WO2009137721A2 - Lysosomal targeting peptides and uses thereof - Google Patents

Lysosomal targeting peptides and uses thereof Download PDF

Info

Publication number
WO2009137721A2
WO2009137721A2 PCT/US2009/043207 US2009043207W WO2009137721A2 WO 2009137721 A2 WO2009137721 A2 WO 2009137721A2 US 2009043207 W US2009043207 W US 2009043207W WO 2009137721 A2 WO2009137721 A2 WO 2009137721A2
Authority
WO
WIPO (PCT)
Prior art keywords
igf
fusion protein
targeted therapeutic
therapeutic fusion
mutein
Prior art date
Application number
PCT/US2009/043207
Other languages
French (fr)
Other versions
WO2009137721A3 (en
Inventor
Jonathan H. Lebowitz
John Maga
Original Assignee
Zystor Therapeutics, Inc.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EP09743707.3A priority Critical patent/EP2279210B1/en
Priority to US12/991,104 priority patent/US20110223147A1/en
Priority to BR122017015900A priority patent/BR122017015900A2/en
Application filed by Zystor Therapeutics, Inc. filed Critical Zystor Therapeutics, Inc.
Priority to ES09743707.3T priority patent/ES2629853T3/en
Priority to CN200980123156.6A priority patent/CN102066422B/en
Priority to AU2009244148A priority patent/AU2009244148B2/en
Priority to JP2011508686A priority patent/JP5627571B2/en
Priority to CA2723412A priority patent/CA2723412A1/en
Priority to BRPI0912225-7A priority patent/BRPI0912225A2/en
Priority to DK09743707.3T priority patent/DK2279210T3/en
Priority to PL09743707T priority patent/PL2279210T3/en
Priority to EP20184387.7A priority patent/EP3778652A1/en
Priority to EP17182845.2A priority patent/EP3272773B8/en
Publication of WO2009137721A2 publication Critical patent/WO2009137721A2/en
Publication of WO2009137721A3 publication Critical patent/WO2009137721A3/en
Priority to IL209091A priority patent/IL209091A/en
Priority to US13/399,844 priority patent/US8563691B2/en
Priority to US14/535,505 priority patent/US9469683B2/en
Priority to US15/274,115 priority patent/US20170007680A1/en
Priority to HRP20170698TT priority patent/HRP20170698T1/en
Priority to CY20171100545T priority patent/CY1119183T1/en
Priority to US15/657,764 priority patent/US11351231B2/en
Priority to US16/869,862 priority patent/US20210069304A1/en
Priority to US17/829,620 priority patent/US20220354934A1/en
Priority to US17/815,468 priority patent/US20230241187A1/en

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43—Enzymes; Proenzymes; Derivatives thereof
    • A61K38/46—Hydrolases (3)
    • A61K38/47—Hydrolases (3) acting on glycosyl compounds (3.2), e.g. cellulases, lactases
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575—Hormones
    • C07K14/65—Insulin-like growth factors, i.e. somatomedins, e.g. IGF-1, IGF-2
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
    • C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
    • C12N9/2405—Glucanases
    • C12N9/2408—Glucanases acting on alpha -1,4-glucosidic bonds
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
    • C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
    • C12Y302/0102—Alpha-glucosidase (3.2.1.20)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/06—Fusion polypeptide containing a localisation/targetting motif containing a lysosomal/endosomal localisation signal
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies

Definitions

  • mammalian lysosomal enzymes are synthesized in the cytosol and traverse the ER where they are glycosylated with N-linked, high mannose type carbohydrate.
  • the high mannose carbohydrate is modified on lysosomal proteins by the addition of mannose-6-phosphate (M6P) which targets these proteins to the lysosome.
  • M6P mannose-6-phosphate
  • the M6P-modif ⁇ ed proteins are delivered to the lysosome via interaction with either of two M6P receptors. The most favorable form of modification is when two M6Ps are added to a high mannose carbohydrate.
  • LSDs lysosomal storage diseases
  • Enzyme replacement therapy for LSDs is being actively pursued.
  • Therapy generally requires that LSD proteins be taken up and delivered to the lysosomes of a variety of cell types in an M6P- dependent fashion.
  • One possible approach involves purifying an LSD protein and modifying it to incorporate a carbohydrate moiety with M6P. This modified material may be taken up by the cells more efficiently than unmodified LSD proteins due to interaction with M6P receptors on the cell surface.
  • GILT Glycosylation Independent Lysosomal Targeting
  • the present invention provides further improved compositions and methods for efficient lysosomal targeting based on the GILT technology.
  • the present invention provides methods and compositions for targeting lysosomal enzymes to lysosomes using furin-resistant lysosomal targeting peptides.
  • the present invention also provides methods and compositions for targeting lysosomal enzymes to lysosomes using a lysosomal targeting peptide that has reduced or diminished binding affinity for the insulin receptor.
  • the present invention encompasses unexpected discovery that furin-resistant lysosomal targeting peptides according to the invention have reduced binding affinity for the insulin receptor.
  • the present invention provides a furin-resistant IGF-II mutein.
  • the present invention provides a furin-resistant IGF-II mutein having an amino acid sequence at least 70% identical to mature human IGF-II (SEQ ID NO: 1) and a mutation that abolishes at least one furin protease cleavage site.
  • the present invention provides an IGF-II mutein comprising an amino acid sequence at least 70% identical to mature human IGF-II (SEQ ID NO:1) and a mutation that reduces or diminishes the binding affinity for the insulin receptor as compared to the wild-type human IGF-II.
  • the furin-resistant IGF-II mutein has diminished binding affinity for the IGF-I receptor relative to the affinity of naturally-occurring human IGF-II for the IGF-I receptor.
  • the present invention provides a targeted therapeutic fusion protein containing a lysosomal enzyme; and an IGF-II mutein having an amino acid sequence at least 70% identical to mature human IGF-II (SEQ ID NO: 1), wherein the IGF-II mutein is resistant to furin cleavage and binds to the human cation-independent mannose-6- phosphate receptor in a mannose-6-phosphate-independent manner.
  • the present invention provides a targeted therapeutic fusion protein containing a lysosomal enzyme; and an IGF-II mutein having an amino acid sequence at least 70% identical to mature human IGF-II (SEQ ID NO:1), and having diminished binding affinity for the insulin receptor relative to the affinity of naturally-occurring human IGF- II for the insulin receptor; wherein the IGF-II mutein binds to the human cation-independent mannose-6-phosphate receptor in a mannose-6-phosphate-independent manner.
  • the present invention provides a targeted therapeutic fusion protein containing a lysosomal enzyme; and an IGF-II mutein having an amino acid sequence at least 70% identical to mature human IGF-II (SEQ ID NO:1), and having diminished binding affinity for the insulin receptor relative to the affinity of naturally-occurring human IGF- II for the insulin receptor; wherein the IGF-II mutein is resistant to furin cleavage and binds to the human cation-independent mannose-6-phosphate receptor in a mannose-6-phosphate- independent manner.
  • an IGF-II mutein suitable for the invention includes a mutation within a region corresponding to amino acids 30-40 of SEQ ID NO: 1. In some embodiments, an IGF-II mutein suitable for the invention includes a mutation within a region corresponding to amino acids 34-40 of SEQ ID NO:1 such that the mutation abolishes at least one furin protease cleavage site.
  • a suitable mutation is an amino acid substitution, deletion and/or insertion. In some embodiments, the mutation is an amino acid substitution at a position corresponding to Arg37 or Arg40 of SEQ ID NO: 1. In some embodiments, the amino acid substitution is a Lys or Ala substitution.
  • a suitable mutation is a deletion or replacement of amino acid residues corresponding to positions selected from the group consisting of 31 -40, 32-40, 33- 40, 34-40, 30-39, 31-39, 32-39, 34-37, 32-39, 33-39, 34-39, 35-39, 36-39, 37-40, 34-40 of SEQ ID NO:1, and combinations thereof.
  • an IGF-II mutein according to the invention further contains a deletion or a replacement of amino acids corresponding to positions 2-7 of SEQ ID NO:1. In some embodiments, an IGF-II mutein according to the invention further includes a deletion or a replacement of amino acids corresponding to positions 1-7 of SEQ ID NO:1. In some embodiments, an IGF-II mutein according to the invention further contains a deletion or a replacement of amino acids corresponding to positions 62-67 of SEQ ID NO:1. hi some embodiments, an IGF-II mutein according to the invention further contains an amino acid substitution at a position corresponding to Tyr27, Leu43, or Ser26 of SEQ ID NO: 1.
  • an IGF-II mutein according to the invention contains at least an amino acid substitution selected from the group consisting of Tyr27Leu, Leu43Val, Ser26Phe and combinations thereof. In some embodiments, an IGF-II mutein according to the invention contains amino acids corresponding to positions 48-55 of SEQ ID NO: 1. In some embodiments, an IGF-II mutein according to the invention contains at least three amino acids selected from the group consisting of amino acids corresponding to positions 8, 48, 49, 50, 54, and 55 of SEQ ID NO:1. In some embodiments, an IGF-II mutein of the invention contains, at positions corresponding to positions 54 and 55 of SEQ ID NO:1, amino acids each of which is uncharged or negatively charged at pH 7.4. In some embodiments, the IGF-II mutein has diminished binding affinity for the IGF-I receptor relative to the affinity of naturally-occurring human IGF- II for the IGF-I receptor.
  • a lysosomal enzyme suitable for the invention is human acid alpha-glucosidase (GAA), or a functional variant thereof.
  • a lysosomal enzyme suitable for the invention includes amino acids 70-952 of human GAA.
  • a targeted therapeutic fusion protein of the invention further includes a spacer between the lysosomal enzyme and the furin-resistant IGF-II mutein.
  • the spacer contains an amino acid sequence Gly-Ala-Pro.
  • the present invention also provides nucleic acids encoding the IGF-II mutein or the targeted therapeutic fusion protein as described in various embodiments above.
  • the present invention further provides various cells containing the nucleic acid of the invention.
  • the present invention provides pharmaceutical compositions suitable for treating lysosomal storage disease containing a therapeutically effective amount of a targeted therapeutic fusion protein of the invention.
  • the invention further provides methods of treating lysosomal storage diseases comprising administering to a subject in need of treatment a targeted therapeutic fusion protein according to the invention.
  • the lysosomal storage disease is Pompe Disease.
  • the lysosomal storage disease is Fabry Disease.
  • the lysosomal storage disease is Gaucher Disease.
  • the present invention provides a method of producing a targeted therapeutic fusion protein including a step of culturing mammalian cells in a cell culture medium, wherein the mammalian cells carry the nucleic acid of the invention, in particular, as described in various embodiments herein; and the culturing is performed under conditions that permit expression of the targeted therapeutic fusion protein.
  • the present invention provides a method of producing a targeted therapeutic fusion protein including a step of culturing furin-deficient cells (e.g., furin- deficient mammalian cells) in a cell culture medium, wherein the furin-deficient cells carry a nucleic acid encoding a fusion protein comprising a lysosomal enzyme and an IGF-II mutein having an amino acid sequence at least 70% identical to mature human IGF-II (SEQ ID NO:1), wherein the IGF-II mutein binds to the human cation-independent mannose-6-phosphate receptor in a mannose-6-phosphate-independent manner; and wherein the culturing is performed under conditions that permit expression of the targeted therapeutic fusion protein.
  • furin-deficient cells e.g., furin- deficient mammalian cells
  • the furin-deficient cells carry a nucleic acid encoding a fusion protein comprising a lysosomal enzyme and an I
  • FIG. 1 illustrates a map of N-terminus of ZC-701. Two amino acid residues boxed are sites of cleavage events. The first is the site of signal peptide cleavage, the second is the site of a furin cleavage.
  • FIG. 2 illustrates an exemplary SDS-PAGE analysis of ZC-701 after treatment with PNGase F.
  • the lane on the right has been additionally treated with furin.
  • FIG. 3 Left: Schematic illustration of exemplary ZC-701 mutants in which furin cleavage site is modified. Center: Exemplary SDS-PAGE analysis of PNGase treated mutants after 3-7 days of cell culture. Right: Exemplary SDS-PAGE analysis of PNGase-treated mutants treated with furin.
  • FIG. 4 illustrates exemplary competitive IGF-II receptor binding results.
  • FIG. 5 illustrates additional exemplary competitive IGF-II receptor binding results.
  • FIG. 6 illustrates exemplary insulin receptor competition assay results.
  • FIG. 7 illustrates exemplary IGF-I receptor competition assay results.
  • FIG. 8 illustrates exemplary results of certain insulin receptor binding assay.
  • FIG. 9 illustrates exemplary results of certain insulin receptor binding assay.
  • FIG. 10 illustrates exemplary analysis of partially purified GILT-tagged GAA from transient transfections.
  • HEK293 cells were transfected with constructs 1479, 1487 or ZC- 701. After harvest, culture supernatants were partially purified by Hydrophobic Interaction Chromatography (HIC). All samples were treated with PNGase prior to electrophoresis.
  • Left panels SDS-PAGE of partially purified proteins.
  • Purified ZC-701 B12 is shown as a control.
  • Right panels Immunoblot analysis of the partially purified proteins. The indicated primary antibody was used. Bottom panels were additionally treated with exogenous furin.
  • the protein encoded by construct 1487 is identical in sequence to that encoded by construct 1461 (R37A).
  • the protein encoded by construct 1479 is identical to that encoded by construct 1459 (R37K).
  • FIG. 11 illustrates exemplary uptake results of exemplary furin resistant GILT- tagged GAA into rat L6 myoblasts.
  • K upt akes for protein 1479, 1487, ZC-701, and purified ZC-701 are 4.5 nM, 4.4 nM, 5.0 nM and 2.6 nM respectively.
  • the protein encoded by construct 1487 is identical in sequence to that encoded by construct 1461 in Figure 3 (R37A).
  • the protein encoded by construct 1479 is identical to that encoded by construct 1459 in Figure 3 (R37K).
  • Amelioration is meant the prevention, reduction or palliation of a state, or improvement of the state of a subject. Amelioration includes, but does not require complete recovery or complete prevention of a disease condition. In some embodiments, amelioration includes reduction of accumulated materials inside lysosomes of relevant diseases tissues.
  • Furin protease cleavage site refers to the amino acid sequence of a peptide or protein that serves as a recognition sequence for enzymatic protease cleavage by furin or furin-like proteases.
  • a furin protease cleavage site has a consensus sequence Arg-X-X-Arg (SEQ ID NO: 2), X is any amino acid.
  • the cleavage site is positioned after the carboxy-terminal arginine (Arg) residue in the sequence.
  • a furin cleavage site may have a consensus sequence Lys/Arg-X-X-X-Lys/Arg- Arg (SEQ ID NO: 3), X is any amino acid.
  • the cleavage site is positioned after the carboxy- terminal arginine (Arg) residue in the sequence.
  • Furin refers to any protease that can recognize and cleave the furin protease cleavage site as defined herein, including furin or furin-like protease.
  • Furin is also known as paired basic amino acid cleaving enzyme (PACE).
  • PACE paired basic amino acid cleaving enzyme
  • Furin belongs to the subtilisin-like proprotein convertase family.
  • the gene encoding furin was known as FUR (FES Upstream Region).
  • Furin-deficient cells refers to any cells whose furin protease activity is inhibited, reduced or eliminated. Furin-deficient cells include both mammalian and non-mammalian cells that do not produce furin or produce reduced amount of furin or defective furin protease.
  • glycosylation independent lysosomal targeting refers to lysosomal targeting that is mannose-6-phosphate-independent.
  • Human acid alpha-glucosidase As used herein, the term “human acid alpha- glucosidase” (also referred to as "GAA”) refers to precursor wild-type form of human GAA or a functional variant that is capable of reducing glycogen levels in mammalian lysosomes or that can rescue or ameliorate one or more Pompe disease symptoms.
  • GAA human acid alpha-glucosidase
  • “reduce,” or grammatical equivalents indicate values that are relative to a baseline measurement, such as a measurement in the same individual prior to initiation of the treatment described herein, or a measurement in a control individual (or multiple control individuals) in the absence of the treatment described herein.
  • a “control individual” is an individual afflicted with the same form of lysosomal storage disease (e.g., Pompe disease) as the individual being treated, who is about the same age as the individual being treated (to ensure that the stages of the disease in the treated individual and the control individual(s) are comparable).
  • patient refers to a human or a non-human mammalian subject.
  • the individual (also referred to as “patient” or “subject") being treated is an individual (fetus, infant, child, adolescent, or adult human) suffering from a lysosomal storage disease, for example, Pompe disease (i.e., either infantile-, juvenile-, or adult-onset Pompe disease) or having the potential to develop a lysosomal storage disease (e.g., Pompe disease).
  • Pompe disease i.e., either infantile-, juvenile-, or adult-onset Pompe disease
  • a lysosomal storage disease e.g., Pompe disease
  • Lysosomal storage diseases refer to a group of genetic disorders that result from deficiency in at least one of the enzymes (e.g., acid hydrolases) that are required to break macromolecules down to peptides, amino acids, monosaccharides, nucleic acids and fatty acids in lysosomes. As a result, individuals suffering from lysosomal storage diseases have accumulated materials in lysosomes. Exemplary lysosomal storage diseases are listed in Table 1.
  • Lysosomal enzyme refers to any enzyme that is capable of reducing accumulated materials in mammalian lysosomes or that can rescue or ameliorate one or more lysosomal storage disease symptoms.
  • Lysosomal enzymes suitable for the invention include both wild-type or modified lysosomal enzymes and can be produced using recombinant and synthetic methods or purified from nature sources. Exemplary lysosomal enzymes are listed in Table 1.
  • Spacer refers to a peptide sequence between two protein moieties in a fusion protein.
  • a spacer is generally designed to be flexible or to interpose a structure, such as an alpha-helix, between the two protein moieties.
  • a spacer can be relatively short, such as the sequence Gly-Ala-Pro (SEQ ID NO: 4) or Gly-Gly-Gly-Gly-Gly-Pro (SEQ ID NO: 5), or can be longer, such as, for example, 10-25 amino acids in length.
  • therapeutically effective amount refers to an amount of a targeted therapeutic fusion protein which confers a therapeutic effect on the treated subject, at a reasonable benefit/risk ratio applicable to any medical treatment.
  • the therapeutic effect may be objective (i.e., measurable by some test or marker) or subjective (i.e., subject gives an indication of or feels an effect).
  • therapeutically effective amount refers to an amount of a therapeutic fusion protein or composition effective to treat, ameliorate, or prevent a desired disease or condition, or to exhibit a detectable therapeutic or preventative effect, such as by ameliorating symptoms associated with the disease, preventing or delaying the onset of the disease, and/or also lessening the severity or frequency of symptoms of the disease.
  • a therapeutically effective amount is commonly administered in a dosing regimen that may comprise multiple unit doses.
  • a therapeutically effective amount (and/or an appropriate unit dose within an effective dosing regimen) may vary, for example, depending on route of administration, on combination with other pharmaceutical agents.
  • the specific therapeutically effective amount (and/or unit dose) for any particular patient may depend upon a variety of factors including the disorder being treated and the severity of the disorder; the activity of the specific pharmaceutical agent employed; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and/or rate of excretion or metabolism of the specific fusion protein employed; the duration of the treatment; and like factors as is well known in the medical arts.
  • treatment refers to any administration of a therapeutic fusion protein that partially or completely alleviates, ameliorates, relieves, inhibits, delays onset of, reduces severity of and/or reduces incidence of one or more symptoms or features of a particular disease, disorder, and/or condition.
  • Such treatment may be of a subject who does not exhibit signs of the relevant disease, disorder and/or condition and/or of a subject who exhibits only early signs of the disease, disorder, and/or condition.
  • such treatment may be of a subject who exhibits one or more established signs of the relevant disease, disorder and/or condition.
  • treatment can refer to improvement of cardiac status (e.g., increase of end-diastolic and/or end-systolic volumes, or reduction, amelioration or prevention of the progressive cardiomyopathy that is typically found in Pompe disease) or of pulmonary function (e.g., increase in crying vital capacity over baseline capacity, and/or normalization of oxygen desaturation during crying); improvement in neurodevelopment and/or motor skills (e.g., increase in AIMS score); reduction of glycogen levels in tissue of the individual affected by the disease; or any combination of these effects.
  • treatment includes improvement of glycogen clearance, particularly in reduction or prevention of Pompe disease-associated cardiomyopathy.
  • the present invention provides improved methods and compositions for targeting lysosomal enzymes based on the glycosylation-independent lysosomal targeting (GILT) technology.
  • the present invention provides IGF-II muteins that are resistant to furin and/or has reduced or diminished binding affinity for the insulin receptor and targeted therapeutic fusion proteins containing an IGF-II mutein of the invention.
  • the present invention also provides methods of making and using the same.
  • a lysosomal enzyme suitable for the invention includes any enzyme that is capable of reducing accumulated materials in mammalian lysosomes or that can rescue or ameliorate one or more lysosomal storage disease symptoms.
  • Suitable lysosomal enzymes include both wild-type or modified lysosomal enzymes and can be produced using recombinant or synthetic methods or purified from nature sources. Exemplary lysosomal enzymes are listed in Table 1. Table 1. Lysosomal Storage Diseases and associated enzyme defects
  • a lysosomal enzyme suitable for the invention includes a polypeptide sequence having 50-100%, including 50, 55, 60, 65, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 and 100%, sequence identity to the naturally-occurring polynucleotide sequence of a human enzyme shown in Tables 1, while still encoding a protein that is capable of reducing accumulated materials in mammalian lysosomes or that can rescue or ameliorate one or more lysosomal storage disease symptoms.
  • Percent (%) amino acid sequence identity with respect to the lysosomal enzyme sequences is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the naturally-occurring human enzyme sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
  • the WU-BLAST-2 software is used to determine amino acid sequence identity (Altschul et al, Methods in Enzvmology 266, 460-480 (1996); http://blast.wustl/edu/blast/README.html). WU-BLAST-2 uses several search parameters, most of which are set to the default values.
  • HSP score (S) and HSP S2 parameters are dynamic values and are established by the program itself, depending upon the composition of the particular sequence, however, the minimum values may be adjusted and are set as indicated above.
  • Pompe disease is a rare genetic disorder caused by a deficiency in the enzyme acid alpha-glucosidase (GAA), which is needed to break down glycogen, a stored form of sugar used for energy.
  • GAA acid alpha-glucosidase
  • Pompe disease is also known as glycogen storage disease type II, GSD II, type II glycogen storage disease, glycogenosis type II, acid maltase deficiency, alpha- 1,4-glucosidase deficiency, cardiomegalia glycogenic diffusa, and cardiac form of generalized glycogenosis.
  • the build-up of glycogen causes progressive muscle weakness (myopathy) throughout the body and affects various body tissues, particularly in the heart, skeletal muscles, liver, respiratory and nervous system.
  • Pompe disease The presenting clinical manifestations of Pompe disease can vary widely depending on the age of disease onset and residual GAA activity. Residual GAA activity correlates with both the amount and tissue distribution of glycogen accumulation as well as the severity of the disease. Infantile-onset Pompe disease (less than 1% of normal GAA activity) is the most severe form and is characterized by hypotonia, generalized muscle weakness, and hypertrophic cardiomyopathy, and massive glycogen accumulation in cardiac and other muscle tissues. Death usually occurs within one year of birth due to cardiorespiratory failure. Hirschhorn et al.
  • a GAA enzyme suitable for treating Pompe disease includes a wild-type human
  • GAA or a fragment or sequence variant thereof which retains the ability to cleave ⁇ l-4 linkages in linear oligosaccharides.
  • Enzyme replacement therapy is a therapeutic strategy to correct an enzyme deficiency by infusing the missing enzyme into the bloodstream.
  • enzyme is taken up by cells and transported to the lysosome, where the enzyme acts to eliminate material that has accumulated in the lysosomes due to the enzyme deficiency.
  • the therapeutic enzyme must be delivered to lysosomes in the appropriate cells in tissues where the storage defect is manifest.
  • Conventional lysosomal enzyme replacement therapeutics are delivered using carbohydrates naturally attached to the protein to engage specific receptors on the surface of the target cells.
  • One receptor, the cation-independent M6P receptor (CI-MPR) is particularly useful for targeting replacement lysosomal enzymes because the CI-MPR is present on the surface of most cell types.
  • C-MPR cation-independent mannose-6-phosphate receptor
  • M6P/IGF-II receptor "CI-MPR/IGF-II receptor,” “IGF-II receptor” or “IGF2 Receptor,” or abbreviations thereof, are used interchangeably herein, referring to the cellular receptor which binds both M6P and IGF-II.
  • GILT Glycosylation Independent Lysosomal Targeting
  • the GILT technology uses a peptide tag instead of M6P to engage the CI-MPR for lysosomal targeting.
  • a GILT tag is a protein, peptide, or other moiety that binds the CI-MPR in a mannose-6-phosphate- independent manner.
  • this technology mimics the normal biological mechanism for uptake of lysosomal enzymes, yet does so in a manner independent of mannose-6-phosphate.
  • a preferred GILT tag is derived from human insulin-like growth factor II (IGF-
  • Human IGF-II is a high affinity ligand for the CI-MPR, which is also referred to as IGF-II receptor. Binding of GILT-tagged therapeutic enzymes to the M6P/IGF-II receptor targets the protein to the lysosome via the endocytic pathway. This method has numerous advantages over methods involving glycosylation including simplicity and cost effectiveness, because once the protein is isolated, no further modifications need be made.
  • IGF-II derived GILT tag may be subjected to proteolytic cleavage by furin during production in mammalian cells (see the examples section).
  • Furin protease typically recognizes and cleaves a cleavage site having a consensus sequence Arg-X-X-Arg (SEQ ID NO: 2), X is any amino acid.
  • the cleavage site is positioned after the carboxy-terminal arginine (Arg) residue in the sequence.
  • a furin cleavage site has a consensus sequence Lys/Arg-X-X-X-Lys/Arg-Arg (SEQ ID NO: 3) , X is any amino acid.
  • the cleavage site is positioned after the carboxy- terminal arginine (Arg) residue in the sequence.
  • furin refers to any protease that can recognize and cleave the furin protease cleavage site as defined herein, including furin or furin-like protease.
  • Furin is also known as p_aired basic amino acid cleaving enzyme (PACE).
  • Furin belongs to the subtilisin-like proprotein convertase family that includes PC3, a protease responsible for maturation of pro insulin in pancreatic islet cells.
  • the gene encoding furin was known as FUR (FES Upstream Region).
  • the mature human IGF-II contains two potential overlapping furin cleavage sites between residues 34-40 (bolded and underlined). Arrows point to two potential furin cleavage positions.
  • furin-resistant GILT tags can be designed by mutating the amino acid sequence at one or more furin cleavage sites such that the mutation abolishes at least one furin cleavage site.
  • a furin-resistant GILT tag is a furin-resistant IGF-II mutein containing a mutation that abolishes at least one furin protease cleavage site or changes a sequence adjacent to the furin protease cleavage site such that the furin cleavage is prevented, inhibited, reduced or slowed down as compared to a wild-type IGF-II peptide (e.g., wild-type human mature IGF-II).
  • a suitable mutation does not impact the ability of the furin- resistant GILT tag to bind to the human cation-independent mannose-6-phosphate receptor.
  • a furin-resistant IGF-II mutein suitable for the invention binds to the human cation- independent mannose-6-phosphate receptor in a mannose-6-phosphate-independent manner with a dissociation constant of 10 ⁇ 7 M or less (e.g., 10 "8 , 10 "9 , 10 "10 , 10 "11 , or less) at pH 7.4.
  • a furin-resistant IGF-II mutein contains a mutation within a region corresponding to amino acids 30-40 (e.g., 31-40, 32-40, 33-40, 34-40, 30-39, 31-39, 32-39, 34-37, 32-39, 33- 39, 34-39, 35-39, 36-39, 37-40, 34-40) of SEQ ID NO:1.
  • a suitable mutation abolishes at least one furin protease cleavage site.
  • a mutation can be amino acid substitutions, deletions, insertions.
  • any one amino acid within the region corresponding to residues 30-40 e.g., 31-40, 32-40, 33-40, 34-40, 30-39, 31-39, 32-39, 34-37, 32-39, 33-39, 34-39, 35-39, 36-39, 37-40, 34-40) of SEQ ID NO:1 can be substituted with any other amino acid or deleted.
  • substitutions at position 34 may affect furin recognition of the first cleavage site. Insertion of one or more additional amino acids within each recognition site may abolish one or both furin cleavage sites. Deletion of one or more of the residues in the degenerate positions may also abolish both furin cleavage sites.
  • a furin-resistant IGF-II mutein contains amino acid substitutions at positions corresponding to Arg37 or Arg40 of SEQ ID NO: 1.
  • a furin-resistant IGF-II mutein contains a Lys or Ala substitution at positions Arg37 or Arg40.
  • Other substitutions are possible, including combinations of Lys and/or Ala mutations at both positions 37 and 40, or substitutions of amino acids other than Lys or Ala.
  • the furin-resistant IGF-II mutein suitable for the invention may contain additional mutations.
  • up to 30% or more of the residues of SEQ ID NO:1 may be changed (e.g., up to 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30% or more residues may be changed).
  • a furin-resistant IGF-II mutein suitable for the invention may have an amino acid sequence at least 70%, including at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99%, identical to SEQ ID NO:1.
  • a furin-resistant IGF-II mutein suitable for the invention is targeted specifically to the CI-MPR.
  • Particularly useful are mutations in the IGF-II polypeptide that result in a protein that binds the CI-MPR with high affinity (e.g., with a dissociation constant of 10 "7 M or less at pH 7.4) while binding other receptors known to be bound by IGF-II with reduced affinity relative to native IGF-II.
  • a furin-resistant IGF-II mutein suitable for the invention can be modified to have diminished binding affinity for the IGF-I receptor relative to the affinity of naturally-occurring human IGF-II for the IGF-I receptor.
  • the NMR structure of IGF-II shows that Thr 7 is located near residues 48 Phe and 50 Ser as well as near the 9 Cys-47 Cys disulfide bridge. It is thought that interaction of Thr 7 with these residues can stabilize the flexible N-terminal hexapeptide required for IGF-I receptor binding (Terasawa et al. (1994) EMBO J. 13(23)5590-7). At the same time this interaction can modulate binding to the IGF-II receptor. Truncation of the C-terminus of IGF-II (residues 62-67) also appear to lower the affinity of IGF-II for the IGF-I receptor by 5 fold (Roth et al. (1991) Biochem. Biophvs. Res. Commun. 181(2):907-14).
