human animal, e.g., a rodent, e.g., a mouse, hamster, or rat.
- a rodent e.g., a mouse, hamster, or rat.
- cells transfected with a cDNA encoding Fnl4 can be injected into a non-human animal as a means of producing antibodies that effectively bind the cell surface FnI 4 protein.
- the non-human animal includes at least a part of a human immunoglobulin gene.
- a human immunoglobulin gene For example, it is possible to engineer mouse strains deficient in mouse antibody production with large fragments of the human Ig loci.
- antigen-specific monoclonal antibodies derived from the genes with the desired specificity may be produced and selected. See, e.g., XENOMOUSETM, Green et al. (1994) Nature Genetics 7:13-21, U.S. 2003-0070185, WO 96/34096, and WO 96/33735.
- a monoclonal antibody is obtained from the non-human animal, and then modified, e.g., humanized or deimmunized.
- BioTechniqms 4:214 and by US 5,585,089; US 5,693,761; US 5,693,762; US 5,859,205; and US 6,407,213.
- Those methods include isolating, manipulating, and expressing the nucleic acid sequences that encode all or part of immunoglobulin Fv variable regions from at least one of a heavy or light chain.
- Sources of such nucleic acid are well known to those skilled in the art and, for example, may be obtained from a hybridoma producing an antibody against a predetermined target, as described above, from germline immunoglobulin genes, or from synthetic constructs.
- the recombinant DNA encoding the humanized antibody can then be cloned into an appropriate expression vector.
- a non-human Fnl4-binding antibody may also be modified by specific deletion of human T cell epitopes or "deimmunization" by the methods disclosed in WO 98/52976 and WO
- the heavy and light chain variable regions of an antibody can be analyzed for peptides that bind to MHC Class II; these peptides represent potential T-cell epitopes (as defined in WO 98/52976 and WO 00/34317).
- T-cell epitopes as defined in WO 98/52976 and WO 00/34317.
- peptide threading a computer modeling approach termed "peptide threading" can be applied, and in addition a database of human MHC class II binding peptides can be searched for motifs present in the V H and V L sequences, as described in WO 98/52976 and WO 00/34317. These motifs bind to any of the 18 major MHC class II DR allotypes, and thus constitute potential T cell epitopes.
- T-cell epitopes detected can be eliminated by substituting small numbers of amino acid residues in the variable regions, or preferably, by single amino acid substitutions. As far as possible, conservative substitutions are made. Often, but not exclusively, an amino acid common to a position in human germline antibody sequences may be used.
- nucleic acids encoding V H and VL can be constructed by mutagenesis or other synthetic methods (e.g., de novo synthesis, cassette replacement, and so forth).
- a mutagenized variable sequence can, optionally, be fused to a human constant region, e.g., human IgGl or kappa constant regions.
- a potential T cell epitope will include residues which are known or predicted to be important for antibody function. For example, potential T cell epitopes are usually biased towards the CDRs. In addition, potential T cell epitopes can occur in framework residues important for antibody structure and binding. Changes to eliminate these potential epitopes will in some cases require more scrutiny, e.g., by making and testing chains with and without the change. Where possible, potential T cell epitopes that overlap the CDRs can be eliminated by substitutions outside the CDRs. In some cases, an alteration within a CDR is the only option, and thus variants with and without this substitution can be tested.
- the substitution required to remove a potential T cell epitope is at a residue position within the framework that might be critical for antibody binding.
- variants with and without this substitution are tested.
- several variant deimmunized heavy and light chain variable regions are designed and various heavy/light chain combinations are tested to identify the optimal deimmunized antibody.
- the choice of the final deimmunized antibody can then be made by considering the binding affinity of the different variants in conjunction with the extent of deimmunization, particularly, the number of potential T cell epitopes remaining in the variable region.
- Deimmunization can be used to modify any antibody, e.g., an antibody that includes a non-human sequence, e.g., a synthetic antibody, a murine antibody other non-human monoclonal antibody, or an antibody isolated from a display library.
- a non-human sequence e.g., a synthetic antibody, a murine antibody other non-human monoclonal antibody, or an antibody isolated from a display library.
- humanizing antibodies can also be used.
- other methods can account for the three dimensional structure of the antibody, framework positions that are in three dimensional proximity to binding determinants, and immunogenic peptide sequences. See, e.g., WO 90/07861; U.S. Pat. Nos. 5,693,762; 5,693,761; 5,585,089; 5,530,101; and 6,407,213; Tempest et al. (1991) Biotechnology 9:266-271. Still another method is termed "humaneering" and is described, for example, in U.S. 2005-008625.
- the antibody can include a human Fc region, e.g., a wild-type Fc region or an Fc region that includes one or more alterations.
- the constant region is altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function).
- the human IgGl constant region can be mutated at one or more residues, e.g., one or more of residues 234 and 237.
- Antibodies may have mutations in the CH2 region of the heavy chain that reduce or alter effector function, e.g., Fc receptor binding and complement activation.
- antibodies may have mutations such as those described in U.S. Patent Nos. 5,624,821 and 5,648,260.
- Antibodies may also have mutations that stabilize the disulfide bond between the two heavy chains of an immunoglobulin, such as mutations in the hinge region of IgG4, as disclosed in the art (e.g., Angal et al. (1993) MoL Immunol. 30:105-08). See also, e.g., U.S. 2005-0037000.
- an anti-Fnl4 antibody is modified, e.g., by mutagenesis, to provide a pool of modified antibodies.
- the modified antibodies are then evaluated to identify one or more antibodies which have altered functional properties (e.g., improved binding, improved stability, reduced antigenicity, or increased stability in vivo).
- display library technology is used to select or screen the pool of modified antibodies.
- Higher affinity antibodies are then identified from the second library, e.g., by using higher stringency or more competitive binding and washing conditions. Other screening techniques can also be used.
- the mutagenesis is targeted to regions known or likely to be at the binding interface. If, for example, the identified binding proteins are antibodies, then mutagenesis can be directed to the CDR regions of the heavy or light chains as described herein. Further, mutagenesis can be directed to framework regions near or adjacent to the CDRs, e.g., framework regions, particularly within 10, 5, or 3 amino acids of a CDR junction. In the case of antibodies, mutagenesis can also be limited to one or a few of the CDRs, e.g., to make step- wise improvements. hi one embodiment, mutagenesis is used to make an antibody more similar to one or more germline sequences.
- One exemplary germlining method can include: identifying one or more germline sequences that are similar (e.g., most similar in a particular database) to the sequence of the isolated antibody. Then mutations (at the amino acid level) can be made in the isolated antibody, either incrementally, in combination, or both. For example, a nucleic acid library that includes sequences encoding some or all possible germline mutations is made. The mutated antibodies are then evaluated, e.g., to identity an antibody that has one or more additional germline residues relative to the isolated antibody and that is still useful (e.g., has a functional activity). In one embodiment, as many germline residues are introduced into an isolated antibody as possible.
- mutagenesis is used to substitute or insert one or more germline residues into a CDR region.
- the germline CDR residue can be from a germline sequence that is similar (e.g., most similar) to the variable region being modified.
- activity e.g., binding or other functional activity
- Similar mutagenesis can be performed in the framework regions.
- a germline sequence can be selected if it meets a predetermined criteria for selectivity or similarity, e.g., at least a certain percentage identity, e.g., at least 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 99.5% identity, relative to the donor non-human antibody.
- the selection can be performed using at least 2, 3, 5, or 10 germline sequences.
- identifying a similar germline sequence can include selecting one such sequence.
- identifying a similar germline sequence can include selecting one such sequence, but may include using two germline sequences that separately contribute to the amino-terminal portion and the carboxy-terminal portion. In other implementations, more than one or two germline sequences are used, e.g., to form a consensus sequence.
- sequence identity between two sequences are performed as follows.
- the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
- the optimal alignment is determined as the best score using the GAP program in the GCG software package with a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
- the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
- the antibody may be modified to have an altered glycosylation pattern (i.e., altered from the original or native glycosylation pattern).
- altered means having one or more carbohydrate moieties deleted, and/or having one or more glycosylation sites added to the original antibody. Addition of glycosylation sites to the presently disclosed antibodies may be accomplished by altering the amino acid sequence to contain glycosylation site consensus sequences; such techniques are well known in the art.
- Another means of increasing the number of carbohydrate moieties on the antibodies is by chemical or enzymatic coupling of glycosides to the amino acid residues of the antibody. These methods are described in, e.g., WO 87/05330, and Aplin and Wriston (1981) CRC Crit. Rev. Biochem. 22:259-306. Removal of any carbohydrate moieties present on the antibodies may be accomplished chemically or enzymatically as described in the art (Hakimuddin et al. (1987) Arch. Biochem. Biophys. 259:52; Edge et al. (1981) Anal. Biochem. 118:131; and Thotakura et al. (1987) Meth. Enzymol. 138:350). See, e.g., U.S. Pat. No. 5,869,046 for a modification that increases in vivo half life by providing a salvage receptor binding epitope.
- an antibody has CDR sequences that differ only insubstantially from those of P4A8, P2D3, P3G5, or P3D8.
- Insubstantial differences include minor amino acid changes, such as substitutions of 1 or 2 out of any of typically 5-7 amino acids in the sequence of a CDR, e.g., a Chothia or Kabat CDR.
- an amino acid is substituted by a related amino acid having similar charge, hydrophobic, or stereochemical characteristics.
- substitutions would be within the ordinary skills of an artisan.
- FRs structure framework regions
- Changes to FRs include, but are not limited to, humanizing a nonhuman-derived framework or engineering certain framework residues that are important for antigen contact or for stabilizing the binding site, e.g., changing the class or subclass of the constant region, changing specific amino acid residues which might alter an effector function such as Fc receptor binding (Lund et al. (1991) J Immun. 147:2657-62; Morgan et al. (1995) Immunology 86:319-24), or changing the species from which the constant region is derived.
- humanizing a nonhuman-derived framework or engineering certain framework residues that are important for antigen contact or for stabilizing the binding site e.g., changing the class or subclass of the constant region, changing specific amino acid residues which might alter an effector function such as Fc receptor binding (Lund et al. (1991) J Immun. 147:2657-62; Morgan et al. (1995) Immunology 86:319-24), or changing the species from which the constant region is derived.
- the anti-Fnl4 antibodies can be in the form of full length antibodies, or in the form of fragments of antibodies, e.g., Fab, F(ab') 2 , Fd, dAb, and scFv fragments.
- a fragment of an antibody can be an antigen-binding fragment, such as a variable region, e.g., VH or VL.
- Additional forms include a protein that includes a single variable domain, e.g., a camel or camelized domain. See, e.g., U.S. 2005-0079574 and Davies et al. (1996) Protein Eng. 9(6):531-7.
- compositions comprising a mixture of anti-Fnl4 antibody and one or more acidic variants thereof, e.g., wherein the amount of acidic variant(s) is less than about 80%, 70%, 60%, 60%, 50%, 40%, 30%, 30%, 20%, 10%, 5% or 1%.
- compositions comprising an anti-Fnl4 antibody comprising at least one deamidation site, wherein the pH of the composition is from about 5.0 to about 6.5, such that, e.g., at least about 90% of the anti- Fnl4 antibodies are not deamidated (i.e., less than about 10% of the antibodies are deamidated).
- the pH may be from 5.0 to 6.0, such as 5.5 or 6.0. In certain embodiments, the pH of the composition is 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4 or 6.5.
- an “acidic variant” is a variant of a polypeptide of interest which is more acidic (e.g. as determined by cation exchange chromatography) than the polypeptide of interest.
- An example of an acidic variant is a deamidated variant.
- a "deamidated" variant of a polypeptide molecule is a polypeptide wherein one or more asparagine residue(s) of the original polypeptide have been converted to aspartate, i.e. the neutral amide side chain has been converted to a residue with an overall acidic character.
- composition as used herein in reference to a composition comprising an anti-Fnl4 antibody, means the presence of both the desired anti-Fnl4 antibody and one or more acidic variants thereof.
- the acidic variants may comprise predominantly deamidated anti-Fnl4 antibody, with minor amounts of other acidic variants).
- an amino acid within the deamidation site (NG) or in the vicinity of the deamidation site is mutated to reduce or eliminate deamidation of the antibody.
- CDR2 of the humanized P4A8 heavy chain SEQ ID NO:11 contains a deamidation site (NG) at positions 55 (N; Asn) and 56 (G; GIy).
- At least one amino acid substitution can be introduced within CDR2 of an antibody that contains CDR2 of SEQ ID NO : 11 (or a variant thereof described herein) at a position corresponding to position 54, 55 or 56 of SEQ ID NO:11 so as to reduce or eliminate antibody deamidation, wherein: position 54 is GIy, Ala, Ser, VaI, Thr, Leu, He, Met, Phe, Tyr, or Trp; position 55 is Asn, GIn, Arg, Asp, Ser, GIy, or Ala; position 56 is GIy, Ala, Ser, VaI, Thr, Leu, He, Met, Phe, Tyr, or Trp; provided that when position 55 is Asn, position 56 is not GIy.
- N or the G may be substituted for another amino acid.
- the asparagine at amino acid position 55 is substituted with a serine (i.e., an N55S mutant of CDR2).
- position 54 is GIy, position 55 is Asn, and position 56 is VaI; position 54 is GIy, position 55 is Asn, and position 56 is Ala; position 54 is GIy, position 55 is Asp, and position 56 is GIy; position 54 is GIy, position 55 is Gm, and position 56 is GIy; position 54 is GIy, position 55 is Ala, and position 56 is GIy; position 54 is GIy, position 55 is GIy, and position 56 is GIy; position 54 is selected from the group consisting of GIy, Ala, Ser, VaI, Thr, Leu, He, Met, Phe, Tyr, and Trp, position 55 is Ala, and position 56 is GIy; and position 54 is selected from the group consisting of GIy, Ala, Ser, VaI, Thr, Leu, He, Met, Phe, Tyr, and Trp, position 55 is Ala, and position 56 is GIy; and position 54 is selected from the group consisting of GIy, Ala,
- the binding affinity (K D ), on-rate (K D on) and/or off-rate (K D off) of the antibody that was mutated to eliminate deamidation is similar to that of the wild-type antibody, e.g., having a difference of less than about 5 fold, 2 fold, 1 fold (100%), 50%, 30%, 20%, 10%, 5%, 3%, 2% or 1 %.
- an anti-Fnl4 antibody inhibits angiogenesis.
- Anti-Fnl4 antibodies may alternatively stimulate angiogenesis or have no effect on angiogenesis.
- An effect on angiogenesis may be determined in in vitro or in vivo assays, e.g., in an endothelial proliferation assays on HUVEC cells, or in a corneal pocket assay, wound closure assays and other assays, known in the art.
- antibody fragments were derived via proteolytic digestion of intact antibodies. Alternatively, these fragments can be produced directly by recombinant host cells. Fab, Fv and ScFv antibody fragments can all be expressed in and secreted from E. coli, thus allowing the facile production of large amounts of these fragments. Antibody fragments can be isolated from the antibody phage libraries. Alternatively, Fab'-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab) 2 fragments (Carter et al., Bio/Technology 10:163-167 (1992)). According to another approach, F(ab') 2 fragments can be isolated directly from recombinant host cell culture.
- the antibody of choice is a single chain Fv fragment (scFv).
- Fv and scFv contain intact combining sites that are devoid of constant regions; thus, they are suitable for reduced nonspecific binding during in vivo use.
- scFv fusion proteins may be constructed to yield fusion of an effector protein at either the amino or the carboxy terminus of an scFv.
- the antibody fragment may also be a "linear antibody," e.g., as described in U.S. Pat. No. 5,641,870. Such linear antibody fragments may be monospecific or bispecif ⁇ c.
- Bispecific antibodies are antibodies that have binding specificities for at least two different epitopes. Exemplary bispecific antibodies may bind to two different epitopes of the Fnl4 protein. Other such antibodies may combine an Fnl4 binding site with a binding site for another protein.
- an anti-Fnl4 arm may be combined with an arm which binds to a triggering molecule on a leukocyte such as a T-cell receptor molecule (e.g., CD3), or Fc receptors for IgG (Fc-gamma-R), such as Fc-gamma-RI (CD64), Fc-gamma-RII (CD32) and Fc- gamma-RIII (CD 16), so as to focus and localize cellular defense mechanisms to the Fn 14- expressing cell.
- Bispecif ⁇ c antibodies may also be used to localize cytotoxic agents to cells which express Fnl4.
- bispecific antibodies possess an Fnl4-binding arm and an arm that binds the cytotoxic agent (e.g., saporin, anti-interferon-alpha, vinca alkaloid, ricin A chain, methotrexate, or a radioactive isotope hapten).
- cytotoxic agent e.g., saporin, anti-interferon-alpha, vinca alkaloid, ricin A chain, methotrexate, or a radioactive isotope hapten.
- Bispecific antibodies can be prepared as full length antibodies or antibody fragments (e.g., F(ab') 2 bispecific antibodies).
- the interface between a pair of antibody molecules can be engineered to maximize the percentage of heterodimers that are recovered from recombinant cell culture.
- the preferred interface comprises at least a part of the C H3 domain.
- one or more small amino acid side chains from the interface of the first antibody molecule are replaced with larger side chains (e.g., tyrosine or tryptophan).
- Compensatory "cavities" of identical or similar size to the large side chain(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones (e.g., alanine or threonine). This provides a mechanism for increasing the yield of the heterodimer over other unwanted end-products such as homodimers.
- Bispecific antibodies include cross-linked or "heteroconjugate" antibodies.
- one of the antibodies in the heteroconjugate can be coupled to avidin, the other to biotin.
- Heteroconjugate antibodies may be made using any convenient cross-linking methods.
- the "diabody” technology provides an alternative mechanism for making bispecific antibody fragments.
- the fragments comprise a V H connected to a V L by a linker which is too short to allow pairing between the two domains on the same chain. Accordingly, the V H and V L domains of one fragment are forced to pair with the complementary V L and V H domains of another fragment, thereby forming two antigen-binding sites.
- a multivalent antibody may be internalized (and/or catabolized) faster than a bivalent antibody by a cell expressing an antigen to which the antibodies bind.
- the antibodies describe herein can be multivalent antibodies with three or more antigen binding sites (e.g., tetravalent antibodies), which can be readily produced by recombinant expression of nucleic acid encoding the polypeptide chains of the antibody.
- the multivalent antibody can comprise a dimerization domain and three or more antigen binding sites.
- An exemplary dimerization domain comprises (or consists of) an Fc region or a hinge region.
- a multivalent antibody can comprise (or consist of) three to about eight (e.g., four) antigen binding sites.
- the multivalent antibody optionally comprises at least one polypeptide chain (e.g., at least two polypeptide chains), wherein the polypeptide chain(s) comprise two or more variable domains.
- the polypeptide chain(s) may comprise VDl-(Xl) n -VD2-(X2) n -Fc, wherein VDl is a first variable domain, VD2 is a second variable domain, Fc is a polypeptide chain of an Fc region, Xl and X2 represent an amino acid or peptide spacer, and n is 0 or 1.
- antibodies can be produced in bacterial cells, e.g., E. coli cells. Antibodies can also be produced in eukaryotic cells. In one embodiment, the antibodies (e.g., scFv's) are expressed in a yeast cell such as Pichia (see, e.g., Powers et al. (2001) J Immunol Methods. 251 : 123-35), Hanseula, or Saccharomyces.
- a yeast cell such as Pichia (see, e.g., Powers et al. (2001) J Immunol Methods. 251 : 123-35), Hanseula, or Saccharomyces.
- antibodies are produced in mammalian cells.
- exemplary mammalian host cells for expressing an antibody include Chinese Hamster Ovary (CHO cells) (including dhff CHO cells, described in Urlaub and Chasin (1980) Proc. Natl. Acad. Sci. USA 77:4216-4220, used with a DHFR selectable marker, e.g., as described in Kaufman and Sharp (1982) MoI. Biol. 159:601-621), lymphocytic cell lines, e.g., NSO myeloma cells and SP2 cells, COS cells, and a cell from a transgenic animal, e.g., a transgenic mammal.
- the cell is a mammary epithelial cell.
- the recombinant expression vectors may carry additional sequences, such as sequences that regulate replication of the vector in host cells (e.g., origins of replication) and selectable marker genes.
- the selectable marker gene facilitates selection of host cells into which the vector has been introduced (see e.g., U.S. Pat. Nos. 4,399,216, 4,634,665 and 5,179,017).
- the selectable marker gene confers resistance to drugs, such as G418, hygromycin, or methotrexate, on a host cell into which the vector has been introduced.
- a recombinant expression vector encoding both the antibody heavy chain and the antibody light chain is introduced into dhfr " CHO cells by calcium phosphate-mediated transfection.
- the antibody heavy and light chain genes are each operatively linked to enhancer/promoter regulatory elements (e.g., derived from SV40, CMV, adenovirus and the like, such as a CMV enhancer/AdMLP promoter regulatory element or an S V40 enhancer/AdMLP promoter regulatory element) to drive high levels of transcription of the genes.
- enhancer/promoter regulatory elements e.g., derived from SV40, CMV, adenovirus and the like, such as a CMV enhancer/AdMLP promoter regulatory element or an S V40 enhancer/AdMLP promoter regulatory element
- the recombinant expression vector also carries a DHFR gene, which allows for selection of CHO cells that have been transfected with the vector using methotrexate selection/amplification.
- the selected transformant host cells are cultured to allow for expression of the antibody heavy and light chains and the antibody is recovered from the culture medium.
- Standard molecular biology techniques are used to prepare the recombinant expression vector, transfect the host cells, select for transformants, culture the host cells and recover the antibody from the culture medium. For example, some antibodies can be isolated by affinity chromatography with a Protein A or Protein G coupled matrix.
- the antibody production system preferably synthesizes antibodies in which the Fc region is glycosylated.
- the Fc domain of IgG molecules is glycosylated at asparagine 297 in the CH2 domain.
- TMs asparagine is the site for modification with biantennary-type oligosaccharides. It has been demonstrated that this glycosylation is required for effector functions mediated by Fc ⁇ receptors and complement CIq (Burton and Woof (1992) Adv. Immunol. 51:1-84; Jefferis et al. (1998) Immunol. Rev. 163:59- 76).
- the Fc domain is produced in a mammalian expression system that appropriately glycosylates the residue corresponding to asparagine 297.
- the Fc domain or other region of the antibody can also include other eukaryotic post-translational modifications.
- Antibodies can also be produced by a transgenic animal.
- U.S. Pat. No. 5,849,992 describes a method of expressing an antibody in the mammary gland of a transgenic mammal.
- a transgene is constructed that includes a milk-specific promoter and nucleic acids encoding the antibody of interest and a signal sequence for secretion.
- the milk produced by females of such transgenic mammals includes, secreted-therein, the antibody of interest.
- the antibody can be purified from the milk, or for some applications, used directly. Animals are also provided comprising one or more of the nucleic acids described herein.
- the binding properties of an antibody may be measured by any standard method, e.g., one of the following methods: BIACORETM analysis, Enzyme Linked Immunosorbent Assay (ELISA), Fluorescence Resonance Energy Transfer (FRET), x-ray crystallography, sequence analysis and scanning mutagenesis.
- the antibody has a statistically significant effect that indicates that the antibody promotes one or more activities of Fnl4 (e.g., promotes FnH signaling).
- the binding interaction of a protein of interest and a target can be analyzed using SPR.
- SPR or Biomolecular Interaction Analysis (BIA) detects biospecific interactions in real time, without labeling any of the interactants. Changes in the mass at the binding surface (indicative of a binding event) of the BIA chip result in alterations of the refractive index of light near the surface (the optical phenomenon of surface plasmon resonance (SPR)). The changes in the refractivity generate a detectable signal, which are measured as an indication of real-time reactions between biological molecules.
- SPR Surface plasmon resonance
- Epitopes can also be directly mapped by assessing the ability of different antibodies to compete with each other for binding to Fnl4 (e.g., human Fnl4) using BIAcore chromatographic techniques (Pharmacia BIAtechnology Handbook, "Epitope Mapping", Section 6.3.2, (May 1994); see also Johne et al. (1993) J. Immunol. Methods, 160:191-198). Additional general guidance for evaluating antibodies, e.g., in Western blots and immunoprecipitation assays, can be found in Antibodies: A Laboratory Manual, ed. by Harlow and Lane, Cold Spring Harbor press (1988)).
- Anti-Fnl4 antibodies can be evaluated for their ability to increase or activate a downstream effect of Fnl4 signaling (e.g., increase or activate events downstream of FnI 4 engagement by a natural ligand (e.g., TWEAK)) or to mimic an effect caused by the binding of a natural ligand (e.g., TWEAK) to Fnl4.
- the mimicking can be the same degree or to a lesser or greater degree than the effect of natural ligand, as long as the same type of effect is caused.
- an antibody can be evaluated for the ability to induce or enhance cell killing of Fn-14 expressing cells (e.g., cancer cells such as WiDr colon cancer cells).
- Fn-14 expressing cells e.g., cancer cells such as WiDr colon cancer cells.
- an antibody is evaluated for the ability to induce or enhance IL-8 secretion in Fn-14 expressing cells (e.g., A375 cells), induces or increases NF-KB p52 and/or cell cycle inhibitor p21 Wafl/Cipl expression or protein levels.
- Antibodies having activities that are similar to those of mouse or humanized P4A8, e.g., wherein the same amount of antibody produces an effect that is at least about 50%, 75%, 80%, 90%, 95%, 97%, 98% or 99% the effect produced by the mouse or humanized P4A8, may be used for treating cancer as described herein.
- an anti-Fnl4 antibody that induces the production of an amount of IL-8 that is at least about 50% of that produced by P4A8; an antibody that induces cell killing at least 50% as efficacious as P4A8; and an antibody that induces NK-KB p52 or p21 expression to amounts that are at least about 50% of those produced by P4A8, respectively can be used for treating cancer.
- antibodies having activities that are stronger than those of P4A8 or other antibodies described herein are also encompassed herein.
- Hybridomas producing the monoclonal antibody 1.P4A8.3C7 (P4A8), the monoclonal antibody 1.P3G5.1E4 (P3G5), and the monoclonal antibody 1.P2D3.3D5 (P2D3) have been deposited with the American Type Culture Collection (ATCC) under the terms of the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purpose of Patent Procedure on April 7, 2009, and bear the accession numbers PTA-9947 (P4A8), PTA- 9949 (P3G5), and PTA-9948 (P2D3).
- ATCC American Type Culture Collection
- effector functions The interaction of antibodies and antibody-antigen complexes with cells of the immune system triggers a variety of responses, referred to herein as effector functions.
- IgG antibodies activate effector pathways of the immune system by binding to members of the family of cell surface Fc ⁇ receptors and to CIq of the complement system.
- Ligation of effector proteins by clustered antibodies triggers a variety of responses, including release of inflammatory cytokines, regulation of antigen production, endocytosis, and cell killing. In some clinical applications these responses are crucial for the efficacy of a monoclonal antibody. In others they provoke unwanted side effects such as inflammation and the elimination of antigen-bearing cells.
- the present invention further relates to Fnl4-binding proteins, including antibodies, with altered, e.g., reduced, effector functions.
- Effector function of an anti-Fnl4 antibody of the present invention may be determined using one of many known assays.
- the anti-Fnl4 antibody's effector function may be reduced relative to a second anti-Fnl4 antibody.
- the second anti-Fnl4 antibody may be any antibody that binds FnH specifically.
- the second Fnl4- specific antibody may be any of the antibodies of the invention, such as P4A8.
- the second anti-Fnl4 antibody may be the unmodified or parental version of the antibody.
- effector functions include Fc receptor binding, phagocytosis, apoptosis, pro- inflammatory responses, down-regulation of cell surface receptors (e.g. B cell receptor; BCR), etc.
- Other effector functions include antibody-dependent cell-mediated cytotoxicity (ADCC), whereby antibodies bind Fc receptors on cytotoxic T cells, natural killer (NK) cells, or macrophages leading to cell death, and complement-dependent cytotoxicity (CDC), which is cell death induced via activation of the complement cascade (reviewed in Daeron, Annu. Rev. Immunol. 15:203-234 (1997); Ward and Ghetie, Therapeutic Immunol. 2:77-94 (1995); and
- effector functions generally require the Fc region to be combined with a binding domain (e.g. an antibody variable domain) and can be assessed using standard assays that are known in the art (see, e.g., WO 05/018572, WO 05/003175, and U.S. 6,242,195). Effector functions can be avoided by using antibody fragments lacking the Fc domain such as Fab, Fab'2, or single chain Fv.
- Fab fragments lacking the Fc domain
- Fab'2 single chain Fv.
- An alternative has been to use the IgG4 subtype antibody, which binds to Fc ⁇ RI but which binds poorly to CIq and Fc ⁇ RII and RIII.
- the IgG2 subtype also has reduced binding to Fc receptors, but retains significant binding to the Hl 31 allotype of Fc ⁇ RIIa and to CIq. Thus, additional changes in the Fc sequence are required to eliminate binding to all the Fc receptors and to CIq.
- FcRs Fc receptors
- the affinity of an antibody for a particular FcR, and hence the effector activity mediated by the antibody, may be modulated by altering the amino acid sequence and/or post-translational modifications of the Fc and/or constant region of the antibody.
- FcRs are defined by their specificity for immunoglobulin isotypes; Fc receptors for IgG antibodies are referred to as Fc ⁇ R, for IgE as Fc ⁇ R, for IgA as Fc ⁇ R and so on.
- Fc ⁇ RI CD64
- Fc ⁇ RII CD32
- Fc ⁇ RIII CD 16
- Both Fc ⁇ RII and Fc ⁇ RIII have two types: Fc ⁇ RIIA (CD32) and Fc ⁇ RIIB (CD32); and Fc ⁇ RIIIA (CDl 6a) and Fc ⁇ RIIIB (CDl 6b).
- Fc ⁇ RII (CD32) includes the isoforms Ha 5 UbI, Ilb2 Ilb3, and Uc.
- the anti-Fnl4 antibodies of the present invention include modifications of one or more of the aforementioned residues.
- Fc variants having altered and/or reduced affinities for some or all Fc receptor subtypes (and thus for effector functions) are known in the art. See, e.g., US 2007/0224188; US 2007/0148171; US 2007/0048300; US 2007/0041966; US 2007/0009523; US 2007/0036799; US 2006/0275283; US 2006/0235208; US 2006/0193856; US 2006/0160996; US 2006/0134105; US 2006/0024298; US 2005/0244403; US 2005/0233382; US 2005/0215768; US 2005/0118174; US 2005/0054832;US 2004/0228856; US 2004/132101 ;US 2003/158389; see also US 7,183,387; 6,737,056; 6,538,124; 6,528,624; 6,194,551; 5,624,821; 5,648,260.
- the antibody-antigen complex binds complement, resulting in the activation of the complement cascade and generation of the membrane attack complex.
- Activation of the classical complement pathway is initiated by the binding of the first component of the complement system (CIq) to antibodies (of the appropriate subclass) which are bound to their cognate antigen; thus the activation of the complement cascade is regulated in part by the binding affinity of the immunoglobulin to CIq protein.
- CIq first component of the complement system
- To activate the complement cascade it is necessary for CIq to bind to at least two molecules of IgGl, IgG2, or IgG3, but only one molecule of IgM, attached to the antigenic target (Ward and Ghetie, Therapeutic Immunology 2:77-94 (1995) p. 80).
- a CDC assay e.g. as described in Gazzano-Santoro et al., J. Immunol. Methods 202:163 (1996), may be performed.
- one or more of these residues may be modified, substituted, or removed or one or more amino acid residues may be inserted so as to decrease CDC activity of the FnI 4 antibodies provided herein.
- it may be desirable to reduce or eliminate effector function(s) of the subject antibodies in order to reduce or eliminate the potential of further activating immune responses.
- Antibodies with decreased effector function may also reduce the risk of thromboembolic events in subjects receiving the antibodies.
- the present invention provides an anti-Fnl4 antibody that exhibits reduced binding to one or more FcR receptors but that maintains its ability to bind complement (e.g., to a similar or, in some embodiments, to a lesser extent than a native, non- variant, or parent anti-Fnl4 antibody).
- an anti-Fnl4 antibody of the present invention may bind and activate complement while exhibiting reduced binding to an FcR, such as, for example, Fc ⁇ RIIa (e.g., Fc ⁇ RIIa expressed on platelets).
- an antibody with reduced or no binding to Fc ⁇ RIIa (such as Fc ⁇ RIIa expressed on platelets, for example) but that can bind CIq and activate the complement cascade to at least some degree will reduce the risk of thromboembolic events while maintaining perhaps desirable effector functions.
- an anti-Fnl4 antibody of the present invention exhibits reduced binding to one or more FcRs but maintains its ability to bind one or more other FcRs.
- effector functions involving the constant region of an anti-Fnl4 antibody may be modulated by altering properties of the constant region, and the Fc region in particular.
- the anti-Fnl4 antibody having reduced effector function is compared with a second antibody with effector function and which may be a non- variant, native, or parent antibody comprising a native constant or Fc region that mediates effector function.
- effector function modulation includes situations in which an activity is abolished or completely absent.
- a native sequence Fc or constant region comprises an amino acid sequence identical to the amino acid sequence of a Fc or constant chain region found in nature.
- a control molecule used to assess relative effector function comprises the same type/subtype Fc region as does the test or variant antibody.
- a variant or altered Fc or constant region comprises an amino acid sequence which differs from that of a native sequence heavy chain region by virtue of at least one amino acid modification (such as, for example, post-translational modification, amino acid substitution, insertion, or deletion).
- the variant constant region may contain one or more amino acid substitutions, deletions, or insertions that results in altered post- translational modifications, including, for example, an altered glycosylation pattern.
- a parent antibody or Fc region is, for example, a variant having normal effector function used to construct a constant region (i.e., Fc) having altered, e.g., reduced, effector function.
- Antibodies with altered (e.g., reduced or eliminated) effector function(s) may be generated by engineering or producing antibodies with variant constant, Fc, or heavy chain regions.
- Recombinant DNA technology and/or cell culture and expression conditions may be used to produce antibodies with altered function and/or activity.
- recombinant DNA technology may be used to engineer one or more amino acid substitutions, deletions, or insertions in regions (such as, for example, Fc or constant regions) that affect antibody function including effector functions.
- changes in post-translational modifications such as, e.g. glycosylation patterns (see below), may be achieved by manipulating the host cell and cell culture and expression conditions by which the antibody is produced.
- Amino acid alterations can alter the effector function of the anti-Fnl4 antibodies of the present invention without affecting antigen binding affinity.
- the amino acid substitutions described above e.g., Glu318, Kys320, Lys332, Lys235, Gly237, K332, and P329), for example, may be used to generate antibodies with reduced effector function.
- amino acid substitutions may be made for one or more of the following amino acid residues: 234, 235, 236, 237, 297, 318, 320, and 322 of the heavy chain constant region (see US 5,624,821 and US 5,648,260). Such substitutions may alter effector function while retaining antigen binding activity.
- An alteration at one or more of amino acids 234, 235, 236, and 237 can decrease the binding affinity of the Fc region for Fc ⁇ RI receptor as compared to an unmodified or non- variant antibody.
- Amino acid residues 234, 236, and/or 237 may be substituted with alanine, for example, and amino acid residue 235 may be substituted with glutamine, for example.
- an anti-Fnl4 IgGl antibody may comprise a substitution of Leu at position 234 with Ala, a substitution of Leu at position 235 with GIu, and a substitution of GIy at position 237 with Ala.
- the Fc amino acid residues at 318, 320, and 322 may be altered. These amino acid residues, which are highly conserved in mouse and human IgGs, mediate complement binding. It has been shown that alteration of these amino acid residues reduces CIq binding but does not alter antigen binding, protein A binding, or the ability of the Fc to bind to mouse macrophages.
- an anti-Fnl4 antibody of the present invention is an IgG4 immunoglobulin comprising substitutions that reduce or eliminate effector function.
- the IgG4 Fc portion of an anti-Fnl4 antibody of the invention may comprise one or more of the following substitutions: substitution of proline for glutamate at residue 233, alanine or valine for phenylalanine at residue 234 and alanine or glutamate for leucine at residue 235 (EU numbering, Kabat, E. A. et al. (1991), supra).
- removing the N-linked glycosylation site in the IgG4 Fc region by substituting Ala for Asn at residue 297 may further reduce effector function and eliminate any residual effector activity that may exist.
- Another exemplary IgG4 mutant with reduced effector function is the IgG4 subtype variant containing the mutations S228P and L235E (PE mutation) in the heavy chain constant region. This mutation results in reduced effector function. See US 5,624,821 and US 5,648,260.
- Another exemplary mutation in the IgG4 context that reduces effector function is S228P/T229A, as described herein.
- anti- FnI 4 antibodies with mutations within the constant region including the Ala- Ala mutation may be used to reduce or abolish effector function.
- the constant region of an anti-Fnl4 antibody comprises a mutation to an alanine at position 234 or a mutation to an alanine at position 235.
- an anti-Fnl4 antibody comprises an IgG4 framework, wherein the Ala- Ala mutation would describe a mutation(s) from phenylalanine to alanine at position 234 and/or a mutation from leucine to alanine at position 235.
- the anti-Fnl4 antibody comprises an IgGl framework, wherein the Ala- Ala mutation would describe a mutation(s) from leucine to alanine at position 234 and/or a mutation from leucine to alanine at position 235.
- An anti-Fnl4 antibody may alternatively or additionally carry other mutations, including the point mutation K322A in the CH2 domain (Hezareh et al. 2001 J Virol. 75: 12161- 8).
- Other exemplary amino acid substitutions are provided in WO 94/29351 (which is incorporated herein by reference in its entirety), which recites antibodies having mutations in the N-terminal region of the CH2 domain that alter the ability of the antibodies to bind to FcRI, thereby decreasing the ability of antibodies to bind to CIq which in turn decreases the ability of the antibodies to fix complement.
- Cole et al. J Immunol.
- Site-directed mutagenesis is well known in the art (see, e.g., Carter et al. Nucleic Acids Res. 13:4431-4443 (1985) and Kunkel et al., Proc. Natl. Acad. Sci. USA 82:488 (1987)).