  • the binding surfaces for the IGF-I and cation-independent M6P receptors are on separate faces of IGF-II.
  • functional cation-independent M6P binding domains can be constructed that are substantially smaller than human IGF-II.
  • the amino terminal amino acids e.g., 1-7 or 2-7) and/or the carboxy terminal residues 62-67 can be deleted or replaced.
  • amino acids 29-40 can likely be eliminated or replaced without altering the folding of the remainder of the polypeptide or binding to the cation- independent M6P receptor.
  • a targeting moiety including amino acids 8-28 and 41-61 can be constructed. These stretches of amino acids could perhaps be joined directly or separated by a linker.
  • amino acids 8-28 and 41-61 can be provided on separate polypeptide chains.
  • Comparable domains of insulin which is homologous to IGF-II and has a tertiary structure closely related to the structure of IGF-II, have sufficient structural information to permit proper refolding into the appropriate tertiary structure, even when present in separate polypeptide chains (Wang et al. (1991) Trends Biochem. Sci. 279-281).
  • amino acids 8-28, or a conservative substitution variant thereof could be fused to a lysosomal enzyme; the resulting fusion protein could be admixed with amino acids 41-61, or a conservative substitution variant thereof, and administered to a patient.
  • IGF-II can also be modified to minimize binding to serum IGF -binding proteins
  • An alternate approach is to identify minimal regions of IGF-II that can bind with high affinity to the M6P/IGF-II receptor.
  • the residues that have been implicated in IGF-II binding to the M6P/IGF-II receptor mostly cluster on one face of IGF-II (Terasawa et al. (1994) EMBO J. 13(23):5590-7).
  • IGF-II tertiary structure is normally maintained by three intramolecular disulfide bonds, a peptide incorporating the amino acid sequence on the M6P/IGF-II receptor binding surface of IGF-II can be designed to fold properly and have binding activity.
  • Such a minimal binding peptide is a highly preferred lysosomal targeting domain.
  • a preferred lysosomal targeting domain is amino acids 8-67 of human IGF-II.
  • Designed peptides based on the region around amino acids 48-55, which bind to the M6P/IGF-II receptor, are also desirable lysosomal targeting domains.
  • a random library of peptides can be screened for the ability to bind the M6P/IGF-II receptor either via a yeast two hybrid assay, or via a phage display type assay. Binding affinity for the insulin receptor
  • a peptide tag suitable for the invention has reduced or diminished binding affinity for the insulin receptor relative to the affinity of naturally- occurring human IGF-II for the insulin receptor.
  • peptide tags with reduced or diminished binding affinity for the insulin receptor suitable for the invention include peptide tags having a binding affinity for the insulin receptor that is more than 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 12-fold, 14-fold, 16-fold, 18-fold, 20-fold, 50-fold, 100-fold less than that of the wild-type mature human IGF-II.
  • the binding affinity for the insulin receptor can be measured using various in vitro and in vivo assays known in the art. Exemplary binding assays are described in the Examples section.
  • IGF-II muteins can be prepared by introducing appropriate nucleotide changes into the IGF-II DNA, or by synthesis of the desired IGF-II polypeptide. Variations in the IGF-II sequence can be made, for example, using any of the techniques and guidelines for conservative and non-conservative mutations set forth, for instance, in U.S. Pat. No. 5,364,934. Variations may be a substitution, deletion or insertion of one or more codons encoding IGF-II that results in a change in the amino acid sequence of IGF-II as compared with a naturally-occurring sequence of mature human IGF-II.
  • Amino acid substitutions can be the result of replacing one amino acid with another amino acid having similar structural and/or chemical properties, such as the replacement of a leucine with a serine, i.e., conservative amino acid replacements. Amino acid substitutions can also be the result of replacing one amino acid with another amino acid having dis-similar structural and/or chemical properties, i.e., non-conservative amino acid replacements. Insertions or deletions may optionally be in the range of 1 to 5 amino acids.
  • the variation allowed may be determined by systematically making insertions, deletions or substitutions of amino acids in the sequence and testing the resulting variants for activity in the in vivo or in vitro assays known in the art (such as binding assays to the CI-MPR or furin cleavage assays).
  • Scanning amino acid analysis can also be employed to identify one or more amino acids along a contiguous sequence.
  • preferred scanning amino acids are relatively small, neutral amino acids.
  • Such amino acids include alanine, glycine, serine, and cysteine.
  • Alanine is typically a preferred scanning amino acid among this group because it eliminates the side-chain beyond the beta-carbon and is less likely to alter the main-chain conformation of the variant. Alanine is also typically preferred because it is the most common amino acid. Further, it is frequently found in both buried and exposed positions [Creighton, The Proteins, (W. H. Freeman & Co., N. Y.); Chothia, J. MoI. Biol. 150:1 (1976)]. If alanine substitution does not yield adequate amounts of variant, an isoteric amino acid can be used.
  • the variations can be made using methods known in the art such as oligonucleotide-mediated (site-directed) mutagenesis, alanine scanning, and PCR mutagenesis.
  • Site-directed mutagenesis [Carter et al., Nucl. Acids Res., 13:4331 (1986); Zoller et al., Nucl. Acids Res.. 10:6487 (1987)]
  • cassette mutagenesis [Wells et al., Gene. 34:315 (1985)]
  • restriction selection mutagenesis Wells et al., Philos. Trans. R. Soc. London SerA, 317:415 (1986)] or other known techniques can be performed on the cloned DNA to produce IGF-II muteins.
  • a furin-resistant GILT tag can be fused to the N-terminus or C-terminus of a polypeptide encoding a lysosomal enzyme.
  • the GILT tag can be fused directly to the lysosomal enzyme polypeptide or can be separated from the lysosomal enzyme polypeptide by a linker or a spacer.
  • An amino acid linker or spacer is generally designed to be flexible or to interpose a structure, such as an alpha-helix, between the two protein moieties.
  • a linker or spacer can be relatively short, such as the sequence Gly-Ala-Pro (SEQ ID NO: 4) or Gly-Gly-Gly-Gly-Pro (SEQ ID NO: 5), or can be longer, such as, for example, 10-25 amino acids in length.
  • the site of a fusion junction should be selected with care to promote proper folding and activity of both fusion partners and to prevent premature separation of a peptide tag from a GAA polypeptide.
  • the linker sequence is Gly-Ala-Pro (SEQ ID NO: 4).
  • Any mammalian cell or cell type susceptible to cell culture, and to expression of polypeptides may be utilized in accordance with the present invention, such as, for example, human embryonic kidney (HEK) 293, Chinese hamster ovary (CHO), monkey kidney (COS), HT1080, ClO, HeLa, baby hamster kidney (BHK), 3T3, C127, CV-I, HaK, NS/O, and L-929 cells.
  • HEK human embryonic kidney
  • COS Chinese hamster ovary
  • COS monkey kidney
  • HT1080 HT1080
  • HeLa HeLa
  • BHK baby hamster kidney
  • 3T3T3 C127
  • CV-I HaK
  • HaK HaK
  • NS/O NS/O
  • L-929 cells any mammalian cell or cell type susceptible to cell culture, and to expression of polypeptides
  • Non-limiting examples of mammalian cells include, but are not limited to, BALB/c mouse myeloma line (NSO/1, ECACC No: 85110503); human retinoblasts (PER.C6 (CruCell, Leiden, The Netherlands)); monkey kidney CVl line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol., 36:59 (1977)); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells +/-DHFR (CHO, Urlaub and Chasin, Proc. Natl.
  • BALB/c mouse myeloma line NSO/1, ECACC No: 85110503
  • human retinoblasts PER.C6 (CruCell, Leiden, The Netherlands)
  • monkey kidney CVl line transformed by SV40 COS-7, ATCC
  • the fusion protein of the present invention is produced from CHO cell lines.
  • the fusion protein of the invention can also be expressed in a variety of non- mammalian host cells such as, for example, insect (e.g., Sf-9, Sf-21, Hi5), plant (e.g., Leguminosa, cereal, or tobacco), yeast (e.g., S. cerivisae, P. pastoris), prokaryote (e.g., E. CoIi, B. subtilis and other Bacillus spp., Pseudomonas spp., Streptomyces spp), or fungus.
  • insect e.g., Sf-9, Sf-21, Hi5
  • plant e.g., Leguminosa, cereal, or tobacco
  • yeast e.g., S. cerivisae, P. pastoris
  • prokaryote e.g., E. CoIi, B. subtilis and other Bacillus spp., Pseudomonas spp., Strepto
  • a fusion protein with or without a furin-resistant GILT tag can be produced in furin-deficient cells.
  • furin-deficient cells refers to any cells whose furin protease activity is inhibited, reduced or eliminated. Furin-deficient cells include both mammalian and non-mammalian cells that do not produce furin or produce reduced amount or defective furin protease.
  • furin deficient cells that are known and available to the skilled artisan, including but not limited to FDl 1 cells (Gordon et al (1997) Infection and Immunity 65(8):3370 3375), and those mutant cells described in Moebring and Moehring (1983) Infection and Immunity 41(3):998 1009.
  • a furin deficient cell may be obtained by exposing the above-described mammalian and non-mammalian cells to mutagenesis treatment, e.g., irradiation, ethidium bromide, bromidated uridine (BrdU) and others, preferably chemical mutagenesis, and more preferred ethyl methane sulfonate mutagenesis, recovering the cells which survive the treatment and selecting for those cells which are found to be resistant to the toxicity of Pseudomonas exotoxin A (see Moehring and Moehrin (1983) Infection and Immunity 41(3):998 1009).
  • mutagenesis treatment e.g., irradiation, ethidium bromide, bromidated uridine (BrdU) and others, preferably chemical mutagenesis, and more preferred ethyl methane sulfonate mutagenesis
  • Targeted therapeutic proteins of the invention can be underglycosylated, that is, one or more carbohydrate structures that would normally be present on a naturally-occurring human protein is preferably omitted, removed, modified, or masked. Without wishing to be bound by any theories, it is contemplated that an underglycosylated protein may extend the half- life of the protein in a mammal. Underglycosylation can be achieved in many ways.
  • the targeted fusion protein of the invention can be produced using a secretory signal peptide to facilitate secretion of the fusion protein.
  • the fusion protein can be produced using an IGF-II signal peptide.
  • fusion protein produced using an IGF-II signal peptide has reduced mannose-6-phosphate (M6P) level on the surface of the protein compared to wild-type enzyme.
  • M6P mannose-6-phosphate
  • a protein may be completely underglycosylated (as when synthesized in E. coli), partially unglycosylated (as when synthesized in a mammalian system after disruption of one or more glycosylation sites by site- directed mutagenesis), or may have a non-mammalian glycosylation pattern.
  • underglycosylated fusion proteins may be generated by modifying, substituting or eliminating one or more glycosylation sites by site-directed mutagenesis.
  • wild-type GAA typically have seven sites that match the canonical recognition sequence for N-linked glycosylation, Asn-Xaa-Thr/Ser (SEQ ID NO: 7) (Xaa can be any residue except Pro), namely, Asn-140, -233, -390, -470, -652, -882 and -925 (Hoefsloot et al., 1988; Martiniuk et al., 1990b).
  • Asn may be changed or eliminated to generated underglycosylated GAA.
  • Asn may be changed to GIn.
  • a therapeutic fusion protein can be deglycosylated after synthesis.
  • deglycosylation can be through chemical or enzymatic treatments, and may lead to complete deglycosylation or, if only a portion of the carbohydrate structure is removed, partial deglycosylation.
  • glycosylation of a lysosomal enzyme is modified, e.g., by oxidation and reduction, to reduce clearance of the therapeutic protein from the blood.
  • a lysosomal enzyme can be deglycosylated by periodate treatment.
  • treatment with periodate and a reducing agent such as sodium borohydride is effective to modify the carbohydrate structure of most glycoproteins.
  • Periodate treatment oxidizes vicinal diols, cleaving the carbon-carbon bond and replacing the hydroxyl groups with aldehyde groups; borohydride reduces the aldehydes to hydroxyls.
  • aldehydes For example, at 1 mM concentration, periodate exclusively oxidizes sialic acid groups and at or above 10 mM all available vicinal diols are converted to aldehydes (Hermanson, G.T. 1996, Bioconjugate techniques. Academic press). Once formed, aldehyde groups are highly reactive and may form Schiff s base linkages with primary amino groups in the protein resulting intramolecular linkages. Therefore, aldehyde groups formed ought to be reduced to alcohol groups. A commonly used reducing agent is NaBH 4 and the reaction is best run under alkaline conditions. Many sugar residues including vicinal diols, therefore, are cleaved by this treatment.
  • Grubb, J.H., et al report treatment of human ⁇ -glucuronidase with sodium metaperiodate followed by sodium borohydride reduction.
  • the modified beta-glucuronidase retained 90% of activity, but lost both mannose and mannose-6- phosphate dependent receptor uptake activity.
  • the alkaline pH condition used in the reduction due to sodium borohydride reagent as described by Grubb et al is not suitable for all lysosomal enzymes, many of which are labile under alkaline conditions.
  • sodium cyanoborohydride is used as reducing agent. While the rate of reduction of aldehydes by cyanoborohydride is negligible at neutral pH and above, the rate of reaction becomes rapid at acidic pH (Borch, et al. 1971, JACS 93:2897). For example, regimens using sodium metaperiodate and cyanoborohydride at pH 3.5-4 can be used.
  • the reduction of sodium metaperiodate treated GAA involves use of sodium cyanoborohydride at acidic pH from pH 3.0 to pH 6.
  • Optimal conditions for the chemical modification can be readily determined by using two assays: loss of binding to ConA sepharose, and diminished uptake into J774E macrophage.
  • a therapeutic protein of the invention is typically administered to the individual alone, or in compositions or medicaments comprising the therapeutic protein (e.g., in the manufacture of a medicament for the treatment of the disease), as described herein.
  • the compositions can be formulated with a physiologically acceptable carrier or excipient to prepare a pharmaceutical composition.
  • the carrier and composition can be sterile. The formulation should suit the mode of administration.
  • Suitable pharmaceutically acceptable carriers include but are not limited to water, salt solutions (e.g., NaCl), saline, buffered saline, alcohols, glycerol, ethanol, gum arabic, vegetable oils, benzyl alcohols, polyethylene glycols, gelatin, carbohydrates such as lactose, amylose or starch, sugars such as mannitol, sucrose, or others, dextrose, magnesium stearate, talc, silicic acid, viscous paraffin, perfume oil, fatty acid esters, hydroxymethylcellulose, polyvinyl pyrolidone, etc., as well as combinations thereof.
  • the pharmaceutical preparations can, if desired, be mixed with auxiliary agents (e.g., lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, flavoring and/or aromatic substances and the like) which do not deleteriously react with the active compounds or interference with their activity.
  • auxiliary agents e.g., lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, flavoring and/or aromatic substances and the like
  • a water-soluble carrier suitable for intravenous administration is used.
  • the composition or medicament can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.
  • the composition can be a liquid solution, suspension, emulsion, tablet, pill, capsule, sustained release formulation, or powder.
  • the composition can also be formulated as a suppository, with traditional binders and carriers such as triglycerides.
  • Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, polyvinyl pyrollidone, sodium saccharine, cellulose, magnesium carbonate, etc.
  • the composition or medicament can be formulated in accordance with the routine procedures as a pharmaceutical composition adapted for administration to human beings.
  • a composition for intravenous administration typically is a solution in sterile isotonic aqueous buffer.
  • the composition may also include a solubilizing agent and a local anesthetic to ease pain at the site of the injection.
  • the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampule or sachette indicating the quantity of active agent.
  • the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water, saline or dextrose/water.
  • an ampule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
  • the therapeutic protein can be formulated as neutral or salt forms.
  • Pharmaceutically acceptable salts include those formed with free amino groups such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with free carboxyl groups such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
  • a therapeutic protein (or a composition or medicament containing a therapeutic protein) is administered by any appropriate route.
  • a therapeutic protein is administered intravenously.
  • a therapeutic protein is administered by direct administration to a target tissue, such as heart or muscle (e.g., intramuscular), or nervous system (e.g., direct injection into the brain; intraventricularly; intrathecally).
  • a therapeutic protein or a composition or medicament containing a therapeutic protein
  • a therapeutic protein (or a composition or medicament containing a therapeutic protein) can be administered alone, or in conjunction with other agents, such as antihistamines (e.g., diphenhydramine) or immunosuppressants or other immunotherapeutic agents which counteract anti-GILT-tagged lysosomal enzyme antibodies.
  • agents such as antihistamines (e.g., diphenhydramine) or immunosuppressants or other immunotherapeutic agents which counteract anti-GILT-tagged lysosomal enzyme antibodies.
  • antihistamines e.g., diphenhydramine
  • immunosuppressants e.g., anti-GILT-tagged lysosomal enzyme antibodies
  • the agent can be mixed into a composition containing the therapeutic protein, and thereby administered contemporaneously with the therapeutic protein; alternatively, the agent can be administered contemporaneously, without mixing (e.g., by "piggybacking" delivery of the agent on the intravenous line by which the therapeutic protein is also administered, or vice versa).
  • the agent can be administered separately (e.g., not admixed), but within a short time frame (e.g., within 24 hours) of administration of the therapeutic protein.
  • the therapeutic protein (or composition or medicament containing the therapeutic protein) is administered in a therapeutically effective amount (i.e., a dosage amount that, when administered at regular intervals, is sufficient to treat the disease, such as by ameliorating symptoms associated with the disease, preventing or delaying the onset of the disease, and/or also lessening the severity or frequency of symptoms of the disease, as described above).
  • a therapeutically effective amount i.e., a dosage amount that, when administered at regular intervals, is sufficient to treat the disease, such as by ameliorating symptoms associated with the disease, preventing or delaying the onset of the disease, and/or also lessening the severity or frequency of symptoms of the disease, as described above.
  • the dose which will be therapeutically effective for the treatment of the disease will depend on the nature and extent of the disease's effects, and can be determined by standard clinical techniques.
  • in vitro or in vivo assays may optionally be employed to help identify optimal dosage ranges using methods known in the art.
  • the precise dose to be employed will also depend on the route of administration, and the seriousness of the disease, and should be decided according to the judgment of a practitioner and each patient's circumstances. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems.
  • the therapeutically effective dosage amount can be, for example, about 0.1-1 mg/kg, about 1-5 mg/kg, about 5-20 mg/kg, about 20-50 mg/kg, or 20-100 mg/kg.
  • the effective dose for a particular individual can be varied (e.g., increased or decreased) over time, depending on the needs of the individual. For example, in times of physical illness or stress, or if disease symptoms worsen, the dosage amount can be increased.
  • the therapeutically effective amount of the therapeutic protein is administered at regular intervals, depending on the nature and extent of the disease's effects, and on an ongoing basis.
  • Administration at an "interval,” as used herein, indicates that the therapeutically effective amount is administered periodically (as distinguished from a one-time dose).
  • the interval can be determined by standard clinical techniques.
  • the therapeutic protein is administered bimonthly, monthly, twice monthly, triweekly, biweekly, weekly, twice weekly, thrice weekly, or daily.
  • the administration interval for a single individual need not be a fixed interval, but can be varied over time, depending on the needs of the individual. For example, in times of physical illness or stress, or if disease symptoms worsen, the interval between doses can be decreased.
  • the term “monthly” means administration once per month;
  • the term “triweekly” means administration once per three weeks (i.e., once every three weeks);
  • the term “biweekly” means administration once per two weeks (i.e., once every two weeks);
  • the term “weekly” means administration once per week; and the term “daily” means administration once per day.
  • the invention additionally pertains to a pharmaceutical composition
  • a pharmaceutical composition comprising a therapeutic protein, as described herein, in a container (e.g., a vial, bottle, bag for intravenous administration, syringe, etc.) with a label containing instructions for administration of the composition for treatment of Pompe disease, such as by the methods described herein.
  • a container e.g., a vial, bottle, bag for intravenous administration, syringe, etc.
  • a label containing instructions for administration of the composition for treatment of Pompe disease such as by the methods described herein.
  • Example 1 Furin cleaves an IGF-II based GILT tag
  • ZC-701 has been developed for the treatment of Pompe disease.
  • ZC-701 is a chimeric protein that contains an N-terminal IGF-II based GILT tag fused via a three amino acid spacer to residues 70-952 of human acid- ⁇ -glucosidase (hGAA).
  • ZC-701 includes amino acids 1 and 8-67 of human IGF-II (i.e., ⁇ 2-7 of mature human IGF-II), the spacer sequence Gly-Ala-Pro, and amino acids 70-952 of human GAA.
  • the full length amino acid sequence is shown below. The spacer sequence is bolded.
  • the sequence N-terminal to the spacer sequence reflects amino acids 1 and 8-67 of human IGF-II and the sequence C-terminal to the spacer sequence reflects amino acids 70-952 of human GAA.
  • the two potential overlapping furin cleavage sites within the IGF-II tag sequence is bolded and underlined. Arrows point to two potential furin cleavage positions.
  • IGF-II derived GILT tag on a fraction of the ZC-701 molecules is subjected to proteolytic cleavage by furin during production in CHO cells.
  • N-terminal analysis of ZC-701 batch 10-2- F45-54 revealed the presence of two n-terminal sequences. One conformed to the predicted n- terminus of ZC-701 indicating the presence of the predicted ZC-701 protein. The other n- terminal sequence aligned with sequence within the tag portion of ZC-701 indicating the presence of a derivative of ZC-701 consistent with an endoproteo lytic cleavage at amino acid residue 34 of ZC-701. Based on the estimated molar ratios of the two n-termini, this batch of ZC-701 was found to have about a 1 :1 ratio of intact and cleaved species.
  • each of the other batches of ZC-701 were subjected to n-terminal sequencing. All of the batches displayed the same two n-termini with the cleaved species ranging from 20-50% of the total compound.
  • Figure 1 shows a map of the amino terminus of ZC-701.
  • the two amino acid boxed residues are the sites of n-termini mapped in all of the ZC-701 batches.
  • the first of the N- termini is the site of signal peptide cleavage, which yields the predicted n-terminus of ZC-701.
  • the second boxed residue is the site of an undesired proteolytic cleavage event.
  • the amino acid sequence proximal to the cleavage site is Arg-Arg-Ser-Arg (SEQ ID NO: 9). This matches the canonical cleavage site of a protease present in CHO cells called furin, which cleaves after Arg- X-X-Arg (SEQ ID NO: 10).
  • Furin is a member of a family of prohormone convertases that includes PC3, a protease responsible for maturation of proinsulin in pancreatic islet cells.
  • PC3 cleavage site in proinsulin is conserved and identical to the site at which furin cleaves the IGF-II tag.
  • the Furin cleaved ZC-701 differs in molecular weight from intact ZC-701 by about 3000 daltons, which represents less than a 3% difference in molecular weight. Due to the heterogeneity of the oligosaccharide in the protein, the presence of the cleaved ZC-701 was not previously detected by SDS-PAGE. However, if ZC-701 is first deglycosylated by treatment with Peptide N-Glycosidase F (PNGase F), then the cleaved protein can be resolved from the intact ZC-701 by SDS-PAGE.
  • PNGase F Peptide N-Glycosidase F
  • lane 1 of the SDS-PAGE gel shows the electrophoretic pattern of deglycosylated purified ZC-701. Two bands are evident. The upper band is believed to be intact ZC-701 and the lower band is believed to be furin cleaved ZC-701. To prove that the lower band is indeed Furin cleaved ZC-701, same proteins loaded in lane 1 were first treated with furin and then loaded in lane 2. As shown in Figure 2, all of the proteins in lane 2 co- migrates with the lower band in lane 1 indicating that the lower band is in fact furin cleaved ZC- 701.
  • Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2-7-GAA70-952 (Plasmid p701). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7/K37-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2-7/K37-GAA70-952 (Plasmid pl459). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7/K37 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7/K37 cassette contains an Arg to Lys substitution at amino acid 37 of the human IGF- II sequence (uppercase bold). ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
  • the GILT ⁇ 2-7/K40-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2-7/K40-GAA70-952 (Plasmid pi 460). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7/K40 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7/K40 cassette contains an Arg to Lys substitution at amino acid 40 of the human IGF- II sequence (uppercase bold). ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
  • the GILT ⁇ 2-7/A37-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2-7/A37-GAA70-952 (Plasmid pi 461). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7/A37 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7/A37 cassette contains an Arg to Ala substitution at amino acid 37 of the human IGF- II sequence (uppercase bold). ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
  • the GILT ⁇ 2-7/A40-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2-7/A40-GAA70-952 (Plasmid pi 463). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7/A40 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7/A40 cassette contains an Arg to Ala substitution at amino acid 40 of the human IGF2 sequence (uppercase bold). ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
  • the GILT ⁇ 2-7M1/K37-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2-7Ml/K37-GAA70- 952 (Plasmid pl479). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7M1/K37 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7M1/K37 cassette contains an Arg to Lys substitution at amino acid 37 of the human IGF-II sequence (uppercase bold). ggtaccaagcttgccATGGGAATCCCAATGGGCAAGTCGATGCTGGTGCTGCTCACCTTCTT
  • the GILT ⁇ 2-7M1/A37-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2-7Ml/A37-GAA70- 952 (Plasmid pl487). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7M1/A37 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7M1/A37 cassette contains an Arg to AIa substitution at amino acid 37 of the human IGF-II sequence (uppercase bold). ggtaccaagcttgccATGGGAATCCCAATGGGCAAGTCGATGCTGGTGCTGCTCACCTTCTT
  • construct 1461 containing a R37A substitution is additionally resistant to addition of exogenous furin.
  • GILT ⁇ 2-7 ⁇ 30-39-GAA70-952 cassette was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2-7 ⁇ 30-39-GAA70-952 (Plasmid 1726). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7 ⁇ 30-39 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7 ⁇ 30-39 cassette contains a deletion of amino acid residues 30-39 (Arg-Pro-Ala-Ser- Arg-Val-Ser-Arg-Arg-Ser) from the human IGF-II sequence.
  • GILT ⁇ 2-7 ⁇ 31-39-GAA70-952 cassette was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2-7 ⁇ 31-39-GAA70-952 (Plasmid 1749). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7 ⁇ 31-39 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7 ⁇ 31-39 cassette contains a deletion of amino acid residues 31-39 (Pro-Ala-Ser-Arg- Val-Ser-Arg-Arg-Ser) from the human IGF-II sequence.
  • the GILT ⁇ 2-7 ⁇ 32-39-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2-7 ⁇ 32-39-GAA70-952 (Plasmid 1746). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7 ⁇ 32-39 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7 ⁇ 32-39 cassette contains a deletion of amino acid residues 32-39 (Ala-Ser-Arg-Val- Ser-Arg-Arg-Ser) from the human IGF-II sequence.
  • GILT ⁇ 2-7 ⁇ 33-39-GAA70-952 cassette was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2-7 ⁇ 33-39-GAA70-952 (Plasmid 1747). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7 ⁇ 33-39 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7 ⁇ 33-39 cassette contains a deletion of amino acid residues 33-39 (Ser-Arg-Val-Ser- Arg-Arg-Ser) from the human IGF-II sequence.
  • the GILT ⁇ 2-7 ⁇ 34-39-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2-7 ⁇ 34-39-GAA70-952 (Plasmid 1758). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7 ⁇ 34-39 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7 ⁇ 34-39 cassette contains a deletion of amino acid residues 34-39 (Arg-Val-Ser-Arg- Arg-Ser) from the human IGF-II sequence.
  • the GILT ⁇ 2-7 ⁇ 35-39-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2 ⁇ 7 ⁇ 35-39-GAA70-952 (Plasmid 1750). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7 ⁇ 35-39 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7 ⁇ 35-39 cassette contains a deletion of amino acid residues 35-39 (Val-Ser-Arg-Arg- Ser) from the human IGF-II sequence.
  • GILT ⁇ 2-7 ⁇ 36-39-GAA70-952 cassette was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2-7 ⁇ 36-39-GAA70-952 (Plasmid 1748). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7 ⁇ 36-39 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7 ⁇ 36-39 cassette contains a deletion of amino acid residues 36-39 (Ser-Arg-Arg-Ser) from the human IGF-II sequence. ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
  • the GILT ⁇ 2-7 ⁇ 29-40-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2-7 ⁇ 29-40-GAA70-952 (Plasmid 1751). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7 ⁇ 29-40 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7 ⁇ 29-40 cassette contains a deletion of amino acid residues 29-40 (Ser-Arg-Pro-Ala- Ser-Arg-Val-Ser-Arg-Arg-Ser-Arg) from the human IGF-II sequence.
  • the GILT ⁇ 2-7 ⁇ 30-40-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2-7 ⁇ 30-40-GAA70-952 (Plasmid 1752). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7 ⁇ 30-40 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7 ⁇ 30-40 cassette contains a deletion of amino acid residues 30-40 (Arg-Pro- AIa-S er- Arg-Val-Ser-Arg-Arg-Ser-Arg) from the human IGF-II sequence.
  • the GILT ⁇ 2-7 ⁇ 31-40-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2-7 ⁇ 31-40-GAA70-952 (Plasmid 1753). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7 ⁇ 31-40 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7 ⁇ 31-40 cassette contains a deletion of amino acid residues 31-40 (Pro-Ala-Ser-Arg- Val-Ser-Arg-Arg-Ser-Arg) from the human IGF-II sequence. ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
  • the GILT ⁇ 2-7 ⁇ 32-40-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2-7 ⁇ 32-40-GAA70-952 (Plasmid 1754). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7 ⁇ 32-40 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7 ⁇ 32-40 cassette contains a deletion of amino acid residues 32-40 (Ala-Ser-Arg-Val- Ser-Arg-Arg-Ser-Arg) from the human IGF-II sequence. ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
  • GILT ⁇ 2-7 ⁇ 33-40-GAA70-952 cassette was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2-7 ⁇ 33-40-GAA70-952 (Plasmid 1755). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7 ⁇ 33-40 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7 ⁇ 33-40 cassette contains a deletion of amino acid residues 33-40 (Ser-Arg-Val-Ser- Arg-Arg-Ser-Arg) from the human IGF-II sequence. ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
  • GILT ⁇ 2-7 ⁇ 34-40-GAA70-952 cassette was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2-7 ⁇ 34-40-GAA70-952 (Plasmid 1756). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7 ⁇ 34-40 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7 ⁇ 34-40 cassette contains a deletion of amino acid residues 34-40 (Arg-Val-Ser-Arg- Arg-Ser-Arg) from the human IGF-II sequence. ggtaccagctgctagcaagctaattcacaccaATGGG AATCCCAATGGGGAAGTCGATGCTGGTGCTTC
  • Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILT ⁇ 2- 7M1/L27A37-GAA70-952 (Plasmid 1763). Restriction sites for cloning are in lowercase bold.