- PCR mutagenesis is also suitable for making amino acid sequence variants of the starting polypeptide. See Higuchi, in PCR Protocols, pp.177-183 (Academic Press, 1990); and Vallette et al., Nuc. Acids Res. 17:723-733 (1989). Another method for preparing sequence variants, cassette mutagenesis, is based on the technique described by Wells et al., Gene 34:315-323 (1985).
- Another embodiment of the present invention relates to an anti-Fnl4 antibody with reduced effector function in which the antibody's Fc region, or portions thereof, is swapped with an Fc region (or with portions thereof) having naturally reduced effector inducing activity.
- human IgG4 constant region exhibits reduced or no complement activation.
- the different IgG molecules differ in their binding affinity for FcR, which may be due at least in part to the varying length and flexibility of the IgGs' hinge regions (which decreases in the order IgG3>IgGl>IgG4>IgG2).
- IgG4 exhibits reduced or no binding to Fc ⁇ RIIa.
- the invention also relates to anti-Fnl4 antibodies with reduced effector function in which the Fc region is completely absent.
- Such antibodies may also be referred to as antibody derivatives and antigen-binding fragments of the present invention.
- Such derivatives and fragments may be fused to non-antibody protein sequences or non-protein structures, especially structures designed to facilitate delivery and/or bioavailability when administered to an animal, e.g., a human subject (see below).
- hinge region changes within the hinge region also affect effector functions. For example, deletion of the hinge region may reduce affinity for Fc receptors and may reduce complement activation (Klein et al. 1981 PNAS USA 78: 524-528).
- the present disclosure therefore also relates to antibodies with alterations in the hinge region.
- antibodies of the present invention may be modified to inhibit complement dependent cytotoxicity (CDC).
- Modulated CDC activity may be achieved by introducing one or more amino acid substitutions, insertions, or deletions in an Fc region of the antibody (see, e.g., US 6,194,551 and US 6,242,195).
- cysteine residue(s) may be introduced in the Fc region, thereby allowing interchain disulfide bond formation in this region.
- the homodimeric antibody thus generated may have improved or reduced internalization capability and/or increased or decreased complement-mediated cell killing. See Caron et al., J Exp Med. 176:1191-1195 (1992) and Shopes, B. J Immunol. 148:2918-2922 (1992), WO 99/51642, Duncan & Winter Nature 322: 738-40 (1988); US 5,648,260; US 5,624,821; and WO 94/29351.
- effector function may vary according to the binding affinity of the antibody.
- antibodies with high affinity may be more efficient hi activating the complement system compared to antibodies with relatively lower affinity (Marzocchi- Machado et al. 1999 Immunol Invest 28: 89-101).
- an antibody may be altered such that the binding affinity for its antigen is reduced (e.g., by changing the variable regions of the antibody by methods such as substitution, addition, or deletion of one or more amino acid residues).
- An antibody with reduced binding affinity may exhibit reduced effector functions, including, for example, reduced ADCC and/or CDC.
- Anti-Fnl4 antibodies of the present invention with reduced effector function include antibodies with reduced binding affinity for one or more Fc receptors (FcRs) relative to a parent or non-variant anti-Fnl4 antibody. Accordingly, anti-Fnl4 antibodies with reduced FcR binding affinity includes anti-Fnl4 antibodies that exhibit a 1.5-fold, 2-fold, 2.5-fold, 3-fold, 4-fold, or 5- fold or higher decrease in binding affinity to one or more Fc receptors compared to a parent or non-variant anti-Fnl4 antibody. In some embodiments, an anti-Fnl4 antibody with reduced effector function binds to an FcR with about 10-fold less affinity relative to a parent or non- variant antibody.
- an anti-Fnl4 antibody with reduced effector function binds to an FcR with about 15-fold less affinity or with about 20-fold less affinity relative to a parent or non- variant antibody.
- the FcR receptor may be one or more of Fc ⁇ RI (CD64), Fc ⁇ RII (CD32), and Fc ⁇ RIII, and isoforms thereof, and Fc ⁇ R, Fc ⁇ R, Fc ⁇ R, and/or an Fc ⁇ R.
- an anti-Fnl4 antibody with reduced effector function exhibits a 1.5-fold, 2-fold, 2.5-fold, 3-fold, 4-fold, or 5-fold or higher decrease in binding affinity to Fc ⁇ RIIa.
- an anti-Fnl4 antibody of the present invention exhibits reduced binding to a complement protein relative to a second anti-Fnl4 antibody.
- an anti-Fnl4 antibody of the invention exhibits reduced binding by a factor of about 1.5 -fold or more, about 2-fold or more, about 3 -fold or more, about 4-fold or more, about 5-fold or more, about 6-fold or more, about 7-fold or more, about 8-fold or more, about 9- fold or more, about 10-fold or more, or about 15-fold or more, relative to a second anti-Fnl4 antibody.
- an anti-Fnl4 antibody comprising one or more heavy chain CDR sequences selected from CDR-Hl of SEQ ID NO:2, CDR-H2 of SEQ ID NO:2 and CDR-H3 of SEQ ID NO:2, wherein the antibody further comprises a variant Fc region that confers reduced effector function compared to a native or parental Fc region.
- the anti-Fnl4 antibody comprises at least two of the CDRs, and in other embodiments the antibody comprises all three of the heavy chain CDR sequences.
- an anti-Fnl4 antibody comprising one or more light chain CDR sequences selected from CDR-Ll of SEQ ID NO:5, CDR-L2 of SEQ ID NO:5 and CDR-L3 of SEQ ID NO:5, the antibody further comprising a variant Fc region that confers reduced effector function compared to a native or parental Fc region.
- the anti-Fnl4 antibody comprises at least two of the light chain CDRs, and in other embodiments the antibody comprises all three of the light chain CDR sequences.
- the anti-Fnl4 antibody with reduced effector function comprises all three light chain CDR sequences of SEQ ID NO: 5 and comprises all three heavy chain CDR sequences of SEQ ID NO:2.
- the invention relates to an anti-Fnl4 antibody comprising a V L sequence of amino acids 1-111 of SEQ ID NO: 9, the antibody further comprising a variant Fc region that confers reduced effector function compared to a native or parental Fc region.
- the invention relates to an anti-Fnl4 antibody comprising a V H sequence of amino acids 1-121 of SEQ ID NO: 8, the antibody further comprising a variant Fc region that confers reduced effector function compared to a native or parental Fc region.
- Glycan removal produces a structural change that should greatly reduce binding to all members of the Fc receptor family across species.
- the glycans oligosaccharides
- the sugar residues making contact with specific amino acid residues on the opposing CH2 domain.
- Different glycosylation patterns are associated with different biological properties of antibodies (Jefferis and Lund, 1997, Chem. Immunol., 65: 111-128; Wright and Morrison, 1997, Trends Biotechnol, 15: 26-32). Certain specific glycoforms confer potentially advantageous biological properties.
- Loss of the glycans changes spacing between the domains and increases their mobility relative to each other and is expected to have an inhibitory effect on the binding of all members of the Fc receptor family.
- in vitro studies with various glycosylated antibodies have demonstrated that removal of the CH2 glycans alters the Fc structure such that antibody binding to Fc receptors and the complement protein ClQ are greatly reduced.
- Another known approach to reducing effector functions is to inhibit production of or remove the N-linked glycans at position 297 (EU numbering) in the CH2 domain of the Fc (Nose et al, 1983 PNAS 80: 6632; Leatherbarrow et al., 1985 MoI. Immunol. 22: 407; Tao et al., 1989 J.
- the oligosaccharide structure can affect properties relevant to protease resistance, the serum half-life of the antibody mediated by the FcRn receptor, phagocytosis and antibody feedback, in addition to effector functions of the antibody (e.g., binding to the complement complex Cl, which induces CDC, and binding to Fc ⁇ R receptors, which are responsible for modulating the ADCC pathway) (Nose and Wigzell, 1983; Leatherbarrow and Dwek, 1983; Leatherbarrow et al.,1985; Walker et al., 1989; Carter et al., 1992, PNAS, 89: 4285-4289).
- another means of modulating effector function of antibodies includes altering glycosylation of the antibody constant region.
- Altered glycosylation includes, for example, a decrease or increase in the number of glycosylated residues, a change in the pattern or location of glycosylated residues, as well as a change in sugar structure(s).
- the oligosaccharides found on human IgGs affects their degree of effector function (Raju, T. S. BioProcess International April 2003. 44-53); the microheterogeneity of human IgG oligosaccharides can affect biological functions such as CDC and ADCC, binding to various Fc receptors, and binding to CIq protein (Wright A. & Morrison SL.
- IgG IgG to bind CIq and activate the complement cascade may depend on the presence, absence or modification of the carbohydrate moiety positioned between the two CH2 domains (which is normally anchored at Asn297) (Ward and Ghetie, Therapeutic Immunology 2:77-94 (1995).
- Glycosylation sites in an Fc-containing polypeptide may be identified by standard techniques. The identification of the glycosylation site can be experimental or based on sequence analysis or modeling data. Consensus motifs, that is, the amino acid sequence recognized by various glycosyl transferases, have been described. For example, the consensus motif for an N-linked glycosylation motif is frequently NXT or NXS, where X can be any amino acid except proline. Several algorithms for locating a potential glycosylation motif have also been described.
- the sequence of the antibody is examined, for example, by using publicly available databases such as the website provided by the Center for Biological Sequence Analysis (see NetNGlyc services for predicting N-linked glycosylation sites and NetOGlyc services for predicting O-linked glycosylation sites).
- aglycosyl anti-CD8 antibody is incapable of depleting CD8-bearing cells in mice (Isaacs, 1992 J Immunol. 148: 3062) and an aglycosyl anti-CD3 antibody does not induce cytokine release syndrome in mice or humans (Boyd, 1995 supra; Friend, 1999
- the anti-Fnl4 antibodies of the present invention may be modified or altered to elicit reduced effector function(s) (compared to a second Fnl4-specific antibody) while optionally retaining the other valuable attributes of the Fc portion. Accordingly, in certain embodiments, the present invention relates to aglycosyl anti-Fnl4 antibodies with decreased effector function, which are characterized by a modification at the conserved N-lmked site in the CH2 domains of the Fc portion of the antibody. A modification of the conserved N-linked site in the CH2 domains of the Fc dimer can lead to aglycosyl anti-Fnl4 antibodies.
- an aglycosyl anti-Fnl4 antibody may be created by changing the canonical N-linked Asn site in the heavy chain CH2 domain to a GIn residue (see, for example, WO 05/03175 and US 2006-0193856).
- the modification comprises a mutation at the heavy chain glycosylation site to prevent glycosylation at the site.
- the aglycosyl anti-Fnl4 antibodies are prepared by mutation of the heavy chain glycosylation site, i.e. , mutation of N298Q (N297 using Kabat EU numbering) and expressed in an appropriate host cell.
- this mutation may be accomplished by following the manufacturer's recommended protocol for unique site mutagenesis kit from Amersham- Pharmacia Biotech® (Piscataway, NJ, USA).
- the mutated antibody can be stably expressed in a host cell (e. g. NSO or CHO cell) and then purified.
- purification can be carried out using Protein A and gel filtration chromatography. It will be apparent to those of skill in the art that additional methods of expression and purification may also be used.
- the aglycosyl anti-Fnl4 antibodies have decreased effector function, wherein the modification at the conserved N-linked site in the CH2 domains of the Fc portion of said antibody or antibody derivative comprises the removal of the CH2 domain glycans, i.e. , deglycosylation.
- These aglycosyl anti-Fnl4 antibodies may be generated by conventional methods and then deglycosylated enzymatically. Methods for enzymatic deglycosylation of antibodies are well known to those of skill in the art (Williams, 1973 ; Winkelhake & Nicolson, 1976 J. Biol Chem. 251 : 1074-80.).
- deglycosylation may be achieved by growing host cells which produce the antibodies in culture medium comprising a glycosylation inhibitor such as tunicamycin (Nose & Wigzell, 1983). That is, the modification is the reduction or prevention of glycosylation at the conserved N-linked site in the CH2 domains of the Fc portion of said antibody.
- a glycosylation inhibitor such as tunicamycin (Nose & Wigzell, 1983).
- recombinant X polypeptides may be used as an antigen to generate an anti-Fnl4 antibody or antibody derivatives, which may then be deglycosylated.
- agyclosyl anti-Fnl4 antibodies or anti-Fnl4 antibodies with reduced glycosylation of the present invention may be produced by the method described in Taylor et al. (WO 05/18572 and US 2007-0048300).
- an anti- Fnl4 aglycosyl antibody may be produced by altering a first amino acid residue (e.g., by substitution, insertion, deletion, or by chemical modification), wherein the altered first amino acid residue inhibits the glycosylation of a second residue by either steric hindrance or charge or both.
- the first amino acid residue is modified by amino acid substitution.
- the amino acid substitution is selected from the group consisting of GIy, Ala, VaI, Leu, He, Phe, Asn, GIn, Trp, Pro, Ser, Thr, Tyr, Cys, Met, Asp, GIu, Lys, Arg, and His.
- the amino acid substitution is a non-traditional amino acid residue.
- the second amino acid residue may be near or within a glycosylation motif, for example, anN-linked glycosylation motif that contains the amino acid sequence NXT or NXS.
- the first amino acid residue is amino acid 299 and the second amino acid residue is amino acid 297, according to the Kabat numbering.
- the first amino acid substitution may be T299A, T299N, T299G, T299Y, T299C, T299H, T299E, T299D, T299K, T299R, T299G, T299I, T299L, T299M, T299F, T299P, T299W, and T299V, according to the Kabat numbering.
- the amino acid substitution is T299C.
- Effector function may also be reduced by modifying an antibody of the present invention such that the antibody contains a blocking moiety.
- exemplary blocking moieties include moieties of sufficient steric bulk and/or charge such that reduced glycosylation occurs, for example, by blocking the ability of a glycosidase to glycosylate the polypeptide.
- the blocking moiety may additionally or alternatively reduce effector function, for example, by inhibiting the ability of the Fc region to bind a receptor or complement protein.
- the present invention relates to an Fnl4-binding protein, e.g., an anti-Fnl4 antibody, comprising a variant Fc region, the variant Fc region comprising a first amino acid residue and an N- glycosylation site, the first amino acid residue modified with side chain chemistry to achieve increased steric bulk or increased electrostatic charge compared to the unmodified first amino acid residue, thereby reducing the level of or otherwise altering glycosylation at the N- glycosylation site.
- the variant Fc region confers reduced effector function compared to a control, non- variant Fc region.
- the side chain with increased steric bulk is a side chain of an amino acid residue selected from the group consisting of Phe, Trp, His, GIu, GIn, Arg, Lys, Met and Tyr.
- the side chain chemistry with increased electrostatic charge is a side chain of an amino acid residue selected from the group consisting of Asp, GIu, Lys, Arg, and His.
- glycosylation and Fc binding can be modulated by substituting T299 with a charged side chain chemistry such as D, E, K, or R.
- the resulting antibody will have reduced glycosylation as well as reduced Fc binding affinity to an Fc receptor due to unfavorable electrostatic interactions.
- a T299C variant antibody which is both aglycosylated and capable of forming a cysteine adduct, may exhibit less effector function (e.g., Fc ⁇ RI binding) compared to its aglycosylated antibody counterpart (see, e.g., WO 05/18572).
- alteration of a first amino acid proximal to a glycosylation motif can inhibit the glycosylation of the antibody at a second amino acid residue; when the first amino acid is a cysteine residue, the antibody may exhibit even further reduced effector function.
- inhibition of glycosylation of an antibody of the IgG4 subtype may have a more profound affect on Fc ⁇ RI binding compared to the effects of agycosylation in the other subtypes.
- the present invention relates to anti-Fnl4 antibodies with altered glycosylation that exhibit reduced binding to one or more FcR receptors and that optionally also exhibit increased or normal binding to one or more Fc receptors and/or complement — e.g., antibodies with altered glycosylation that at least maintain the same or similar binding affinity to one or more Fc receptors and/or complement as a native, control anti- Fnl4 antibody).
- anti-Fnl4 antibodies with predominantly Man 5 GlcNAc 2 N-glycan as the glycan structure present may exhibit altered effector function compared to an anti-Fnl4 antibody population wherein Man 5 GlcNAc 2 N-glycan structure is not predominant.
- Antibodies with predominantly this glycan structure exhibit decreased binding to Fc ⁇ RIIa and Fc ⁇ RIIb, increased binding to Fc ⁇ RIIIa and Fc ⁇ RIIIb, and increased binding to CIq subunit of the Cl complex (see US 2006-0257399).
- This glycan structure when it is the predominant glycan structure, confers increased ADCC, increased CDC, increased serum half-life, increased antibody production of B cells, and decreased phagocytosis by macrophages.
- glycosylation structures on a glycoprotein will vary depending upon the expression host and culturing conditions (Raju, TS. BioProcess International April 2003. 44-53). Such differences can lead to changes in both effector function and pharmacokinetics (Israel et al. Immunology. 1996; 89(4):573-578; Newkirk et al. P. Clin. Exp. 1996; 106(2):259-64).
- galactosylation can vary with cell culture conditions, which may render some immunoglobulin compositions immunogenic depending on their specific galactose pattern (Patel et al., 1992. Biochem J. 285: 839-845).
- protein expression host systems may be engineered or selected to express a predominant Ig glycoform or alternatively may naturally produce glycoproteins having predominant glycan structures.
- engineered protein expression host systems producing a glycoprotein having a predominant glycoform include gene knockouts/mutations (Shields et al., 2002, JBC, 277: 26733-26740); genetic engineering in (Umana et al., 1999, Nature Biotech., 17: 176-180) or a combination of both.
- an anti-Fnl4 antibody or antibody composition having altered glycosylation can be obtained by one skilled in the art by selecting at least one of many expression host systems.
- Protein expression host systems that may be used to produce anti-Fnl4 antibodies of the present invention include animal, plant, insect, bacterial cells and the like. For example, US 2007- 0065909, 2007-0020725, and 2005-0170464 describe producing aglycosylated immunoglobulin molecules in bacterial cells.
- aglycosyl anti-Fnl4 antibodies with reduced effector function may be antibodies that comprise modifications or that may be conjugated to comprise a functional moiety.
- Such moieties include a blocking moiety (e.g., a PEG moiety, cysteine adducts, etc.), a detectable moiety (e.g., fluorescent moieties, radioisotopic moieties, radiopaque moieties, etc., including diagnostic moieties), a therapeutic moiety (e.g., cytotoxic agents, anti-inflammatory agents, immunomodulatory agents, anti-infective agents, anti-cancer agents, anti-neurodegenerative agents, radionuclides, etc.), and/or a binding moiety or bait (e.g., that allows the antibody to be pre-targeted to a tumor and then to bind a second molecule, composed of the complementary binding moiety or prey and a detectable moiety or therapeutic moeity, as described above).
- a blocking moiety e.g., a PEG moiety, cysteine adducts, etc.
- a detectable moiety e.g., fluorescent moieties, radiois
- An anti-Fnl4 antibody (such as an antibody described herein) can be used to treat a variety of disorders, such as an Fnl4-associated disorder.
- the antibody can be used to treat cancer, e.g., solid tumor cancers, in a patient.
- cancers e.g., solid tumor cancers
- cancers that can be treated with an anti-Fnl4 antibody include colon cancer and breast cancer.
- cancers that can be treated include: Anal, Bile duct, Bladder, Bone, secondary Bone, Bowel (colon & rectum; colorectal cancer), Brain, secondary Brain, Breast, secondary Breast, Cervix, Pediatric cancers, Endocrine, Eye, Gall bladder, Gastrointestinal (e.g., Gastric), Gullet (esophagus), Head & neck, Kaposi's sarcoma, Kidney, Larynx, Leukemia, acute lymphoblastic Leukemia, acute myeloid Leukemia, chronic lymphocytic Leukemia, chronic myeloid Leukemia, Liver, secondary Liver, Lung (e.g., NSCLC), secondary Lung, secondary Lymph nodes, Lymphoma, Hodgkin Lymphoma, non-Hodgkin Lymphoma, Melanoma, Mesothelioma, Myeloma, Neuroendocrine, Ovary, Esophageal, Pancreas (pancreas (
- Tumors that can be treated include those having Fnl4 expression, e.g., high Fnl4 expression, relative to the FnI 4 expression level on a normal adult cell.
- treating refers to administering a composition described herein in an amount, manner, and/or mode effective to improve a condition, symptom, or parameter associated with a disorder or to prevent progression or exacerbation of the disorder (including secondary damage caused by the disorder) to either a statistically significant degree or to a degree detectable to one skilled in the art.
- treatment of a patient that has a solid tumor with an anti-Fnl4 antibody described herein results in a reduction of the size of the solid tumor by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%.
- a subject who is at risk for, diagnosed with, or who has one of these disorders can be administered an anti-Fnl4 antibody in an amount and for a time to provide an overall therapeutic effect.
- the anti-Fnl4 antibody can be administered alone (monotherapy) or in combination with other agents (combination therapy).
- the amounts and times of administration can be those that provide, e.g., an additive or a synergistic therapeutic effect.
- the administration of the anti-Fnl4 antibody can be used as a primary, e.g., first line treatment, or as a secondary treatment, e.g., for subjects who have an inadequate response to a previously administered therapy (i.e., a therapy other than one with an anti-Fnl4 antibody).
- an anti-Fnl4 antibody can be used in combination with another chemotherapeutic agent.
- the combination therapy includes the use of two or more anti-Fnl4 antibodies, e.g., at least one of the anti-Fnl4 antibodies described herein in combination with another anti-Fnl4 antibody, e.g., two or more of the anti-Fnl4 antibodies described herein.
- a subject receiving an anti-Fnl4 antibody has Fnl4 expression on tumor cells, e.g., high Fnl4 expression relative to the level of expression of Fnl4 on normal adult cells.
- a subject receiving an anti-Fnl4 antibody is not a subject having no detectable Fnl4 level on the surface of its tumor cells.
- the level of Fnl4 on tumor cells may be measured by immunohistochemistry or FACS using, e.g., an antibody described herein.
- the therapy or treatment with which the anti-Fnl4 antibody therapy is combined does not significantly induce expression of Fn 14 on normal cells, such as to minimize unwanted potential toxicity effects.
- the second therapy or treatment induces FnI 4 levels on normal cells
- the an anti-Fnl4 antibody is administered after administration of the first therapy or treatment of the combination therapy, at a time when any increase in Fn 14 levels have essentially returned to normal.
- a subject that is treated with an FnI 4 antibody described herein, e.g., an Fnl4 agonist antibody is not a subject who has a disease that is or may be exacerbated by an Fn 14 agonist antibody.
- a subject that is treated with an Fnl4 antibody, e.g., an agonist antibody is not a subject having an autoimmune disease, rheumatoid arthritis, multiple sclerosis, stroke, fibrosis, a neurodegenerative disease,
- a subject receiving an anti-Fnl4 antibody is not a subject having or likely to develop an inflammatory or autoimmune disease, e.g., rheumatoid arthritis, intestinal bowel disease, lupus, Crohn's disease, multiple sclerosis, diabetes, psoriasis, acute graft versus host disease (GVHD), pancreatitis, delayed type hypersensitivity (DTH).
- an inflammatory or autoimmune disease e.g., rheumatoid arthritis, intestinal bowel disease, lupus, Crohn's disease, multiple sclerosis, diabetes, psoriasis, acute graft versus host disease (GVHD), pancreatitis, delayed type hypersensitivity (DTH).
- a subject receiving an anti-Fnl4 antibody has received or receives or will receive an anti-inflammatory treatment.
- a subject may be treated with an anti-inflammatory agent at the same time, before and/or after treatment with an anti- FnI 4 Ab.
- anti-inflammatory agents include methotrexate, a TNF-alpha blocking agent, a Tweak blocking agent, a disease modifying anti-rheumatic drug (DMARD), nonsteroidal anti-inflammatory drugs such as salicylates (Aspirin), a gold compound, Hydroxychloroquine, penicillamine, steroids, and immunosuppressive drugs.
- a method comprises determining the level of Fn 14 expressed on tumor cells of a subject, and then, if the level is higher than that on normal cells, e.g., normal cells of the same type or lineage as the cancer cells, treating the subject with an anti-Fnl4 antibody, and if the level is lower than that on normal cells, e.g., normal cells of the same type or lineage as the cancer cells or if there is no detectable level of Fn 14, not treating the subject with an anti-Fnl4 antibody.
- a method comprises determining whether FnI 4 is expressed (at a minimum threshold level) on tumor cells of a subj ect, and then, if FnI 4 expression is detected (at the minimum threshold level), treating the subject with an anti-Fnl4 antibody, and if Fn 14 expression is not detected (at the minimum threshold level), not treating the subject with an anti- Fn 14 antibody.
- an Fn 14 antibody may be useful in treating a disease in which Fnl4 expression is not detected.
- An anti-Fnl4 antibody can be used to treat a subject diagnosed as having or as being at risk for cancer, e.g., colon cancer or breast cancer.
- the cancer can be primary, secondary or metastatic.
- An anti-Fnl4 antibody (such as an antibody described herein) can be used to treat cancer or reduce the risk of cancer occurrence, alone or hi combination with another cancer therapy, such as a standard of care therapy.
- an anti-Fnl4 antibody can be used in combination with Gemcitabine (e.g., for the treatment of pancreatic cancer), taxol or trastuzumab (e.g., for the treatment of breast cancer),
- Irinotecan bevacizumab, 5-fluorouracil, or cetuximab (e.g., for the treatment of colon cancer), or trastuzumab (e.g., for the treatment of gastric cancer).
- Other cancer treatments include surgery, chemotherapy, radiation therapy, immunotherapy, and monoclonal antibody therapy.
- An FnI 4 antibody can be used in combination with any of these treatment modalities. The choice of therapy depends upon the location and grade of the tumor and the stage of the disease, as well as the general state of the patient.
- cancers can be cured if entirely removed by surgery, but this is not always possible. When the cancer has metastasized to other sites in the body prior to surgery, complete surgical excision is usually impossible. In one model of cancer progression, tumors grow locally, then spread to the lymph nodes, then to the rest of the body. This has given rise to the popularity of local-only treatments such as surgery for small cancers. Even small localized tumors are increasingly recognized as possessing metastatic potential.
- Examples of surgical procedures for cancer include mastectomy for breast cancer and prostatectomy for prostate cancer.
- the goal of the surgery can be either the removal of only the tumor, or the entire organ.
- a single cancer cell is invisible to the naked eye but can re-grow into a new tumor.
- Staging is a major determinant of prognosis and of the need for adjuvant therapy.
- An anti-Fnl4 antibody can be used in combination with surgery, before, during, and/or after surgery.
- the antibody can be administered locally at the site of surgery, e.g., on the tissue in and/or surrounding the area from which a tumor was excised, or as therapy after a patient who has undergone surgery is recovering.
- Radiation therapy Radiation therapy (also called radiotherapy, X-ray therapy, or irradiation) is the use of ionizing radiation to kill cancer cells and shrink tumors.
- Radiation therapy can be administered externally via external beam radiotherapy (EBRT) or internally via brachytherapy.
- EBRT external beam radiotherapy
- the effects of radiation therapy are localized and confined to the region being treated.
- Radiation therapy injures or destroys cells in the area being treated (the "target tissue").
- the goal of radiation therapy is to damage as many cancer cells as possible, while limiting harm to nearby healthy tissue. Hence, it is given in many fractions, allowing healthy tissue to recover between fractions.
- Radiation therapy may be used to treat almost every type of solid tumor, including cancers of the brain, breast, cervix, larynx, lung, pancreas, prostate, skin, stomach, uterus, or soft tissue sarcomas. Radiation is also used to treat leukemia and lymphoma. Radiation dose to each site depends on a number of factors, including the radiosensitivity of each cancer type and whether there are tissues and organs nearby that may be damaged by radiation.
- An anti-Fnl4 antibody can be used in combination with radiation therapy e.g.,, before, during, and/or after radiation therapy.
- the antibody can be administered locally at a site that was/is being/will be irradiated.
- Chemotherapy is the treatment of cancer with drugs that can destroy cancer cells. "Chemotherapy” usually refers to cytotoxic drugs which affect rapidly dividing cells in general, in contrast with targeted therapy. Chemotherapy drugs interfere with cell division in various possible ways, e.g., with the duplication of DNA or the separation of newly formed chromosomes. Most forms of chemotherapy target all rapidly dividing cells and are not specific for cancer cells, although some degree of specificity may come from the inability of many cancer cells to repair DNA damage, while normal cells generally can.
- chemotherapeutic agents used in cancer therapy include: Amsacrine, Bleomycin, Busulfan, Capecitabine, Carboplatin, Carmustine, Chlorambucil, Cisplatin, Cladribine, Clofarabine, Crisantaspase, Cyclophosphamide, Cytarabine, dacarbazine, Dactinomycin, Daunorubicin, Docetaxel, Doxorubicin, Epirubicin, Etoposide, Fludarabine, 5 Fluorouracil (5FU), Gemcitabine, Gliadel implants, Hydroxycarbamide, Idarubicin, Ifosfamide, Irinotecan, Leucovorin, Liposomal doxorubicin, Liposomal daunorubicin, Lomustine, Melphalan, Mercaptopurine, Mesna, Methotrexate, Mitomycin, Mitoxantrone, Oxaliplatin, Paclitaxel, Pemetrexed, Pento
- an anti-Fnl4 antibody can be used in combination with chemotherapy (e.g., with one or more chemotherapeutics), e.g., before, during, or after the use of the chemotherapeutic agent(s).
- Targeted therapy constitutes the use of agents specific for the deregulated proteins or other identified molecules of cancer cells.
- Small molecule targeted therapy drugs are generally inhibitors of enzymatic domains on mutated, overexpressed, or otherwise critical proteins within the cancer cell. Prominent examples are the tyrosine kinase inhibitors imatinib and gefitinib.
- Monoclonal antibody therapy is another strategy in which the therapeutic agent is an antibody which specifically binds to a protein on the surface of the cancer cells. Examples include anti-Fnl4 antibodies, the anti-HER2/neu antibody trastuzumab (HERCEPTIN®) typically used in breast cancer, and the anti-CD20 antibody rituximab, typically used in a variety of B-cell malignancies.
- Targeted therapy can also involve small peptides as "homing devices” which can bind to cell surface receptors or affected extracellular matrix surrounding the tumor. Radionuclides which are attached to this peptides (e.g., RGDs) eventually kill the cancer cell if the nuclide decays in the vicinity of the cell.
- RGDs Radionuclides which are attached to this peptides
- An anti-Fnl4 antibody can be used in combination with another targeted therapy, e.g., a targeted therapy described herein, e.g., before, during, or after the use of the targeted therapy.
- Photodynamic therapy is a ternary treatment for cancer involving a photosensitizer, tissue oxygen, and light (often using lasers). PDT can be used as treatment, e.g., for basal cell carcinoma (BCC) or lung cancer; PDT can also be useful in removing traces of malignant tissue after surgical removal of large tumors.
- An anti-Fnl4 antibody can be used in combination with photodynamic therapy, e.g., before, during, or after the use of the photodynamic therapy.
- Immunotherapy Cancer immunotherapy refers to a diverse set of therapeutic strategies designed to induce the patient's own immune system to fight the tumor. Contemporary methods for generating an immune response against tumors include intravesical BCG immunotherapy for superficial bladder cancer, and use of interferons (e.g., interferon-gamma) and other cytokines to induce an immune response, e.g., in renal cell carcinoma and melanoma patients.
- Allogeneic hematopoietic stem cell transplantation can be considered a form of immunotherapy, since the donor's immune cells will often attack the tumor in a graft- versus- tumor effect.
- An anti-Fnl4 antibody can be used in combination with an immunotherapy described herein, e.g., before, during, or after the use of the other immunotherapy.
- Hormonal therapy The growth of some cancers can be inhibited by providing or blocking certain hormones.
- hormone-sensitive tumors include certain types of breast and prostate cancers. Removing or blocking estrogen or testosterone is often an important additional treatment.
- administration of hormone agonists, such as progestogens may be therapeutically beneficial.
- An anti-Fnl4 antibody can be used in combination with a hormonal therapy described herein, e.g., before, during, or after the use of the hormonal therapy.
- Colon cancer is cancer that starts in the large intestine (colon) or the rectum (end of the colon). Such cancer is sometimes referred to as "colorectal cancer.” The most common type is colon carcinoma. Other types of colon cancer such as lymphoma, carcinoid tumors, melanoma, and sarcomas are rare. Causes: According to the American Cancer Society, colorectal cancer is one of the leading causes of cancer-related deaths in the United States. There is no single cause for colon cancer. N early all colon cancers begin as benign polyps, which slowly develop into cancer.
- a higher risk for colon cancer exists if a patient has: colorectal polyps, cancer elsewhere in the body, a family history of colon cancer, ulcerative colitis, Crohn's disease, personal history of breast cancer, and/or certain genetic syndromes also increase the risk of developing colon cancer.
- colon cancer Many cases of colon cancer have no symptoms. The following symptoms, however, may indicate colon cancer: diarrhea, constipation, or other change in bowel habits, blood in the stool, unexplained anemia, abdominal pain and tenderness in the lower abdomen, intestinal obstruction, weight loss with no known reason, and narrow stools. With proper screening, colon cancer can be detected before the development of symptoms, when it is most curable.
- Stage 0 Very early cancer on the innermost layer of the intestine; stage I: cancer is in the inner layers of the colon; stage II: cancer has spread through the muscle wall of the colon; stage III: cancer has spread to the lymph nodes; stage IV: cancer that has spread to other organs.
- Treatment depends partly on the stage of the cancer.
- treatments may include: chemotherapy medicines to kill cancer cells, surgery to remove cancer cells, and/or radiation therapy to destroy cancerous tissue.
- an anti-Fnl4 antibody described herein can be used to treat colon cancer, alone or in combination with another treatment described herein.
- Stage 0 colon cancer may be treated by removing the cancer cells, often during a colonoscopy.
- an anti-Fnl4 antibody described herein can be used to treat stage 0 colon cancer, alone or in combination with another treatment described herein (e.g., surgery or chemotherapy).
- stages I, II, and III cancer more extensive surgery is needed to remove the part of the colon that is cancerous.
- an anti-Fnl4 antibody described herein can be used to treat stage I, II, or III colon cancer, alone or in combination with another treatment described herein(e.g., surgery, chemotherapy, or radiotherapy). Almost all patients with stage III colon cancer should receive chemotherapy after surgery for approximately 6 - 8 months.
- 5-fluorouracil is an example of a chemotherapeutic used to treat stage III colon cancer.
- Chemotherapy is also used to treat patients with stage IV colon cancer. Irinotecan, oxaliplatin, and 5-fluorouracil are the three most commonly used drugs. Capecitabine is also used.
- an anti-Fnl4 antibody described herein can be used to treat stage IV colon cancer, alone or in combination with another treatment described herein(e.g., surgery, chemotherapy, or radiotherapy).
- various treatments directed specifically at the liver can be used. This may include cutting out the cancer, ablation, or cryotherapy. Chemotherapy or radiation can sometimes be delivered directly into the liver.
- an anti-Fnl4 antibody described herein can be used to treat colon cancer that has metastasized to the liver or other location in the body alone or in combination with another treatment described herein(e.g., surgery, chemotherapy, or radiotherapy). While radiation therapy is occasionally used in patients with colon cancer, it is usually used in combination with chemotherapy for patients with stage III rectal cancer.
- an anti-Fnl4 antibody described herein can be used to treat stage IV colon cancer, e.g., in combination with radiation therapy.
- stage of the cancer how well a patient does depends on many things, including the stage of the cancer. In general, when treated at an early stage, more than 90% of patients survive at least 5 years after their diagnosis. However, only about 39% of colorectal cancer is found at an early stage. The 5-year survival rate drops considerably once the cancer has spread. If the patient's colon cancer does not recur within 5 years, it is considered cured. Stage I, II, and III cancers are considered potentially curable. In most cases, stage IV cancer is not curable.
- Complications include metastasis, recurrence of carcinoma within the colon, development of a second primary colorectal cancer.
- Colon cancer can almost always be caught in its earliest and most curable stages by colonoscopy. Almost all men and women age 50 and older should have a colonoscopy. Dietary and lifestyle modifications are important. Some evidence suggests that low-fat and high- fiber diets may reduce your risk of colon cancer.
- An anti-Fn-14 antibody can be used to reduce the risk of or prevent the development of colon cancer, e.g., in a patient identified as being at risk for colon cancer.
- Breast cancer is a cancer that starts in the tissues of the breast.
- the two main types of breast cancer are ductal carcinoma and lobular carcinoma. In rare cases, breast cancer can start in other areas of the breast.
- Many breast cancers are estrogen- sensitive (estrogen receptor positive cancer or ER positive cancer).
- Some breast cancers are HER2- positive.
- Risk factors include:
- Age and gender ⁇ Risk of developing breast cancer increases with age. The majority of advanced breast cancer cases are found in women over age 50. Women are 100 times more likely to get breast cancer then men.
- Menstrual cycle Women who get their periods early (before age 12) or went through menopause late (after age 55) have an increased risk for breast cancer. Alcohol use — Drinking more than 1-2 glasses of alcohol a day may increase the risk for breast cancer.
- DES Diethylstilbestrol
- HRT Hormone replacement therapy
- Obesity has been linked to breast cancer, although this link is controversial. Radiation — Radiation therapy received as a child or young adult to treat cancer of the chest area increases the risk of developing breast cancer.
- Symptoms Early breast cancer usually does not cause symptoms. As the cancer grows, symptoms may include: breast lump or lump in the armpit that is hard, has uneven edges, and usually does not hurt; change in the size, shape, or feel of the breast or nipple ⁇ for example, redness, dimpling, or puckering; fluid coming from the nipple — may be bloody, clear-to-yellow, or green, and look like pus. In men, symptoms of breast cancer include breast lump, breast pain and tenderness.
- Symptoms of advanced breast cancer may include: bone pain, breast pain or discomfort, skin ulcers, swelling of one arm (next to breast with cancer), and weight loss.
- Exams and Tests A doctor will ask about symptoms and risk factors, and perform a physical exam, which includes both breasts, armpits, and the neck and chest area. Additional tests may include: mammography, breast MRI, breast ultrasound, breast biopsy, needle aspiration, or breast lump removal to remove all or part of the breast lump for closer examination. If a patient has breast cancer, additional tests are done to see if the cancer has spread, e.g., staging, to help guide future treatment.