  • the spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILT ⁇ 2-7M1/L27A37 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
  • the GILT ⁇ 2-7M1/L27A37 cassette contains Y27L and R37A substitutions in the human IGFII sequence.
  • the DNA sequence of the GILT cassette differs from the human DNA sequence at every 6 th codon.
  • GILT-tagged GAA plasmids were each transfected into suspension FreeStyle
  • 293-F cells as described by the manufacturer (Invitrogen). Briefly, cells were grown in Opti- MEM I media (Invitrogen) in polycarbonate shaker flasks on an orbital shaker at 37 0 C and 8% CO 2 . Cells were adjusted to a concentration of 1x10 6 cells/ml, then transfected with a 1:1:1 ratio of ml cells: ⁇ g DNA: ⁇ l 293fectin. Culture aliquots were harvested 5-7 days post-transfection and centrifuged at 5,000 x g for 5 minutes. Supernatants were stored frozen at -8O 0 C.
  • HIC Load Buffer 50 mM citrate pH 6.0, IM AmSO 4 .
  • the column was washed with 10 column volumes of HIC Wash Buffer (50 mM citrate pH 6.0, 0.8M AmSO 4 ), and eluted with 5 column volumes of HIC Elution Buffer (50 mM citrate pH 6.0).
  • GAA expression was determined by a para-nitrophenol (PNP) enzymatic assay.
  • GAA enzyme was incubated in 50 ⁇ l reaction mixture containing 100 mM sodium acetate pH 4.2 and 10 mM Para-Nitrophenol (PNP) ⁇ -glucoside substrate (Sigma N137). Reactions were incubated at 37 0 C for 20 minutes and stopped with 300 ⁇ l of 100 mM sodium carbonate. Absorbance at 405 nm was measured in 96-well microtiter plates and compared to standard curves derived from p-nitrophenol (Sigma N7660). 1 GAA PNP unit is defined as 1 nmole PNP hydrolyzed/ hour.
  • IGF2R IGF2 receptor
  • IGFlR IGF 1 receptor
  • IR insulin receptor
  • Receptors were coated at room temperature overnight onto Reacti-bind white plates (Pierce, Cat# 437111) in Coating Buffer (0.05M Carbonate buffer, pH 9.6) at a concentration of either 0.5 ⁇ g/well (IGF2R) or 1 ⁇ g/well (IGFlR, IR). Plates were washed with wash buffer (Phosphate Buffered Saline plus 0.05% Tween-20), then blocked in Super Blocking Buffer (Pierce, Cat#37516) for 1 hour.
  • wash buffer Phosphate Buffered Saline plus 0.05% Tween-20
  • biotinylated ligands (Cell Sciences) were added to wells; IGF2R wells received 8nM IGF2-biotin, IGFlR wells received 3OnM IGFl-biotin, and IR wells received 2OnM insulin-biotin.
  • wells also contained serial dilutions of the GILT-tagged GAA protein samples or non-biotinylated control ligands to act as binding inhibitors for the biotinylated ligands.
  • 1751 and 1752 proteins were not as effective as inhibitors compared to 701 or IGF-II (See Figure 6). This indicates that the 1751 and 1752 proteins, with deletions in the loop region corresponding to amino acids 30-40 of the GILT tag, had a reduced affinity for the insulin receptor compared to the intact GILT tag on 701 or IGF-II.
  • 1763 protein was not as effective as an inhibitor compared to 701, IGF-II or IGF-I (See Figure 7). This indicates that the 1763 protein, with ⁇ 2-7, Y27L and R37A mutations in the GILT tag, had a reduced affinity for the IGFl receptor compared to ZC-701 or IGF-II.
  • Protein ZC- 1487 was tested fro its binding affinity for the insulin receptor.
  • Protein ZC-1487 contains the GILTD2-7M1/A37 cassette contains with and Arg to Ala substitution at amino acid 37 of the human IGF2 sequence and is resistant to proteolysis by furin.
  • Two different batches of this protein purified from CHO cells, ZC-1487-B26 and ZC-1487-B28 were analyzed in an assay measuring the competition of biotinylated insulin binding to plate- bound insulin. [0141] An insulin receptor binding assay was conducted by competing insulin, IGF-II,
  • IGF-II, ZC701B20, B26 and B28 by serial dilutions (final concentrations are shown in Table 2).
  • lOOul of diluted Insulin, IGF-II, ZC710B20, ZC1487B26, and ZC1487B28 in 2OnM Insulin- biotin were added into the coated plates and the plates were incubated at room temperature for 2 hours. The plates were then washed 3 times with washing buffer.
  • lOOul of strepavidin-HRP working solution 50 ul strepavidin-HRP in 10 ml blocking buffer was added into the plates and the plates were incubated at room temperature for 30 minutes.
  • HEK293 cells were transfected with constructs 1479 (R37K), 1487 (R37A) or ZC-701. After harvest, culture supernatants were partially purified by HIC chromatography. All samples were treated with PNGase prior to electrophoresis.
  • Figure 10 shows partially purified preparations of targeted fusion proteins containing a furin-resistant IGF-II mutein tag analyzed by SDS-PAGE and immunoblotting. As can be seen, the fusion protein encoded by construct 1487 containing R37A mutation is resistant to exogenous furin.
  • Figure 11 illustrates exemplary uptake results of furin resistant GILT-tagged
  • exemplary K upt akes for proteins 1479, 1487, ZC-701, and purified ZC-701 are 4.5 nM, 4.4 nM, 5.0 nM and 2.6 nM, respectively, which indicates that the proteins encoded by constructs 1487 (R37A) and 1479 (R37K) retain the ability for efficient uptake into rat L6 myoblasts.
  • the efficient uptake of fusion proteins containing a furin-resistant GILT tag also indicates that the furin-resistant tag retains high affinity for the CI- MPR.
  • the invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process.
  • the invention also includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.
  • the invention encompasses variations, combinations, and permutations in which one or more limitations, elements, clauses, descriptive terms, etc., from one or more of the claims is introduced into another claim dependent on the same base claim (or, as relevant, any other claim) unless otherwise indicated or unless it would be evident to one of ordinary skill in the art that a contradiction or inconsistency would arise.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Wood Science & Technology (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • General Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Diabetes (AREA)
  • Biophysics (AREA)
  • Toxicology (AREA)
  • Endocrinology (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Microbiology (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Obesity (AREA)
  • Hematology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

The present invention provides further improved compositions and methods for efficient lysosomal targeting based on the GILT technology. Among other things, the present invention provides methods and compositions for targeting lysosomal enzymes to lysosomes using furin-resistant lysosomal targeting peptides. The present invention also provides methods and compositions for targeting lysosomal enzymes to lysosomes using a lysosomal targeting peptide that has reduced or diminished binding affinity for the insulin receptor.

Description

LYSOSOMAL TARGETING PEPTIDES AND USES THEREOF
REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of U.S. Provisional Patent Application No.
61/051,336, filed May 7, 2008 and U.S. Provisional Patent Application No. 61/144,106, filed January 12, 2009, the contents of each of which are hereby incorporated by reference in their entireties.
BACKGROUND
[0002] Normally, mammalian lysosomal enzymes are synthesized in the cytosol and traverse the ER where they are glycosylated with N-linked, high mannose type carbohydrate. In the golgi, the high mannose carbohydrate is modified on lysosomal proteins by the addition of mannose-6-phosphate (M6P) which targets these proteins to the lysosome. The M6P-modifϊed proteins are delivered to the lysosome via interaction with either of two M6P receptors. The most favorable form of modification is when two M6Ps are added to a high mannose carbohydrate.
[0003] More than forty lysosomal storage diseases (LSDs) are caused, directly or indirectly, by the absence of one or more lysosomal enzymes in the lysosome. Enzyme replacement therapy for LSDs is being actively pursued. Therapy generally requires that LSD proteins be taken up and delivered to the lysosomes of a variety of cell types in an M6P- dependent fashion. One possible approach involves purifying an LSD protein and modifying it to incorporate a carbohydrate moiety with M6P. This modified material may be taken up by the cells more efficiently than unmodified LSD proteins due to interaction with M6P receptors on the cell surface.
[0004] The inventors of the present application have previously developed a peptide- based targeting technology that allows more efficient delivery of therapeutic enzymes to the lysosomes. This proprietary technology is termed Glycosylation Independent Lysosomal Targeting (GILT) because a peptide tag replaces M6P as the moiety targeting the lysosomes. Details of the GILT technology are described in U.S. Application Publication No.s 2003- 0082176, 2004-0006008, 2003-0072761, 2005-0281805, 2005-0244400, and international publications WO 03/032913, WO 03/032727, WO 02/087510, WO 03/102583, WO 2005/078077, the disclosures of all of which are hereby incorporated by reference.
SUMMARY OF THE INVENTION
[0005] The present invention provides further improved compositions and methods for efficient lysosomal targeting based on the GILT technology. Among other things, the present invention provides methods and compositions for targeting lysosomal enzymes to lysosomes using furin-resistant lysosomal targeting peptides. The present invention also provides methods and compositions for targeting lysosomal enzymes to lysosomes using a lysosomal targeting peptide that has reduced or diminished binding affinity for the insulin receptor. The present invention encompasses unexpected discovery that furin-resistant lysosomal targeting peptides according to the invention have reduced binding affinity for the insulin receptor.
[0006] In some embodiments, the present invention provides a furin-resistant IGF-II mutein. In some embodiments, the present invention provides a furin-resistant IGF-II mutein having an amino acid sequence at least 70% identical to mature human IGF-II (SEQ ID NO: 1) and a mutation that abolishes at least one furin protease cleavage site.
[0007] In some embodiments, the present invention provides an IGF-II mutein comprising an amino acid sequence at least 70% identical to mature human IGF-II (SEQ ID NO:1) and a mutation that reduces or diminishes the binding affinity for the insulin receptor as compared to the wild-type human IGF-II.
[0008] In some embodiments, the furin-resistant IGF-II mutein has diminished binding affinity for the IGF-I receptor relative to the affinity of naturally-occurring human IGF-II for the IGF-I receptor. [0009] In some embodiments, the present invention provides a targeted therapeutic fusion protein containing a lysosomal enzyme; and an IGF-II mutein having an amino acid sequence at least 70% identical to mature human IGF-II (SEQ ID NO: 1), wherein the IGF-II mutein is resistant to furin cleavage and binds to the human cation-independent mannose-6- phosphate receptor in a mannose-6-phosphate-independent manner.
[0010] In some embodiments, the present invention provides a targeted therapeutic fusion protein containing a lysosomal enzyme; and an IGF-II mutein having an amino acid sequence at least 70% identical to mature human IGF-II (SEQ ID NO:1), and having diminished binding affinity for the insulin receptor relative to the affinity of naturally-occurring human IGF- II for the insulin receptor; wherein the IGF-II mutein binds to the human cation-independent mannose-6-phosphate receptor in a mannose-6-phosphate-independent manner.
[0011] In some embodiments, the present invention provides a targeted therapeutic fusion protein containing a lysosomal enzyme; and an IGF-II mutein having an amino acid sequence at least 70% identical to mature human IGF-II (SEQ ID NO:1), and having diminished binding affinity for the insulin receptor relative to the affinity of naturally-occurring human IGF- II for the insulin receptor; wherein the IGF-II mutein is resistant to furin cleavage and binds to the human cation-independent mannose-6-phosphate receptor in a mannose-6-phosphate- independent manner.
[0012] In some embodiments, an IGF-II mutein suitable for the invention includes a mutation within a region corresponding to amino acids 30-40 of SEQ ID NO: 1. In some embodiments, an IGF-II mutein suitable for the invention includes a mutation within a region corresponding to amino acids 34-40 of SEQ ID NO:1 such that the mutation abolishes at least one furin protease cleavage site. In some embodiments, a suitable mutation is an amino acid substitution, deletion and/or insertion. In some embodiments, the mutation is an amino acid substitution at a position corresponding to Arg37 or Arg40 of SEQ ID NO: 1. In some embodiments, the amino acid substitution is a Lys or Ala substitution.
[0013] In some embodiments, a suitable mutation is a deletion or replacement of amino acid residues corresponding to positions selected from the group consisting of 31 -40, 32-40, 33- 40, 34-40, 30-39, 31-39, 32-39, 34-37, 32-39, 33-39, 34-39, 35-39, 36-39, 37-40, 34-40 of SEQ ID NO:1, and combinations thereof.
[0014] In some embodiments, an IGF-II mutein according to the invention further contains a deletion or a replacement of amino acids corresponding to positions 2-7 of SEQ ID NO:1. In some embodiments, an IGF-II mutein according to the invention further includes a deletion or a replacement of amino acids corresponding to positions 1-7 of SEQ ID NO:1. In some embodiments, an IGF-II mutein according to the invention further contains a deletion or a replacement of amino acids corresponding to positions 62-67 of SEQ ID NO:1. hi some embodiments, an IGF-II mutein according to the invention further contains an amino acid substitution at a position corresponding to Tyr27, Leu43, or Ser26 of SEQ ID NO: 1. In some embodiments, an IGF-II mutein according to the invention contains at least an amino acid substitution selected from the group consisting of Tyr27Leu, Leu43Val, Ser26Phe and combinations thereof. In some embodiments, an IGF-II mutein according to the invention contains amino acids corresponding to positions 48-55 of SEQ ID NO: 1. In some embodiments, an IGF-II mutein according to the invention contains at least three amino acids selected from the group consisting of amino acids corresponding to positions 8, 48, 49, 50, 54, and 55 of SEQ ID NO:1. In some embodiments, an IGF-II mutein of the invention contains, at positions corresponding to positions 54 and 55 of SEQ ID NO:1, amino acids each of which is uncharged or negatively charged at pH 7.4. In some embodiments, the IGF-II mutein has diminished binding affinity for the IGF-I receptor relative to the affinity of naturally-occurring human IGF- II for the IGF-I receptor.
[0015] In some embodiments, a lysosomal enzyme suitable for the invention is human acid alpha-glucosidase (GAA), or a functional variant thereof. In some embodiments, a lysosomal enzyme suitable for the invention includes amino acids 70-952 of human GAA.
[0016] In some embodiments, a targeted therapeutic fusion protein of the invention further includes a spacer between the lysosomal enzyme and the furin-resistant IGF-II mutein. In some embodiments, the spacer contains an amino acid sequence Gly-Ala-Pro. [0017] The present invention also provides nucleic acids encoding the IGF-II mutein or the targeted therapeutic fusion protein as described in various embodiments above. The present invention further provides various cells containing the nucleic acid of the invention.
[0018] The present invention provides pharmaceutical compositions suitable for treating lysosomal storage disease containing a therapeutically effective amount of a targeted therapeutic fusion protein of the invention. The invention further provides methods of treating lysosomal storage diseases comprising administering to a subject in need of treatment a targeted therapeutic fusion protein according to the invention. In some embodiments, the lysosomal storage disease is Pompe Disease. In some embodiments, the lysosomal storage disease is Fabry Disease. In some embodiments, the lysosomal storage disease is Gaucher Disease.
[0019] In another aspect, the present invention provides a method of producing a targeted therapeutic fusion protein including a step of culturing mammalian cells in a cell culture medium, wherein the mammalian cells carry the nucleic acid of the invention, in particular, as described in various embodiments herein; and the culturing is performed under conditions that permit expression of the targeted therapeutic fusion protein.
[0020] In yet another aspect, the present invention provides a method of producing a targeted therapeutic fusion protein including a step of culturing furin-deficient cells (e.g., furin- deficient mammalian cells) in a cell culture medium, wherein the furin-deficient cells carry a nucleic acid encoding a fusion protein comprising a lysosomal enzyme and an IGF-II mutein having an amino acid sequence at least 70% identical to mature human IGF-II (SEQ ID NO:1), wherein the IGF-II mutein binds to the human cation-independent mannose-6-phosphate receptor in a mannose-6-phosphate-independent manner; and wherein the culturing is performed under conditions that permit expression of the targeted therapeutic fusion protein.
[0021] Other features, objects, and advantages of the present invention are apparent in the detailed description that follows. It should be understood, however, that the detailed description, while indicating embodiments of the present invention, is given by way of illustration only, not limitation. Various changes and modifications within the scope of the invention will become apparent to those skilled in the art from the detailed description. BRIEF DESCRIPTION OF THE DRAWINGS
[0022] The drawings are for illustration purposes only, not for limitation.
[0023] FIG. 1 illustrates a map of N-terminus of ZC-701. Two amino acid residues boxed are sites of cleavage events. The first is the site of signal peptide cleavage, the second is the site of a furin cleavage.
[0024] FIG. 2 illustrates an exemplary SDS-PAGE analysis of ZC-701 after treatment with PNGase F. The lane on the right has been additionally treated with furin.
[0025] FIG. 3 Left: Schematic illustration of exemplary ZC-701 mutants in which furin cleavage site is modified. Center: Exemplary SDS-PAGE analysis of PNGase treated mutants after 3-7 days of cell culture. Right: Exemplary SDS-PAGE analysis of PNGase-treated mutants treated with furin.
[0026] FIG. 4 illustrates exemplary competitive IGF-II receptor binding results.
[0027] FIG. 5 illustrates additional exemplary competitive IGF-II receptor binding results.
[0028] FIG. 6 illustrates exemplary insulin receptor competition assay results.
[0029] FIG. 7 illustrates exemplary IGF-I receptor competition assay results.
[0030] FIG. 8 illustrates exemplary results of certain insulin receptor binding assay.
[0031] FIG. 9 illustrates exemplary results of certain insulin receptor binding assay.
[0032] FIG. 10 illustrates exemplary analysis of partially purified GILT-tagged GAA from transient transfections. HEK293 cells were transfected with constructs 1479, 1487 or ZC- 701. After harvest, culture supernatants were partially purified by Hydrophobic Interaction Chromatography (HIC). All samples were treated with PNGase prior to electrophoresis. Left panels: SDS-PAGE of partially purified proteins. Purified ZC-701 B12 is shown as a control. Right panels: Immunoblot analysis of the partially purified proteins. The indicated primary antibody was used. Bottom panels were additionally treated with exogenous furin. The protein encoded by construct 1487 is identical in sequence to that encoded by construct 1461 (R37A). The protein encoded by construct 1479 is identical to that encoded by construct 1459 (R37K).
[0033] FIG. 11 illustrates exemplary uptake results of exemplary furin resistant GILT- tagged GAA into rat L6 myoblasts. Kuptakes for protein 1479, 1487, ZC-701, and purified ZC-701 are 4.5 nM, 4.4 nM, 5.0 nM and 2.6 nM respectively. The protein encoded by construct 1487 is identical in sequence to that encoded by construct 1461 in Figure 3 (R37A). The protein encoded by construct 1479 is identical to that encoded by construct 1459 in Figure 3 (R37K).
DEFINITIONS
[0034] Amelioration: As used herein, the term "amelioration" is meant the prevention, reduction or palliation of a state, or improvement of the state of a subject. Amelioration includes, but does not require complete recovery or complete prevention of a disease condition. In some embodiments, amelioration includes reduction of accumulated materials inside lysosomes of relevant diseases tissues.
[0035] Furin-resistant IGF-II mute in: As used herein, the term "furin-resistant IGF-II mutein" refers to an IGF-II-based peptide containing an altered amino acid sequence that abolishes at least one native furin protease cleavage site or changes a sequence close or adjacent to a native furin protease cleavage site such that the furin cleavage is prevented, inhibited, reduced, or slowed down as compared to a wild-type human IGF-II peptide. As used herein, a furin-resistant IGF-II mutein is also referred to as an IGF-II mutein that is resistant to furin.
[0036] Furin protease cleavage site: As used herein, the term "furin protease cleavage site" (also referred to as "furin cleavage site" or "furin cleavage sequence") refers to the amino acid sequence of a peptide or protein that serves as a recognition sequence for enzymatic protease cleavage by furin or furin-like proteases. Typically, a furin protease cleavage site has a consensus sequence Arg-X-X-Arg (SEQ ID NO: 2), X is any amino acid. The cleavage site is positioned after the carboxy-terminal arginine (Arg) residue in the sequence. In some embodiments, a furin cleavage site may have a consensus sequence Lys/Arg-X-X-X-Lys/Arg- Arg (SEQ ID NO: 3), X is any amino acid. The cleavage site is positioned after the carboxy- terminal arginine (Arg) residue in the sequence.
[0037] Furin: As used herein, the term "furin" refers to any protease that can recognize and cleave the furin protease cleavage site as defined herein, including furin or furin-like protease. Furin is also known as paired basic amino acid cleaving enzyme (PACE). Furin belongs to the subtilisin-like proprotein convertase family. The gene encoding furin was known as FUR (FES Upstream Region).
[0038] Furin-deficient cells: As used herein, the term "furin-deficient cells" refers to any cells whose furin protease activity is inhibited, reduced or eliminated. Furin-deficient cells include both mammalian and non-mammalian cells that do not produce furin or produce reduced amount of furin or defective furin protease.
[0039] Glycosylation Independent Lysosomal Targeting: As used herein, the term
"glycosylation independent lysosomal targeting" (also referred to as "GILT") refer to lysosomal targeting that is mannose-6-phosphate-independent.
[0040] Human acid alpha-glucosidase: As used herein, the term "human acid alpha- glucosidase" (also referred to as "GAA") refers to precursor wild-type form of human GAA or a functional variant that is capable of reducing glycogen levels in mammalian lysosomes or that can rescue or ameliorate one or more Pompe disease symptoms.
[0041] Improve, increase, or reduce: As used herein, the terms "improve," "increase" or
"reduce," or grammatical equivalents, indicate values that are relative to a baseline measurement, such as a measurement in the same individual prior to initiation of the treatment described herein, or a measurement in a control individual (or multiple control individuals) in the absence of the treatment described herein. A "control individual" is an individual afflicted with the same form of lysosomal storage disease (e.g., Pompe disease) as the individual being treated, who is about the same age as the individual being treated (to ensure that the stages of the disease in the treated individual and the control individual(s) are comparable).
[0042] Individual, subject, patient: As used herein, the terms "subject," "individual" or
"patient" refer to a human or a non-human mammalian subject. The individual (also referred to as "patient" or "subject") being treated is an individual (fetus, infant, child, adolescent, or adult human) suffering from a lysosomal storage disease, for example, Pompe disease (i.e., either infantile-, juvenile-, or adult-onset Pompe disease) or having the potential to develop a lysosomal storage disease (e.g., Pompe disease).
[0043] Lysosomal storage diseases: As used herein, "lysosomal storage diseases" refer to a group of genetic disorders that result from deficiency in at least one of the enzymes (e.g., acid hydrolases) that are required to break macromolecules down to peptides, amino acids, monosaccharides, nucleic acids and fatty acids in lysosomes. As a result, individuals suffering from lysosomal storage diseases have accumulated materials in lysosomes. Exemplary lysosomal storage diseases are listed in Table 1.
[0044] Lysosomal enzyme: As used herein, the term "lysosomal enzyme" refers to any enzyme that is capable of reducing accumulated materials in mammalian lysosomes or that can rescue or ameliorate one or more lysosomal storage disease symptoms. Lysosomal enzymes suitable for the invention include both wild-type or modified lysosomal enzymes and can be produced using recombinant and synthetic methods or purified from nature sources. Exemplary lysosomal enzymes are listed in Table 1.
[0045] Spacer: As used herein, the term "spacer" (also referred to as "linker") refers to a peptide sequence between two protein moieties in a fusion protein. A spacer is generally designed to be flexible or to interpose a structure, such as an alpha-helix, between the two protein moieties. A spacer can be relatively short, such as the sequence Gly-Ala-Pro (SEQ ID NO: 4) or Gly-Gly-Gly-Gly-Gly-Pro (SEQ ID NO: 5), or can be longer, such as, for example, 10-25 amino acids in length.
[0046] Therapeutically effective amount: As used herein, the term "therapeutically effective amount" refers to an amount of a targeted therapeutic fusion protein which confers a therapeutic effect on the treated subject, at a reasonable benefit/risk ratio applicable to any medical treatment. The therapeutic effect may be objective (i.e., measurable by some test or marker) or subjective (i.e., subject gives an indication of or feels an effect). In particular, the "therapeutically effective amount" refers to an amount of a therapeutic fusion protein or composition effective to treat, ameliorate, or prevent a desired disease or condition, or to exhibit a detectable therapeutic or preventative effect, such as by ameliorating symptoms associated with the disease, preventing or delaying the onset of the disease, and/or also lessening the severity or frequency of symptoms of the disease. A therapeutically effective amount is commonly administered in a dosing regimen that may comprise multiple unit doses. For any particular therapeutic fusion protein, a therapeutically effective amount (and/or an appropriate unit dose within an effective dosing regimen) may vary, for example, depending on route of administration, on combination with other pharmaceutical agents. Also, the specific therapeutically effective amount (and/or unit dose) for any particular patient may depend upon a variety of factors including the disorder being treated and the severity of the disorder; the activity of the specific pharmaceutical agent employed; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and/or rate of excretion or metabolism of the specific fusion protein employed; the duration of the treatment; and like factors as is well known in the medical arts.
[0047] Treatment: As used herein, the term "treatment" (also "treat" or "treating") refers to any administration of a therapeutic fusion protein that partially or completely alleviates, ameliorates, relieves, inhibits, delays onset of, reduces severity of and/or reduces incidence of one or more symptoms or features of a particular disease, disorder, and/or condition. Such treatment may be of a subject who does not exhibit signs of the relevant disease, disorder and/or condition and/or of a subject who exhibits only early signs of the disease, disorder, and/or condition. Alternatively or additionally, such treatment may be of a subject who exhibits one or more established signs of the relevant disease, disorder and/or condition. For example, treatment can refer to improvement of cardiac status (e.g., increase of end-diastolic and/or end-systolic volumes, or reduction, amelioration or prevention of the progressive cardiomyopathy that is typically found in Pompe disease) or of pulmonary function (e.g., increase in crying vital capacity over baseline capacity, and/or normalization of oxygen desaturation during crying); improvement in neurodevelopment and/or motor skills (e.g., increase in AIMS score); reduction of glycogen levels in tissue of the individual affected by the disease; or any combination of these effects. In some embodiments, treatment includes improvement of glycogen clearance, particularly in reduction or prevention of Pompe disease-associated cardiomyopathy. [0048] As used in this application, the terms "about" and "approximately" are used as equivalents. Any numerals used in this application with or without about/approximately are meant to cover any normal fluctuations appreciated by one of ordinary skill in the relevant art.
DETAILED DESCRIPTION OF THE INVENTION
[0049] The present invention provides improved methods and compositions for targeting lysosomal enzymes based on the glycosylation-independent lysosomal targeting (GILT) technology. Among other things, the present invention provides IGF-II muteins that are resistant to furin and/or has reduced or diminished binding affinity for the insulin receptor and targeted therapeutic fusion proteins containing an IGF-II mutein of the invention. The present invention also provides methods of making and using the same.
[0050] Various aspects of the invention are described in detail in the following sections.
The use of sections is not meant to limit the invention. Each section can apply to any aspect of the invention. In this application, the use of "or" means "and/or" unless stated otherwise.
Lysosomal enzymes
[0051] A lysosomal enzyme suitable for the invention includes any enzyme that is capable of reducing accumulated materials in mammalian lysosomes or that can rescue or ameliorate one or more lysosomal storage disease symptoms. Suitable lysosomal enzymes include both wild-type or modified lysosomal enzymes and can be produced using recombinant or synthetic methods or purified from nature sources. Exemplary lysosomal enzymes are listed in Table 1. Table 1. Lysosomal Storage Diseases and associated enzyme defects
Figure imgf000013_0001
Figure imgf000014_0001
Figure imgf000014_0002
Figure imgf000015_0001
Figure imgf000015_0002
[0052] In some embodiments, a lysosomal enzyme suitable for the invention includes a polypeptide sequence having 50-100%, including 50, 55, 60, 65, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 and 100%, sequence identity to the naturally-occurring polynucleotide sequence of a human enzyme shown in Tables 1, while still encoding a protein that is capable of reducing accumulated materials in mammalian lysosomes or that can rescue or ameliorate one or more lysosomal storage disease symptoms.
[0053] "Percent (%) amino acid sequence identity" with respect to the lysosomal enzyme sequences is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the naturally-occurring human enzyme sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. Preferably, the WU-BLAST-2 software is used to determine amino acid sequence identity (Altschul et al, Methods in Enzvmology 266, 460-480 (1996); http://blast.wustl/edu/blast/README.html). WU-BLAST-2 uses several search parameters, most of which are set to the default values. The adjustable parameters are set with the following values: overlap span=l, overlap fraction=0.125, world threshold (T)=I 1. HSP score (S) and HSP S2 parameters are dynamic values and are established by the program itself, depending upon the composition of the particular sequence, however, the minimum values may be adjusted and are set as indicated above.
Pompe disease
[0054] One exemplary lysosomal storage disease is Pompe disease. Pompe disease is a rare genetic disorder caused by a deficiency in the enzyme acid alpha-glucosidase (GAA), which is needed to break down glycogen, a stored form of sugar used for energy. Pompe disease is also known as glycogen storage disease type II, GSD II, type II glycogen storage disease, glycogenosis type II, acid maltase deficiency, alpha- 1,4-glucosidase deficiency, cardiomegalia glycogenic diffusa, and cardiac form of generalized glycogenosis. The build-up of glycogen causes progressive muscle weakness (myopathy) throughout the body and affects various body tissues, particularly in the heart, skeletal muscles, liver, respiratory and nervous system.