- Breast cancer stages range from O to IV.
- breast cancer may be in situ (noninvasive) breast cancer or invasive breast cancer. The higher the number, the more advanced the cancer.
- Treatment is based on many factors, including type and stage of the cancer, whether the cancer is sensitive to certain hormones, and whether or not the cancer overproduces (overexpresses) a gene called HER2/neu.
- cancer treatments may include: chemotherapy, radiation therapy, surgery to remove cancerous tissue - a lumpectomy removes the breast lump; mastectomy removes all or part of the breast and possible nearby structures.
- an anti-Fnl4 antibody described herein can be used to treat breast cancer, alone or in combination with another treatment described herein.
- Other treatments include: hormonal therapy and targeted therapy.
- hormonal therapy is the drug tamoxifen. This drug blocks the effects of estrogen, which can help breast cancer cells survive and grow. Most women with estrogen sensitive breast cancer benefit from this drug.
- aromatase inhibitors such as exemestane (Aromasin)
- exemestane exemestane
- Targeted therapy uses special anti-cancer drugs that identify certain changes in a cell that can lead to cancer.
- One such drug is trastuzumab (HERCEPTIN®).
- HERCEPTIN® trastuzumab
- HERCEPTIN® plus chemotherapy has been shown to be work better than chemotherapy alone.
- An anti-Fnl4 antibody described herein can be used to treat in combination with HERCEPTIN® (alone or with chemotherapy).
- Cancer treatment may be local or systemic. Radiation and surgery are forms of local treatment. Chemotherapy is a type of systemic treatment. Most women receive a combination of treatments. For women with stage I, II, or III breast cancer, the main goal is to treat the cancer and prevent it from returning. For women with stage IV cancer, the goal is to improve symptoms and help them live longer. In most cases, stage IV breast cancer cannot be cured. An anti-Fnl4 antibody described herein can be used, alone or in combination with another treatment described herein, to treat stage 0, 1, II, III, or IV breast cancer.
- Stage 0 Lumpectomy plus radiation or mastectomy is the standard treatment.
- Stage I and II Lumpectomy plus radiation or mastectomy with some sort of lymph node removal is standard treatment. Hormone therapy, chemotherapy, and biologic therapy may also be recommended following surgery.
- Stage III Treatment involves surgery possibly followed by chemotherapy, hormone therapy, and biologic therapy.
- Stage IV Treatment may involve surgery, radiation, chemotherapy, hormonal therapy, or a combination of such treatments.
- the 5-year survival rates for persons with breast cancer that is appropriately treated are as follows: 100% for stage 0
- Breast cancer can spread to other parts of the body. Sometimes, cancer returns even after the entire tumor is removed and nearby lymph nodes are found to be cancer-free. Side effects or complications from cancer treatment are possible. For example, radiation therapy may cause temporary swelling of the breast, and aches and pains around the area.
- BSE breast self-exams
- clinical breast exams by a medical professional
- screening mammography screening mammography
- An anti-Fnl4 antibody (such as an antibody described herein) can be formulated as a pharmaceutical composition for administration to a subject, e.g., to treat a disorder described herein.
- a pharmaceutical composition includes a pharmaceutically acceptable carrier.
- composition includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
- the composition can include a pharmaceutically acceptable salt, e.g., an acid addition salt or a base addition salt (see e.g., Berge, S.M., et ah (1977) J. Pharm. ScL 66:1-19).
- Pharmaceutical formulation is a well-established art, and is further described, e.g., in
- Gennaro ed.
- Remington The Science and Practice of Pharmacy, 20 th ed., Lippincott, Williams & Wilkins (2000) (ISBN: 0683306472); Ansel et al., Pharmaceutical Dosage Forms and Drug Delivery Systems, 7 th Ed., Lippincott Williams & Wilkins Publishers (1999) (ISBN: 0683305727); and Kibbe (ed.), Handbook of Pharmaceutical Excipients American Pharmaceutical Association, 3 rd ed. (2000) (ISBN: 091733096X).
- compositions may be in a variety of forms. These include, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, tablets, pills, powders, liposomes and suppositories.
- liquid solutions e.g., injectable and infusible solutions
- dispersions or suspensions tablets, pills, powders, liposomes and suppositories.
- the preferred form can depend on the intended mode of administration and therapeutic application.
- compositions for the agents described herein are hi the form of injectable or infusible solutions.
- the anti-Fnl4 antibody is formulated with excipient materials, such as sodium chloride, sodium dibasic phosphate heptahydrate, sodium monobasic phosphate, and a stabilizer. It can be provided, for example, in a buffered solution at a suitable concentration and can be stored at 2-8°C.
- excipient materials such as sodium chloride, sodium dibasic phosphate heptahydrate, sodium monobasic phosphate, and a stabilizer. It can be provided, for example, in a buffered solution at a suitable concentration and can be stored at 2-8°C.
- compositions can be administered by a parenteral mode (e.g., intravenous, subcutaneous, intraperitoneal, or intramuscular injection).
- parenteral administration e.g., intravenous, subcutaneous, intraperitoneal, or intramuscular injection.
- parenteral administration e.g., intravenous, subcutaneous, intraperitoneal, or intramuscular injection.
- parenteral administration e.g., intravenous, subcutaneous, intraperitoneal, or intramuscular injection.
- parenteral administration e.g., intravenous, subcutaneous, intraperitoneal, or intramuscular injection.
- the composition can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable for stable storage at high concentration.
- Sterile injectable solutions can be prepared by incorporating an agent described herein in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating an agent described herein into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
- the preferred methods of preparation are vacuum drying and freeze drying that yield a powder of an agent described herein plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- the proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
- the anti-Fnl4 antibody may be prepared with a carrier that will protect the compound against rapid release, such as a controlled release formulation, including implants, and microencapsulated delivery systems.
- Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J.R. Robinson, ed., Marcel Dekker, Inc., New York (1978).
- an anti-Fnl4 antibody can be modified, e.g., with a moiety that improves its stabilization and/or retention in circulation, e.g., in blood, serum, or other tissues, e.g., by at least 1.5, 2, 5, 10, or 50 fold.
- the anti-Fnl4 antibody can be associated with (e.g., conjugated to) a polymer, e.g., a substantially non-antigenic polymer, such as a polyalkylene oxide or a polyethylene oxide.
- Suitable polymers will vary substantially by weight. Polymers having molecular number average weights ranging from about 200 to about 35,000 Daltons (or about 1,000 to about 15,000, and 2,000 to about 12,500) can be used.
- the anti-Fnl4 antibody can be conjugated to a water soluble polymer, e.g., a hydrophilic polyvinyl polymer, e.g., polyvinylalcohol or polyvinylpyrrolidone.
- a water soluble polymer e.g., a hydrophilic polyvinyl polymer, e.g., polyvinylalcohol or polyvinylpyrrolidone.
- polymers include polyalkylene oxide homopolymers such as polyethylene glycol (PEG) or polypropylene glycols, polyoxyethylenated polyols, copolymers thereof and block copolymers thereof, provided that the water solubility of the block copolymers is maintained.
- Additional useful polymers include polyoxyalkylenes such as polyoxyethylene, polyoxypropylene, and block copolymers of polyoxyethylene and polyoxypropylene; polymethacrylates; carbomers; and branched or unbranched polysaccharides.
- the anti-Fnl4 antibody can also be coupled to or otherwise associated with a label or other agent, e.g., another therapeutic agent such as a cytotoxic or cytostatic agent, although, in many embodiments, this configuration is unnecessary.
- cytotoxic and chemotherapeutic agents include taxol, cytochalasin B, gramicidin D, vinblastine, doxorubicin, daunorubicin, a maytansinoid (e.g., maytansinol or the DMl maytansinoid, a sulfhydryl-containing derivative of maytansine), mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, taxane, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof.
- a maytansinoid e.g., maytansinol or the DMl maytansinoid, a sulfhydryl-containing derivative of maytansine
- mitoxantrone mithramycin
- actinomycin D 1-dehydrotestosterone
- the two agents can be formulated separately or together.
- the agents can be formulated or otherwise used in a synergistically effective amount. It is also possible to use one or both of the agents in amounts less than would be used for mono-therapy.
- the respective pharmaceutical compositions can be mixed, e.g., just prior to administration, and administered together or can be administered separately, e.g., at the same or different times.
- the agent may be any type of compound (e.g., small organic or inorganic molecule, nucleic acid, protein, or peptide mimetic) that can be administered to a subject.
- the agent is a biologic, e.g., a protein having a molecular weight of between 5-300 kDa.
- an Fn 14 agonist agent may activate events downstream of FnI 4 engagement.
- Exemplary FnI 4 agonist agents, other than agonist antibodies that bind to FnI 4 include TWEAK and soluble forms of TWEAK (see e.g., U.S. Patent No. 7,109,298).
- TWEAK soluble forms of TWEAK
- Such agents can be administered as part of a combination therapy with one or more antibodies described herein.
- Other therapeutic agents described herein can also be provided as a pharmaceutical composition, e.g., by standard methods or method described herein.
- the anti-Fnl4 antibody can be administered to a subject, e.g., a subject in need thereof, for example, a human subject, by a variety of methods.
- the route of administration is one of: intravenous injection or infusion (IV), subcutaneous injection (SC), intraperitoneally (IP), or intramuscular injection. It is also possible to use intra-articular delivery.
- Other modes of parenteral administration can also be used. Examples of such modes include: intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, transtracheal, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, and epidural and intrasternal injection.
- administration may be directly to a site of a cancer, e.g., into and/or adjacent to a tumor.
- administration can be oral.
- the route and/or mode of administration of the antibody can also be tailored for the individual case, e.g., by monitoring the subject, e.g., using tomographic imaging, e.g., to visualize a tumor.
- the antibody can be administered as a fixed dose, or in a mg/kg dose.
- the dose can also be chosen to reduce or avoid production of antibodies against the anti-Fnl4 antibody.
- Dosage regimens are adjusted to provide the desired response, e.g., a therapeutic response or a combinatorial therapeutic effect.
- doses of the anti-Fnl4 antibody (and optionally a second agent) can be used hi order to provide a subject with the agent in bioavailable quantities.
- doses in the range of 0.1-100 mg/kg, 0.5-100 mg/kg, 1 mg/kg -100 mg/kg, 0.5-20 mg/kg, 0.1-10 mg/kg, or 1-10 mg/kg can be administered.
- Other doses can also be used.
- a composition may comprise about 10 to 100 mg/ml or about 50 to 100 mg/ml or about
- the anti-Fnl4 antibody in a composition is predominantly in monomeric form, e.g., at least about 90%, 92%, 94%, 96%, 98%, 98.5% or 99% in monomeric form.
- Certain anti-Fnl4 antibody compositions may comprise less than about 5, 4, 3, 2, 1, 0.5, 0.3 or 0.1% aggregates, as detected, e.g., by UV at A280 nm.
- Certain anti-Fnl4 antibody compositions comprise less than about 5, 4, 3, 2, 1, 0.5, 0.3, 0.2 or 0.1% fragments, as detected, e.g., by UV at A280 nm.
- Dosage unit form or "fixed dose” as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier and optionally in association with the other agent. Single or multiple dosages may be given. Alternatively, or in addition, the antibody may be administered via continuous infusion.
- An anti-Fnl4 antibody dose can be administered, e.g., at a periodic interval over a period of time (a course of treatment) sufficient to encompass at least 2 doses, 3 doses, 5 doses, 10 doses, or more, e.g., once or twice daily, or about one to four times per week, or preferably weekly, biweekly (every two weeks), every three weeks, monthly, e.g., for between about 1 to 12 weeks, preferably between 2 to 8 weeks, more preferably between about 3 to 7 weeks, and even more preferably for about 4, 5, or 6 weeks.
- Factors that may influence the dosage and timing required to effectively treat a subject include, e.g., the severity of the disease or disorder, formulation, route of delivery, previous treatments, the general health and/or age of the subject, and other diseases present.
- treatment of a subject with a therapeutically effective amount of a compound can include a single treatment or, preferably, can include a series of treatments. Animal models can also be used to determine a useful dose, e.g., an initial dose or a regimen.
- the antibody can be administered before the full onset of the cancer or disorder, e.g., as a preventative measure.
- the duration of such preventative treatment can be a single dosage of the antibody or the treatment may continue (e.g., multiple dosages).
- a subject at risk for the disorder or who has a predisposition for the disorder may be treated with the antibody for days, weeks, months, or even years so as to prevent the disorder from occurring or fuhninating.
- a pharmaceutical composition may include a "therapeutically effective amount" of an agent described herein. Such effective amounts can be determined based on the effect of the administered agent, or the combinatorial effect of agents if more than one agent is used.
- a therapeutically effective amount of an agent may also vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the compound to elicit a desired response in the individual, e.g., amelioration of at least one disorder parameter or amelioration of at least one symptom of the disorder.
- a therapeutically effective amount is also one in which any toxic or detrimental effects of the composition are outweighed by the therapeutically beneficial effects.
- compositions that include the anti-Fnl4 antibody can be administered with a medical device.
- the device can designed with features such as portability, room temperature storage, and ease of use so that it can be used in emergency situations, e.g., by an untrained subject or by emergency personnel in the field, removed from medical facilities and other medical equipment.
- the device can include, e.g., one or more housings for storing pharmaceutical preparations that include anti-Fnl4 antibody, and can be configured to deliver one or more unit doses of the antibody.
- the device can be further configured to administer a second agent, e.g., a chemo therapeutic agent, either as a single pharmaceutical composition that also includes the anti-Fnl4 antibody or as two separate pharmaceutical compositions.
- the pharmaceutical composition may be administered with a syringe.
- the pharmaceutical composition can also be administered with a needleless hypodermic injection device, such as the devices disclosed in US 5,399,163; 5,383,851; 5,312,335; 5,064,413;
- implants and modules include: US 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; US 4,486,194, which discloses a therapeutic device for administering medicaments through the skin; US 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; US 4,447,224, which discloses a variable flow implantable infusion apparatus for continuous drug delivery; US 4,439,196, which discloses an osmotic drug delivery system having multi-chamber compartments; and US 4,475,196, which discloses an osmotic drug delivery system.
- kits can be provided in a kit.
- the kit includes (a) a container that contains a composition that includes anti-Fnl4 antibody, and optionally (b) informational material.
- the informational material can be descriptive, instructional, marketing or other material that relates to the methods described herein and/or the use of the agents for therapeutic benefit.
- the kit also includes a second agent for treating a disorder described herein, e.g., a chemotherapeutic agent.
- the kit includes a first container that contains a composition that includes the anti-Fnl4 antibody, and a second container that includes the second agent.
- the informational material of the kits is not limited in its form.
- the informational material can include information about production of the compound, molecular weight of the compound, concentration, date of expiration, batch or production site information, and so forth.
- the informational material relates to methods of administering the anti-Fnl4 antibody, e.g., in a suitable dose, dosage form, or mode of administration (e.g., a dose, dosage form, or mode of administration described herein), to treat a subject who has had or who is at risk for a cancer, or other disorder described herein.
- the information can be provided in a variety of formats, include printed text, computer readable material, video recording, or audio recording, or information that provides a link or address to substantive material, e.g., on the internet.
- the composition in the kit can include other ingredients, such as a solvent or buffer, a stabilizer, or a preservative.
- the antibody can be provided in any form, e.g., liquid, dried or lyophilized form, preferably substantially pure and/or sterile.
- the liquid solution preferably is an aqueous solution.
- the agents are provided as a dried form, reconstitution generally is by the addition of a suitable solvent.
- the solvent e.g., sterile water or buffer, can optionally be provided in the kit.
- the kit can include one or more containers for the composition or compositions containing the agents. In some embodiments, the kit contains separate containers, dividers or compartments for the composition and informational material.
- the composition can be contained in a bottle, vial, or syringe, and the informational material can be contained in a plastic sleeve or packet.
- the separate elements of the kit are contained within a single, undivided container.
- the composition is contained in a bottle, vial or syringe that has attached thereto the informational material in the form of a label.
- the kit includes a plurality (e.g., a pack) of individual containers, each containing one or more unit dosage forms (e.g., a dosage form described herein) of the agents.
- the containers can include a combination unit dosage, e.g., a unit that includes both the anti-Fnl4 antibody and the second agent, e.g., in a desired ratio.
- the kit includes a plurality of syringes, ampules, foil packets, blister packs, or medical devices, e.g., each containing a single combination unit dose.
- the containers of the kits can be air tight, waterproof (e.g., impermeable to changes in moisture or evaporation), and/or light-tight.
- the kit optionally includes a device suitable for administration of the composition, e.g., a syringe or other suitable delivery device.
- a device suitable for administration of the composition e.g., a syringe or other suitable delivery device.
- the device can be provided pre-loaded with one or both of the agents or can be empty, but suitable for loading.
- the anti-Fnl4 antibodies described herein can be used to target a pay load to a Fn 14- expressing cell or to a tissue or other structure associated with FnI 4.
- the antibodies can be attached to a virus or virus like particle that can deliver an exogenous gene (e.g., for gene therapy) or to a liposome, e.g., a liposome that encapsulates a therapeutic agent or exogenous gene.
- An exemplary method for using an antibody to target a virus is described in Roux et al. (1989) Proc Natl Acad Sci USA (1989) 86:9079-9083. See also, e.g., Curr Gene Ther. (2005) 5:63-70 and Hum Gene Ther. (2004) 15:1034-1044.
- the anti-Fnl4 antibodies of this invention may also be attached to liposomes containing a therapeutic agent such as a chemotherapeutic agent. Attachment of antibodies to liposomes may be accomplished by any known cross-linking agent such as heterobifunctional cross-linking agents that have been widely used to couple toxins or chemotherapeutic agents to antibodies for targeted delivery. For example, conjugation to liposomes can be accomplished using the carbohydrate-directed cross-linking reagent 4-(4-maleimidophenyl) butyric acid hydrazide (MPBH) (Duzgunes et al. (1992) J Cell. Biochem. Abst. Suppl. 16E 77).
- MPBH 4-(4-maleimidophenyl) butyric acid hydrazide
- Liposomes containing antibodies can also be prepared by well-known methods (See, e.g. DE 3,218,121; Epstein et al. (1985) Proc. Natl. Acad. Sci. USA, 82:3688-92 ; Hwang et al. (1980) Proc. Natl. Acad. Sci. USA, 77:4030-34; U.S. 4,485,045 and 4,544,545).
- Anti-Fnl4 antibodies can be used in a diagnostic method for detecting the presence of
- Fnl4 in vitro (e.g., a biological sample, such as tissue, biopsy) or in vivo (e.g., in vivo imaging in a subject).
- human or effectively human anti-Fnl4 antibodies can be administered to a subject to detect Fn 14 within the subject.
- the antibody can be labeled, e.g., with an MRI detectable label or a radiolabel.
- the subject can be evaluated using a means for detecting the detectable label.
- the subject can be scanned to evaluate localization of the antibody within the subject.
- the subject is imaged, e.g., by NMR or other tomographic means.
- labels useful for diagnostic imaging include radiolabels such as 131 1, 111 In, 123 1, 99m Tc, 32 P, 33 P, 125 I 5 3 H, 14 C, and 188 Rh, fluorescent labels such as fluorescein and rhodamine, nuclear magnetic resonance active labels, positron emitting isotopes detectable by a positron emission tomography (“PET") scanner, chemiluminescers such as luciferin, and enzymatic markers such as peroxidase or phosphatase.
- Short-range radiation emitters such as isotopes detectable by short-range detector probes, can also be employed.
- the protein ligand can be labeled with such reagents using known techniques.
- the subject can be "imaged" in vivo using known techniques such as radionuclear scanning using e.g., a gamma camera or emission tomography. See e.g., A.R. Bradwell et ah, "Developments in Antibody Imaging", Monoclonal Antibodies for Cancer Detection and Therapy, R. W. Baldwin et al., (eds.), pp 65-85 (Academic Press 1985).
- a positron emission transaxial tomography scanner such as designated Pet VI located at Brookhaven National Laboratory, can be used where the radiolabel emits positrons (e.g., 11 C, 18 F, 15 O, and 13 N).
- Magnetic Resonance Imaging uses NMR to visualize internal features of living subject, and is useful for prognosis, diagnosis, treatment, and surgery. MRI can be used without radioactive tracer compounds for obvious benefit.
- Some MRI techniques are summarized in EPO 502 814 A.
- the differences related to relaxation time constants Tl and T2 of water protons in different environments is used to generate an image. However, these differences can be insufficient to provide sharp high resolution images.
- the differences in these relaxation time constants can be enhanced by contrast agents. Examples of such contrast agents include a number of magnetic agents, paramagnetic agents
- Chelates e.g., EDTA, DTPA and NTA chelates
- Some paramagnetic substances e.g., Fe 3+ , Mn 2+ , Gd 3+
- Other agents can be in the form of particles, e.g., less than 10 ⁇ m to about 10 nm in diameter).
- Particles can have ferromagnetic, anti-ferromagnetic or superparamagnetic properties.
- Particles can include, e.g., magnetite (Fe 3 O 4 ), ⁇ -Fe 2 O 3 , ferrites, and other magnetic mineral compounds of transition elements.
- Magnetic particles may include one or more magnetic crystals with and without nonmagnetic material.
- the nonmagnetic material can include synthetic or natural polymers (such as sepharose, dextran, dextrin, starch and the like).
- the anti-Fnl4 antibodies can also be labeled with an indicating group containing the
- NMR-active 19 F atom or a plurality of such atoms inasmuch as (i) substantially all of naturally abundant fluorine atoms are the 19 F isotope and, thus, substantially all fluorine-containing compounds are NMR-active; (ii) many chemically active polyfluorinated compounds such as trifluoracetic anhydride are commercially available at relatively low cost, and (iii) many fluorinated compounds have been found medically acceptable for use in humans such as the perfluorinated polyethers utilized to carry oxygen as hemoglobin replacements. After permitting such time for incubation, a whole body MRI is carried out using an apparatus such as one of those described by Pykett (1982) Scientific American, 246:78-88 to locate and image Fnl4 distribution.
- the disclosure provides a method for detecting the presence of Fnl4 in a sample in vitro (e.g., a biological sample, such as serum, plasma, tissue, biopsy).
- a sample in vitro e.g., a biological sample, such as serum, plasma, tissue, biopsy.
- the subject method can be used to diagnose a disorder, e.g., a cancer.
- the method includes: (i) contacting the sample or a control sample with the anti-Fnl4 antibody; and (ii) evaluating the sample for the presence of Fnl4, e.g., by detecting formation of a complex between the anti-Fnl4 antibody and FnI 4, or by detecting the presence of the antibody or FnI 4.
- the antibody can be immobilized, e.g., on a support, and retention of the antigen on the support is detected, and/or vice versa.
- a control sample can be included.
- a statistically significant change in the formation of the complex in the sample relative to the control sample can be indicative of the presence of Fnl4 in the sample.
- an anti-Fnl4 antibody can be used in applications that include fluorescence polarization, microscopy, ELISA, centrifugation, chromatography, and cell sorting (e.g., fluorescence activated cell sorting).
- Anti-Fnl4 antibodies P4A8, P3G5, P2D3, and P3D8 were raised in Fnl4-def ⁇ cient mice by administration of CHO cells expressing human surface FnI 4 and boosted with Fnl4-myc-His protein. This immunization strategy appeared necessary as earlier immunization strategies were unsuccessful.
- the antibodies bind to both human and cynomolgus Fn 14 proteins in vitro.
- An alignment of the human (top) and cynomolgus (bottom) Fn 14 proteins is as follows:
- P4A8 properties include the following: monovalent binding affinity of about 1.6 or 2 nM; EC 50 for in vitro efficacy to trigger apoptosis of tumor cells is 170 pM; species cross-reactivity to human, cyno, rat and mouse Fnl4; ability to induce tumor cell killing in vitro; efficacious in tumor xenograft models in vivo; induces NF-kB signaling and caspase-3/7 induction in vitro and in vivo; half-life in mice of 2 days; half-life in rats of > 5 days; and does not bind to other TNF family member receptors.
- Widr colon cancer cells were treated with increasing concentrations of an anti-Fnl4 antibody (P2D3, P4A8, P3G5, or P3D8), a positive control agonist (Fc-TWEAK), or a negative control (MOPC21), each in combination with IFN- ⁇ .
- Cell death was measured by decreased viability as scored by an MTT assay.
- the antibodies P2D3, P4A8, P3G5, and P3D8 as well as Fc-TWEAK were able to kill the tumor cells (FIG. 1).
- the EC50 of P4A8 in the WiDr MTT assay is about 30 ng/ml.
- WiDr cells were treated with the P4A8 antibody or a positive control (Fc-TWEAK), each in combination with IFN- ⁇ , or were left untreated. Both the P4A8 antibody and Fc-TWEAK were able to kill the tumor cells (FIGS. 2A and 2B).
- Anti-Fnl4 antibodies were tested for their ability to kill MDA-MB231 breast cancer cells in vitro.
- the cancer cells were treated with increasing concentrations of the antibody P2D3, P4A8, P3G5, or P3D8, or a positive control agonist (Fc-TWEAK), each in combination with IFN- ⁇ .
- Cell death was measured by decreased viability as scored by an MTT assay.
- the MDA- MB231 cells were resistant to the anti-Fnl4 antibodies in vitro (FIG. 3).
- P4A8 was rapidly internalized into all cells tested. The appearance of internal granules varied from small and numerous (WiDr) to large and few (MDA-MB231). In addition, P4A8 treatment of cells caused an induction or stabilization of FnI 4 itself. This phenomenon was not due to an increase in FnI 4 mRNA.
- the P2D3, P4A8, P3G5, and P3D8 antibodies were tested to assess their ability to induce interleukin 8 (IL-8) secretion in vitro.
- A375 cells were treated with increasing concentrations of MOPC21 negative control, hFcTWEAK positive control, or P2D3, P4A8, P3G5, or P3D8 antibody.
- the levels of IL-8 secreted into the culture medium at each concentration was measured.
- Example 4 Treatment of Tumors in vivo
- WiDr colon cancer cell xenografts were implanted into mice. After tumor implantation, the animals were treated with an anti-Fnl4 antibody (P2D3, P4A8, P3G5, or P3D8), a negative control (PBS, MOPC21 or P 1.17), or a positive control (Fc-TWEAK). The doses used, the routes of administration, and the frequency of administration are shown in FIG. 5. Tumor growth was measured by tumor volume (mm 3 , top panel) or tumor weight (grams, bottom panel). The anti-Fnl4 antibodies were efficacious hi treating tumors in vivo (FIG. 5).
- the anti-Fnl4 antibodies and controls were also tested for toxicity. No obvious toxicities were observed with any of the treatments even after repeated doses, as measured by animal weight (FIG. 6).
- the ability of the anti-Fnl4 antibodies to treat cancer in vivo was tested in large tumors. Widr colon cancer cell xenografts were implanted into mice. After tumor implantation, the animals were treated with an anti-Fnl4 antibody (P4A8; 100 ⁇ g) or a negative control (PBS or MOPC21). Antibody was administered once a week and continued throughout the study, or dosing began on day 16 and ended early (day 37), or dosing began late (day 37) and ran through the end of the study. Tumor growth was measured by tumor volume (mm 3 ). The anti-Fnl4 antibodies were efficacious in treating tumors in vivo, even when treatment started late or was terminated early (FIG. 7).
- FnI 4 antibody and PBS negative control were tested (tumor volume (mm 3 ) over time (days)). Efficacy increased with increasing doses of antibody (FIG. 8).
- the dose response was also analyzed as a percent of test/control (%T/C). As shown in
- FIG. 9 efficacy increased with increasing doses of antibody.
- the various doses of the antibody and the controls were also tested for toxicity. No obvious toxicities were observed with any of the treatments even after repeated doses, as measured by percent body weight change (FIG. 10).
- Example 7 Treatment of Breast Cancer Cell Tumors in vivo
- MDA-MB231 breast cancer cell xenografts were implanted into mice. After tumor implantation, the animals were treated with an anti-Fnl4 antibody (P2D3 or P4A8) or a negative control (PBS or MOPC21). The doses used, the routes of administration, and the frequency of administration are shown in
- FIG. 11 Tumor growth was measured by tumor volume (mm 3 ).
- the anti-Fnl4 antibodies were efficacious in treating tumors in vivo (FIG. 11).
- Example 8 Antibody Cross Reactivity Anti-Fnl4 antibodies P4A8 and P2D3 are cross reactive to FnI 4 from multiple species.
- both antibodies react with human, cynomolgus, and murine FnI 4, as determined by flow cytometry (mean fluorescence value, MFI).
- EC50 values are also provided in the figure.
- P4A8 was also cross-reactive with rat Fnl4.
- Rhesus monkey Fnl4 was cloned and determined to be identical to human FnI 4. Therefore, the binding characteristics of the antibodies to rhesus monkey FnI 4 are the same as those to human FnI 4.
- FnI 4 cDNAs encoding human (NM_016639), cynomolgus (see Example 1), mouse (NM_013749), rat (NM_181086) and Xenopus (NM OO 1090171) Fnl4 were engineered to remove extraneous 5' and 3' UTRs and add an identical optimized Kozak sequence, then were subcloned into pNEOOl, a fully sequence-confirmed pUC-based EBV expression vector derived from the Invitrogen expression vector pCEP4, in which heterologous gene expression is controlled by a CMV-IE promoter and an SV40 polyadenylation signal, but lacking the EBNA gene and the hygromycin resistance gene.
- Fnl4 expression vectors (human: pEAG2121, cynomolgus monkey: pEAG2120, mouse: pEAG2126, rat: pEAG2275 and Xenopus: pEAG2237) were co-transfected into 293E cells at a 1:1 molar ratio with an EBV expression vector carrying an EGFP reporter. Cells were used in FACS at 2 days post-transfection, staining with monoclonal antibodies of interest (with dilution titration) and gating on green EGFP- positive living cells. This type of assay depends upon the cell surface density of FnI 4 and therefore reflects apparent EC50 values for a given transfection: this direct binding assay does not determine true Kd values.
- FIG. 16 shows direct binding FACS assay of the panel of anti-huFnl4 mAbs P2D3, P3D8, P3G5 and P4A8 to human and cynomolgus monkey surface Fnl4: all bind with similar EC50 values.
- FIG. 17 shows direct binding FACS assay of the panel of anti-huFnl4 mAbs P2D3, P3D8, P3G5 and P4A8 to murine surface Fnl4: all bind with similar apparent EC50 values that are similar to those for primate Fnl4 binding.
- Humanized P4A8 (Hl/Ll) (huP4A8) (described below) binds to human FnI 4 with an affinity equivalent to that of authentic murine P4A8 mAb.
- FIG. 19A shows that although P4A8 binds well to human, cynomolgus monkey and mouse surface FnI 4, no binding to Xenopus FnI 4 can be detected.
- FIG. 20 is a gapped alignment of the Fnl4 ectodomain (residues E28 to P80 to in human Fnl4).
- W42A mutants were constructed in the EBV expression vectors for full-length human, cyno, and mouse Fnl4 cDNAs by site-directed mutagenesis using Stratagene's QuikChange II kit following the manufacturer's recommended protocol. Mutated plasmids were identified by screening for introduced restriction site changes.
- the FnI 4 cDNA sequences in the resultant plasmids were confirmed by DNA sequencing in the W42A mutant expression vectors: human FnI 4 W42A designated pEAG2251 , murine W42A designated pEAG2250, and cyno W42A designated pEAG2249. Wildtype huFnl4 and W42A mutants in human, cyno, and murine Fnl4 were over-expressed transiently in 293E cells and binding of Fc-TWEAK or P4A8 mAb assayed in FACS assay as previously described.
- FIG. 21 A shows that Fc-TWEAK binds to all W42A mutants, while FIG.
- FIG. 21B shows that P4A8 binding is abrogated by mutation to W42A in all species examined. We performed site-directed mutagenesis on the huFnl4 expression plasmid pEAG2121 to generate other point mutants for additional epitope mapping studies.
- FIG. 22 shows that P4 A8 binding is restored to normal when residue W42 is mutated to large hydrophobic residues W42F or W42Y (pYL373 and pYL374, respectively).
- a panel of huFnl4 point mutants was made by substituting Xenopus residues into the human sequence at a number positions by site-directed mutagenesis on the pEAG2121 template (EBV expression vector for huFnl4): pYL391 T33Q, pYL392 S40R, ⁇ YL393 L65Q, pYL396 M50A, pYL397 R56K, pYL398 R56P (a more drastic substitution than the Xenopus change) and pYL399 H60K.
- Direct binding FACS assays showed that the entire mutant panel bound Fc- TWEAK (FIG. 23A).
- Immunol. .170:341) were tested in direct binding FACS assay on human, cynomolgus monkey, rat, and mouse Fnl4 and on the entire huFnl4 mutant panel (W42A, T33Q, S40R, L65Q, M50A, R56K, R56P and H60K).
- P4A8 binding to the mutant panel is shown in FIG. 23B
- P3G5 results are shown in FIG. 23C
- P2D3 results are shown in FIG. 23D
- ITEM-I results are shown FIG. 23E
- ITEM-4 results are shown in FIG. 23F
- ITEM-2 results are shown in FIG. 23G
- ITEM- 3 results are shown in FIG. 23H.
- Example 10 Immunohistochemistry The anti-Fnl4 antibody P4A8 was tested for use as an immunohistochemistry (IHC) reagent to detect Fnl4 in sections of paraffin tissue sections. Paraffin sections were obtained for normal pancreatic tissue and pancreatic tumor tissue. P4A8 was able to stain FnI 4 in the paraffin sections and the results demonstrated that FnI 4 is overexpressed in pancreatic tumors as compared to normal tissue. P4A8 was also used to measure FnI 4 levels in normal tissue. Human tissue arrays
- amino acid sequence of the VH domain of the P4A8 antibody is:
- amino acid sequence of the VH domain of the P3G5 antibody is:
- amino acid sequence of the VH domain of the P2D3 antibody is:
- the amino acid sequence of the VL domain of the P4A8 antibody is: DIVLTOSPASLAVSLGORATISCRASKSVSTSSYSYMHWYOOKPGOPPKLLIKYASNLES GVPARFSGSGSGTDFILNIHPVEEEDAATYYCQHSRELPFTFGSGTKLEIK (SEQ ID N0:5).
- the DNA sequence (SEQ ID NO:20) encoding the VL domain of P4A8 is depicted in Fig. 14D.
- the amino acid sequence of the VL domain of the P3G5 antibody is: DIVLTQSP ASLAVSLGORATISCRANKSVSTSSYSYMHWYOQKPGOPPKLLIKYASNLES GVPARFSGSGSGTDFILNIHPVEEEDAATYYCQHSRELPFTFGSGTKLEIK (SEQ ID N0:6).
- the DNA sequence (SEQ ID N0:21) encoding the VL domain of P3G5 is depicted in Fig. 14E.
- the amino acid sequence of the VL domain of the P2D3 antibody is: DIVLTQSP ASLAVSLGORATISCRASKSVSTSSYSYMHWYOOKPGOPPKLLIKYTSNLES GVPARFSGSGSGTDFILNIHP VEEEDAATYYCQHSRELPWTFGGGTKLEIKfSEO ID N0:7).
- the DNA sequence (SEQ ID NO:22) encoding the VL domain of P2D3 is depicted in Fig. 14F.
- CDR-H 1/CDR-H2/CDR-H3 and CDR-L 1/CDR-L2/CDR-L3 are underlined for each of the variable domain sequences depicted above.
- P3D8 has VH and VL domains that are identical to those of P2D3.
- P3G5 1 QVQLQQSGPEVVRPGVSVKISCKGSGYTFTDYGIHWKQSHAKSIJEWIGV 50
- P4A8 101 YGNLYYAMDYWGQGTSVTVSS 121 (SEQ ID NO : 2 )
- P2D3 100 RGPDYYG.. YYPMDYWGQGTSVTVSS 123 (SEQ ID NO:4)
- CDR-Hl left
- CDR-H2 center
- CDR-H3 right
- P4A8 1 DIVLTQSPASLAVSLGQRATISCRASKSVSTSSYSYMHWYQQKPGQPPKL 50
- P3G5 1 DIVLTQSPASLAVSLGQRATISCRANKSVSTSSYSYMHWYQQKPGQPPKL 50
- P2D3 1 DIVLTQSPASLAVSLGQRATISCRASKSVSTSSYSYMHWYQQKPGQPPKL 50
- P2D3 101 TFGGGTKLEIK 111 (SEQ ID NO:7)
- CDR-Ll left
- CDR-L2 center
- CDR-L3 right
- Example 12 Chimeric Antibodies cDNAs encoding the murine P4A8 variable regions of the heavy and light chains were used to construct vectors for expression of murine-human chimeras (chP4A8) in which the muP4A8 variable regions were linked to human IgGl and kappa constant regions.
- Expression vectors (chP4A8 heavy chain vector pXW362 and chP4A8 light chain vector pXW364) were co-transfected into 293 -EBNA cells and transfected cells were tested for antibody secretion and specificity (empty vector- and a molecularly cloned irrelevant mAb vector-transfected cells served as controls). Western blot analysis (developed with anti-human heavy and light chain antibodies) of conditioned medium indicated that chP4A8-transfected cells synthesized and efficiently secreted heavy and light chains. Direct FACS binding to human FnI 4 confirmed the specificity of chP4A8. Expression vectors for stable expression of chP4A8 in CHO cells were constructed.
- a stable CHO cell line secreting chP4A8-huIgGl, kappa mAb was derived by co-transfection with the vectors encoding the light and the heavy chains.
- the binding affinity of chP4A8 was demonstrated to be equivalent to that of the murine P4A8 mAb by direct binding to surface expressed human Fnl4 by dilution titration FACS assay.
- Example 13 Humanized Antibodies Examples of two humanized P4A8 (huP4A8) heavy chains (germline huVHl-18 framework / consensus HUMVHl FR4 / P4A8H CDRs) are depicted below (the amino acid and DNA sequences are shown for each; CDRs are underlined and backmutations are shown in bold):
- a stable CHO expression vector for the Hl huP4A8-huIgGl heavy chain, pYL310 was constructed.