[0055] The presenting clinical manifestations of Pompe disease can vary widely depending on the age of disease onset and residual GAA activity. Residual GAA activity correlates with both the amount and tissue distribution of glycogen accumulation as well as the severity of the disease. Infantile-onset Pompe disease (less than 1% of normal GAA activity) is the most severe form and is characterized by hypotonia, generalized muscle weakness, and hypertrophic cardiomyopathy, and massive glycogen accumulation in cardiac and other muscle tissues. Death usually occurs within one year of birth due to cardiorespiratory failure. Hirschhorn et al. (2001) "Glycogen Storage Disease Type II: Acid Alpha-glucosidase (Acid Maltase) Deficiency," in Scriver et al., eds., The Metabolic and Molecular Basis of Inherited Disease, 8th Ed., New York: McGraw-Hill, 3389-3420. Juvenile-onset (1-10% of normal GAA activity) and adult-onset (10-40% of normal GAA activity) Pompe disease are more clinically heterogeneous, with greater variation in age of onset, clinical presentation, and disease progression. Juvenile- and adult-onset Pompe disease are generally characterized by lack of severe cardiac involvement, later age of onset, and slower disease progression, but eventual respiratory or limb muscle involvement results in significant morbidity and mortality. While life expectancy can vary, death generally occurs due to respiratory failure. Hirschhorn et al. (2001) "Glycogen Storage Disease Type II: Acid Alpha-glucosidase (Acid Maltase) Deficiency," in Scriver et ah, eds., The Metabolic and Molecular Basis of Inherited Disease, 8th Ed., New York: McGraw-Hill, 3389-3420.
[0056] A GAA enzyme suitable for treating Pompe disease includes a wild-type human
GAA, or a fragment or sequence variant thereof which retains the ability to cleave αl-4 linkages in linear oligosaccharides.
Enzyme replacement therapy
[0057] Enzyme replacement therapy (ERT) is a therapeutic strategy to correct an enzyme deficiency by infusing the missing enzyme into the bloodstream. As the blood perfuses patient tissues, enzyme is taken up by cells and transported to the lysosome, where the enzyme acts to eliminate material that has accumulated in the lysosomes due to the enzyme deficiency. For lysosomal enzyme replacement therapy to be effective, the therapeutic enzyme must be delivered to lysosomes in the appropriate cells in tissues where the storage defect is manifest. Conventional lysosomal enzyme replacement therapeutics are delivered using carbohydrates naturally attached to the protein to engage specific receptors on the surface of the target cells. One receptor, the cation-independent M6P receptor (CI-MPR), is particularly useful for targeting replacement lysosomal enzymes because the CI-MPR is present on the surface of most cell types.
[0058] The terms "cation-independent mannose-6-phosphate receptor (CI-MPR),"
"M6P/IGF-II receptor," "CI-MPR/IGF-II receptor," "IGF-II receptor" or "IGF2 Receptor," or abbreviations thereof, are used interchangeably herein, referring to the cellular receptor which binds both M6P and IGF-II.
Glycosylation Independent Lysosomal Targeting
[0059] We have developed a Glycosylation Independent Lysosomal Targeting (GILT) technology to target therapeutic enzymes to lysosomes. Specifically, the GILT technology uses a peptide tag instead of M6P to engage the CI-MPR for lysosomal targeting. Typically, a GILT tag is a protein, peptide, or other moiety that binds the CI-MPR in a mannose-6-phosphate- independent manner. Advantageously, this technology mimics the normal biological mechanism for uptake of lysosomal enzymes, yet does so in a manner independent of mannose-6-phosphate.
[0060] A preferred GILT tag is derived from human insulin-like growth factor II (IGF-
II). Human IGF-II is a high affinity ligand for the CI-MPR, which is also referred to as IGF-II receptor. Binding of GILT-tagged therapeutic enzymes to the M6P/IGF-II receptor targets the protein to the lysosome via the endocytic pathway. This method has numerous advantages over methods involving glycosylation including simplicity and cost effectiveness, because once the protein is isolated, no further modifications need be made.
[0061] Detailed description of the GILT technology and GILT tag can be found in U.S.
Publication Nos. 20030082176, 20040006008, 20040005309, and 20050281805, the teachings of all of which are hereby incorporated by references in their entireties. Furin-resistant GILT tag
[0062] During the course of development of GILT-tagged lysosomal enzymes for treating lysosomal storage disease, it has become apparent that the IGF-II derived GILT tag may be subjected to proteolytic cleavage by furin during production in mammalian cells (see the examples section). Furin protease typically recognizes and cleaves a cleavage site having a consensus sequence Arg-X-X-Arg (SEQ ID NO: 2), X is any amino acid. The cleavage site is positioned after the carboxy-terminal arginine (Arg) residue in the sequence. In some embodiments, a furin cleavage site has a consensus sequence Lys/Arg-X-X-X-Lys/Arg-Arg (SEQ ID NO: 3) , X is any amino acid. The cleavage site is positioned after the carboxy- terminal arginine (Arg) residue in the sequence. As used herein, the term "furin" refers to any protease that can recognize and cleave the furin protease cleavage site as defined herein, including furin or furin-like protease. Furin is also known as p_aired basic amino acid cleaving enzyme (PACE). Furin belongs to the subtilisin-like proprotein convertase family that includes PC3, a protease responsible for maturation of pro insulin in pancreatic islet cells. The gene encoding furin was known as FUR (FES Upstream Region).
[0063] The mature human IGF-II peptide sequence is shown below.
AYRPSETLCGGELVDTLOFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYC ATPAKSE (SEQ ID NO: 1)
[0064] As can be seen, the mature human IGF-II contains two potential overlapping furin cleavage sites between residues 34-40 (bolded and underlined). Arrows point to two potential furin cleavage positions.
[0065] We have developed modified GILT tags that are resistant to cleavage by furin and still retain ability to bind to the CI-MPR in a mannose-6-phosphate-independent manner. Specifically, furin-resistant GILT tags can be designed by mutating the amino acid sequence at one or more furin cleavage sites such that the mutation abolishes at least one furin cleavage site. Thus, in some embodiments, a furin-resistant GILT tag is a furin-resistant IGF-II mutein containing a mutation that abolishes at least one furin protease cleavage site or changes a sequence adjacent to the furin protease cleavage site such that the furin cleavage is prevented, inhibited, reduced or slowed down as compared to a wild-type IGF-II peptide (e.g., wild-type human mature IGF-II). Typically, a suitable mutation does not impact the ability of the furin- resistant GILT tag to bind to the human cation-independent mannose-6-phosphate receptor. In particular, a furin-resistant IGF-II mutein suitable for the invention binds to the human cation- independent mannose-6-phosphate receptor in a mannose-6-phosphate-independent manner with a dissociation constant of 10~7 M or less (e.g., 10"8, 10"9, 10"10, 10"11, or less) at pH 7.4. In some embodiments, a furin-resistant IGF-II mutein contains a mutation within a region corresponding to amino acids 30-40 (e.g., 31-40, 32-40, 33-40, 34-40, 30-39, 31-39, 32-39, 34-37, 32-39, 33- 39, 34-39, 35-39, 36-39, 37-40, 34-40) of SEQ ID NO:1. In some embodiments, a suitable mutation abolishes at least one furin protease cleavage site. A mutation can be amino acid substitutions, deletions, insertions. For example, any one amino acid within the region corresponding to residues 30-40 (e.g., 31-40, 32-40, 33-40, 34-40, 30-39, 31-39, 32-39, 34-37, 32-39, 33-39, 34-39, 35-39, 36-39, 37-40, 34-40) of SEQ ID NO:1 can be substituted with any other amino acid or deleted. For example, substitutions at position 34 may affect furin recognition of the first cleavage site. Insertion of one or more additional amino acids within each recognition site may abolish one or both furin cleavage sites. Deletion of one or more of the residues in the degenerate positions may also abolish both furin cleavage sites.
[0066] In some embodiments, a furin-resistant IGF-II mutein contains amino acid substitutions at positions corresponding to Arg37 or Arg40 of SEQ ID NO: 1. In some embodiments, a furin-resistant IGF-II mutein contains a Lys or Ala substitution at positions Arg37 or Arg40. Other substitutions are possible, including combinations of Lys and/or Ala mutations at both positions 37 and 40, or substitutions of amino acids other than Lys or Ala.
[0067] In some embodiments, the furin-resistant IGF-II mutein suitable for the invention may contain additional mutations. For example, up to 30% or more of the residues of SEQ ID NO:1 may be changed (e.g., up to 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30% or more residues may be changed). Thus, a furin-resistant IGF-II mutein suitable for the invention may have an amino acid sequence at least 70%, including at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99%, identical to SEQ ID NO:1.
[0068] In some embodiments, a furin-resistant IGF-II mutein suitable for the invention is targeted specifically to the CI-MPR. Particularly useful are mutations in the IGF-II polypeptide that result in a protein that binds the CI-MPR with high affinity (e.g., with a dissociation constant of 10"7 M or less at pH 7.4) while binding other receptors known to be bound by IGF-II with reduced affinity relative to native IGF-II. For example, a furin-resistant IGF-II mutein suitable for the invention can be modified to have diminished binding affinity for the IGF-I receptor relative to the affinity of naturally-occurring human IGF-II for the IGF-I receptor. For example, substitution of IGF-II residues Tyr 27 with Leu, Leu 43 with VaI or Ser 26 with Phe diminishes the affinity of IGF-II for the IGF-I receptor by 94-, 56-, and 4-fold respectively (Torres et al. (1995) J. MoI. Biol. 248(2):385-401). Deletion of residues 1-7 of human IGF-II resulted in a 30- fold decrease in affinity for the human IGF-I receptor and a concomitant 12 fold increase in affinity for the rat IGF-II receptor (Hashimoto et al. (1995) J. Biol. Chem. 270(30): 18013-8). The NMR structure of IGF-II shows that Thr 7 is located near residues 48 Phe and 50 Ser as well as near the 9 Cys-47 Cys disulfide bridge. It is thought that interaction of Thr 7 with these residues can stabilize the flexible N-terminal hexapeptide required for IGF-I receptor binding (Terasawa et al. (1994) EMBO J. 13(23)5590-7). At the same time this interaction can modulate binding to the IGF-II receptor. Truncation of the C-terminus of IGF-II (residues 62-67) also appear to lower the affinity of IGF-II for the IGF-I receptor by 5 fold (Roth et al. (1991) Biochem. Biophvs. Res. Commun. 181(2):907-14).
[0069] The binding surfaces for the IGF-I and cation-independent M6P receptors are on separate faces of IGF-II. Based on structural and mutational data, functional cation-independent M6P binding domains can be constructed that are substantially smaller than human IGF-II. For example, the amino terminal amino acids (e.g., 1-7 or 2-7) and/or the carboxy terminal residues 62-67 can be deleted or replaced. Additionally, amino acids 29-40 can likely be eliminated or replaced without altering the folding of the remainder of the polypeptide or binding to the cation- independent M6P receptor. Thus, a targeting moiety including amino acids 8-28 and 41-61 can be constructed. These stretches of amino acids could perhaps be joined directly or separated by a linker. Alternatively, amino acids 8-28 and 41-61 can be provided on separate polypeptide chains. Comparable domains of insulin, which is homologous to IGF-II and has a tertiary structure closely related to the structure of IGF-II, have sufficient structural information to permit proper refolding into the appropriate tertiary structure, even when present in separate polypeptide chains (Wang et al. (1991) Trends Biochem. Sci. 279-281). Thus, for example, amino acids 8-28, or a conservative substitution variant thereof, could be fused to a lysosomal enzyme; the resulting fusion protein could be admixed with amino acids 41-61, or a conservative substitution variant thereof, and administered to a patient.
[0070] IGF-II can also be modified to minimize binding to serum IGF -binding proteins
(Baxter (2000) Am. J. Physiol Endocrinol Metab. 278(6):967-76) to avoid sequestration of IGF- IFGILT constructs. A number of studies have localized residues in IGF-II necessary for binding to IGF-binding proteins. Constructs with mutations at these residues can be screened for retention of high affinity binding to the M6P/IGF-II receptor and for reduced affinity for IGF- binding proteins. For example, replacing Phe 26 of IGF-II with Ser is reported to reduce affinity of IGF-II for IGFBP-I and -6 with no effect on binding to the M6P/IGF-II receptor (Bach et al. (1993) J. Biol. Chem. 268(13):9246-54). Other substitutions, such as Lys for GIu 9, can also be advantageous. The analogous mutations, separately or in combination, in a region of IGF-I that is highly conserved with IGF-II result in large decreases in IGF-BP binding (Magee et al. (1999) Biochemistry 38(48):15863-70).
[0071] An alternate approach is to identify minimal regions of IGF-II that can bind with high affinity to the M6P/IGF-II receptor. The residues that have been implicated in IGF-II binding to the M6P/IGF-II receptor mostly cluster on one face of IGF-II (Terasawa et al. (1994) EMBO J. 13(23):5590-7). Although IGF-II tertiary structure is normally maintained by three intramolecular disulfide bonds, a peptide incorporating the amino acid sequence on the M6P/IGF-II receptor binding surface of IGF-II can be designed to fold properly and have binding activity. Such a minimal binding peptide is a highly preferred lysosomal targeting domain. For example, a preferred lysosomal targeting domain is amino acids 8-67 of human IGF-II. Designed peptides, based on the region around amino acids 48-55, which bind to the M6P/IGF-II receptor, are also desirable lysosomal targeting domains. Alternatively, a random library of peptides can be screened for the ability to bind the M6P/IGF-II receptor either via a yeast two hybrid assay, or via a phage display type assay. Binding affinity for the insulin receptor
[0072] The inventors of the present application discovered unexpectedly that many furin- resistant IGF-II muteins described herein have reduced or diminished binding affinity for the insulin receptor. Thus, in some embodiments, a peptide tag suitable for the invention has reduced or diminished binding affinity for the insulin receptor relative to the affinity of naturally- occurring human IGF-II for the insulin receptor. In some embodiments, peptide tags with reduced or diminished binding affinity for the insulin receptor suitable for the invention include peptide tags having a binding affinity for the insulin receptor that is more than 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 12-fold, 14-fold, 16-fold, 18-fold, 20-fold, 50-fold, 100-fold less than that of the wild-type mature human IGF-II. The binding affinity for the insulin receptor can be measured using various in vitro and in vivo assays known in the art. Exemplary binding assays are described in the Examples section.
Mutagenesis
[0073] IGF-II muteins can be prepared by introducing appropriate nucleotide changes into the IGF-II DNA, or by synthesis of the desired IGF-II polypeptide. Variations in the IGF-II sequence can be made, for example, using any of the techniques and guidelines for conservative and non-conservative mutations set forth, for instance, in U.S. Pat. No. 5,364,934. Variations may be a substitution, deletion or insertion of one or more codons encoding IGF-II that results in a change in the amino acid sequence of IGF-II as compared with a naturally-occurring sequence of mature human IGF-II. Amino acid substitutions can be the result of replacing one amino acid with another amino acid having similar structural and/or chemical properties, such as the replacement of a leucine with a serine, i.e., conservative amino acid replacements. Amino acid substitutions can also be the result of replacing one amino acid with another amino acid having dis-similar structural and/or chemical properties, i.e., non-conservative amino acid replacements. Insertions or deletions may optionally be in the range of 1 to 5 amino acids. The variation allowed may be determined by systematically making insertions, deletions or substitutions of amino acids in the sequence and testing the resulting variants for activity in the in vivo or in vitro assays known in the art (such as binding assays to the CI-MPR or furin cleavage assays).
[0074] Scanning amino acid analysis can also be employed to identify one or more amino acids along a contiguous sequence. Among the preferred scanning amino acids are relatively small, neutral amino acids. Such amino acids include alanine, glycine, serine, and cysteine. Alanine is typically a preferred scanning amino acid among this group because it eliminates the side-chain beyond the beta-carbon and is less likely to alter the main-chain conformation of the variant. Alanine is also typically preferred because it is the most common amino acid. Further, it is frequently found in both buried and exposed positions [Creighton, The Proteins, (W. H. Freeman & Co., N. Y.); Chothia, J. MoI. Biol. 150:1 (1976)]. If alanine substitution does not yield adequate amounts of variant, an isoteric amino acid can be used.
[0075] The variations can be made using methods known in the art such as oligonucleotide-mediated (site-directed) mutagenesis, alanine scanning, and PCR mutagenesis. Site-directed mutagenesis [Carter et al., Nucl. Acids Res., 13:4331 (1986); Zoller et al., Nucl. Acids Res.. 10:6487 (1987)], cassette mutagenesis [Wells et al., Gene. 34:315 (1985)], restriction selection mutagenesis [Wells et al., Philos. Trans. R. Soc. London SerA, 317:415 (1986)] or other known techniques can be performed on the cloned DNA to produce IGF-II muteins.
Spacer
[0076] A furin-resistant GILT tag can be fused to the N-terminus or C-terminus of a polypeptide encoding a lysosomal enzyme. The GILT tag can be fused directly to the lysosomal enzyme polypeptide or can be separated from the lysosomal enzyme polypeptide by a linker or a spacer. An amino acid linker or spacer is generally designed to be flexible or to interpose a structure, such as an alpha-helix, between the two protein moieties. A linker or spacer can be relatively short, such as the sequence Gly-Ala-Pro (SEQ ID NO: 4) or Gly-Gly-Gly-Gly-Gly-Pro (SEQ ID NO: 5), or can be longer, such as, for example, 10-25 amino acids in length. The site of a fusion junction should be selected with care to promote proper folding and activity of both fusion partners and to prevent premature separation of a peptide tag from a GAA polypeptide. In a preferred embodiment, the linker sequence is Gly-Ala-Pro (SEQ ID NO: 4).
[0077] Additional constructs of GILT-tagged GAA proteins that can be used in the methods and compositions of the present invention were described in detail in U.S. Publication No. 20050244400, the entire disclosure of which is incorporated herein by reference.
Cells
[0078] Any mammalian cell or cell type susceptible to cell culture, and to expression of polypeptides, may be utilized in accordance with the present invention, such as, for example, human embryonic kidney (HEK) 293, Chinese hamster ovary (CHO), monkey kidney (COS), HT1080, ClO, HeLa, baby hamster kidney (BHK), 3T3, C127, CV-I, HaK, NS/O, and L-929 cells. Non-limiting examples of mammalian cells that may be used in accordance with the present invention include, but are not limited to, BALB/c mouse myeloma line (NSO/1, ECACC No: 85110503); human retinoblasts (PER.C6 (CruCell, Leiden, The Netherlands)); monkey kidney CVl line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol., 36:59 (1977)); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells +/-DHFR (CHO, Urlaub and Chasin, Proc. Natl. Acad. Sci. USA, 77:4216 (1980)); mouse Sertoli cells (TM4, Mather, Biol. Reprod., 23:243-251 (1980)); monkey kidney cells (CVl ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-I 587); human cervical carcinoma cells (HeLa, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al., Annals N. Y. Acad. Sci.. 383:44-68 (1982)); MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2). In some embodiments, the fusion protein of the present invention is produced from CHO cell lines.
[0079] The fusion protein of the invention can also be expressed in a variety of non- mammalian host cells such as, for example, insect (e.g., Sf-9, Sf-21, Hi5), plant (e.g., Leguminosa, cereal, or tobacco), yeast (e.g., S. cerivisae, P. pastoris), prokaryote (e.g., E. CoIi, B. subtilis and other Bacillus spp., Pseudomonas spp., Streptomyces spp), or fungus.
[0080] In some embodiments, a fusion protein with or without a furin-resistant GILT tag can be produced in furin-deficient cells. As used herein, the term "furin-deficient cells" refers to any cells whose furin protease activity is inhibited, reduced or eliminated. Furin-deficient cells include both mammalian and non-mammalian cells that do not produce furin or produce reduced amount or defective furin protease. Exemplary furin deficient cells that are known and available to the skilled artisan, including but not limited to FDl 1 cells (Gordon et al (1997) Infection and Immunity 65(8):3370 3375), and those mutant cells described in Moebring and Moehring (1983) Infection and Immunity 41(3):998 1009. Alternatively, a furin deficient cell may be obtained by exposing the above-described mammalian and non-mammalian cells to mutagenesis treatment, e.g., irradiation, ethidium bromide, bromidated uridine (BrdU) and others, preferably chemical mutagenesis, and more preferred ethyl methane sulfonate mutagenesis, recovering the cells which survive the treatment and selecting for those cells which are found to be resistant to the toxicity of Pseudomonas exotoxin A (see Moehring and Moehrin (1983) Infection and Immunity 41(3):998 1009).
Underglycosylation
[0081] Targeted therapeutic proteins of the invention can be underglycosylated, that is, one or more carbohydrate structures that would normally be present on a naturally-occurring human protein is preferably omitted, removed, modified, or masked. Without wishing to be bound by any theories, it is contemplated that an underglycosylated protein may extend the half- life of the protein in a mammal. Underglycosylation can be achieved in many ways. In some embodiments, the targeted fusion protein of the invention can be produced using a secretory signal peptide to facilitate secretion of the fusion protein. For example, the fusion protein can be produced using an IGF-II signal peptide. In general, the fusion protein produced using an IGF-II signal peptide has reduced mannose-6-phosphate (M6P) level on the surface of the protein compared to wild-type enzyme. In some embodiments, a protein may be completely underglycosylated (as when synthesized in E. coli), partially unglycosylated (as when synthesized in a mammalian system after disruption of one or more glycosylation sites by site- directed mutagenesis), or may have a non-mammalian glycosylation pattern. For example, underglycosylated fusion proteins may be generated by modifying, substituting or eliminating one or more glycosylation sites by site-directed mutagenesis. For example, wild-type GAA typically have seven sites that match the canonical recognition sequence for N-linked glycosylation, Asn-Xaa-Thr/Ser (SEQ ID NO: 7) (Xaa can be any residue except Pro), namely, Asn-140, -233, -390, -470, -652, -882 and -925 (Hoefsloot et al., 1988; Martiniuk et al., 1990b). One or more Asn at the above described positions may be changed or eliminated to generated underglycosylated GAA. In some embodiments, Asn may be changed to GIn.
[0082] In some embodiments, a therapeutic fusion protein can be deglycosylated after synthesis. For example, deglycosylation can be through chemical or enzymatic treatments, and may lead to complete deglycosylation or, if only a portion of the carbohydrate structure is removed, partial deglycosylation.
[0083] In some embodiments, glycosylation of a lysosomal enzyme is modified, e.g., by oxidation and reduction, to reduce clearance of the therapeutic protein from the blood. For example, a lysosomal enzyme can be deglycosylated by periodate treatment. In particular, treatment with periodate and a reducing agent such as sodium borohydride is effective to modify the carbohydrate structure of most glycoproteins. Periodate treatment oxidizes vicinal diols, cleaving the carbon-carbon bond and replacing the hydroxyl groups with aldehyde groups; borohydride reduces the aldehydes to hydroxyls. For example, at 1 mM concentration, periodate exclusively oxidizes sialic acid groups and at or above 10 mM all available vicinal diols are converted to aldehydes (Hermanson, G.T. 1996, Bioconjugate techniques. Academic press). Once formed, aldehyde groups are highly reactive and may form Schiff s base linkages with primary amino groups in the protein resulting intramolecular linkages. Therefore, aldehyde groups formed ought to be reduced to alcohol groups. A commonly used reducing agent is NaBH4 and the reaction is best run under alkaline conditions. Many sugar residues including vicinal diols, therefore, are cleaved by this treatment. Nevertheless, while this treatment converts cyclic carbohydrates into linear carbohydrates, it does not completely remove the carbohydrate, minimizing risks of exposing potentially protease-sensitive or antigenic polypeptide sites. [0084] Grubb, J.H., et al (Grubb et al, 2008, PNAS 105:2616) report treatment of human β-glucuronidase with sodium metaperiodate followed by sodium borohydride reduction. The modified beta-glucuronidase retained 90% of activity, but lost both mannose and mannose-6- phosphate dependent receptor uptake activity. The alkaline pH condition used in the reduction due to sodium borohydride reagent as described by Grubb et al is not suitable for all lysosomal enzymes, many of which are labile under alkaline conditions.
[0085] Therefore, in some embodiments, sodium cyanoborohydride is used as reducing agent. While the rate of reduction of aldehydes by cyanoborohydride is negligible at neutral pH and above, the rate of reaction becomes rapid at acidic pH (Borch, et al. 1971, JACS 93:2897). For example, regimens using sodium metaperiodate and cyanoborohydride at pH 3.5-4 can be used.
[0086] For example, treatment of GAA or alpha galactosidase A, the enzymes deficient in Pompe and Fabry diseases respectively, with periodate and cyanoborohydride at pH 5.6 resulted in good recovery of enzyme activity. Enzyme was incubated with equal volume mixture containing 20 mM sodium metaperiodate and 40 niM sodium cyanoborohydride in 0.1 MNa acetate, pH 5.6 for 60 min on ice. The unreacted periodate was quenched with glycerol (10 % final concentration) for 15 min on ice. The proteins were finally exchanged into phosphate buffered saline, pH 6.2 by diafiltration using Amicon centrifugal filter devices. Other reducing reagents for example, dimethylamine borane, may also be useful to reduce aldehydes generated by sodium metaperiodate oxidation of glycoproteins such as GAA under acidic conditions.
[0087] Thus, in some embodiments, the reduction of sodium metaperiodate treated GAA involves use of sodium cyanoborohydride at acidic pH from pH 3.0 to pH 6. Optimal conditions for the chemical modification can be readily determined by using two assays: loss of binding to ConA sepharose, and diminished uptake into J774E macrophage.
[0088] For example, the ability of periodate/borohydride modified β-glucuronidase to bind to ConA-sepharose was compared to that of untreated β-glucuronidase. The enzymes were incubated with 50 μl ConA beads in 20 mM Tris-HCl, pH 6.8, 0.5 MNaCl for 15 min at room temperature. Beads were centrifuged at maximum speed for 15 sec. Supernatant (flow through) was carefully withdrawn, assayed for GUS activity and analyzed by SDS/PAGE. When we treated GUS exactly as reported in Grubb et al., 60% ConA binding activity was lost and unbound GUS was present only in the flow through of periodate treated and subsequently sodium borohydride reduced sample.
Administration of therapeutic proteins
[0089] In accordance of the invention, a therapeutic protein of the invention is typically administered to the individual alone, or in compositions or medicaments comprising the therapeutic protein (e.g., in the manufacture of a medicament for the treatment of the disease), as described herein. The compositions can be formulated with a physiologically acceptable carrier or excipient to prepare a pharmaceutical composition. The carrier and composition can be sterile. The formulation should suit the mode of administration.
[0090] Suitable pharmaceutically acceptable carriers include but are not limited to water, salt solutions (e.g., NaCl), saline, buffered saline, alcohols, glycerol, ethanol, gum arabic, vegetable oils, benzyl alcohols, polyethylene glycols, gelatin, carbohydrates such as lactose, amylose or starch, sugars such as mannitol, sucrose, or others, dextrose, magnesium stearate, talc, silicic acid, viscous paraffin, perfume oil, fatty acid esters, hydroxymethylcellulose, polyvinyl pyrolidone, etc., as well as combinations thereof. The pharmaceutical preparations can, if desired, be mixed with auxiliary agents (e.g., lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, flavoring and/or aromatic substances and the like) which do not deleteriously react with the active compounds or interference with their activity. In a preferred embodiment, a water-soluble carrier suitable for intravenous administration is used.
[0091] The composition or medicament, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. The composition can be a liquid solution, suspension, emulsion, tablet, pill, capsule, sustained release formulation, or powder. The composition can also be formulated as a suppository, with traditional binders and carriers such as triglycerides. Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, polyvinyl pyrollidone, sodium saccharine, cellulose, magnesium carbonate, etc. [0092] The composition or medicament can be formulated in accordance with the routine procedures as a pharmaceutical composition adapted for administration to human beings. For example, in a preferred embodiment, a composition for intravenous administration typically is a solution in sterile isotonic aqueous buffer. Where necessary, the composition may also include a solubilizing agent and a local anesthetic to ease pain at the site of the injection. Generally, the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampule or sachette indicating the quantity of active agent. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water, saline or dextrose/water. Where the composition is administered by injection, an ampule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
[0093] The therapeutic protein can be formulated as neutral or salt forms.
Pharmaceutically acceptable salts include those formed with free amino groups such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with free carboxyl groups such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
[0094] A therapeutic protein (or a composition or medicament containing a therapeutic protein) is administered by any appropriate route. In a preferred embodiment, a therapeutic protein is administered intravenously. In other embodiments, a therapeutic protein is administered by direct administration to a target tissue, such as heart or muscle (e.g., intramuscular), or nervous system (e.g., direct injection into the brain; intraventricularly; intrathecally). Alternatively, a therapeutic protein (or a composition or medicament containing a therapeutic protein) can be administered parenterally, transdermally, or transmucosally (e.g., orally or nasally). More than one route can be used concurrently, if desired.
[0095] A therapeutic protein (or a composition or medicament containing a therapeutic protein) can be administered alone, or in conjunction with other agents, such as antihistamines (e.g., diphenhydramine) or immunosuppressants or other immunotherapeutic agents which counteract anti-GILT-tagged lysosomal enzyme antibodies. The term, "in conjunction with," indicates that the agent is administered prior to, at about the same time as, or following the therapeutic protein (or a composition or medicament containing the therapeutic protein). For example, the agent can be mixed into a composition containing the therapeutic protein, and thereby administered contemporaneously with the therapeutic protein; alternatively, the agent can be administered contemporaneously, without mixing (e.g., by "piggybacking" delivery of the agent on the intravenous line by which the therapeutic protein is also administered, or vice versa). In another example, the agent can be administered separately (e.g., not admixed), but within a short time frame (e.g., within 24 hours) of administration of the therapeutic protein.
[0096] The therapeutic protein (or composition or medicament containing the therapeutic protein) is administered in a therapeutically effective amount (i.e., a dosage amount that, when administered at regular intervals, is sufficient to treat the disease, such as by ameliorating symptoms associated with the disease, preventing or delaying the onset of the disease, and/or also lessening the severity or frequency of symptoms of the disease, as described above). The dose which will be therapeutically effective for the treatment of the disease will depend on the nature and extent of the disease's effects, and can be determined by standard clinical techniques. In addition, in vitro or in vivo assays may optionally be employed to help identify optimal dosage ranges using methods known in the art. The precise dose to be employed will also depend on the route of administration, and the seriousness of the disease, and should be decided according to the judgment of a practitioner and each patient's circumstances. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems. The therapeutically effective dosage amount can be, for example, about 0.1-1 mg/kg, about 1-5 mg/kg, about 5-20 mg/kg, about 20-50 mg/kg, or 20-100 mg/kg. The effective dose for a particular individual can be varied (e.g., increased or decreased) over time, depending on the needs of the individual. For example, in times of physical illness or stress, or if disease symptoms worsen, the dosage amount can be increased.
[0097] The therapeutically effective amount of the therapeutic protein (or composition or medicament containing the therapeutic protein) is administered at regular intervals, depending on the nature and extent of the disease's effects, and on an ongoing basis. Administration at an "interval," as used herein, indicates that the therapeutically effective amount is administered periodically (as distinguished from a one-time dose). The interval can be determined by standard clinical techniques. In some embodiments, the therapeutic protein is administered bimonthly, monthly, twice monthly, triweekly, biweekly, weekly, twice weekly, thrice weekly, or daily. The administration interval for a single individual need not be a fixed interval, but can be varied over time, depending on the needs of the individual. For example, in times of physical illness or stress, or if disease symptoms worsen, the interval between doses can be decreased.
[0098] As used herein, the term "bimonthly" means administration once per two months
(i.e., once every two months); the term "monthly" means administration once per month; the term "triweekly" means administration once per three weeks (i.e., once every three weeks); the term "biweekly" means administration once per two weeks (i.e., once every two weeks); the term "weekly" means administration once per week; and the term "daily" means administration once per day.
[0099] The invention additionally pertains to a pharmaceutical composition comprising a therapeutic protein, as described herein, in a container (e.g., a vial, bottle, bag for intravenous administration, syringe, etc.) with a label containing instructions for administration of the composition for treatment of Pompe disease, such as by the methods described herein.
[0100] The invention will be further and more specifically described by the following examples. Examples, however, are included for illustration purposes, not for limitation.
EXAMPLES
Example 1 : Furin cleaves an IGF-II based GILT tag
[0101] ZC-701 has been developed for the treatment of Pompe disease. ZC-701 is a chimeric protein that contains an N-terminal IGF-II based GILT tag fused via a three amino acid spacer to residues 70-952 of human acid-α-glucosidase (hGAA). Specifically, ZC-701 includes amino acids 1 and 8-67 of human IGF-II (i.e., Δ2-7 of mature human IGF-II), the spacer sequence Gly-Ala-Pro, and amino acids 70-952 of human GAA. The full length amino acid sequence is shown below. The spacer sequence is bolded. The sequence N-terminal to the spacer sequence reflects amino acids 1 and 8-67 of human IGF-II and the sequence C-terminal to the spacer sequence reflects amino acids 70-952 of human GAA. The two potential overlapping furin cleavage sites within the IGF-II tag sequence is bolded and underlined. Arrows point to two potential furin cleavage positions.
AALCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPA
KSEGAPAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGAQ
MGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHF
TIKDPANRRYEVPLETPRVHSRAPSPLYSVEFSEEPFGVIVHRQLDGRVLLNTTVAPLFFA
DQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPFYLALE
DGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGY
PFMPPYWGLGFHLCRWGYSSTAITRQWENMTRAHFPLDVQWNDLD YMDSRRDFTFN
KDGFRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPL
IGKVWPGSTAFPDFTNPTALA WWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCP
NNELENPPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGT
RPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLG
NTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLY
TLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPL
GTWYDLQTVPIEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPG
LTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNEL
VRVTSEGAGLQLQKVTVLGVATAPQQ VLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFL
VSWC (SEQ ID NO: 8)
[0102] During the course of development of ZC-701 , it has become apparent that the
IGF-II derived GILT tag on a fraction of the ZC-701 molecules is subjected to proteolytic cleavage by furin during production in CHO cells. N-terminal analysis of ZC-701 batch 10-2- F45-54 revealed the presence of two n-terminal sequences. One conformed to the predicted n- terminus of ZC-701 indicating the presence of the predicted ZC-701 protein. The other n- terminal sequence aligned with sequence within the tag portion of ZC-701 indicating the presence of a derivative of ZC-701 consistent with an endoproteo lytic cleavage at amino acid residue 34 of ZC-701. Based on the estimated molar ratios of the two n-termini, this batch of ZC-701 was found to have about a 1 :1 ratio of intact and cleaved species.
[0103] Upon receipt of this result, each of the other batches of ZC-701 were subjected to n-terminal sequencing. All of the batches displayed the same two n-termini with the cleaved species ranging from 20-50% of the total compound. One batch, previously shown to have low uptake activity, displayed a set of n-termini indicative of additional proteolysis. We concluded that the proteolytic event responsible for the second species in all of our batches of ZC-701 was perpetrated by furin or a furin-like protease.
[0104] Figure 1 shows a map of the amino terminus of ZC-701. The two amino acid boxed residues are the sites of n-termini mapped in all of the ZC-701 batches. The first of the N- termini is the site of signal peptide cleavage, which yields the predicted n-terminus of ZC-701. The second boxed residue is the site of an undesired proteolytic cleavage event. The amino acid sequence proximal to the cleavage site is Arg-Arg-Ser-Arg (SEQ ID NO: 9). This matches the canonical cleavage site of a protease present in CHO cells called furin, which cleaves after Arg- X-X-Arg (SEQ ID NO: 10). Furin is a member of a family of prohormone convertases that includes PC3, a protease responsible for maturation of proinsulin in pancreatic islet cells. In fact the PC3 cleavage site in proinsulin is conserved and identical to the site at which furin cleaves the IGF-II tag.
[0105] The Furin cleaved ZC-701 differs in molecular weight from intact ZC-701 by about 3000 daltons, which represents less than a 3% difference in molecular weight. Due to the heterogeneity of the oligosaccharide in the protein, the presence of the cleaved ZC-701 was not previously detected by SDS-PAGE. However, if ZC-701 is first deglycosylated by treatment with Peptide N-Glycosidase F (PNGase F), then the cleaved protein can be resolved from the intact ZC-701 by SDS-PAGE.
[0106] As shown in Figure 2, lane 1 of the SDS-PAGE gel shows the electrophoretic pattern of deglycosylated purified ZC-701. Two bands are evident. The upper band is believed to be intact ZC-701 and the lower band is believed to be furin cleaved ZC-701. To prove that the lower band is indeed Furin cleaved ZC-701, same proteins loaded in lane 1 were first treated with furin and then loaded in lane 2. As shown in Figure 2, all of the proteins in lane 2 co- migrates with the lower band in lane 1 indicating that the lower band is in fact furin cleaved ZC- 701.
[0107] We have estimated the proportion of ZC-701 that has been cleaved with furin in a number of batches of ZC-701 by quantification of the band intensity in SDS-PAGE and by quantification of amino acids released in N-terminal sequencing experiments. As discussed above, the fraction of cleaved ZC-701 has ranged from 20% to 50% in different batches. Example 2. Targeted fusion proteins containing a furin-resistant IGF-II based GILT tag
[0108] We can design around the problem of furin cleavage by altering the amino acid sequence of IGF-II such that the amino acid alteration abolishes at least one furin cleavage site. A series of mutant versions of ZC-701 were generated and assayed for resistance to cleavage by furin. Exemplary mutant versions of ZC-701 were generated as described below.
ZC-701
[0109] The GILTΔ2-7-GAA70-952 cassette below was cloned using the Asp718 and
Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2-7-GAA70-952 (Plasmid p701). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70.
ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
TCACCTTCTTGGCCTTCGCCTCGTGCTGCATTGCTGCTCTGTGCGGCGGGGAGCTGGT
GGACACCCTCCAGTTCGTCTGTGGGGACCGCGGCTTCTACTTCAGCAGGCCCGCAAG
CCGTGTGAGCCGTCGCAGCCGTGGCATCGTTGAGGAGTGCTGTTTCCGCAGCTGTGA
CCTGGCCCTCCTGGAGACGTACTGTGCTACCCCCGCCAAGTCCGAGGGCGCGCCGgca caccccggccgtcccagagcagtgcccacacagtgcgacgtcccccccaacagccgcttcgattgcgcccctgacaaggccatcaccca ggaacagtgcgaggcccgcggctgctgctacatccctgcaaagcaggggctgcagggagcccagatggggcagccctggtgcttcttcc cacccagctaccccagctacaagctggagaacctgagctcctctgaaatgggctacacggccaccctgacccgtaccacccccaccttctt ccccaaggacatcctgaccctgcggctggacgtgatgatggagactgagaaccgcctccacttcacgatcaaagatccagctaacaggcg ctacgaggtgcccttggagaccccgcgtgtccacagccgggcaccgtccccactctacagcgtggagttctctgaggagcccttcggggt gatcgtgcaccggcagctggacggccgcgtgctgctgaacacgacggtggcgcccctgttctttgcggaccagttccttcagctgtccacc tcgctgccctcgcagtatatcacaggcctcgccgagcacctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaacc gggaccttgcgcccacgcccggtgcgaacctctacgggtctcaccctttctacctggcgctggaggacggcgggtcggcacacggggtg ttcctgctaaacagcaatgccatggatgtggtcctgcagccgagccctgcccttagctggaggtcgacaggtgggatcctggatgtctacat cttcctgggcccagagcccaagagcgtggtgcagcagtacctggacgttgtgggatacccgttcatgccgccatactggggcctgggcttc cacctgtgccgctggggctactcctccaccgctatcacccgccaggtggtggagaacatgaccagggcccacttccccctggacgtccaa tggaacgacctggactacatggactcccggagggacttcacgttcaacaaggatggcttccgggacttcccggccatggtgcaggagctg caccagggcggccggcgctacatgatgatcgtggatcctgccatcagcagctcgggccctgccgggagctacaggccctacgacgagg gtctgcggaggggggttttcatcaccaacgagaccggccagccgctgattgggaaggtatggcccgggtccactgccttccccgacttca ccaaccccacagccctggcctggtgggaggacatggtggctgagttccatgaccaggtgcccttcgacggcatgtggattgacatgaacg agccttccaacttcatcaggggctctgaggacggctgccccaacaatgagctggagaacccaccctacgtgcctggggtggttgggggga ccctccaggcggcaaccatctgtgcctccagccaccagtttctctccacacactacaacctgcacaacctctacggcctgaccgaagccatc gcctcccacagggcgctggtgaaggctcgggggacacgcccatttgtgatctcccgctcgacctttgctggccacggccgatacgccggc cactggacgggggacgtgtggagctcctgggagcagctcgcctcctccgtgccagaaatcctgcagtttaacctgctgggggtgcctctg gtcggggccgacgtctgcggcttcctgggcaacacctcagaggagctgtgtgtgcgctggacccagctgggggccttctaccccttcatgc ggaaccacaacagcctgctcagtctgccccaggagccgtacagcttcagcgagccggcccagcaggccatgaggaaggccctcaccct gcgctacgcactcctcccccacctctacacgctgttccaccaggcccacgtcgcgggggagaccgtggcccggcccctcttcctggagtt ccccaaggactctagcacctggactgtggaccaccagctcctgtggggggaggccctgctcatcaccccagtgctccaggccgggaagg ccgaagtgactggctacttccccttgggcacatggtacgacctgcagacggtgccaatagaggcccttggcagcctcccacccccacctg cagctccccgtgagccagccatccacagcgaggggcagtgggtgacgctgccggcccccctggacaccatcaacgtccacctccgggc tgggtacatcatccccctgcagggccctggcctcacaaccacagagtcccgccagcagcccatggccctggctgtggccctgaccaagg gtggagaggcccgaggggagctgttctgggacgatggagagagcctggaagtgctggagcgaggggcctacacacaggtcatcttcct ggccaggaataacacgatcgtgaatgagctggtacgtgtgaccagtgagggagctggcctgcagctgcagaaggtgactgtcctgggcg tggccacggcgccccagcaggtcctctccaacggtgtccctgtctccaacttcacctacagccccgacaccaaggtcctggacatctgtgtc tcgctgttgatgggagagcagtttctcgtcagctggtgttagtctagagcttgctagcggccgc (SEQ ID NO: 11)
Construct 1459
[0110] The GILTΔ2-7/K37-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2-7/K37-GAA70-952 (Plasmid pl459). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7/K37 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70. The GILTΔ2-7/K37 cassette contains an Arg to Lys substitution at amino acid 37 of the human IGF- II sequence (uppercase bold). ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
TCACCTTCTTGGCCTTCGCCTCGTGCTGCATTGCTGCTCTGTGCGGCGGGGAGCTGGT
GGACACCCTCCAGTTCGTCTGTGGGGACCGCGGCTTCTACTTCAGCAGGCCCGCAAG
CCGTGTGAGCAAGCGCAGCCGTGGCATCGTTGAGGAGTGCTGTTTCCGCAGCTGTGA
CCTGGCCCTCCTGGAGACGTACTGTGCTACCCCCGCCAAGTCCGAGGGCGCGCCGgca caccccggccgtcccagagcagtgcccacacagtgcgacgtcccccccaacagccgcttcgattgcgcccctgacaaggccatcaccca ggaacagtgcgaggcccgcggctgctgctacatccctgcaaagcaggggctgcagggagcccagatggggcagccctggtgcttcttcc cacccagctaccccagctacaagctggagaacctgagctcctctgaaatgggctacacggccaccctgacccgtaccacccccaccttctt ccccaaggacatcctgaccctgcggctggacgtgatgatggagactgagaaccgcctccacttcacgatcaaagatccagctaacaggcg ctacgaggtgcccttggagaccccgcgtgtccacagccgggcaccgtccccactctacagcgtggagttctctgaggagcccttcggggt gatcgtgcaccggcagctggacggccgcgtgctgctgaacacgacggtggcgcccctgttctttgcggaccagttccttcagctgtccacc tcgctgccctcgcagtatatcacaggcctcgccgagcacctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaacc gggaccttgcgcccacgcccggtgcgaacctctacgggtctcaccctttctacctggcgctggaggacggcgggtcggcacacggggtg ttcctgctaaacagcaatgccatggatgtggtcctgcagccgagccctgcccttagctggaggtcgacaggtgggatcctggatgtctacat cttcctgggcccagagcccaagagcgtggtgcagcagtacctggacgttgtgggatacccgttcatgccgccatactggggcctgggcttc cacctgtgccgctggggctactcctccaccgctatcacccgccaggtggtggagaacatgaccagggcccacttccccctggacgtccaa tggaacgacctggactacatggactcccggagggacttcacgttcaacaaggatggcttccgggacttcccggccatggtgcaggagctg caccagggcggccggcgctacatgatgatcgtggatcctgccatcagcagctcgggccctgccgggagctacaggccctacgacgagg gtctgcggaggggggttttcatcaccaacgagaccggccagccgctgattgggaaggtatggcccgggtccactgccttccccgacttca ccaaccccacagccctggcctggtgggaggacatggtggctgagttccatgaccaggtgcccttcgacggcatgtggattgacatgaacg agccttccaacttcatcaggggctctgaggacggctgccccaacaatgagctggagaacccaccctacgtgcctggggtggttgggggga ccctccaggcggcaaccatctgtgcctccagccaccagtttctctccacacactacaacctgcacaacctctacggcctgaccgaagccatc gcctcccacagggcgctggtgaaggctcgggggacacgcccatttgtgatctcccgctcgacctttgctggccacggccgatacgccggc cactggacgggggacgtgtggagctcctgggagcagctcgcctcctccgtgccagaaatcctgcagtttaacctgctgggggtgcctctg gtcggggccgacgtctgcggcttcctgggcaacacctcagaggagctgtgtgtgcgctggacccagctgggggccttctaccccttcatgc ggaaccacaacagcctgctcagtctgccccaggagccgtacagcttcagcgagccggcccagcaggccatgaggaaggccctcaccct gcgctacgcactcctcccccacctctacacgctgttccaccaggcccacgtcgcgggggagaccgtggcccggcccctcttcctggagtt ccccaaggactctagcacctggactgtggaccaccagctcctgtggggggaggccctgctcatcaccccagtgctccaggccgggaagg ccgaagtgactggctacttccccttgggcacatggtacgacctgcagacggtgccaatagaggcccttggcagcctcccacccccacctg cagctccccgtgagccagccatccacagcgaggggcagtgggtgacgctgccggcccccctggacaccatcaacgtccacctccgggc tgggtacatcatccccctgcagggccctggcctcacaaccacagagtcccgccagcagcccatggccctggctgtggccctgaccaagg gtggagaggcccgaggggagctgttctgggacgatggagagagcctggaagtgctggagcgaggggcctacacacaggtcatcttcct ggccaggaataacacgatcgtgaatgagctggtacgtgtgaccagtgagggagctggcctgcagctgcagaaggtgactgtcctgggcg tggccacggcgccccagcaggtcctctccaacggtgtccctgtctccaacttcacctacagccccgacaccaaggtcctggacatctgtgtc tcgctgttgatgggagagcagtttctcgtcagctggtgttagtctagagcttgctagcggccgc (SEQ ID NO: 12)
Construct 1460
[0111] The GILTΔ2-7/K40-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2-7/K40-GAA70-952 (Plasmid pi 460). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7/K40 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70. The GILTΔ2-7/K40 cassette contains an Arg to Lys substitution at amino acid 40 of the human IGF- II sequence (uppercase bold). ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
TCACCTTCTTGGCCTTCGCCTCGTGCTGCATTGCTGCTCTGTGCGGCGGGGAGCTGGT
GGACACCCTCCAGTTCGTCTGTGGGGACCGCGGCTTCTACTTCAGCAGGCCCGCAAG
CCGTGTGAGCCGTCGCAGCAAGGGCATCGTTGAGGAGTGCTGTTTCCGCAGCTGTGA
CCTGGCCCTCCTGGAGACGTACTGTGCTACCCCCGCCAAGTCCGAGGGCGCGCCGgca caccccggccgtcccagagcagtgcccacacagtgcgacgtcccccccaacagccgcttcgattgcgcccctgacaaggccatcaccca ggaacagtgcgaggcccgcggctgctgctacatccctgcaaagcaggggctgcagggagcccagatggggcagccctggtgcttcttcc cacccagctaccccagctacaagctggagaacctgagctcctctgaaatgggctacacggccaccctgacccgtaccacccccaccttctt ccccaaggacatcctgaccctgcggctggacgtgatgatggagactgagaaccgcctccacttcacgatcaaagatccagctaacaggcg ctacgaggtgcccttggagaccccgcgtgtccacagccgggcaccgtccccactctacagcgtggagttctctgaggagcccttcggggt gatcgtgcaccggcagctggacggccgcgtgctgctgaacacgacggtggcgcccctgttctttgcggaccagttccttcagctgtccacc tcgctgccctcgcagtatatcacaggcctcgccgagcacctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaacc gggaccttgcgcccacgcccggtgcgaacctctacgggtctcaccctttctacctggcgctggaggacggcgggtcggcacacggggtg ttcctgctaaacagcaatgccatggatgtggtcctgcagccgagccctgcccttagctggaggtcgacaggtgggatcctggatgtctacat cttcctgggcccagagcccaagagcgtggtgcagcagtacctggacgttgtgggatacccgttcatgccgccatactggggcctgggcttc cacctgtgccgctggggctactcctccaccgctatcacccgccaggtggtggagaacatgaccagggcccacttccccctggacgtccaa tggaacgacctggactacatggactcccggagggacttcacgttcaacaaggatggcttccgggacttcccggccatggtgcaggagctg caccagggcggccggcgctacatgatgatcgtggatcctgccatcagcagctcgggccctgccgggagctacaggccctacgacgagg gtctgcggaggggggttttcatcaccaacgagaccggccagccgctgattgggaaggtatggcccgggtccactgccttccccgacttca ccaaccccacagccctggcctggtgggaggacatggtggctgagttccatgaccaggtgcccttcgacggcatgtggattgacatgaacg agccttccaacttcatcaggggctctgaggacggctgccccaacaatgagctggagaacccaccctacgtgcctggggtggttgggggga ccctccaggcggcaaccatctgtgcctccagccaccagtttctctccacacactacaacctgcacaacctctacggcctgaccgaagccatc gcctcccacagggcgctggtgaaggctcgggggacacgcccatttgtgatctcccgctcgacctttgctggccacggccgatacgccggc cactggacgggggacgtgtggagctcctgggagcagctcgcctcctccgtgccagaaatcctgcagtttaacctgctgggggtgcctctg gtcggggccgacgtctgcggcttcctgggcaacacctcagaggagctgtgtgtgcgctggacccagctgggggccttctaccccttcatgc ggaaccacaacagcctgctcagtctgccccaggagccgtacagcttcagcgagccggcccagcaggccatgaggaaggccctcaccct gcgctacgcactcctcccccacctctacacgctgttccaccaggcccacgtcgcgggggagaccgtggcccggcccctcttcctggagtt ccccaaggactctagcacctggactgtggaccaccagctcctgtggggggaggccctgctcatcaccccagtgctccaggccgggaagg ccgaagtgactggctacttccccttgggcacatggtacgacctgcagacggtgccaatagaggcccttggcagcctcccacccccacctg cagctccccgtgagccagccatccacagcgaggggcagtgggtgacgctgccggcccccctggacaccatcaacgtccacctccgggc tgggtacatcatccccctgcagggccctggcctcacaaccacagagtcccgccagcagcccatggccctggctgtggccctgaccaagg gtggagaggcccgaggggagctgttctgggacgatggagagagcctggaagtgctggagcgaggggcctacacacaggtcatcttcct ggccaggaataacacgatcgtgaatgagctggtacgtgtgaccagtgagggagctggcctgcagctgcagaaggtgactgtcctgggcg tggccacggcgccccagcaggtcctctccaacggtgtccctgtctccaacttcacctacagccccgacaccaaggtcctggacatctgtgtc tcgctgttgatgggagagcagtttctcgtcagctggtgttagtctagagcttgctagcggccgc (SEQ ID NO: 13)
Construct 1461
[0112] The GILTΔ2-7/A37-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2-7/A37-GAA70-952 (Plasmid pi 461). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7/A37 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70. The GILTΔ2-7/A37 cassette contains an Arg to Ala substitution at amino acid 37 of the human IGF- II sequence (uppercase bold). ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
TCACCTTCTTGGCCTTCGCCTCGTGCTGCATTGCTGCTCTGTGCGGCGGGGAGCTGGT
GGACACCCTCCAGTTCGTCTGTGGGGACCGCGGCTTCTACTTCAGCAGGCCCGCAAG
CCGTGTGAGCGCTCGCAGCCGTGGCATCGTTGAGGAGTGCTGTTTCCGCAGCTGTGA
CCTGGCCCTCCTGGAGACGTACTGTGCTACCCCCGCCAAGTCCGAGGGCGCGCCGgca caccccggccgtcccagagcagtgcccacacagtgcgacgtcccccccaacagccgcttcgattgcgcccctgacaaggccatcaccca ggaacagtgcgaggcccgcggctgctgctacatccctgcaaagcaggggctgcagggagcccagatggggcagccctggtgcttcttcc cacccagctaccccagctacaagctggagaacctgagctcctctgaaatgggctacacggccaccctgacccgtaccacccccaccttctt ccccaaggacatcctgaccctgcggctggacgtgatgatggagactgagaaccgcctccacttcacgatcaaagatccagctaacaggcg ctacgaggtgcccttggagaccccgcgtgtccacagccgggcaccgtccccactctacagcgtggagttctctgaggagcccttcggggt gatcgtgcaccggcagctggacggccgcgtgctgctgaacacgacggtggcgcccctgttctttgcggaccagttccttcagctgtccacc tcgctgccctcgcagtatatcacaggcctcgccgagcacctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaacc gggaccttgcgcccacgcccggtgcgaacctctacgggtctcaccctttctacctggcgctggaggacggcgggtcggcacacggggtg ttcctgctaaacagcaatgccatggatgtggtcctgcagccgagccctgcccttagctggaggtcgacaggtgggatcctggatgtctacat cttcctgggcccagagcccaagagcgtggtgcagcagtacctggacgttgtgggatacccgttcatgccgccatactggggcctgggcttc cacctgtgccgctggggctactcctccaccgctatcacccgccaggtggtggagaacatgaccagggcccacttccccctggacgtccaa tggaacgacctggactacatggactcccggagggacttcacgttcaacaaggatggcttccgggacttcccggccatggtgcaggagctg caccagggcggccggcgctacatgatgatcgtggatcctgccatcagcagctcgggccctgccgggagctacaggccctacgacgagg gtctgcggaggggggttttcatcaccaacgagaccggccagccgctgattgggaaggtatggcccgggtccactgccttccccgacttca ccaaccccacagccctggcctggtgggaggacatggtggctgagttccatgaccaggtgcccttcgacggcatgtggattgacatgaacg agccttccaacttcatcaggggctctgaggacggctgccccaacaatgagctggagaacccaccctacgtgcctggggtggttgggggga ccctccaggcggcaaccatctgtgcctccagccaccagtttctctccacacactacaacctgcacaacctctacggcctgaccgaagccatc gcctcccacagggcgctggtgaaggctcgggggacacgcccatttgtgatctcccgctcgacctttgctggccacggccgatacgccggc cactggacgggggacgtgtggagctcctgggagcagctcgcctcctccgtgccagaaatcctgcagtttaacctgctgggggtgcctctg gtcggggccgacgtctgcggcttcctgggcaacacctcagaggagctgtgtgtgcgctggacccagctgggggccttctaccccttcatgc ggaaccacaacagcctgctcagtctgccccaggagccgtacagcttcagcgagccggcccagcaggccatgaggaaggccctcaccct gcgctacgcactcctcccccacctctacacgctgttccaccaggcccacgtcgcgggggagaccgtggcccggcccctcttcctggagtt ccccaaggactctagcacctggactgtggaccaccagctcctgtggggggaggccctgctcatcaccccagtgctccaggccgggaagg ccgaagtgactggctacttccccttgggcacatggtacgacctgcagacggtgccaatagaggcccttggcagcctcccacccccacctg cagctccccgtgagccagccatccacagcgaggggcagtgggtgacgctgccggcccccctggacaccatcaacgtccacctccgggc tgggtacatcatccccctgcagggccctggcctcacaaccacagagtcccgccagcagcccatggccctggctgtggccctgaccaagg gtggagaggcccgaggggagctgttctgggacgatggagagagcctggaagtgctggagcgaggggcctacacacaggtcatcttcct ggccaggaataacacgatcgtgaatgagctggtacgtgtgaccagtgagggagctggcctgcagctgcagaaggtgactgtcctgggcg tggccacggcgccccagcaggtcctctccaacggtgtccctgtctccaacttcacctacagccccgacaccaaggtcctggacatctgtgtc tcgctgttgatgggagagcagtttctcgtcagctggtgttagtctagagcttgctagcggccgc (SEQ ID NO: 14)
Construct 1463
[0113] The GILTΔ2-7/A40-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2-7/A40-GAA70-952 (Plasmid pi 463). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7/A40 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70. The GILTΔ2-7/A40 cassette contains an Arg to Ala substitution at amino acid 40 of the human IGF2 sequence (uppercase bold). ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
TCACCTTCTTGGCCTTCGCCTCGTGCTGCATTGCTGCTCTGTGCGGCGGGGAGCTGGT
GGACACCCTCCAGTTCGTCTGTGGGGACCGCGGCTTCTACTTCAGCAGGCCCGCAAG
CCGTGTGAGCCGTCGCAGCGCTGGCATCGTTGAGGAGTGCTGTTTCCGCAGCTGTGA