- the sequence of the Hl huP4A8-huIgGl heavy chain cDNA insert of pYL310 (from the signal sequence's initiator ATG through the terminator TGA) is shown below:
- pYL310 The deduced mature huP4A8-IgGl Hl heavy chain protein sequence encoded by pYL310 is shown below:
- pYL320 The deduced mature huP4A8-IgGl H2 heavy chain protein sequence encoded by pYL320 is shown below:
- a stable CHO expression vector for the full-length version L2 huP4A8-kappa light chain, pYL317, cDNA was also constructed.
- the sequence of the huP4A8 L2 kappa light chain cDNA insert of pYL317 (from the signal sequence's initiator ATG through the terminator TAG) is shown below:
- the deduced mature huP4A8 L2 kappa light chain protein sequence encoded by pYL317 is shown below:
- the sequence of the huP4A8 Ll kappa light chain cDNA insert of pYL321 (from the signal sequence's initiator ATG through the terminator TAG) is shown below:
- the deduced mature huP4A8 Ll kappa light chain protein sequence encoded by pYL321 is shown below: 1 DIVLTQSPAS LAVSLGQRAT ISCRASKSVS TSSYSYMHWY QQKPGQPPKL
- the sequence of the huP4A8 L3 kappa light chain cDNA insert of pYL322 (from the signal sequence's initiator ATG through the terminator TAG) is shown below:
- the deduced mature huP4A8 L3 kappa light chain protein sequence encoded by pYL322 is shown below:
- FIG. 24 shows that all versions of huP4A8 expressed transiently had equivalent bioactivities to chP4A8 as assayed by FACS dilution titration direct binding to surface human Fnl4 transiently overexpressed in 293E cells.
- FIG. 25 shows that all six versions of huP4A8 retained Fn 14 binding affinities essentially equivalent to chP4A8 assayed by competition ELISA (binding to huFnl4-huFc fusion protein coated onto the wells of a 96 well plate, competing with binding by a constant amount of biotinylated murine P4A8).
- a stable CHO cell line secreting huP4A8-huIgGl , kappa (Hl/Ll) mAb was derived by co-transfection withpYL310 and pYL321. This antibody has a glycosylation at Asn301 (natural glycosylation site in CH2 domain of IgGl) in the mature sequence of the heavy chain. Asn301 corresponds to Asn297 in the Kabat EU numbering scheme (see Kabat et al., 1991,
- the mature sequence of the heavy chain (SEQ ID NO:8) is depicted below, with residues S228P and T299A underlined and in bold (the VH domain corresponds to residues 1-121; the IgG4 constant domain corresponds to residues 122-447):
- This protein is encoded by the following nucleotide sequence:
- the mature sequence of the huP4A8 kappa light chain (SEQ ID NO:9) of the antibody is as follows (the VL domain corresponds to residues 1-111):
- a T299A aglycosylated huP4A8-huIgGl heavy chain can also be used in combination with the light chain of SEQ ID NO:9.
- the mature sequence of the T299A aglycosylated huP4A8-huIgGl heavy chain (SEQ ID NO: 16), with residue T299A underlined and in bold, is depicted below (the VH domain corresponds to residues 1-121): 1 QVQLVQSGAE VKKPGASVKV SCKGSGYTFT DYGMHWVRQA PGQGLEWMGV
- VLDSDGSFFL YSKLTVDKSR WQQGNVFSCS VMHEALHNHY TQKSLSLSPG SEQ ID NO: 16
- This protein is encoded by the following nucleotide sequence:
- VLDSDGSFFL YSKLTVDKSR WQQGNVFSCS VMHEALHNHY TQKSLSLSPG (SEQ ID NO: 48)
- Characteristics of the humanized P4A8 IgGl include: a solubility of over 12 mg/ml; pi
- the EC 50 of hP4A8.IgGl for FnI 4 was estimated using an ELISA direct binding assay. 96 well ELISA plate was coated with 2 ⁇ g/ml of mouse Fnl4-mouse Fc in sodium carbonate pH 9.5 overnight at 4 0 C. Plate was blocked with 3% BSA in PBS for 1 hour at room temperature. The concentrations of hP4A8.IgGl were titrated from 2 ⁇ g/ml to 11 pg/ml and the incubation time was 1 hour at room temperature. The bound hP4A8.IgGl was detected by HRP-goat anti- human IgG. The EC 50 for hP4A8.IgGl under this ELISA condition is -6.79 ng/ml.
- Raw data were normalized by setting the preinjection response to zero on the Y-axis and the injection start to zero on the X-axis for each concentration series. Data were further normalized by subtracting the response on the underivitized surface from the response on the active surfaces and then subtracting the buffer only response on the active surface from the binding data on the same surface (so-called 'double referencing' of the data).
- the global association and dissociation rate constants were then determined for each concentration series by fitting the data using a Marquardt-Levenberg algorithm for 1 : 1 binding within the Biaevaluation software.
- the binding assays were done with greater than 95% pure monomeric soluble human FnI 4.
- the monovalent binding affinity (or "intrinsic affinity") of humanized P4A8 to soluble monomeric human FnI 4 is in the range of about 1 to 4 or 5 nM.
- the bivalent binding affinity (affinity and avidity components) of P4A8 whole antibody to immobilized Fnl4 (bivalent Fnl4-Fc) is about 5OpM.
- the caspase assay measures levels of cleaved caspases 3 and 7. Induction of caspase cleavage was measured in response to treatment with hP4A8. Caspases 3 and 7 are considered to be the "executioner" caspases, immediately proximal to induction of apoptosis; and therefore, this assay is relevant to the proposed MOA of hP4A8.
- WiDr tumor cells were seeded in 96-well plates, and exposed to a range of concentrations (1 ⁇ g/ml titrated at 1 :3 dilutions) of hP4A8 in the presence of 80 U/ml of hlFNg. After 3 days in culture, the Promega Caspase-Glo 3/7 Assay reagent was used to measure the presence of cleaved caspases 3 and 7. The data are presented as fold change as compared to untreated cells.
- Results show induction of Caspases 3/7 in WiDr cells in response to stimulation with hP4A8, with a maximal effect observed in response to the multimeric version of hP4A8 (hP4A8- multi) even when tested at even the lowest concentration (FIG. 26). A dose response is observed when testing increasing concentrations of the monomeric form of P4A8. Similar results were obtained in ex vivo tumors.
- the NF-kB assay measures induction of the canonical (p50, p65) and non-canonical (p52, ReIB) NF-kB pathways. It has been well established that the TWEAK/Fnl 4 pathway signals through NF-kB; therefore, this is a relevant assay for demonstrating agonist activity of hP4A8.
- WiDr tumor cells were grown in 6-well dishes and exposed to 1 ⁇ g/ml of P4A8 (in this assay the murine version of P4A8 was used), or 100 ng/ml hFc-TWEAK for comparison.
- nuclear extracts were prepared from the cultures. The nuclear extracts were then subjected to analysis by an ELISA kit (Active Motif- Trans AM NFkB Family transcription factor Assay kit) to measure the individual NF-kB family members (p50, p65, p52, ReIB, c-Rel). All values are normalized relative to unstimulated cells.
- hP4A8.IgGl i.e., humanized P4A8 having the VHl and VLl sequences linked to human IgGl
- hP4A8- IgGlagly and hP4A8.IgG4Pagly were compared to Fc-crippled versions of P4A8 (hP4A8- IgGlagly and hP4A8.IgG4Pagly).
- NK cells isolated from donor PBMCs were incubated overnight in the presence of IL-2.
- WiDr and MDA-MB-231 target cells were labeled with 51 Cr.
- Cultured NK cells and labeled target cells were incubated together at 5:1 ratio in the presence of varying concentrations of antibody for 4 hours at 37 degrees (also conducted at 2:1 ratio, data not shown).
- a spontaneous release control (no NK cells) and maximum release control (Triton-X- 10 treated target cells) were included in the assay. Cpm in supernatant was measured following the incubation period. The % lysis was calculated as follows:
- % Lysis (sample cpm - spont. cpm) X 100 (max cpm - spont. cpm)
- hP4A8 antibody The positive controls showed some activity, though not as robust as hP4A8.IgGl (FIG. 28). These studies demonstrate that hP4A8.IgGl has ADCC capacity, as measured by the ability of the antibody to induce ADCC in the in vitro assay.
- the effect of glycosylation on activity was also determined.
- the MTT assay (described above) in WiDr cells was used to test whether glycosylation has an effect on in vitro activity.
- hP4A8.IgGl full effector function
- hP4A8.IgG4Pagly no effector function
- the Research Reference Standard materials were tested in this assay. Results show a slight but reproducible enhancement in activity of the hP4A8.IgGl as compared to hP4A8.IgG4Pagly in the in vitro assay.
- hP4A8.IgGl has also been shown to contribute to P4A8 activity in vivo in both WiDr and MDA-MB231 xenograft assays.
- Administration of P4A8 hlgGl at 6.4 mg/kg to either animal model is more efficacious than administration of
- Efficacy of P4A8.hIgGl Fnl4 antibody, administered as a single agent at doses ranging from 0.9 to 25.6 mg/kg administered intraperitoneally (i.p.) on a once a week schedule (qw) for 6 weeks was evaluated in WiDr human colon tumor-bearing athymic nude mice.
- Mice were treated with IDEC 151 (negative control) at 12.8 mg/kg and P4A8.hIgGl at 12.8, 6.4, 3.2, 1.8 and 0.9 mg/kg IP, on a QW schedule (as indicated by arrows) starting on Day 12 following tumor cell inoculation when the average tumor volume was approximately 200 mm 3 .
- Data are Mean ⁇ SEM of 10 mice per treatment group.
- P4A8hIgGl demonstrated statistically significant (p ⁇ 0.001) efficacy at doses ranging from 0.9-25.6 mg/kg, compared to the isotype matched negative control antibody (FIG. 30, FIG. 31, and FIG. 32).
- Dose-dependent efficacy was observed across 0.9, 1.8, 3.2 and 6.4 mg/kg dose groups. Above 6.4 mg/kg dose, no dose-dependency was observed across 6.4, 12.8 and 25.6 mg/kg dose groups (FIG. 30 and FIG. 31).
- the minimally efficacious dose of P4A8hIgGl administered as a single agent in this model appears to be 0.9 mg/kg on a qwx6 schedule (FIG. 30 and FIG. 31).
- the maximally efficacious dose is 6.4 mg/kg.
- P4A8.hIgGl demonstrated statistically significant (p ⁇ 0.001) efficacy at doses ranging from 6.4 -25.6 mg/kg, compared to the isotype matched negative control antibody (FIG. 33). Comparison of the test group mean tumor sizes as a percentage of the mean negative control are presented in FIG. 34, the dotted line indicates the National Cancer Institute's criteria for activity (42%).
- P4A8.hIgGl exhibited greater efficacy in the MDA-MB-231 human breast tumor assay than did the parent antibody P4A8.
- the two antibodies exhibited similar efficacy in the WiDr human colon tumor assay.
- the humanized P4A8 IgGl antibody was shown to exhibit an anti-tumor effect at various doses tested in the Hs746T gastric carcinoma xenograft model (FIG. 35 and FIG. 36A).
- single agent efficacy 70-80% reduction in tumor size was demonstrated by treatment with humanized P4A8IgGl at 3.2, 6.4 and 12.8 mg/kg with once weekly dosing in the N87 gastric xenograft model (FIG. 36B).
- P4A8 effectively kills tumor cells in in vivo animal models, and has a prolonged effect.
- the complex of the murine P4A8 Fab/human Fn 14 ectodomain was crystallized by vapor diffusion method and placed at a temperature of 2O 0 C. Plate-shaped crystals of diffraction quality grew in 10-14 days in a crystallization solution that contained 30% PEG 8000, 100 mM sodium acetate at pH 5, 0.2 M lithium sulfate. Crystals (0.2 x 0.2 x 0.01 mm 3 ) were harvested as is and flash frozen in liquid nitrogen. Diffraction data to 3.5 A resolution was collected at beamline X25 at the National Synchrotron Light Source (Upton, NY).
- FACS analysis of cell lines was done in FACS buffer (PBS 1% BSA 0.1% Na Azide) by mixing cells with a dose curve of P4A8, starting at 10 ⁇ g/ml followed by a serial dilution of 1 :2.
- mAb IDEC 151 was prepared in the same manner and then each antibody was incubated with the cells for 30 min at 4°C. Following 2 washes with FACS buffer the cells were incubated with PE labeled anti hu IgG Fc specific antibody (Jackson Labs West Grove, PA) 30 min 4C. Following 2 washes the cells were fixed in 2% para formaldehyde and acquired on Caliber Facscan (Becton Dickinson, San Jose, CA).
- the data was analyzed using Flow Jo software (Tree Star Inc. Ashland, OR) and the MFFs (Mean Fluorescent Intensity) were determined.
- the expression levels of the cell lines were scored according to their MFI at a concentration of 1.25 ⁇ g/ml P4A8 by the following criteria:
- Antibody crossblocking was evaluated as follows. Soluble human Fnl4 was immobilized on a surface. The surface was then contacted with an unlabeled first antibody. Subsequently, a biotinylated second antibody was added and binding of the second antibody to the surface was measured. An abrogation of second antibody binding indicated that the first antibody crossblocked binding of the second antibody to FnI 4.
- FIG. 38A The ability of a panel of antibodies to crossblock binding of selected anti-Fnl4 antibodies is depicted in FIG. 38A (P2D3 was the biotinylated second antibody), FIG. 38B (P3G5 was the biotinylated second antibody), FIG. 38C (P4A8 was the biotinylated second antibody), FIG.
- FIG. 38D (ITEM-4 was the biotinylated second antibody), and FIG. 38E (ITEM-3 was the biotinylated second antibody).
- P IB 12 and P1C12 were used as unrelated control antibodies. * indicates instances were no unlabeled first antibody was used.
- TMB Substrate Solution by mixing 1 to 1 ratio of reagent A and reagent B (TMB Substrate Reagent Set, BD Biosciences 555214). Add 100 ul per well.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Veterinary Medicine (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Public Health (AREA)
- General Chemical & Material Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Genetics & Genomics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Endocrinology (AREA)
- Reproductive Health (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
Description
Claims
Priority Applications (7)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CA2723973A CA2723973A1 (en) | 2008-05-15 | 2009-05-08 | Anti-fn14 antibodies and uses thereof |
MX2010012324A MX2010012324A (en) | 2008-05-15 | 2009-05-08 | Anti-fn14 antibodies and uses thereof. |
EP09736321A EP2294089A2 (en) | 2008-05-15 | 2009-05-08 | Anti-fn14 antibodies and uses thereof |
AU2009246640A AU2009246640A1 (en) | 2008-05-15 | 2009-05-08 | Anti-Fn14 antibodies and uses thereof |
BRPI0912198A BRPI0912198A2 (en) | 2008-05-15 | 2009-05-08 | anti-fn14 antibodies and uses thereof |
JP2011509580A JP2011523414A (en) | 2008-05-15 | 2009-05-08 | Anti-FN14 antibodies and uses thereof |
IL209309A IL209309A0 (en) | 2008-05-15 | 2010-11-15 | Anti-fn14 antibodies and uses thereof |
Applications Claiming Priority (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US5365008P | 2008-05-15 | 2008-05-15 | |
US61/053,650 | 2008-05-15 | ||
US14951709P | 2009-02-03 | 2009-02-03 | |
US61/149,517 | 2009-02-03 | ||
US17313709P | 2009-04-27 | 2009-04-27 | |
US61/173,137 | 2009-04-27 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2009140177A2 true WO2009140177A2 (en) | 2009-11-19 |
WO2009140177A3 WO2009140177A3 (en) | 2010-08-26 |
Family
ID=41319269
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2009/043382 WO2009140177A2 (en) | 2008-05-15 | 2009-05-08 | Anti-fn14 antibodies and uses thereof |
Country Status (11)
Country | Link |
---|---|
US (1) | US20090324602A1 (en) |
EP (1) | EP2294089A2 (en) |
JP (1) | JP2011523414A (en) |
AR (1) | AR071794A1 (en) |
AU (1) | AU2009246640A1 (en) |
BR (1) | BRPI0912198A2 (en) |
CA (1) | CA2723973A1 (en) |
IL (1) | IL209309A0 (en) |
MX (1) | MX2010012324A (en) |
TW (1) | TW201008579A (en) |
WO (1) | WO2009140177A2 (en) |
Cited By (31)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7731963B2 (en) * | 2000-09-14 | 2010-06-08 | Biogen Idec Ma Inc. | TWEAK receptor agonists as anti-angiogenic agents |
WO2012122513A2 (en) | 2011-03-10 | 2012-09-13 | Omeros Corporation | Generation of anti-fn14 monoclonal antibodies by ex-vivo accelerated antibody evolution |
WO2013026099A1 (en) | 2011-08-23 | 2013-02-28 | Transbio Ltd | Fn14 binding proteins and uses thereof |
US8440189B2 (en) | 1999-01-15 | 2013-05-14 | Biogen Idec Ma Inc. | Antagonists of TWEAK and of TWEAK receptor and their use to treat immunological disorders |
JP2013521769A (en) * | 2010-03-11 | 2013-06-13 | ユセベ ファルマ ソシエテ アノニム | Biologic: humanized agonist anti-PD-1 antibody |
WO2013177386A1 (en) * | 2012-05-24 | 2013-11-28 | Abbvie Biotherapeutics Inc. | Biomarkers for predicting response to tweak receptor (tweakr) agonist therapy |
US8728475B2 (en) | 2005-05-10 | 2014-05-20 | Biogen Idec Ma Inc. | Methods for treating inflammatory bowel disease |
WO2014198817A1 (en) | 2013-06-14 | 2014-12-18 | Bayer Pharma Aktiengesellschaft | Anti-tweakr antibodies and uses thereof |
US8980610B2 (en) | 2008-11-20 | 2015-03-17 | Biogen Idec Ma Inc. | Arginine inactivation of viruses |
US9005926B2 (en) | 2009-10-02 | 2015-04-14 | Biogen Idec Ma Inc. | Methods of preventing and removing trisulfide bonds |
US9011859B2 (en) | 2002-04-09 | 2015-04-21 | Biogen Idec Ma Inc. | Methods for treating TWEAK-related conditions |
WO2016061632A1 (en) * | 2014-10-23 | 2016-04-28 | La Trobe University | Fn14-binding proteins and uses thereof |
WO2016096610A1 (en) * | 2014-12-15 | 2016-06-23 | Bayer Pharma Aktiengesellschaft | Antibody-drug conjugates (adcs) of ksp inhibitors with aglycosylated anti-tweakr antibodies |
WO2016207094A1 (en) | 2015-06-23 | 2016-12-29 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates of kinesin spindel protein (ksp) inhibitors with anti-tweakr-antibodies |
WO2016207104A1 (en) * | 2015-06-23 | 2016-12-29 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates of kinesin spindel protein (ksp) inhibitors with anti-b7h3-antibodies |
WO2016207089A1 (en) | 2015-06-22 | 2016-12-29 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates (adcs) and antibody prodrug conjugates (apdcs) with enzymatically cleavable groups |
US9562252B2 (en) | 2011-05-13 | 2017-02-07 | Biogen Ma Inc. | Methods of preventing and removing trisulfide bonds |
WO2016207090A3 (en) * | 2015-06-23 | 2017-02-16 | Bayer Pharma Aktiengesellschaft | Targeted conjugates of ksp inhibitors |
WO2017060322A2 (en) | 2015-10-10 | 2017-04-13 | Bayer Pharma Aktiengesellschaft | Ptefb-inhibitor-adc |
US9730947B2 (en) | 2005-06-13 | 2017-08-15 | Biogen Ma Inc. | Method of treating lupus nephritis |
WO2017162663A1 (en) | 2016-03-24 | 2017-09-28 | Bayer Pharma Aktiengesellschaft | Prodrugs of cytotoxic active agents having enzymatically cleavable groups |
US9775899B2 (en) | 2005-02-17 | 2017-10-03 | Biogen Ma Inc. | Treating neurological disorders |
WO2018114578A1 (en) | 2016-12-21 | 2018-06-28 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates (adcs) having enzymatically cleavable groups |
WO2018114798A1 (en) | 2016-12-21 | 2018-06-28 | Bayer Aktiengesellschaft | Prodrugs of cytotoxic active agents having enzymatically cleavable groups |
US10022453B2 (en) | 2013-12-23 | 2018-07-17 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates (ADCs) with kinesin spindel protein (KSP) |
WO2019149637A1 (en) | 2018-01-31 | 2019-08-08 | Bayer Aktiengesellschaft | Antibody drug conjugates (adcs) with nampt inhibitors |
WO2020128927A1 (en) * | 2018-12-20 | 2020-06-25 | Kyowa Kirin Co., Ltd. | Fn14 antibodies and uses thereof |
WO2021013693A1 (en) | 2019-07-23 | 2021-01-28 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates (adcs) with nampt inhibitors |
US11001636B2 (en) | 2016-06-15 | 2021-05-11 | Bayer Pharma Aktiengesellschaft | Specific antibody-drug-conjugates (ADCs) with KSP inhibitors and anti-CD123-antibodies |
US11433140B2 (en) | 2016-12-21 | 2022-09-06 | Bayer Pharma Aktiengesellschaft | Specific antibody drug conjugates (ADCs) having KSP inhibitors |
WO2024105206A1 (en) | 2022-11-17 | 2024-05-23 | Vincerx Pharma Gmbh | Antibody-drug-conjugates cleavable in a tumor microenvironment |
Families Citing this family (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2011097500A2 (en) | 2010-02-04 | 2011-08-11 | University Of Louisville Research Foundation, Inc. | The tweak/fn14 system regulates skeletal muscle atrophy and regeneration |
WO2015036643A2 (en) | 2013-09-13 | 2015-03-19 | Sierra Jiménez Angels | Marker for predicting metastasis of breast cancer |
JP7437317B2 (en) * | 2018-04-02 | 2024-02-22 | アラマブ セラピューティクス, インコーポレイテッド | Connexin 43 antibody and its use |
SG11202104463YA (en) * | 2018-10-31 | 2021-05-28 | Astellas Pharma Inc | Anti-human fn14 antibody |
JP2022519293A (en) * | 2019-02-04 | 2022-03-22 | アラマブ セラピューティクス, インコーポレイテッド | Connexin 43 antibody and its use |
US20210101974A1 (en) * | 2019-10-02 | 2021-04-08 | Alamab Therapeutics, Inc. | Anti-connexin antibody formulations |
CN112979760B (en) * | 2021-04-21 | 2023-09-29 | 华侨大学 | Specific targeting functional peptide of hepatic stellate cell receptor Fn14 and application thereof |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2006125632A2 (en) * | 2005-05-24 | 2006-11-30 | Rechtsanwalt Dr. Martin Prager Als Insolvenzverwalter Über Das Vermögen Der Xantos Biomedicine Ag, Pluta Rechtsanwalts Gmbh | Agonistic antibodies that bind to the tweak receptor fn14 and thereby modulate adiposity-associated phenotypes as well as their use in therapy |
WO2009020933A2 (en) * | 2007-08-03 | 2009-02-12 | Facet Biotech Corporation | Therapeutic use of anti-tweak receptor antibodies |
-
2009
- 2009-05-08 AU AU2009246640A patent/AU2009246640A1/en not_active Abandoned
- 2009-05-08 WO PCT/US2009/043382 patent/WO2009140177A2/en active Application Filing
- 2009-05-08 CA CA2723973A patent/CA2723973A1/en not_active Abandoned
- 2009-05-08 MX MX2010012324A patent/MX2010012324A/en not_active Application Discontinuation
- 2009-05-08 EP EP09736321A patent/EP2294089A2/en not_active Withdrawn
- 2009-05-08 BR BRPI0912198A patent/BRPI0912198A2/en not_active IP Right Cessation
- 2009-05-08 JP JP2011509580A patent/JP2011523414A/en not_active Ceased
- 2009-05-08 US US12/463,291 patent/US20090324602A1/en not_active Abandoned
- 2009-05-14 TW TW098116062A patent/TW201008579A/en unknown
- 2009-05-14 AR ARP090101740A patent/AR071794A1/en unknown
-
2010
- 2010-11-15 IL IL209309A patent/IL209309A0/en unknown
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2006125632A2 (en) * | 2005-05-24 | 2006-11-30 | Rechtsanwalt Dr. Martin Prager Als Insolvenzverwalter Über Das Vermögen Der Xantos Biomedicine Ag, Pluta Rechtsanwalts Gmbh | Agonistic antibodies that bind to the tweak receptor fn14 and thereby modulate adiposity-associated phenotypes as well as their use in therapy |
WO2009020933A2 (en) * | 2007-08-03 | 2009-02-12 | Facet Biotech Corporation | Therapeutic use of anti-tweak receptor antibodies |
Non-Patent Citations (2)
Title |
---|
CULP PATRICIA A ET AL: "Anti-TweakR antibodies inhibit tumor growth in vivo through dual mechanisms" PROCEEDINGS OF THE ANNUAL MEETING OF THE AMERICAN ASSOCIATION FOR CANCER RESEARCH, NEW YORK, NY, US, vol. 49, 16 April 2008 (2008-04-16), page 354, XP001537048 ISSN: 0197-016X * |
NAKAYAMA M ET AL: "Fibroblast growth factor-inducible 14 mediates multiple pathways of TWEAK-induced cell death" JOURNAL OF IMMUNOLOGY, AMERICAN ASSOCIATION OF IMMUNOLOGISTS, US, vol. 170, no. 1, 1 January 2003 (2003-01-01), pages 341-348, XP002356992 ISSN: 0022-1767 * |
Cited By (57)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8440189B2 (en) | 1999-01-15 | 2013-05-14 | Biogen Idec Ma Inc. | Antagonists of TWEAK and of TWEAK receptor and their use to treat immunological disorders |
US7731963B2 (en) * | 2000-09-14 | 2010-06-08 | Biogen Idec Ma Inc. | TWEAK receptor agonists as anti-angiogenic agents |
US9011859B2 (en) | 2002-04-09 | 2015-04-21 | Biogen Idec Ma Inc. | Methods for treating TWEAK-related conditions |
US9775899B2 (en) | 2005-02-17 | 2017-10-03 | Biogen Ma Inc. | Treating neurological disorders |
US8728475B2 (en) | 2005-05-10 | 2014-05-20 | Biogen Idec Ma Inc. | Methods for treating inflammatory bowel disease |
US9730947B2 (en) | 2005-06-13 | 2017-08-15 | Biogen Ma Inc. | Method of treating lupus nephritis |
US8980610B2 (en) | 2008-11-20 | 2015-03-17 | Biogen Idec Ma Inc. | Arginine inactivation of viruses |
US10308706B2 (en) | 2009-10-02 | 2019-06-04 | Biogen Ma Inc. | Methods of preventing and removing trisulfide bonds |
US9005926B2 (en) | 2009-10-02 | 2015-04-14 | Biogen Idec Ma Inc. | Methods of preventing and removing trisulfide bonds |
JP2013521769A (en) * | 2010-03-11 | 2013-06-13 | ユセベ ファルマ ソシエテ アノニム | Biologic: humanized agonist anti-PD-1 antibody |
JP2014510079A (en) * | 2011-03-10 | 2014-04-24 | オメロス コーポレーション | Generation of anti-FN14 monoclonal antibodies by accelerated antibody evolution ex vivo |
EP2683740A2 (en) * | 2011-03-10 | 2014-01-15 | Omeros Corporation | Generation of anti-fn14 monoclonal antibodies by ex-vivo accelerated antibody evolution |
EP2683740A4 (en) * | 2011-03-10 | 2014-12-03 | Omeros Corp | Generation of anti-fn14 monoclonal antibodies by ex-vivo accelerated antibody evolution |
AU2012225246B2 (en) * | 2011-03-10 | 2016-01-21 | Omeros Corporation | Generation of anti-FN14 monoclonal antibodies by ex-vivo accelerated antibody evolution |
WO2012122513A2 (en) | 2011-03-10 | 2012-09-13 | Omeros Corporation | Generation of anti-fn14 monoclonal antibodies by ex-vivo accelerated antibody evolution |
US9346888B2 (en) | 2011-03-10 | 2016-05-24 | Omeros Corporation | Generation of anti-FN14 monoclonal antibodies by ex-vivo accelerated antibody evolution |
US9790533B2 (en) | 2011-05-13 | 2017-10-17 | Biogen Ma Inc. | Methods of preventing and removing trisulfide bonds |
US9562252B2 (en) | 2011-05-13 | 2017-02-07 | Biogen Ma Inc. | Methods of preventing and removing trisulfide bonds |
US10590454B2 (en) | 2011-05-13 | 2020-03-17 | Biogen Ma Inc. | Methods of preventing and removing trisulfide bonds |
US10287359B2 (en) | 2011-08-23 | 2019-05-14 | La Trobe University | Fn14 binding proteins and uses thereof |
WO2013026099A1 (en) | 2011-08-23 | 2013-02-28 | Transbio Ltd | Fn14 binding proteins and uses thereof |
EP2748203A1 (en) * | 2011-08-23 | 2014-07-02 | Transbio Ltd | Fn14 binding proteins and uses thereof |
EP2748203A4 (en) * | 2011-08-23 | 2015-04-22 | Transbio Ltd | Fn14 binding proteins and uses thereof |
WO2013177386A1 (en) * | 2012-05-24 | 2013-11-28 | Abbvie Biotherapeutics Inc. | Biomarkers for predicting response to tweak receptor (tweakr) agonist therapy |
WO2014198817A1 (en) | 2013-06-14 | 2014-12-18 | Bayer Pharma Aktiengesellschaft | Anti-tweakr antibodies and uses thereof |
US10022453B2 (en) | 2013-12-23 | 2018-07-17 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates (ADCs) with kinesin spindel protein (KSP) |
EP3209697A4 (en) * | 2014-10-23 | 2018-05-30 | La Trobe University | Fn14-binding proteins and uses thereof |
WO2016061632A1 (en) * | 2014-10-23 | 2016-04-28 | La Trobe University | Fn14-binding proteins and uses thereof |
US10584175B2 (en) | 2014-10-23 | 2020-03-10 | La Trobe University | FN14-binding proteins and uses thereof |
US10485880B2 (en) | 2014-12-15 | 2019-11-26 | Bayer Pharma Aktiengesellschaft | Antibody-drug conjugates (ADCs) of KSP inhibitors with aglycosylated anti-TWEAKR antibodies |
WO2016096610A1 (en) * | 2014-12-15 | 2016-06-23 | Bayer Pharma Aktiengesellschaft | Antibody-drug conjugates (adcs) of ksp inhibitors with aglycosylated anti-tweakr antibodies |
US11123439B2 (en) | 2015-06-22 | 2021-09-21 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates (ADCS) and antibody prodrug conjugates (APDCS) with enzymatically cleavable groups |
EP4406606A2 (en) | 2015-06-22 | 2024-07-31 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates (adcs) and antibody prodrug conjugates (apdcs) with enzymatically cleavable g |
IL256394A (en) * | 2015-06-22 | 2018-04-30 | Bayer Pharma AG | Antibody drug conjugates (adcs) and antibody prodrug conjugates (apdcs) with enzymatically cleavable groups |
WO2016207089A1 (en) | 2015-06-22 | 2016-12-29 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates (adcs) and antibody prodrug conjugates (apdcs) with enzymatically cleavable groups |
CN114917361A (en) * | 2015-06-22 | 2022-08-19 | 拜耳医药股份有限公司 | Antibody Drug Conjugates (ADC) and antibody prodrug conjugates (APDC) with enzyme cleavable groups |
US10973923B2 (en) | 2015-06-23 | 2021-04-13 | Bayer Pharma Aktiengesellschaft | Site specific homogeneous with KSP inhibitors |
WO2016207094A1 (en) | 2015-06-23 | 2016-12-29 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates of kinesin spindel protein (ksp) inhibitors with anti-tweakr-antibodies |
US11806404B2 (en) | 2015-06-23 | 2023-11-07 | Bayer Pharma Aktiengesellschaft | Site specific homogeneous with KSP inhibitors |
US11071788B2 (en) | 2015-06-23 | 2021-07-27 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates of kinesin spindel protein (KSP) inhibitors with antiB7H3-antibodies |
WO2016207090A3 (en) * | 2015-06-23 | 2017-02-16 | Bayer Pharma Aktiengesellschaft | Targeted conjugates of ksp inhibitors |
WO2016207104A1 (en) * | 2015-06-23 | 2016-12-29 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates of kinesin spindel protein (ksp) inhibitors with anti-b7h3-antibodies |
WO2017060322A2 (en) | 2015-10-10 | 2017-04-13 | Bayer Pharma Aktiengesellschaft | Ptefb-inhibitor-adc |
WO2017162663A1 (en) | 2016-03-24 | 2017-09-28 | Bayer Pharma Aktiengesellschaft | Prodrugs of cytotoxic active agents having enzymatically cleavable groups |
US11685714B2 (en) | 2016-03-24 | 2023-06-27 | Bayer Pharma Aktiengesellschaft | Prodrugs of cytotoxic active agents having enzymatically cleavable groups |
US11643469B2 (en) | 2016-06-15 | 2023-05-09 | Bayer Pharma Aktiengesellschaft | Specific antibody-drug-conjugates (ADCs) with KSP inhibitors and anti-CD123-antibodies |
US11001636B2 (en) | 2016-06-15 | 2021-05-11 | Bayer Pharma Aktiengesellschaft | Specific antibody-drug-conjugates (ADCs) with KSP inhibitors and anti-CD123-antibodies |
WO2018114798A1 (en) | 2016-12-21 | 2018-06-28 | Bayer Aktiengesellschaft | Prodrugs of cytotoxic active agents having enzymatically cleavable groups |
US11433140B2 (en) | 2016-12-21 | 2022-09-06 | Bayer Pharma Aktiengesellschaft | Specific antibody drug conjugates (ADCs) having KSP inhibitors |
US11478554B2 (en) | 2016-12-21 | 2022-10-25 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates (ADCS) having enzymatically cleavable groups |
US11660351B2 (en) | 2016-12-21 | 2023-05-30 | Bayer Aktiengesellschaft | Antibody drug conjugates (ADCs) having enzymatically cleavable groups |
WO2018114578A1 (en) | 2016-12-21 | 2018-06-28 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates (adcs) having enzymatically cleavable groups |
US12059472B2 (en) | 2016-12-21 | 2024-08-13 | Bayer Aktiengesellschaft | Prodrugs of cytotoxic active agents having enzymatically cleavable groups |
WO2019149637A1 (en) | 2018-01-31 | 2019-08-08 | Bayer Aktiengesellschaft | Antibody drug conjugates (adcs) with nampt inhibitors |
WO2020128927A1 (en) * | 2018-12-20 | 2020-06-25 | Kyowa Kirin Co., Ltd. | Fn14 antibodies and uses thereof |
WO2021013693A1 (en) | 2019-07-23 | 2021-01-28 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates (adcs) with nampt inhibitors |
WO2024105206A1 (en) | 2022-11-17 | 2024-05-23 | Vincerx Pharma Gmbh | Antibody-drug-conjugates cleavable in a tumor microenvironment |
Also Published As
Publication number | Publication date |
---|---|
AR071794A1 (en) | 2010-07-14 |
TW201008579A (en) | 2010-03-01 |
BRPI0912198A2 (en) | 2019-09-24 |
AU2009246640A1 (en) | 2009-11-19 |
WO2009140177A3 (en) | 2010-08-26 |
IL209309A0 (en) | 2011-01-31 |
MX2010012324A (en) | 2011-01-14 |
JP2011523414A (en) | 2011-08-11 |
EP2294089A2 (en) | 2011-03-16 |
CA2723973A1 (en) | 2009-11-19 |
US20090324602A1 (en) | 2009-12-31 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20090324602A1 (en) | Anti-fn14 antibodies and uses thereof | |
KR102493282B1 (en) | Antibodies to TIM3 and uses thereof | |
CN111094352B (en) | B7-H4 antibodies and methods of use thereof | |
KR102473028B1 (en) | Anti-TIM-3 Antibodies and Compositions | |
CN108137687B (en) | anti-OX 40 antibodies and uses thereof | |
US20180362652A1 (en) | Anti-blood dendritic cell antigen 2 antibodies and uses thereof | |
KR20230038311A (en) | Combination therapy with anti-cd73 antibodies | |
CN115636880A (en) | anti-IL-2 antibodies and compositions and uses thereof | |
KR20200123170A (en) | B7-H4 antibody formulation | |
CN106795223B (en) | Antibodies to Fc gamma receptors IIB and Fc epsilon receptors | |
KR20200044899A (en) | TIM-3 antagonist for the treatment and diagnosis of cancer | |
CN114685660A (en) | anti-CLDN 18.2 antibody and preparation method and application thereof | |
KR20160131082A (en) | Anti-laminin4 antibodies specific for lg1-3 | |
KR20220160555A (en) | Antibodies that bind to CD40 and uses thereof | |
CN111868089A (en) | B7-H4 antibody dosing regimen | |
CN113166242A (en) | Combination therapy for cancer | |
KR20220132579A (en) | anti-human CD19 antibody | |
KR102705378B1 (en) | CD200R agonistic antibodies and uses thereof | |
US20150110792A1 (en) | ANTI-TIM-1 Antibodies And Uses Thereof | |
KR20210068065A (en) | antagonist | |
RU2805176C1 (en) | Antibodies against e-selectin, compositions and methods of use | |
KR20240017054A (en) | Treatment of PD-L1 negative or low-expressing cancers using anti-ICOS antibodies | |
CN117460529A (en) | Use of anti-ICOS antibodies | |
NZ789986A (en) | Antibodies against tim3 and uses thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 09736321 Country of ref document: EP Kind code of ref document: A2 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2723973 Country of ref document: CA |
|
WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2010/012324 Country of ref document: MX |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2011509580 Country of ref document: JP Ref document number: 12010502539 Country of ref document: PH |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2009246640 Country of ref document: AU |
|
WWE | Wipo information: entry into national phase |
Ref document number: 589696 Country of ref document: NZ |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2009736321 Country of ref document: EP |
|
ENP | Entry into the national phase |
Ref document number: 2009246640 Country of ref document: AU Date of ref document: 20090508 Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: PI0912198 Country of ref document: BR Kind code of ref document: A2 Effective date: 20101111 |