CCTGGCCCTCCTGGAGACGTACTGTGCTACCCCCGCCAAGTCCGAGGGCGCGCCGgca caccccggccgtcccagagcagtgcccacacagtgcgacgtcccccccaacagccgcttcgattgcgcccctgacaaggccatcaccca ggaacagtgcgaggcccgcggctgctgctacatccctgcaaagcaggggctgcagggagcccagatggggcagccctggtgcttcttcc cacccagctaccccagctacaagctggagaacctgagctcctctgaaatgggctacacggccaccctgacccgtaccacccccaccttctt ccccaaggacatcctgaccctgcggctggacgtgatgatggagactgagaaccgcctccacttcacgatcaaagatccagctaacaggcg ctacgaggtgcccttggagaccccgcgtgtccacagccgggcaccgtccccactctacagcgtggagttctctgaggagcccttcggggt gatcgtgcaccggcagctggacggccgcgtgctgctgaacacgacggtggcgcccctgttctttgcggaccagttccttcagctgtccacc tcgctgccctcgcagtatatcacaggcctcgccgagcacctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaacc gggaccttgcgcccacgcccggtgcgaacctctacgggtctcaccctttctacctggcgctggaggacggcgggtcggcacacggggtg ttcctgctaaacagcaatgccatggatgtggtcctgcagccgagccctgcccttagctggaggtcgacaggtgggatcctggatgtctacat cttcctgggcccagagcccaagagcgtggtgcagcagtacctggacgttgtgggatacccgttcatgccgccatactggggcctgggcttc cacctgtgccgctggggctactcctccaccgctatcacccgccaggtggtggagaacatgaccagggcccacttccccctggacgtccaa tggaacgacctggactacatggactcccggagggacttcacgttcaacaaggatggcttccgggacttcccggccatggtgcaggagctg caccagggcggccggcgctacatgatgatcgtggatcctgccatcagcagctcgggccctgccgggagctacaggccctacgacgagg gtctgcggaggggggttttcatcaccaacgagaccggccagccgctgattgggaaggtatggcccgggtccactgccttccccgacttca ccaaccccacagccctggcctggtgggaggacatggtggctgagttccatgaccaggtgcccttcgacggcatgtggattgacatgaacg agccttccaacttcatcaggggctctgaggacggctgccccaacaatgagctggagaacccaccctacgtgcctggggtggttgggggga ccctccaggcggcaaccatctgtgcctccagccaccagtttctctccacacactacaacctgcacaacctctacggcctgaccgaagccatc gcctcccacagggcgctggtgaaggctcgggggacacgcccatttgtgatctcccgctcgacctttgctggccacggccgatacgccggc cactggacgggggacgtgtggagctcctgggagcagctcgcctcctccgtgccagaaatcctgcagtttaacctgctgggggtgcctctg gtcggggccgacgtctgcggcttcctgggcaacacctcagaggagctgtgtgtgcgctggacccagctgggggccttctaccccttcatgc ggaaccacaacagcctgctcagtctgccccaggagccgtacagcttcagcgagccggcccagcaggccatgaggaaggccctcaccct gcgctacgcactcctcccccacctctacacgctgttccaccaggcccacgtcgcgggggagaccgtggcccggcccctcttcctggagtt ccccaaggactctagcacctggactgtggaccaccagctcctgtggggggaggccctgctcatcaccccagtgctccaggccgggaagg ccgaagtgactggctacttccccttgggcacatggtacgacctgcagacggtgccaatagaggcccttggcagcctcccacccccacctg cagctccccgtgagccagccatccacagcgaggggcagtgggtgacgctgccggcccccctggacaccatcaacgtccacctccgggc tgggtacatcatccccctgcagggccctggcctcacaaccacagagtcccgccagcagcccatggccctggctgtggccctgaccaagg gtggagaggcccgaggggagctgttctgggacgatggagagagcctggaagtgctggagcgaggggcctacacacaggtcatcttcct ggccaggaataacacgatcgtgaatgagctggtacgtgtgaccagtgagggagctggcctgcagctgcagaaggtgactgtcctgggcg tggccacggcgccccagcaggtcctctccaacggtgtccctgtctccaacttcacctacagccccgacaccaaggtcctggacatctgtgtc tcgctgttgatgggagagcagtttctcgtcagctggtgttagtctagagcttgctagcggccgc (SEQ ID NO: 15)
Construct 1479
[0114] The GILTΔ2-7M1/K37-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2-7Ml/K37-GAA70- 952 (Plasmid pl479). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7M1/K37 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70. The GILTΔ2-7M1/K37 cassette contains an Arg to Lys substitution at amino acid 37 of the human IGF-II sequence (uppercase bold). ggtaccaagcttgccATGGGAATCCCAATGGGCAAGTCGATGCTGGTGCTGCTCACCTTCTT
GGCCTTTGCCTCGTGCTGCATTGCCGCTCTGTGCGGCGGGGAACTGGTGGACACCCT
CCAATTCGTCTGTGGGGACCGGGGCTTCTACTTCAGCAGACCCGCAAGCCGTGTGAG
TAAGCGCAGCCGTGGCATTGTTGAGGAGTGCTGTTTTCGCAGCTGTGACCTGGCTCT
CCTGGAGACGTACTGCGCTACCCCCGCCAAGTCTGAGGGCGCGCCGgcacaccccggccgtc ccagagcagtgcccacacagtgcgacgtcccccccaacagccgcttcgattgcgcccctgacaaggccatcacccaggaacagtgcga ggcccgcggctgctgctacatccctgcaaagcaggggctgcagggagcccagatggggcagccctggtgcttcttcccacccagctacc ccagctacaagctggagaacctgagctcctctgaaatgggctacacggccaccctgacccgtaccacccccaccttcttccccaaggacat cctgaccctgcggctggacgtgatgatggagactgagaaccgcctccacttcacgatcaaagatccagctaacaggcgctacgaggtgcc cttggagaccccgcgtgtccacagccgggcaccgtccccactctacagcgtggagttctctgaggagcccttcggggtgatcgtgcaccg gcagctggacggccgcgtgctgctgaacacgacggtggcgcccctgttctttgcggaccagttccttcagctgtccacctcgctgccctcg cagtatatcacaggcctcgccgagcacctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaaccgggaccttgcg cccacgcccggtgcgaacctctacgggtctcaccctttctacctggcgctggaggacggcgggtcggcacacggggtgttcctgctaaac agcaatgccatggatgtggtcctgcagccgagccctgcccttagctggaggtcgacaggtgggatcctggatgtctacatcttcctgggccc agagcccaagagcgtggtgcagcagtacctggacgttgtgggatacccgttcatgccgccatactggggcctgggcttccacctgtgccg ctggggctactcctccaccgctatcacccgccaggtggtggagaacatgaccagggcccacttccccctggacgtccaatggaacgacct ggactacatggactcccggagggacttcacgttcaacaaggatggcttccgggacttcccggccatggtgcaggagctgcaccagggcg gccggcgctacatgatgatcgtggatcctgccatcagcagctcgggccctgccgggagctacaggccctacgacgagggtctgcggagg ggggttttcatcaccaacgagaccggccagccgctgattgggaaggtatggcccgggtccactgccttccccgacttcaccaaccccaca gccctggcctggtgggaggacatggtggctgagttccatgaccaggtgcccttcgacggcatgtggattgacatgaacgagccttccaact tcatcaggggctctgaggacggctgccccaacaatgagctggagaacccaccctacgtgcctggggtggttggggggaccctccaggcg gcaaccatctgtgcctccagccaccagtttctctccacacactacaacctgcacaacctctacggcctgaccgaagccatcgcctcccacag ggcgctggtgaaggctcgggggacacgcccatttgtgatctcccgctcgacctttgctggccacggccgatacgccggccactggacgg gggacgtgtggagctcctgggagcagctcgcctcctccgtgccagaaatcctgcagtttaacctgctgggggtgcctctggtcggggccg acgtctgcggcttcctgggcaacacctcagaggagctgtgtgtgcgctggacccagctgggggccttctaccccttcatgcggaaccacaa cagcctgctcagtctgccccaggagccgtacagcttcagcgagccggcccagcaggccatgaggaaggccctcaccctgcgctacgca ctcctcccccacctctacacgctgttccaccaggcccacgtcgcgggggagaccgtggcccggcccctcttcctggagttccccaaggact ctagcacctggactgtggaccaccagctcctgtggggggaggccctgctcatcaccccagtgctccaggccgggaaggccgaagtgact ggctacttccccttgggcacatggtacgacctgcagacggtgccaatagaggcccttggcagcctcccacccccacctgcagctccccgt gagccagccatccacagcgaggggcagtgggtgacgctgccggcccccctggacaccatcaacgtccacctccgggctgggtacatca tccccctgcagggccctggcctcacaaccacagagtcccgccagcagcccatggccctggctgtggccctgaccaagggtggagaggc ccgaggggagctgttctgggacgatggagagagcctggaagtgctggagcgaggggcctacacacaggtcatcttcctggccaggaata acacgatcgtgaatgagctggtacgtgtgaccagtgagggagctggcctgcagctgcagaaggtgactgtcctgggcgtggccacggcg ccccagcaggtcctctccaacggtgtccctgtctccaacttcacctacagccccgacaccaaggtcctggacatctgtgtctcgctgttgatg ggagagcagtttctcgtcagctggtgttagtctagagcttgctagcggccgc (SEQ ID NO: 16)
Construct 1487
[0115] The GILTΔ2-7M1/A37-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2-7Ml/A37-GAA70- 952 (Plasmid pl487). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7M1/A37 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70. The GILTΔ2-7M1/A37 cassette contains an Arg to AIa substitution at amino acid 37 of the human IGF-II sequence (uppercase bold). ggtaccaagcttgccATGGGAATCCCAATGGGCAAGTCGATGCTGGTGCTGCTCACCTTCTT
GGCCTTTGCCTCGTGCTGCATTGCCGCTCTGTGCGGCGGGGAACTGGTGGACACCCT
CCAATTCGTCTGTGGGGACCGGGGCTTCTACTTCAGCAGACCCGCAAGCCGTGTGAG
TGCTCGCAGCCGTGGCATTGTTGAGGAGTGCTGTTTTCGCAGCTGTGACCTGGCTCT
CCTGGAGACGTACTGCGCTACCCCCGCCAAGTCTGAGGGC GCGCCGgcacaccccggccgtc ccagagcagtgcccacacagtgcgacgtcccccccaacagccgcttcgattgcgcccctgacaaggccatcacccaggaacagtgcga ggcccgcggctgctgctacatccctgcaaagcaggggctgcagggagcccagatggggcagccctggtgcttcttcccacccagctacc ccagctacaagctggagaacctgagctcctctgaaatgggctacacggccaccctgacccgtaccacccccaccttcttccccaaggacat cctgaccctgcggctggacgtgatgatggagactgagaaccgcctccacttcacgatcaaagatccagctaacaggcgctacgaggtgcc cttggagaccccgcgtgtccacagccgggcaccgtccccactctacagcgtggagttctctgaggagcccttcggggtgatcgtgcaccg gcagctggacggccgcgtgctgctgaacacgacggtggcgcccctgttctttgcggaccagttccttcagctgtccacctcgctgccctcg cagtatatcacaggcctcgccgagcacctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaaccgggaccttgcg cccacgcccggtgcgaacctctacgggtctcaccctttctacctggcgctggaggacggcgggtcggcacacggggtgttcctgctaaac agcaatgccatggatgtggtcctgcagccgagccctgcccttagctggaggtcgacaggtgggatcctggatgtctacatcttcctgggccc agagcccaagagcgtggtgcagcagtacctggacgttgtgggatacccgttcatgccgccatactggggcctgggcttccacctgtgccg ctggggctactcctccaccgctatcacccgccaggtggtggagaacatgaccagggcccacttccccctggacgtccaatggaacgacct ggactacatggactcccggagggacttcacgttcaacaaggatggcttccgggacttcccggccatggtgcaggagctgcaccagggcg gccggcgctacatgatgatcgtggatcctgccatcagcagctcgggccctgccgggagctacaggccctacgacgagggtctgcggagg ggggttttcatcaccaacgagaccggccagccgctgattgggaaggtatggcccgggtccactgccttccccgacttcaccaaccccaca gccctggcctggtgggaggacatggtggctgagttccatgaccaggtgcccttcgacggcatgtggattgacatgaacgagccttccaact tcatcaggggctctgaggacggctgccccaacaatgagctggagaacccaccctacgtgcctggggtggttggggggaccctccaggcg gcaaccatctgtgcctccagccaccagtttctctccacacactacaacctgcacaacctctacggcctgaccgaagccatcgcctcccacag ggcgctggtgaaggctcgggggacacgcccatttgtgatctcccgctcgacctttgctggccacggccgatacgccggccactggacgg gggacgtgtggagctcctgggagcagctcgcctcctccgtgccagaaatcctgcagtttaacctgctgggggtgcctctggtcggggccg acgtctgcggcttcctgggcaacacctcagaggagctgtgtgtgcgctggacccagctgggggccttctaccccttcatgcggaaccacaa cagcctgctcagtctgccccaggagccgtacagcttcagcgagccggcccagcaggccatgaggaaggccctcaccctgcgctacgca ctcctcccccacctctacacgctgttccaccaggcccacgtcgcgggggagaccgtggcccggcccctcttcctggagttccccaaggact ctagcacctggactgtggaccaccagctcctgtggggggaggccctgctcatcaccccagtgctccaggccgggaaggccgaagtgact ggctacttccccttgggcacatggtacgacctgcagacggtgccaatagaggcccttggcagcctcccacccccacctgcagctccccgt gagccagccatccacagcgaggggcagtgggtgacgctgccggcccccctggacaccatcaacgtccacctccgggctgggtacatca tccccctgcagggccctggcctcacaaccacagagtcccgccagcagcccatggccctggctgtggccctgaccaagggtggagaggc ccgaggggagctgttctgggacgatggagagagcctggaagtgctggagcgaggggcctacacacaggtcatcttcctggccaggaata acacgatcgtgaatgagctggtacgtgtgaccagtgagggagctggcctgcagctgcagaaggtgactgtcctgggcgtggccacggcg ccccagcaggtcctctccaacggtgtccctgtctccaacttcacctacagccccgacaccaaggtcctggacatctgtgtctcgctgttgatg ggagagcagtttctcgtcagctggtgttagtctagagcttgctagcggccgc (SEQ ID NO: 17)
[0116] As shown in Figure 3, three exemplary mutants (i.e., constructs 1459, 1460 and
1461) in which alanine or lysine has been substituted for one of the canonical arginine residues were expressed without detectable cleavage by furin. As also shown in Figure 3 (right panel), construct 1461 containing a R37A substitution is additionally resistant to addition of exogenous furin.
Construct 1726
[0117] The GILTΔ2-7Δ30-39-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2-7Δ30-39-GAA70-952 (Plasmid 1726). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7Δ30-39 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70. The GILTΔ2-7Δ30-39 cassette contains a deletion of amino acid residues 30-39 (Arg-Pro-Ala-Ser- Arg-Val-Ser-Arg-Arg-Ser) from the human IGF-II sequence. ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
TCACCTTCTTGGCCTTCGCCTCGTGCTGCATTGCTGCTCTGTGCGGCGGGGAGCTGGT
GGACACCCTCCAGTTCGTCTGTGGGGACCGCGGCTTCTACTTCAGCCGTGGCATCGT
TGAGGAGTGCTGTTTCCGCAGCTGTGACCTGGCCCTCCTGGAGACGTACTGTGCTAC
CCCCGCCAAGTCCGAGGGCGCGCCGgcacaccccggccgtcccagagcagtgcccacacagtgcgacgtcccc cccaacagccgcttcgattgcgcccctgacaaggccatcacccaggaacagtgcgaggcccgcggctgctgctacatccctgcaaagca ggggctgcagggagcccagatggggcagccctggtgcttcttcccacccagctaccccagctacaagctggagaacctgagctcctctga aatgggctacacggccaccctgacccgtaccacccccaccttcttccccaaggacatcctgaccctgcggctggacgtgatgatggagact gagaaccgcctccacttcacgatcaaagatccagctaacaggcgctacgaggtgcccttggagaccccgcgtgtccacagccgggcacc gtccccactctacagcgtggagttctctgaggagcccttcggggtgatcgtgcaccggcagctggacggccgcgtgctgctgaacacgac ggtggcgcccctgttctttgcggaccagttccttcagctgtccacctcgctgccctcgcagtatatcacaggcctcgccgagcacctcagtcc cctgatgctcagcaccagctggaccaggatcaccctgtggaaccgggaccttgcgcccacgcccggtgcgaacctctacgggtctcaccc tttctacctggcgctggaggacggcgggtcggcacacggggtgttcctgctaaacagcaatgccatggatgtggtcctgcagccgagccct gcccttagctggaggtcgacaggtgggatcctggatgtctacatcttcctgggcccagagcccaagagcgtggtgcagcagtacctggac gttgtgggatacccgttcatgccgccatactggggcctgggcttccacctgtgccgctggggctactcctccaccgctatcacccgccaggt ggtggagaacatgaccagggcccacttccccctggacgtccaatggaacgacctggactacatggactcccggagggacttcacgttcaa caaggatggcttccgggacttcccggccatggtgcaggagctgcaccagggcggccggcgctacatgatgatcgtggatcctgccatca gcagctcgggccctgccgggagctacaggccctacgacgagggtctgcggaggggggttttcatcaccaacgagaccggccagccgct gattgggaaggtatggcccgggtccactgccttccccgacttcaccaaccccacagccctggcctggtgggaggacatggtggctgagtt ccatgaccaggtgcccttcgacggcatgtggattgacatgaacgagccttccaacttcatcaggggctctgaggacggctgccccaacaat gagctggagaacccaccctacgtgcctggggtggttggggggaccctccaggcggcaaccatctgtgcctccagccaccagtttctctcc acacactacaacctgcacaacctctacggcctgaccgaagccatcgcctcccacagggcgctggtgaaggctcgggggacacgcccatt tgtgatctcccgctcgacctttgctggccacggccgatacgccggccactggacgggggacgtgtggagctcctgggagcagctcgcctc ctccgtgccagaaatcctgcagtttaacctgctgggggtgcctctggtcggggccgacgtctgcggcttcctgggcaacacctcagaggag ctgtgtgtgcgctggacccagctgggggccttctaccccttcatgcggaaccacaacagcctgctcagtctgccccaggagccgtacagct tcagcgagccggcccagcaggccatgaggaaggccctcaccctgcgctacgcactcctcccccacctctacacgctgttccaccaggcc cacgtcgcgggggagaccgtggcccggcccctcttcctggagttccccaaggactctagcacctggactgtggaccaccagctcctgtgg ggggaggccctgctcatcaccccagtgctccaggccgggaaggccgaagtgactggctacttccccttgggcacatggtacgacctgca gacggtgccaatagaggcccttggcagcctcccacccccacctgcagctccccgtgagccagccatccacagcgaggggcagtgggtg acgctgccggcccccctggacaccatcaacgtccacctccgggctgggtacatcatccccctgcagggccctggcctcacaaccacaga gtcccgccagcagcccatggccctggctgtggccctgaccaagggtggagaggcccgaggggagctgttctgggacgatggagagag cctggaagtgctggagcgaggggcctacacacaggtcatcttcctggccaggaataacacgatcgtgaatgagctggtacgtgtgaccag tgagggagctggcctgcagctgcagaaggtgactgtcctgggcgtggccacggcgccccagcaggtcctctccaacggtgtccctgtctc caacttcacctacagccccgacaccaaggtcctggacatctgtgtctcgctgttgatgggagagcagtttctcgtcagctggtgttagtctaga gcttgctagcggccgc (SEQ ID NO: 18)
Construct 1749
[0118] The GILTΔ2-7Δ31-39-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2-7Δ31-39-GAA70-952 (Plasmid 1749). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7Δ31-39 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70. The GILTΔ2-7Δ31-39 cassette contains a deletion of amino acid residues 31-39 (Pro-Ala-Ser-Arg- Val-Ser-Arg-Arg-Ser) from the human IGF-II sequence. ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
TCACCTTCTTGGCCTTCGCCTCGTGCTGCATTGCTGCTCTGTGCGGCGGGGAGCTGGT
GGACACCCTCCAGTTCGTCTGTGGGGACCGCGGCTTCTACTTCAGCAGGCGTGGCAT
CGTTGAGGAGTGCTGTTTCCGCAGCTGTGACCTGGCCCTCCTGGAGACGTACTGTGC
TACCCCCGCCAAGTCCGAGGGCGCGCCGgcacaccccggccgtcccagagcagtgcccacacagtgcgacgt cccccccaacagccgcttcgattgcgcccctgacaaggccatcacccaggaacagtgcgaggcccgcggctgctgctacatccctgcaa agcaggggctgcagggagcccagatggggcagccctggtgcttcttcccacccagctaccccagctacaagctggagaacctgagctcc tctgaaatgggctacacggccaccctgacccgtaccacccccaccttcttccccaaggacatcctgaccctgcggctggacgtgatgatgg agactgagaaccgcctccacttcacgatcaaagatccagctaacaggcgctacgaggtgcccttggagaccccgcgtgtccacagccgg gcaccgtccccactctacagcgtggagttctctgaggagcccttcggggtgatcgtgcaccggcagctggacggccgcgtgctgctgaac acgacggtggcgcccctgttctttgcggaccagttccttcagctgtccacctcgctgccctcgcagtatatcacaggcctcgccgagcacct cagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaaccgggaccttgcgcccacgcccggtgcgaacctctacgggt ctcaccctttctacctggcgctggaggacggcgggtcggcacacggggtgrtcctgctaaacagcaatgccatggatgtggtcctgcagcc gagccctgcccttagctggaggtcgacaggtgggatcctggatgtctacatcttcctgggcccagagcccaagagcgtggtgcagcagta cctggacgttgtgggatacccgttcatgccgccatactggggcctgggcttccacctgtgccgctggggctactcctccaccgctatcaccc gccaggtggtggagaacatgaccagggcccacttccccctggacgtccaatggaacgacctggactacatggactcccggagggacttc acgttcaacaaggatggcttccgggacttcccggccatggtgcaggagctgcaccagggcggccggcgctacatgatgatcgtggatcct gccatcagcagctcgggccctgccgggagctacaggccctacgacgagggtctgcggaggggggttttcatcaccaacgagaccggcc agccgctgattgggaaggtatggcccgggtccactgccttccccgacttcaccaaccccacagccctggcctggtgggaggacatggtgg ctgagttccatgaccaggtgcccttcgacggcatgtggattgacatgaacgagccttccaacttcatcaggggctctgaggacggctgcccc aacaatgagctggagaacccaccctacgtgcctggggtggttggggggaccctccaggcggcaaccatctgtgcctccagccaccagttt ctctccacacactacaacctgcacaacctctacggcctgaccgaagccatcgcctcccacagggcgctggtgaaggctcgggggacacg cccatttgtgatctcccgctcgacctttgctggccacggccgatacgccggccactggacgggggacgtgtggagctcctgggagcagct cgcctcctccgtgccagaaatcctgcagtttaacctgctgggggtgcctctggtcggggccgacgtctgcggcttcctgggcaacacctca gaggagctgtgtgtgcgctggacccagctgggggccttctaccccttcatgcggaaccacaacagcctgctcagtctgccccaggagccg tacagcttcagcgagccggcccagcaggccatgaggaaggccctcaccctgcgctacgcactcctcccccacctctacacgctgttccac caggcccacgtcgcgggggagaccgtggcccggcccctcttcctggagttccccaaggactctagcacctggactgtggaccaccagct cctgtggggggaggccctgctcatcaccccagtgctccaggccgggaaggccgaagtgactggctacttccccttgggcacatggtacga cctgcagacggtgccaatagaggcccttggcagcctcccacccccacctgcagctccccgtgagccagccatccacagcgaggggcag tgggtgacgctgccggcccccctggacaccatcaacgtccacctccgggctgggtacatcatccccctgcagggccctggcctcacaacc acagagtcccgccagcagcccatggccctggctgtggccctgaccaagggtggagaggcccgaggggagctgttctgggacgatgga gagagcctggaagtgctggagcgaggggcctacacacaggtcatcttcctggccaggaataacacgatcgtgaatgagctggtacgtgtg accagtgagggagctggcctgcagctgcagaaggtgactgtcctgggcgtggccacggcgccccagcaggtcctctccaacggtgtccc tgtctccaacttcacctacagccccgacaccaaggtcctggacatctgtgtctcgctgttgatgggagagcagtttctcgtcagctggtgttag tctagagcttgctagcggccgc (SEQ ID NO: 19) Construct 1746
[0119] The GILTΔ2-7Δ32-39-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2-7Δ32-39-GAA70-952 (Plasmid 1746). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7Δ32-39 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70. The GILTΔ2-7Δ32-39 cassette contains a deletion of amino acid residues 32-39 (Ala-Ser-Arg-Val- Ser-Arg-Arg-Ser) from the human IGF-II sequence. ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
TCACCTTCTTGGCCTTCGCCTCGTGCTGCATTGCTGCTCTGTGCGGCGGGGAGCTGGT
GGACACCCTCCAGTTCGTCTGTGGGGACCGCGGCTTCTACTTCAGCAGGCCCCGTGG
CATCGTTGAGGAGTGCTGTTTCCGCAGCTGTGACCTGGCCCTCCTGGAGACGTACTG
TGCTACCCCCGCCAAGTCCGAGGGCGCGCCGgcacaccccggccgtcccagagcagtgcccacacagtgc gacgtcccccccaacagccgcttcgattgcgcccctgacaaggccatcacccaggaacagtgcgaggcccgcggctgctgctacatccc tgcaaagcaggggctgcagggagcccagatggggcagccctggtgcttcttcccacccagctaccccagctacaagctggagaacctga gctcctctgaaatgggctacacggccaccctgacccgtaccacccccaccttcttccccaaggacatcctgaccctgcggctggacgtgat gatggagactgagaaccgcctccacttcacgatcaaagatccagctaacaggcgctacgaggtgcccttggagaccccgcgtgtccacag ccgggcaccgtccccactctacagcgtggagttctctgaggagcccttcggggtgatcgtgcaccggcagctggacggccgcgtgctgct gaacacgacggtggcgcccctgttctttgcggaccagttccttcagctgtccacctcgctgccctcgcagtatatcacaggcctcgccgagc acctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaaccgggaccttgcgcccacgcccggtgcgaacctctacg ggtctcaccctttctacctggcgctggaggacggcgggtcggcacacggggtgttcctgctaaacagcaatgccatggatgtggtcctgca gccgagccctgcccttagctggaggtcgacaggtgggatcctggatgtctacatcttcctgggcccagagcccaagagcgtggtgcagca gtacctggacgttgtgggatacccgttcatgccgccatactggggcctgggcttccacctgtgccgctggggctactcctccaccgctatca cccgccaggtggtggagaacatgaccagggcccacttccccctggacgtccaatggaacgacctggactacatggactcccggaggga cttcacgttcaacaaggatggcttccgggacttcccggccatggtgcaggagctgcaccagggcggccggcgctacatgatgatcgtgga tcctgccatcagcagctcgggccctgccgggagctacaggccctacgacgagggtctgcggaggggggttttcatcaccaacgagaccg gccagccgctgattgggaaggtatggcccgggtccactgccttccccgacttcaccaaccccacagccctggcctggtgggaggacatg gtggctgagttccatgaccaggtgcccttcgacggcatgtggattgacatgaacgagccttccaacttcatcaggggctctgaggacggctg ccccaacaatgagctggagaacccaccctacgtgcctggggtggttggggggaccctccaggcggcaaccatctgtgcctccagccacc agtttctctccacacactacaacctgcacaacctctacggcctgaccgaagccatcgcctcccacagggcgctggtgaaggctcggggga cacgcccatttgtgatctcccgctcgacctttgctggccacggccgatacgccggccactggacgggggacgtgtggagctcctgggagc agctcgcctcctccgtgccagaaatcctgcagtttaacctgctgggggtgcctctggtcggggccgacgtctgcggcttcctgggcaacac ctcagaggagctgtgtgtgcgctggacccagctgggggccttctaccccttcatgcggaaccacaacagcctgctcagtctgccccagga gccgtacagcttcagcgagccggcccagcaggccatgaggaaggccctcaccctgcgctacgcactcctcccccacctctacacgctgtt ccaccaggcccacgtcgcgggggagaccgtggcccggcccctcttcctggagttccccaaggactctagcacctggactgtggaccacc agctcctgtggggggaggccctgctcatcaccccagtgctccaggccgggaaggccgaagtgactggctacttccccttgggcacatggt acgacctgcagacggtgccaatagaggcccttggcagcctcccacccccacctgcagctccccgtgagccagccatccacagcgaggg gcagtgggtgacgctgccggcccccctggacaccatcaacgtccacctccgggctgggtacatcatccccctgcagggccctggcctca caaccacagagtcccgccagcagcccatggccctggctgtggccctgaccaagggtggagaggcccgaggggagctgttctgggacg atggagagagcctggaagtgctggagcgaggggcctacacacaggtcatcttcctggccaggaataacacgatcgtgaatgagctggtac gtgtgaccagtgagggagctggcctgcagctgcagaaggtgactgtcctgggcgtggccacggcgccccagcaggtcctctccaacggt gtccctgtctccaacttcacctacagccccgacaccaaggtcctggacatctgtgtctcgctgttgatgggagagcagtttctcgtcagctggt gttagtctagagcttgctagcggccgc (SEQ ID NO:20)
Construct 1747
[0120] The GILTΔ2-7Δ33-39-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2-7Δ33-39-GAA70-952 (Plasmid 1747). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7Δ33-39 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70. The GILTΔ2-7Δ33-39 cassette contains a deletion of amino acid residues 33-39 (Ser-Arg-Val-Ser- Arg-Arg-Ser) from the human IGF-II sequence. ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
TCACCTTCTTGGCCTTCGCCTCGTGCTGCATTGCTGCTCTGTGCGGCGGGGAGCTGGT
GGACACCCTCCAGTTCGTCTGTGGGGACCGCGGCTTCTACTTCAGCAGGCCCGCACG
TGGCATCGTTGAGGAGTGCTGTTTCCGCAGCTGTGACCTGGCCCTCCTGGAGACGTA
CTGTGCTACCCCCGCCAAGTCCGAGGGCGCGCCGgcacaccccggccgtcccagagcagtgcccacaca gtgcgacgtcccccccaacagccgcttcgattgcgcccctgacaaggccatcacccaggaacagtgcgaggcccgcggctgctgctaca tccctgcaaagcaggggctgcagggagcccagatggggcagccctggtgcttcttcccacccagctaccccagctacaagctggagaac ctgagctcctctgaaatgggctacacggccaccctgacccgtaccacccccaccttcttccccaaggacatcctgaccctgcggctggacg tgatgatggagactgagaaccgcctccacttcacgatcaaagatccagctaacaggcgctacgaggtgcccttggagaccccgcgtgtcc acagccgggcaccgtccccactctacagcgtggagttctctgaggagcccttcggggtgatcgtgcaccggcagctggacggccgcgtg ctgctgaacacgacggtggcgcccctgttctttgcggaccagttccttcagctgtccacctcgctgccctcgcagtatatcacaggcctcgcc gagcacctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaaccgggaccttgcgcccacgcccggtgcgaacct ctacgggtctcaccctttctacctggcgctggaggacggcgggtcggcacacggggtgttcctgctaaacagcaatgccatggatgtggtc ctgcagccgagccctgcccttagctggaggtcgacaggtgggatcctggatgtctacatcttcctgggcccagagcccaagagcgtggtg cagcagtacctggacgttgtgggatacccgttcatgccgccatactggggcctgggcttccacctgtgccgctggggctactcctccaccg ctatcacccgccaggtggtggagaacatgaccagggcccacttccccctggacgtccaatggaacgacctggactacatggactcccgga gggacttcacgttcaacaaggatggcttccgggacttcccggccatggtgcaggagctgcaccagggcggccggcgctacatgatgatc gtggatcctgccatcagcagctcgggccctgccgggagctacaggccctacgacgagggtctgcggaggggggttttcatcaccaacga gaccggccagccgctgattgggaaggtatggcccgggtccactgccttccccgacttcaccaaccccacagccctggcctggtgggagg acatggtggctgagttccatgaccaggtgcccttcgacggcatgtggattgacatgaacgagccttccaacttcatcaggggctctgaggac ggctgccccaacaatgagctggagaacccaccctacgtgcctggggtggttggggggaccctccaggcggcaaccatctgtgcctccag ccaccagtttctctccacacactacaacctgcacaacctctacggcctgaccgaagccatcgcctcccacagggcgctggtgaaggctcgg gggacacgcccatttgtgatctcccgctcgacctttgctggccacggccgatacgccggccactggacgggggacgtgtggagctcctgg gagcagctcgcctcctccgtgccagaaatcctgcagtttaacctgctgggggtgcctctggtcggggccgacgtctgcggcttcctgggca acacctcagaggagctgtgtgtgcgctggacccagctgggggccttctaccccttcatgcggaaccacaacagcctgctcagtctgcccca ggagccgtacagcttcagcgagccggcccagcaggccatgaggaaggccctcaccctgcgctacgcactcctcccccacctctacacgc tgttccaccaggcccacgtcgcgggggagaccgtggcccggcccctcttcctggagttccccaaggactctagcacctggactgtggacc accagctcctgtggggggaggccctgctcatcaccccagtgctccaggccgggaaggccgaagtgactggctacttccccttgggcacat ggtacgacctgcagacggtgccaatagaggcccttggcagcctcccacccccacctgcagctccccgtgagccagccatccacagcgag gggcagtgggtgacgctgccggcccccctggacaccatcaacgtccacctccgggctgggtacatcatccccctgcagggccctggcct cacaaccacagagtcccgccagcagcccatggccctggctgtggccctgaccaagggtggagaggcccgaggggagctgttctgggac gatggagagagcctggaagtgctggagcgaggggcctacacacaggtcatcttcctggccaggaataacacgatcgtgaatgagctggt acgtgtgaccagtgagggagctggcctgcagctgcagaaggtgactgtcctgggcgtggccacggcgccccagcaggtcctctccaacg gtgtccctgtctccaacttcacctacagccccgacaccaaggtcctggacatctgtgtctcgctgttgatgggagagcagtttctcgtcagctg gtgttagtctagagcttgctagcggccgc (SEQ ID NO:21)
Construct 1758
[0121] The GILTΔ2-7Δ34-39-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2-7Δ34-39-GAA70-952 (Plasmid 1758). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7Δ34-39 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70. The GILTΔ2-7Δ34-39 cassette contains a deletion of amino acid residues 34-39 (Arg-Val-Ser-Arg- Arg-Ser) from the human IGF-II sequence.
ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
TCACCTTCTTGGCCTTCGCCTCGTGCTGCATTGCTGCTCTGTGCGGCGGGGAGCTGGT
GGACACCCTCCAGTTCGTCTGTGGGGACCGCGGCTTCTACTTCAGCAGGCCCGCAAG
CCGTGGCATCGTTGAGGAGTGCTGTTTCCGCAGCTGTGACCTGGCCCTCCTGGAGAC
GTACTGTGCTACCCCCGCCAAGTCCGAGGGCGCGCCGgcacaccccggccgtcccagagcagtgccc acacagtgcgacgtcccccccaacagccgcttcgattgcgcccctgacaaggccatcacccaggaacagtgcgaggcccgcggctgct gctacatccctgcaaagcaggggctgcagggagcccagatggggcagccctggtgcttcttcccacccagctaccccagctacaagctg gagaacctgagctcctctgaaatgggctacacggccaccctgacccgtaccacccccaccttcttccccaaggacatcctgaccctgcggc tggacgtgatgatggagactgagaaccgcctccacttcacgatcaaagatccagctaacaggcgctacgaggtgcccttggagaccccgc gtgtccacagccgggcaccgtccccactctacagcgtggagttctctgaggagcccttcggggtgatcgtgcaccggcagctggacggcc gcgtgctgctgaacacgacggtggcgcccctgttctttgcggaccagttccttcagctgtccacctcgctgccctcgcagtatatcacaggcc tcgccgagcacctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaaccgggaccttgcgcccacgcccggtgcg aacctctacgggtctcaccctttctacctggcgctggaggacggcgggtcggcacacggggtgttcctgctaaacagcaatgccatggatg tggtcctgcagccgagccctgcccttagctggaggtcgacaggtgggatcctggatgtctacatcttcctgggcccagagcccaagagcgt ggtgcagcagtacctggacgttgtgggatacccgttcatgccgccatactggggcctgggcttccacctgtgccgctggggctactcctcca ccgctatcacccgccaggtggtggagaacatgaccagggcccacttccccctggacgtccaatggaacgacctggactacatggactccc ggagggacttcacgttcaacaaggatggcttccgggacttcccggccatggtgcaggagctgcaccagggcggccggcgctacatgatg atcgtggatcctgccatcagcagctcgggccctgccgggagctacaggccctacgacgagggtctgcggaggggggttttcatcaccaac gagaccggccagccgctgattgggaaggtatggcccgggtccactgccttccccgacttcaccaaccccacagccctggcctggtggga ggacatggtggctgagttccatgaccaggtgcccttcgacggcatgtggattgacatgaacgagccttccaacttcatcaggggctctgagg acggctgccccaacaatgagctggagaacccaccctacgtgcctggggtggttggggggaccctccaggcggcaaccatctgtgcctcc agccaccagtttctctccacacactacaacctgcacaacctctacggcctgaccgaagccatcgcctcccacagggcgctggtgaaggctc gggggacacgcccatttgtgatctcccgctcgacctttgctggccacggccgatacgccggccactggacgggggacgtgtggagctcct gggagcagctcgcctcctccgtgccagaaatcctgcagtttaacctgctgggggtgcctctggtcggggccgacgtctgcggcttcctggg caacacctcagaggagctgtgtgtgcgctggacccagctgggggccttctaccccttcatgcggaaccacaacagcctgctcagtctgccc caggagccgtacagcttcagcgagccggcccagcaggccatgaggaaggccctcaccctgcgctacgcactcctcccccacctctacac gctgttccaccaggcccacgtcgcgggggagaccgtggcccggcccctcttcctggagttccccaaggactctagcacctggactgtgga ccaccagctcctgtggggggaggccctgctcatcaccccagtgctccaggccgggaaggccgaagtgactggctacttccccttgggca catggtacgacctgcagacggtgccaatagaggcccttggcagcctcccacccccacctgcagctccccgtgagccagccatccacagc gaggggcagtgggtgacgctgccggcccccctggacaccatcaacgtccacctccgggctgggtacatcatccccctgcagggccctgg cctcacaaccacagagtcccgccagcagcccatggccctggctgtggccctgaccaagggtggagaggcccgaggggagctgttctgg gacgatggagagagcctggaagtgctggagcgaggggcctacacacaggtcatcttcctggccaggaataacacgatcgtgaatgagct ggtacgtgtgaccagtgagggagctggcctgcagctgcagaaggtgactgtcctgggcgtggccacggcgccccagcaggtcctctcca acggtgtccctgtctccaacttcacctacagccccgacaccaaggtcctggacatctgtgtctcgctgttgatgggagagcagtttctcgtca gctggtgttagtctagagcttgctagcggccgc (SEQ ID NO:22)
Construct 1750
[0122] The GILTΔ2-7Δ35-39-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2~7Δ35-39-GAA70-952 (Plasmid 1750). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7Δ35-39 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70. The GILTΔ2-7Δ35-39 cassette contains a deletion of amino acid residues 35-39 (Val-Ser-Arg-Arg- Ser) from the human IGF-II sequence.
ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
TCACCTTCTTGGCCTTCGCCTCGTGCTGCATTGCTGCTCTGTGCGGCGGGGAGCTGGT
GGACACCCTCCAGTTCGTCTGTGGGGACCGCGGCTTCTACTTCAGCAGGCCCGCAAG
CCGTCGTGGCATCGTTGAGGAGTGCTGTTTCCGCAGCTGTGACCTGGCCCTCCTGGA
GACGTACTGTGCTACCCCCGCCAAGTCCGAGGGCGCGCCGgcacaccccggccgtcccagagcag tgcccacacagtgcgacgtcccccccaacagccgcttcgattgcgcccctgacaaggccatcacccaggaacagtgcgaggcccgcgg ctgctgctacatccctgcaaagcaggggctgcagggagcccagatggggcagccctggtgcttcttcccacccagctaccccagctacaa gctggagaacctgagctcctctgaaatgggctacacggccaccctgacccgtaccacccccaccttcttccccaaggacatcctgaccctg cggctggacgtgatgatggagactgagaaccgcctccacttcacgatcaaagatccagctaacaggcgctacgaggtgcccttggagacc ccgcgtgtccacagccgggcaccgtccccactctacagcgtggagttctctgaggagcccttcggggtgatcgtgcaccggcagctggac ggccgcgtgctgctgaacacgacggtggcgcccctgttctttgcggaccagttccttcagctgtccacctcgctgccctcgcagtatatcaca ggcctcgccgagcacctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaaccgggaccttgcgcccacgcccgg tgcgaacctctacgggtctcaccctttctacctggcgctggaggacggcgggtcggcacacggggtgttcctgctaaacagcaatgccatg gatgtggtcctgcagccgagccctgcccttagctggaggtcgacaggtgggatcctggatgtctacatcttcctgggcccagagcccaaga gcgtggtgcagcagtacctggacgttgtgggatacccgttcatgccgccatactggggcctgggcttccacctgtgccgctggggctactc ctccaccgctatcacccgccaggtggtggagaacatgaccagggcccacttccccctggacgtccaatggaacgacctggactacatgga ctcccggagggacttcacgttcaacaaggatggcttccgggacttcccggccatggtgcaggagctgcaccagggcggccggcgctaca tgatgatcgtggatcctgccatcagcagctcgggccctgccgggagctacaggccctacgacgagggtctgcggaggggggttttcatca ccaacgagaccggccagccgctgattgggaaggtatggcccgggtccactgccttccccgacttcaccaaccccacagccctggcctggt gggaggacatggtggctgagttccatgaccaggtgcccttcgacggcatgtggattgacatgaacgagccttccaacttcatcaggggctct gaggacggctgccccaacaatgagctggagaacccaccctacgtgcctggggtggttggggggaccctccaggcggcaaccatctgtg cctccagccaccagtttctctccacacactacaacctgcacaacctctacggcctgaccgaagccatcgcctcccacagggcgctggtgaa ggctcgggggacacgcccatttgtgatctcccgctcgacctttgctggccacggccgatacgccggccactggacgggggacgtgtgga gctcctgggagcagctcgcctcctccgtgccagaaatcctgcagtttaacctgctgggggtgcctctggtcggggccgacgtctgcggctt cctgggcaacacctcagaggagctgtgtgtgcgctggacccagctgggggccttctaccccttcatgcggaaccacaacagcctgctcag tctgccccaggagccgtacagcttcagcgagccggcccagcaggccatgaggaaggccctcaccctgcgctacgcactcctcccccacc tctacacgctgttccaccaggcccacgtcgcgggggagaccgtggcccggcccctcttcctggagttccccaaggactctagcacctgga ctgtggaccaccagctcctgtggggggaggccctgctcatcaccccagtgctccaggccgggaaggccgaagtgactggctacttcccct tgggcacatggtacgacctgcagacggtgccaatagaggcccttggcagcctcccacccccacctgcagctccccgtgagccagccatc cacagcgaggggcagtgggtgacgctgccggcccccctggacaccatcaacgtccacctccgggctgggtacatcatccccctgcagg gccctggcctcacaaccacagagtcccgccagcagcccatggccctggctgtggccctgaccaagggtggagaggcccgaggggagc tgttctgggacgatggagagagcctggaagtgctggagcgaggggcctacacacaggtcatcttcctggccaggaataacacgatcgtga atgagctggtacgtgtgaccagtgagggagctggcctgcagctgcagaaggtgactgtcctgggcgtggccacggcgccccagcaggtc ctctccaacggtgtccctgtctccaacttcacctacagccccgacaccaaggtcctggacatctgtgtctcgctgttgatgggagagcagtttc tcgtcagctggtgttagtctagagcttgctagcggccgc (SEQ ID NO:23)
Construct 1748
[0123] The GILTΔ2-7Δ36-39-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2-7Δ36-39-GAA70-952 (Plasmid 1748). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7Δ36-39 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70. The GILTΔ2-7Δ36-39 cassette contains a deletion of amino acid residues 36-39 (Ser-Arg-Arg-Ser) from the human IGF-II sequence. ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
TCACCTTCTTGGCCTTCGCCTCGTGCTGCATTGCTGCTCTGTGCGGCGGGGAGCTGGT
GGACACCCTCCAGTTCGTCTGTGGGGACCGCGGCTTCTACTTCAGCAGGCCCGCAAG
CCGTGTGCGTGGCATCGTTGAGGAGTGCTGTTTCCGCAGCTGTGACCTGGCCCTCCT
GGAGACGTACTGTGCTACCCCCGCCAAGTCCGAGGGCGCGCCGgcacaccccggccgtcccag agcagtgcccacacagtgcgacgtcccccccaacagccgcttcgattgcgcccctgacaaggccatcacccaggaacagtgcgaggcc cgcggctgctgctacatccctgcaaagcaggggctgcagggagcccagatggggcagccctggtgcttcttcccacccagctaccccag ctacaagctggagaacctgagctcctctgaaatgggctacacggccaccctgacccgtaccacccccaccttcttccccaaggacatcctg accctgcggctggacgtgatgatggagactgagaaccgcctccacttcacgatcaaagatccagctaacaggcgctacgaggtgcccttg gagaccccgcgtgtccacagccgggcaccgtccccactctacagcgtggagttctctgaggagcccttcggggtgatcgtgcaccggca gctggacggccgcgtgctgctgaacacgacggtggcgcccctgttctttgcggaccagttccttcagctgtccacctcgctgccctcgcagt atatcacaggcctcgccgagcacctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaaccgggaccttgcgccca cgcccggtgcgaacctctacgggtctcaccctttctacctggcgctggaggacggcgggtcggcacacggggtgttcctgctaaacagca atgccatggatgtggtcctgcagccgagccctgcccttagctggaggtcgacaggtgggatcctggatgtctacatcttcctgggcccaga gcccaagagcgtggtgcagcagtacctggacgttgtgggatacccgttcatgccgccatactggggcctgggcttccacctgtgccgctgg ggctactcctccaccgctatcacccgccaggtggtggagaacatgaccagggcccacttccccctggacgtccaatggaacgacctggac tacatggactcccggagggacttcacgttcaacaaggatggcttccgggacttcccggccatggtgcaggagctgcaccagggcggccg gcgctacatgatgatcgtggatcctgccatcagcagctcgggccctgccgggagctacaggccctacgacgagggtctgcggaggggg gttttcatcaccaacgagaccggccagccgctgattgggaaggtatggcccgggtccactgccttccccgacttcaccaaccccacagccc tggcctggtgggaggacatggtggctgagttccatgaccaggtgcccttcgacggcatgtggattgacatgaacgagccttccaacttcatc aggggctctgaggacggctgccccaacaatgagctggagaacccaccctacgtgcctggggtggttggggggaccctccaggcggcaa ccatctgtgcctccagccaccagtttctctccacacactacaacctgcacaacctctacggcctgaccgaagccatcgcctcccacagggc gctggtgaaggctcgggggacacgcccatttgtgatctcccgctcgacctttgctggccacggccgatacgccggccactggacggggg acgtgtggagctcctgggagcagctcgcctcctccgtgccagaaatcctgcagtttaacctgctgggggtgcctctggtcggggccgacgt ctgcggcttcctgggcaacacctcagaggagctgtgtgtgcgctggacccagctgggggccttctaccccttcatgcggaaccacaacag cctgctcagtctgccccaggagccgtacagcttcagcgagccggcccagcaggccatgaggaaggccctcaccctgcgctacgcactcc tcccccacctctacacgctgttccaccaggcccacgtcgcgggggagaccgtggcccggcccctcttcctggagttccccaaggactcta gcacctggactgtggaccaccagctcctgtggggggaggccctgctcatcaccccagtgctccaggccgggaaggccgaagtgactgg ctacttccccttgggcacatggtacgacctgcagacggtgccaatagaggcccttggcagcctcccacccccacctgcagctccccgtgag ccagccatccacagcgaggggcagtgggtgacgctgccggcccccctggacaccatcaacgtccacctccgggctgggtacatcatccc cctgcagggccctggcctcacaaccacagagtcccgccagcagcccatggccctggctgtggccctgaccaagggtggagaggcccga ggggagctgttctgggacgatggagagagcctggaagtgctggagcgaggggcctacacacaggtcatcttcctggccaggaataacac gatcgtgaatgagctggtacgtgtgaccagtgagggagctggcctgcagctgcagaaggtgactgtcctgggcgtggccacggcgcccc agcaggtcctctccaacggtgtccctgtctccaacttcacctacagccccgacaccaaggtcctggacatctgtgtctcgctgttgatgggag agcagtttctcgtcagctggtgttagtctagagcttgctagcggccgc (SEQ ID NO: 24)
Construct 1751
[0124] The GILTΔ2-7Δ29-40-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2-7Δ29-40-GAA70-952 (Plasmid 1751). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7Δ29-40 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70. The GILTΔ2-7Δ29-40 cassette contains a deletion of amino acid residues 29-40 (Ser-Arg-Pro-Ala- Ser-Arg-Val-Ser-Arg-Arg-Ser-Arg) from the human IGF-II sequence. ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
TCACCTTCTTGGCCTTCGCCTCGTGCTGCATTGCTGCTCTGTGCGGCGGGGAGCTGGT
GGACACCCTCCAGTTCGTCTGTGGGGACCGCGGCTTCTACTTCGGCATCGTTGAGGA
GTGCTGTTTCCGCAGCTGTGACCTGGCCCTCCTGGAGACGTACTGTGCTACCCCCGC
CAAGTCCGAGGGC GCGCCGgcacaccccggccgtcccagagcagtgcccacacagtgcgacgtcccccccaacagc cgcttcgattgcgcccctgacaaggccatcacccaggaacagtgcgaggcccgcggctgctgctacatccctgcaaagcaggggctgca gggagcccagatggggcagccctggtgcttcttcccacccagctaccccagctacaagctggagaacctgagctcctctgaaatgggcta cacggccaccctgacccgtaccacccccaccttcttccccaaggacatcctgaccctgcggctggacgtgatgatggagactgagaaccg cctccacttcacgatcaaagatccagctaacaggcgctacgaggtgcccttggagaccccgcgtgtccacagccgggcaccgtccccact ctacagcgtggagttctctgaggagcccttcggggtgatcgtgcaccggcagctggacggccgcgtgctgctgaacacgacggtggcgc ccctgttctttgcggaccagttccttcagctgtccacctcgctgccctcgcagtatatcacaggcctcgccgagcacctcagtcccctgatgct cagcaccagctggaccaggatcaccctgtggaaccgggaccttgcgcccacgcccggtgcgaacctctacgggtctcaccctttctacct ggcgctggaggacggcgggtcggcacacggggtgttcctgctaaacagcaatgccatggatgtggtcctgcagccgagccctgccctta gctggaggtcgacaggtgggatcctggatgtctacatcttcctgggcccagagcccaagagcgtggtgcagcagtacctggacgttgtgg gatacccgttcatgccgccatactggggcctgggcttccacctgtgccgctggggctactcctccaccgctatcacccgccaggtggtgga gaacatgaccagggcccacttccccctggacgtccaatggaacgacctggactacatggactcccggagggacttcacgttcaacaagga tggcttccgggacttcccggccatggtgcaggagctgcaccagggcggccggcgctacatgatgatcgtggatcctgccatcagcagctc gggccctgccgggagctacaggccctacgacgagggtctgcggaggggggttttcatcaccaacgagaccggccagccgctgattggg aaggtatggcccgggtccactgccttccccgacttcaccaaccccacagccctggcctggtgggaggacatggtggctgagttccatgac caggtgcccttcgacggcatgtggattgacatgaacgagccttccaacttcatcaggggctctgaggacggctgccccaacaatgagctgg agaacccaccctacgtgcctggggtggttggggggaccctccaggcggcaaccatctgtgcctccagccaccagtttctctccacacacta caacctgcacaacctctacggcctgaccgaagccatcgcctcccacagggcgctggtgaaggctcgggggacacgcccatttgtgatctc ccgctcgacctttgctggccacggccgatacgccggccactggacgggggacgtgtggagctcctgggagcagctcgcctcctccgtgc cagaaatcctgcagtttaacctgctgggggtgcctctggtcggggccgacgtctgcggcttcctgggcaacacctcagaggagctgtgtgt gcgctggacccagctgggggccttctaccccttcatgcggaaccacaacagcctgctcagtctgccccaggagccgtacagcttcagcga gccggcccagcaggccatgaggaaggccctcaccctgcgctacgcactcctcccccacctctacacgctgttccaccaggcccacgtcg cgggggagaccgtggcccggcccctcttcctggagttccccaaggactctagcacctggactgtggaccaccagctcctgtggggggag gccctgctcatcaccccagtgctccaggccgggaaggccgaagtgactggctacttccccttgggcacatggtacgacctgcagacggtg ccaatagaggcccttggcagcctcccacccccacctgcagctccccgtgagccagccatccacagcgaggggcagtgggtgacgctgc cggcccccctggacaccatcaacgtccacctccgggctgggtacatcatccccctgcagggccctggcctcacaaccacagagtcccgc cagcagcccatggccctggctgtggccctgaccaagggtggagaggcccgaggggagctgttctgggacgatggagagagcctggaa gtgctggagcgaggggcctacacacaggtcatcttcctggccaggaataacacgatcgtgaatgagctggtacgtgtgaccagtgaggga gctggcctgcagctgcagaaggtgactgtcctgggcgtggccacggcgccccagcaggtcctctccaacggtgtccctgtctccaacttca cctacagccccgacaccaaggtcctggacatctgtgtctcgctgttgatgggagagcagtttctcgtcagctggtgttagtctagagcttgcta gcggccgc (SEQ ID NO:25)
Construct 1752
[0125] The GILTΔ2-7Δ30-40-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2-7Δ30-40-GAA70-952 (Plasmid 1752). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7Δ30-40 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70. The GILTΔ2-7Δ30-40 cassette contains a deletion of amino acid residues 30-40 (Arg-Pro- AIa-S er- Arg-Val-Ser-Arg-Arg-Ser-Arg) from the human IGF-II sequence.
ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
TCACCTTCTTGGCCTTCGCCTCGTGCTGCATTGCTGCTCTGTGCGGCGGGGAGCTGGT
GGACACCCTCCAGTTCGTCTGTGGGGACCGCGGCTTCTACTTCAGCGGCATCGTTGA
GGAGTGCTGTTTCCGCAGCTGTGACCTGGCCCTCCTGGAGACGTACTGTGCTACCCC
CGCCAAGTCCGAGGGCGCGCCGgcacaccccggccgtcccagagcagtgcccacacagtgcgacgtcccccccaa cagccgcttcgattgcgcccctgacaaggccatcacccaggaacagtgcgaggcccgcggctgctgctacatccctgcaaagcaggggc tgcagggagcccagatggggcagccctggtgcttcttcccacccagctaccccagctacaagctggagaacctgagctcctctgaaatgg gctacacggccaccctgacccgtaccacccccaccttcttccccaaggacatcctgaccctgcggctggacgtgatgatggagactgaga accgcctccacttcacgatcaaagatccagctaacaggcgctacgaggtgcccttggagaccccgcgtgtccacagccgggcaccgtcc ccactctacagcgtggagttctctgaggagcccttcggggtgatcgtgcaccggcagctggacggccgcgtgctgctgaacacgacggtg gcgcccctgttctttgcggaccagttccttcagctgtccacctcgctgccctcgcagtatatcacaggcctcgccgagcacctcagtcccctg atgctcagcaccagctggaccaggatcaccctgtggaaccgggaccttgcgcccacgcccggtgcgaacctctacgggtctcaccctttct acctggcgctggaggacggcgggtcggcacacggggtgttcctgctaaacagcaatgccatggatgtggtcctgcagccgagccctgcc cttagctggaggtcgacaggtgggatcctggatgtctacatcttcctgggcccagagcccaagagcgtggtgcagcagtacctggacgttg tgggatacccgttcatgccgccatactggggcctgggcttccacctgtgccgctggggctactcctccaccgctatcacccgccaggtggt ggagaacatgaccagggcccacttccccctggacgtccaatggaacgacctggactacatggactcccggagggacttcacgttcaacaa ggatggcttccgggacttcccggccatggtgcaggagctgcaccagggcggccggcgctacatgatgatcgtggatcctgccatcagca gctcgggccctgccgggagctacaggccctacgacgagggtctgcggaggggggttttcatcaccaacgagaccggccagccgctgatt gggaaggtatggcccgggtccactgccttccccgacttcaccaaccccacagccctggcctggtgggaggacatggtggctgagttccat gaccaggtgcccttcgacggcatgtggattgacatgaacgagccttccaacttcatcaggggctctgaggacggctgccccaacaatgag ctggagaacccaccctacgtgcctggggtggttggggggaccctccaggcggcaaccatctgtgcctccagccaccagtttctctccacac actacaacctgcacaacctctacggcctgaccgaagccatcgcctcccacagggcgctggtgaaggctcgggggacacgcccatttgtga tctcccgctcgacctttgctggccacggccgatacgccggccactggacgggggacgtgtggagctcctgggagcagctcgcctcctccg tgccagaaatcctgcagtttaacctgctgggggtgcctctggtcggggccgacgtctgcggcttcctgggcaacacctcagaggagctgtg tgtgcgctggacccagctgggggccttctaccccttcatgcggaaccacaacagcctgctcagtctgccccaggagccgtacagcttcagc gagccggcccagcaggccatgaggaaggccctcaccctgcgctacgcactcctcccccacctctacacgctgttccaccaggcccacgt cgcgggggagaccgtggcccggcccctcttcctggagttccccaaggactctagcacctggactgtggaccaccagctcctgtgggggg aggccctgctcatcaccccagtgctccaggccgggaaggccgaagtgactggctacttccccttgggcacatggtacgacctgcagacgg tgccaatagaggcccttggcagcctcccacccccacctgcagctccccgtgagccagccatccacagcgaggggcagtgggtgacgctg ccggcccccctggacaccatcaacgtccacctccgggctgggtacatcatccccctgcagggccctggcctcacaaccacagagtcccg ccagcagcccatggccctggctgtggccctgaccaagggtggagaggcccgaggggagctgttctgggacgatggagagagcctgga agtgctggagcgaggggcctacacacaggtcatcttcctggccaggaataacacgatcgtgaatgagctggtacgtgtgaccagtgaggg agctggcctgcagctgcagaaggtgactgtcctgggcgtggccacggcgccccagcaggtcctctccaacggtgtccctgtctccaacttc acctacagccccgacaccaaggtcctggacatctgtgtctcgctgttgatgggagagcagtttctcgtcagctggtgttagtctagagcttgct agcggccgc (SEQ ID NO:26)
Construct 1753
[0126] The GILTΔ2-7Δ31-40-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2-7Δ31-40-GAA70-952 (Plasmid 1753). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7Δ31-40 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70. The GILTΔ2-7Δ31-40 cassette contains a deletion of amino acid residues 31-40 (Pro-Ala-Ser-Arg- Val-Ser-Arg-Arg-Ser-Arg) from the human IGF-II sequence. ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
TCACCTTCTTGGCCTTCGCCTCGTGCTGCATTGCTGCTCTGTGCGGCGGGGAGCTGGT
GGACACCCTCCAGTTCGTCTGTGGGGACCGCGGCTTCTACTTCAGCAGGGGCATCGT
TGAGGAGTGCTGTTTCCGCAGCTGTGACCTGGCCCTCCTGGAGACGTACTGTGCTAC
CCCCGCCAAGTCCGAGGGCGCGCCGgcacaccccggccgtcccagagcagtgcccacacagtgcgacgtcccc cccaacagccgcttcgattgcgcccctgacaaggccatcacccaggaacagtgcgaggcccgcggctgctgctacatccctgcaaagca ggggctgcagggagcccagatggggcagccctggtgcttcttcccacccagctaccccagctacaagctggagaacctgagctcctctga aatgggctacacggccaccctgacccgtaccacccccaccttcttccccaaggacatcctgaccctgcggctggacgtgatgatggagact gagaaccgcctccacttcacgatcaaagatccagctaacaggcgctacgaggtgcccttggagaccccgcgtgtccacagccgggcacc gtccccactctacagcgtggagttctctgaggagcccttcggggtgatcgtgcaccggcagctggacggccgcgtgctgctgaacacgac ggtggcgcccctgttctttgcggaccagttccttcagctgtccacctcgctgccctcgcagtatatcacaggcctcgccgagcacctcagtcc cctgatgctcagcaccagctggaccaggatcaccctgtggaaccgggaccttgcgcccacgcccggtgcgaacctctacgggtctcaccc tttctacctggcgctggaggacggcgggtcggcacacggggtgttcctgctaaacagcaatgccatggatgtggtcctgcagccgagccct gcccttagctggaggtcgacaggtgggatcctggatgtctacatcttcctgggcccagagcccaagagcgtggtgcagcagtacctggac gttgtgggatacccgttcatgccgccatactggggcctgggcttccacctgtgccgctggggctactcctccaccgctatcacccgccaggt ggtggagaacatgaccagggcccacttccccctggacgtccaatggaacgacctggactacatggactcccggagggacttcacgttcaa caaggatggcttccgggacttcccggccatggtgcaggagctgcaccagggcggccggcgctacatgatgatcgtggatcctgccatca gcagctcgggccctgccgggagctacaggccctacgacgagggtctgcggaggggggttttcatcaccaacgagaccggccagccgct gattgggaaggtatggcccgggtccactgccttccccgacttcaccaaccccacagccctggcctggtgggaggacatggtggctgagtt ccatgaccaggtgcccttcgacggcatgtggattgacatgaacgagccttccaacttcatcaggggctctgaggacggctgccccaacaat gagctggagaacccaccctacgtgcctggggtggttggggggaccctccaggcggcaaccatctgtgcctccagccaccagtttctctcc acacactacaacctgcacaacctctacggcctgaccgaagccatcgcctcccacagggcgctggtgaaggctcgggggacacgcccatt tgtgatctcccgctcgacctttgctggccacggccgatacgccggccactggacgggggacgtgtggagctcctgggagcagctcgcctc ctccgtgccagaaatcctgcagtttaacctgctgggggtgcctctggtcggggccgacgtctgcggcttcctgggcaacacctcagaggag ctgtgtgtgcgctggacccagctgggggccttctaccccttcatgcggaaccacaacagcctgctcagtctgccccaggagccgtacagct tcagcgagccggcccagcaggccatgaggaaggccctcaccctgcgctacgcactcctcccccacctctacacgctgttccaccaggcc cacgtcgcgggggagaccgtggcccggcccctcttcctggagttccccaaggactctagcacctggactgtggaccaccagctcctgtgg ggggaggccctgctcatcaccccagtgctccaggccgggaaggccgaagtgactggctacttccccttgggcacatggtacgacctgca gacggtgccaatagaggcccttggcagcctcccacccccacctgcagctccccgtgagccagccatccacagcgaggggcagtgggtg acgctgccggcccccctggacaccatcaacgtccacctccgggctgggtacatcatccccctgcagggccctggcctcacaaccacaga gtcccgccagcagcccatggccctggctgtggccctgaccaagggtggagaggcccgaggggagctgttctgggacgatggagagag cctggaagtgctggagcgaggggcctacacacaggtcatcttcctggccaggaataacacgatcgtgaatgagctggtacgtgtgaccag tgagggagctggcctgcagctgcagaaggtgactgtcctgggcgtggccacggcgccccagcaggtcctctccaacggtgtccctgtctc caacttcacctacagccccgacaccaaggtcctggacatctgtgtctcgctgttgatgggagagcagtttctcgtcagctggtgttagtctaga gcttgctagcggccgc (SEQ ID NO:27)
Construct 1754
[0127] The GILTΔ2-7Δ32-40-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2-7Δ32-40-GAA70-952 (Plasmid 1754). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7Δ32-40 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70. The GILTΔ2-7Δ32-40 cassette contains a deletion of amino acid residues 32-40 (Ala-Ser-Arg-Val- Ser-Arg-Arg-Ser-Arg) from the human IGF-II sequence. ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
TCACCTTCTTGGCCTTCGCCTCGTGCTGCATTGCTGCTCTGTGCGGCGGGGAGCTGGT
GGACACCCTCCAGTTCGTCTGTGGGGACCGCGGCTTCTACTTCAGCAGGCCCGGCAT
CGTTGAGGAGTGCTGTTTCCGCAGCTGTGACCTGGCCCTCCTGGAGACGTACTGTGC
TACCCCCGCCAAGTCCGAGGGCGCGCCGgcacaccccggccgtcccagagcagtgcccacacagtgcgacgt cccccccaacagccgcttcgattgcgcccctgacaaggccatcacccaggaacagtgcgaggcccgcggctgctgctacatccctgcaa agcaggggctgcagggagcccagatggggcagccctggtgcttcttcccacccagctaccccagctacaagctggagaacctgagctcc tctgaaatgggctacacggccaccctgacccgtaccacccccaccttcttccccaaggacatcctgaccctgcggctggacgtgatgatgg agactgagaaccgcctccacttcacgatcaaagatccagctaacaggcgctacgaggtgcccttggagaccccgcgtgtccacagccgg gcaccgtccccactctacagcgtggagttctctgaggagcccttcggggtgatcgtgcaccggcagctggacggccgcgtgctgctgaac acgacggtggcgcccctgttctttgcggaccagttccttcagctgtccacctcgctgccctcgcagtatatcacaggcctcgccgagcacct cagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaaccgggaccttgcgcccacgcccggtgcgaacctctacgggt ctcaccctttctacctggcgctggaggacggcgggtcggcacacggggtgttcctgctaaacagcaatgccatggatgtggtcctgcagcc gagccctgcccttagctggaggtcgacaggtgggatcctggatgtctacatcttcctgggcccagagcccaagagcgtggtgcagcagta cctggacgttgtgggatacccgttcatgccgccatactggggcctgggcttccacctgtgccgctggggctactcctccaccgctatcaccc gccaggtggtggagaacatgaccagggcccacttccccctggacgtccaatggaacgacctggactacatggactcccggagggacttc acgttcaacaaggatggcttccgggacttcccggccatggtgcaggagctgcaccagggcggccggcgctacatgatgatcgtggatcct gccatcagcagctcgggccctgccgggagctacaggccctacgacgagggtctgcggaggggggttttcatcaccaacgagaccggcc agccgctgattgggaaggtatggcccgggtccactgccttccccgacttcaccaaccccacagccctggcctggtgggaggacatggtgg ctgagttccatgaccaggtgcccttcgacggcatgtggattgacatgaacgagccttccaacttcatcaggggctctgaggacggctgcccc aacaatgagctggagaacccaccctacgtgcctggggtggttggggggaccctccaggcggcaaccatctgtgcctccagccaccagttt ctctccacacactacaacctgcacaacctctacggcctgaccgaagccatcgcctcccacagggcgctggtgaaggctcgggggacacg cccatttgtgatctcccgctcgacctttgctggccacggccgatacgccggccactggacgggggacgtgtggagctcctgggagcagct cgcctcctccgtgccagaaatcctgcagtttaacctgctgggggtgcctctggtcggggccgacgtctgcggcttcctgggcaacacctca gaggagctgtgtgtgcgctggacccagctgggggccttctaccccttcatgcggaaccacaacagcctgctcagtctgccccaggagccg tacagcttcagcgagccggcccagcaggccatgaggaaggccctcaccctgcgctacgcactcctcccccacctctacacgctgttccac caggcccacgtcgcgggggagaccgtggcccggcccctcttcctggagttccccaaggactctagcacctggactgtggaccaccagct cctgtggggggaggccctgctcatcaccccagtgctccaggccgggaaggccgaagtgactggctacttccccttgggcacatggtacga cctgcagacggtgccaatagaggcccttggcagcctcccacccccacctgcagctccccgtgagccagccatccacagcgaggggcag tgggtgacgctgccggcccccctggacaccatcaacgtccacctccgggctgggtacatcatccccctgcagggccctggcctcacaacc acagagtcccgccagcagcccatggccctggctgtggccctgaccaagggtggagaggcccgaggggagctgttctgggacgatgga gagagcctggaagtgctggagcgaggggcctacacacaggtcatcttcctggccaggaataacacgatcgtgaatgagctggtacgtgtg accagtgagggagctggcctgcagctgcagaaggtgactgtcctgggcgtggccacggcgccccagcaggtcctctccaacggtgtccc tgtctccaacttcacctacagccccgacaccaaggtcctggacatctgtgtctcgctgttgatgggagagcagtttctcgtcagctggtgttag tctagagcttgctagcggccgc (SEQ ID NO:28) Construct 1755
[0128] The GILTΔ2-7Δ33-40-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2-7Δ33-40-GAA70-952 (Plasmid 1755). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7Δ33-40 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70. The GILTΔ2-7Δ33-40 cassette contains a deletion of amino acid residues 33-40 (Ser-Arg-Val-Ser- Arg-Arg-Ser-Arg) from the human IGF-II sequence. ggtaccagctgctagcaagctaattcacaccaATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTC
TCACCTTCTTGGCCTTCGCCTCGTGCTGCATTGCTGCTCTGTGCGGCGGGGAGCTGGT
GGACACCCTCCAGTTCGTCTGTGGGGACCGCGGCTTCTACTTCAGCAGGCCCGCAGG
CATCGTTGAGGAGTGCTGTTTCCGCAGCTGTGACCTGGCCCTCCTGGAGACGTACTG
TGCTACCCCCGCCAAGTCCGAGGGCGCGCCGgcacaccccggccgtcccagagcagtgcccacacagtgc gacgtcccccccaacagccgcttcgattgcgcccctgacaaggccatcacccaggaacagtgcgaggcccgcggctgctgctacatccc tgcaaagcaggggctgcagggagcccagatggggcagccctggtgcttcttcccacccagctaccccagctacaagctggagaacctga gctcctctgaaatgggctacacggccaccctgacccgtaccacccccaccttcttccccaaggacatcctgaccctgcggctggacgtgat gatggagactgagaaccgcctccacttcacgatcaaagatccagctaacaggcgctacgaggtgcccttggagaccccgcgtgtccacag ccgggcaccgtccccactctacagcgtggagttctctgaggagcccttcggggtgatcgtgcaccggcagctggacggccgcgtgctgct gaacacgacggtggcgcccctgttctttgcggaccagttccttcagctgtccacctcgctgccctcgcagtatatcacaggcctcgccgagc acctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaaccgggaccttgcgcccacgcccggtgcgaacctctacg ggtctcaccctttctacctggcgctggaggacggcgggtcggcacacggggtgttcctgctaaacagcaatgccatggatgtggtcctgca gccgagccctgcccttagctggaggtcgacaggtgggatcctggatgtctacatcttcctgggcccagagcccaagagcgtggtgcagca gtacctggacgttgtgggatacccgttcatgccgccatactggggcctgggcttccacctgtgccgctggggctactcctccaccgctatca cccgccaggtggtggagaacatgaccagggcccacttccccctggacgtccaatggaacgacctggactacatggactcccggaggga cttcacgttcaacaaggatggcttccgggacttcccggccatggtgcaggagctgcaccagggcggccggcgctacatgatgatcgtgga tcctgccatcagcagctcgggccctgccgggagctacaggccctacgacgagggtctgcggaggggggttttcatcaccaacgagaccg gccagccgctgattgggaaggtatggcccgggtccactgccttccccgacttcaccaaccccacagccctggcctggtgggaggacatg gtggctgagttccatgaccaggtgcccttcgacggcatgtggattgacatgaacgagccttccaacttcatcaggggctctgaggacggctg ccccaacaatgagctggagaacccaccctacgtgcctggggtggttggggggaccctccaggcggcaaccatctgtgcctccagccacc agtttctctccacacactacaacctgcacaacctctacggcctgaccgaagccatcgcctcccacagggcgctggtgaaggctcggggga cacgcccatttgtgatctcccgctcgacctttgctggccacggccgatacgccggccactggacgggggacgtgtggagctcctgggagc agctcgcctcctccgtgccagaaatcctgcagtttaacctgctgggggtgcctctggtcggggccgacgtctgcggcttcctgggcaacac ctcagaggagctgtgtgtgcgctggacccagctgggggccttctaccccttcatgcggaaccacaacagcctgctcagtctgccccagga gccgtacagcttcagcgagccggcccagcaggccatgaggaaggccctcaccctgcgctacgcactcctcccccacctctacacgctgtt ccaccaggcccacgtcgcgggggagaccgtggcccggcccctcttcctggagttccccaaggactctagcacctggactgtggaccacc agctcctgtggggggaggccctgctcatcaccccagtgctccaggccgggaaggccgaagtgactggctacttccccttgggcacatggt acgacctgcagacggtgccaatagaggcccttggcagcctcccacccccacctgcagctccccgtgagccagccatccacagcgaggg gcagtgggtgacgctgccggcccccctggacaccatcaacgtccacctccgggctgggtacatcatccccctgcagggccctggcctca caaccacagagtcccgccagcagcccatggccctggctgtggccctgaccaagggtggagaggcccgaggggagctgttctgggacg atggagagagcctggaagtgctggagcgaggggcctacacacaggtcatcttcctggccaggaataacacgatcgtgaatgagctggtac gtgtgaccagtgagggagctggcctgcagctgcagaaggtgactgtcctgggcgtggccacggcgccccagcaggtcctctccaacggt gtccctgtctccaacttcacctacagccccgacaccaaggtcctggacatctgtgtctcgctgttgatgggagagcagtttctcgtcagctggt gttagtctagagcttgctagcggccgc (SEQ ID NO:29)
Construct 1756
[0129] The GILTΔ2-7Δ34-40-GAA70-952 cassette below was cloned using the Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2-7Δ34-40-GAA70-952 (Plasmid 1756). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7Δ34-40 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70. The GILTΔ2-7Δ34-40 cassette contains a deletion of amino acid residues 34-40 (Arg-Val-Ser-Arg- Arg-Ser-Arg) from the human IGF-II sequence. ggtaccagctgctagcaagctaattcacaccaATGGG AATCCCAATGGGGAAGTCGATGCTGGTGCTTC
TCACCTTCTTGGCCTTCGCCTCGTGCTGCATTGCTGCTCTGTGCGGCGGGGAGCTGGT
GGACACCCTCCAGTTCGTCTGTGGGGACCGCGGCTTCTACTTCAGCAGGCCCGCAAG
CGGCATCGTTGAGGAGTGCTGTTTCCGCAGCTGTGACCTGGCCCTCCTGGAGACGTA
CTGTGCTACCCCCGCCAAGTCCGAGGGCGCGCCGgcacaccccggccgtcccagagcagtgcccacaca gtgcgacgtcccccccaacagccgcttcgattgcgcccctgacaaggccatcacccaggaacagtgcgaggcccgcggctgctgctaca tccctgcaaagcaggggctgcagggagcccagatggggcagccctggtgcttcttcccacccagctaccccagctacaagctggagaac ctgagctcctctgaaatgggctacacggccaccctgacccgtaccacccccaccttcttccccaaggacatcctgaccctgcggctggacg tgatgatggagactgagaaccgcctccacttcacgatcaaagatccagctaacaggcgctacgaggtgcccttggagaccccgcgtgtcc acagccgggcaccgtccccactctacagcgtggagttctctgaggagcccttcggggtgatcgtgcaccggcagctggacggccgcgtg ctgctgaacacgacggtggcgcccctgttctttgcggaccagttccttcagctgtccacctcgctgccctcgcagtatatcacaggcctcgcc gagcacctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaaccgggaccttgcgcccacgcccggtgcgaacct ctacgggtctcaccctttctacctggcgctggaggacggcgggtcggcacacggggtgttcctgctaaacagcaatgccatggatgtggtc ctgcagccgagccctgcccttagctggaggtcgacaggtgggatcctggatgtctacatcttcctgggcccagagcccaagagcgtggtg cagcagtacctggacgttgtgggatacccgttcatgccgccatactggggcctgggcttccacctgtgccgctggggctactcctccaccg ctatcacccgccaggtggtggagaacatgaccagggcccacttccccctggacgtccaatggaacgacctggactacatggactcccgga gggacttcacgttcaacaaggatggcttccgggacttcccggccatggtgcaggagctgcaccagggcggccggcgctacatgatgatc gtggatcctgccatcagcagctcgggccctgccgggagctacaggccctacgacgagggtctgcggaggggggttttcatcaccaacga gaccggccagccgctgattgggaaggtatggcccgggtccactgccttccccgacttcaccaaccccacagccctggcctggtgggagg acatggtggctgagttccatgaccaggtgcccttcgacggcatgtggattgacatgaacgagccttccaacttcatcaggggctctgaggac ggctgccccaacaatgagctggagaacccaccctacgtgcctggggtggttggggggaccctccaggcggcaaccatctgtgcctccag ccaccagtttctctccacacactacaacctgcacaacctctacggcctgaccgaagccatcgcctcccacagggcgctggtgaaggctcgg gggacacgcccatttgtgatctcccgctcgacctttgctggccacggccgatacgccggccactggacgggggacgtgtggagctcctgg gagcagctcgcctcctccgtgccagaaatcctgcagtttaacctgctgggggtgcctctggtcggggccgacgtctgcggcttcctgggca acacctcagaggagctgtgtgtgcgctggacccagctgggggccttctaccccttcatgcggaaccacaacagcctgctcagtctgcccca ggagccgtacagcttcagcgagccggcccagcaggccatgaggaaggccctcaccctgcgctacgcactcctcccccacctctacacgc tgttccaccaggcccacgtcgcgggggagaccgtggcccggcccctcttcctggagttccccaaggactctagcacctggactgtggacc accagctcctgtggggggaggccctgctcatcaccccagtgctccaggccgggaaggccgaagtgactggctacttccccttgggcacat ggtacgacctgcagacggtgccaatagaggcccttggcagcctcccacccccacctgcagctccccgtgagccagccatccacagcgag gggcagtgggtgacgctgccggcccccctggacaccatcaacgtccacctccgggctgggtacatcatccccctgcagggccctggcct cacaaccacagagtcccgccagcagcccatggccctggctgtggccctgaccaagggtggagaggcccgaggggagctgttctgggac gatggagagagcctggaagtgctggagcgaggggcctacacacaggtcatcttcctggccaggaataacacgatcgtgaatgagctggt acgtgtgaccagtgagggagctggcctgcagctgcagaaggtgactgtcctgggcgtggccacggcgccccagcaggtcctctccaacg gtgtccctgtctccaacttcacctacagccccgacaccaaggtcctggacatctgtgtctcgctgttgatgggagagcagtttctcgtcagctg gtgttagtctagagcttgctagcggccgc (SEQ ID NO:30)
Construct 1763
[0130] The GILTΔ2-7M1/L27A37-GAA70-952 cassette below was cloned using the
Asp718 and Notl sites of the cassette and vector pCEP4 to produce pCEP-GILTΔ2- 7M1/L27A37-GAA70-952 (Plasmid 1763). Restriction sites for cloning are in lowercase bold. The spacer amino acid sequence GIy, Ala, Pro (underlined sequence) separate the GAA gene and GILTΔ2-7M1/L27A37 tag (upper case sequence). The spacer and tag are placed upstream of GAA residue Ala70. The GILTΔ2-7M1/L27A37 cassette contains Y27L and R37A substitutions in the human IGFII sequence. The DNA sequence of the GILT cassette differs from the human DNA sequence at every 6th codon.
ggtaccaagcttgccATGGGAATCCCAATGGGCAAGTCGATGCTGGTGCTGCTCACCTTCTT
GGCCTTTGCCTCGTGCTGCATTGCCGCTCTGTGCGGCGGGGAACTGGTGGACACCCT
CCAATTCGTCTGTGGGGACCGGGGCTTCCTGTTCAGCAGACCCGCAAGCCGTGTGAG
TGCTCGCAGCCGTGGCATTGTTGAGGAGTGCTGTTTTCGCAGCTGTGACCTGGCTCT
CCTGGAGACGTACTGCGCTACCCCCGCCAAGTCTGAGGGCGCGCCGgcacaccccggccgtc ccagagcagtgcccacacagtgcgacgtcccccccaacagccgcttcgattgcgcccctgacaaggccatcacccaggaacagtgcga ggcccgcggctgctgctacatccctgcaaagcaggggctgcagggagcccagatggggcagccctggtgcttcttcccacccagctacc ccagctacaagctggagaacctgagctcctctgaaatgggctacacggccaccctgacccgtaccacccccaccttcttccccaaggacat cctgaccctgcggctggacgtgatgatggagactgagaaccgcctccacttcacgatcaaagatccagctaacaggcgctacgaggtgcc cttggagaccccgcgtgtccacagccgggcaccgtccccactctacagcgtggagttctctgaggagcccttcggggtgatcgtgcaccg gcagctggacggccgcgtgctgctgaacacgacggtggcgcccctgttctttgcggaccagttccttcagctgtccacctcgctgccctcg cagtatatcacaggcctcgccgagcacctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaaccgggaccttgcg cccacgcccggtgcgaacctctacgggtctcaccctttctacctggcgctggaggacggcgggtcggcacacggggtgttcctgctaaac agcaatgccatggatgtggtcctgcagccgagccctgcccttagctggaggtcgacaggtgggatcctggatgtctacatcttcctgggccc agagcccaagagcgtggtgcagcagtacctggacgttgtgggatacccgttcatgccgccatactggggcctgggcttccacctgtgccg ctggggctactcctccaccgctatcacccgccaggtggtggagaacatgaccagggcccacttccccctggacgtccaatggaacgacct ggactacatggactcccggagggacttcacgttcaacaaggatggcttccgggacttcccggccatggtgcaggagctgcaccagggcg gccggcgctacatgatgatcgtggatcctgccatcagcagctcgggccctgccgggagctacaggccctacgacgagggtctgcggagg ggggttttcatcaccaacgagaccggccagccgctgattgggaaggtatggcccgggtccactgccttccccgacttcaccaaccccaca gccctggcctggtgggaggacatggtggctgagttccatgaccaggtgcccttcgacggcatgtggattgacatgaacgagccttccaact tcatcaggggctctgaggacggctgccccaacaatgagctggagaacccaccctacgtgcctggggtggttggggggaccctccaggcg gcaaccatctgtgcctccagccaccagtttctctccacacactacaacctgcacaacctctacggcctgaccgaagccatcgcctcccacag ggcgctggtgaaggctcgggggacacgcccatttgtgatctcccgctcgacctttgctggccacggccgatacgccggccactggacgg gggacgtgtggagctcctgggagcagctcgcctcctccgtgccagaaatcctgcagtttaacctgctgggggtgcctctggtcggggccg acgtctgcggcttcctgggcaacacctcagaggagctgtgtgtgcgctggacccagctgggggccttctaccccttcatgcggaaccacaa cagcctgctcagtctgccccaggagccgtacagcttcagcgagccggcccagcaggccatgaggaaggccctcaccctgcgctacgca ctcctcccccacctctacacgctgttccaccaggcccacgtcgcgggggagaccgtggcccggcccctcttcctggagttccccaaggact ctagcacctggactgtggaccaccagctcctgtggggggaggccctgctcatcaccccagtgctccaggccgggaaggccgaagtgact ggctacttccccttgggcacatggtacgacctgcagacggtgccaatagaggcccttggcagcctcccacccccacctgcagctccccgt gagccagccatccacagcgaggggcagtgggtgacgctgccggcccccctggacaccatcaacgtccacctccgggctgggtacatca tccccctgcagggccctggcctcacaaccacagagtcccgccagcagcccatggccctggctgtggccctgaccaagggtggagaggc ccgaggggagctgttctgggacgatggagagagcctggaagtgctggagcgaggggcctacacacaggtcatcttcctggccaggaata acacgatcgtgaatgagctggtacgtgtgaccagtgagggagctggcctgcagctgcagaaggtgactgtcctgggcgtggccacggcg ccccagcaggtcctctccaacggtgtccctgtctccaacttcacctacagccccgacaccaaggtcctggacatctgtgtctcgctgttgatg ggagagcagtttctcgtcagctggtgttagtctagagcttgctagcggccgc (SEQ ID NO:31)
Example 3: Expression and Purification of GILT-tagged GAA enzymes
Tissue Culture
[0131] GILT-tagged GAA plasmids were each transfected into suspension FreeStyle
293-F cells as described by the manufacturer (Invitrogen). Briefly, cells were grown in Opti- MEM I media (Invitrogen) in polycarbonate shaker flasks on an orbital shaker at 370C and 8% CO2. Cells were adjusted to a concentration of 1x106 cells/ml, then transfected with a 1:1:1 ratio of ml cells:μg DNA:μl 293fectin. Culture aliquots were harvested 5-7 days post-transfection and centrifuged at 5,000 x g for 5 minutes. Supernatants were stored frozen at -8O0C.
Protein Purification and Concentration
[0132] Starting material was mammalian cell culture supernatant, as described above, thawed from storage at -8O0C. Citric acid was added to reach pH 6.0, then ammonium sulfate was added to reach a final concentration of IM. The material was passed through a 0.2 μm Supor-Mach filter (Nalgene).
[0133] The filtered material was loaded onto a Phenyl-Sepharose™ 6 Low-Sub Fast-
Flow (GE Healthcare) column prepared with HIC Load Buffer (50 mM citrate pH 6.0, IM AmSO4). The column was washed with 10 column volumes of HIC Wash Buffer (50 mM citrate pH 6.0, 0.8M AmSO4), and eluted with 5 column volumes of HIC Elution Buffer (50 mM citrate pH 6.0). Samples from the elution peaks were pooled and buffer was exchanged into phosphate buffered saline (145.15 mM NaCl, 2.33 mM KCl, 1OmM Na2HPO4, 2 mM KH2PO4, pH 6.2) using centricon spin concentrators (Amicon) and Bio-Spin-6 de-salting columns (Bio-Rad).
Enzyme Activity
[0134] GAA expression was determined by a para-nitrophenol (PNP) enzymatic assay.
GAA enzyme was incubated in 50 μl reaction mixture containing 100 mM sodium acetate pH 4.2 and 10 mM Para-Nitrophenol (PNP) α-glucoside substrate (Sigma N1377). Reactions were incubated at 37 0C for 20 minutes and stopped with 300 μl of 100 mM sodium carbonate. Absorbance at 405 nm was measured in 96-well microtiter plates and compared to standard curves derived from p-nitrophenol (Sigma N7660). 1 GAA PNP unit is defined as 1 nmole PNP hydrolyzed/ hour.
Example 4: Competitive Receptor Binding Assays
[0135] The affinity of GILT-tagged proteins for the IGF2 receptor (IGF2R), IGF 1 receptor (IGFlR) and the insulin receptor (IR) was examined in competitive binding experiments performed in a 96-well plate format. Receptors were coated at room temperature overnight onto Reacti-bind white plates (Pierce, Cat# 437111) in Coating Buffer (0.05M Carbonate buffer, pH 9.6) at a concentration of either 0.5 μg/well (IGF2R) or 1 μg/well (IGFlR, IR). Plates were washed with wash buffer (Phosphate Buffered Saline plus 0.05% Tween-20), then blocked in Super Blocking Buffer (Pierce, Cat#37516) for 1 hour. After another plate washing, biotinylated ligands (Cell Sciences) were added to wells; IGF2R wells received 8nM IGF2-biotin, IGFlR wells received 3OnM IGFl-biotin, and IR wells received 2OnM insulin-biotin. Along with the biotinylated ligands, wells also contained serial dilutions of the GILT-tagged GAA protein samples or non-biotinylated control ligands to act as binding inhibitors for the biotinylated ligands. Following a two-hour rocking incubation, plates were washed and bound biotinylated ligands were detected with a streptavidin-HRP incubation (R&D, Cat#890803, 1:200 dilution in blocking buffer, 30 minutes), followed by a Super Elisa Pico Chemiluminescent Substrate incubation (Pierce, Cat#37070, 5 minutes). The chemiluminescent signal was measured at 425 nm.
[0136] The percent bound biotinylated ligand was calculated for each competitor concentration in the IGF2R binding competition assay and the IC50 values were determined (Figure 4). Protein 1752 with a deletion of IGF2 residues 30-40 displayed a similar ICs0 value as the GILT-tagged ZC-701 (Figure 4), indicating that deletion of these residues in the IGF2 loop region does not appear to effect IGF2R binding. Protein 1751 with a deletion of IGF2 residues 29-40 displayed a higher IC50 value (Figure 4), indicating that it does not compete as well for binding to the IGF2R.
[0137] On a separate IGF2R assay plate, comparison of ZC-701 and protein 1763 yielded
IC50 values that differed by 35% (See Figure 5).
[0138] In an assay measuring the competition of biotinylated insulin binding to plate- bound insulin, 1751 and 1752 proteins were not as effective as inhibitors compared to 701 or IGF-II (See Figure 6). This indicates that the 1751 and 1752 proteins, with deletions in the loop region corresponding to amino acids 30-40 of the GILT tag, had a reduced affinity for the insulin receptor compared to the intact GILT tag on 701 or IGF-II.
[0139] In an assay measuring the competition of biotinylated IGF-I binding to plate- bound IGFlR5 1763 protein was not as effective as an inhibitor compared to 701, IGF-II or IGF-I (See Figure 7). This indicates that the 1763 protein, with Δ2-7, Y27L and R37A mutations in the GILT tag, had a reduced affinity for the IGFl receptor compared to ZC-701 or IGF-II.
Example 4. Additional insulin receptor binding assay
[0140] Protein ZC- 1487 was tested fro its binding affinity for the insulin receptor.
Protein ZC-1487 contains the GILTD2-7M1/A37 cassette contains with and Arg to Ala substitution at amino acid 37 of the human IGF2 sequence and is resistant to proteolysis by furin. Two different batches of this protein purified from CHO cells, ZC-1487-B26 and ZC-1487-B28 were analyzed in an assay measuring the competition of biotinylated insulin binding to plate- bound insulin. [0141] An insulin receptor binding assay was conducted by competing insulin, IGF-II,
ZC710B20 and ZC1487B26 or ZC-1487-B28 with Biotinylated-insulin binding to the insulin receptor (Insulin-R).
[0142] Specifically, white Reacti-Bind™ plates were coated with Insulin-R at a concentration of lug/well/ lOOul (38.4nM). The coated plates were incubate over night at room temperature, then washed 3X with washing buffer (300ul/well). The plates were then blocked with blocking buffer (300ul/well) for 1 hour. The washing steps were repeated and any trace of solution in the plates was taken out.
[0143] Biotinylated-insulin was mixed at 2OnM with different concentrations of insulin,
IGF-II, ZC701B20, B26 and B28 by serial dilutions (final concentrations are shown in Table 2). lOOul of diluted Insulin, IGF-II, ZC710B20, ZC1487B26, and ZC1487B28 in 2OnM Insulin- biotin were added into the coated plates and the plates were incubated at room temperature for 2 hours. The plates were then washed 3 times with washing buffer. lOOul of strepavidin-HRP working solution (50 ul strepavidin-HRP in 10 ml blocking buffer) was added into the plates and the plates were incubated at room temperature for 30 minutes. lOOul of Elisa-Pico working solution containing Elisa-Pico chemiluminescent substrate was added and the chemiluminescence was measured at 425nm. Exemplary results are shown in Table 2, Figure 8, and Figure 9. Both batches of ZC- 1487 were not as effective as inhibitors compared to ZC-701 or the insulin control. As can be seen from Table 2 and Figure 8, furin resistant peptide ZC- 1487B26 binds to the insulin receptor more than 10-fold less avidly than does ZC-701 and more than 20-fold less than does the wild-type IGF-II
[0144] This indicates that the 1487 protein had a reduced affinity for the insulin receptor compared to the GILT tag on ZC-701.
Table 2. Insulin-Receptor Binding Activity - Chemiluminescence Intensity
Figure imgf000062_0001
Figure imgf000062_0002
Figure imgf000062_0003
Figure imgf000062_0004
Figure imgf000062_0005
Example 5. Uptake assays
[0145] Some mutants were tested for retention of uptake activity. HEK293 cells were transfected with constructs 1479 (R37K), 1487 (R37A) or ZC-701. After harvest, culture supernatants were partially purified by HIC chromatography. All samples were treated with PNGase prior to electrophoresis.
[0146] Figure 10 shows partially purified preparations of targeted fusion proteins containing a furin-resistant IGF-II mutein tag analyzed by SDS-PAGE and immunoblotting. As can be seen, the fusion protein encoded by construct 1487 containing R37A mutation is resistant to exogenous furin.
[0147] Figure 11 illustrates exemplary uptake results of furin resistant GILT-tagged
GAA into rat L6 myoblasts. As shown in Figure 11, exemplary Kuptakes for proteins 1479, 1487, ZC-701, and purified ZC-701 are 4.5 nM, 4.4 nM, 5.0 nM and 2.6 nM, respectively, which indicates that the proteins encoded by constructs 1487 (R37A) and 1479 (R37K) retain the ability for efficient uptake into rat L6 myoblasts. The efficient uptake of fusion proteins containing a furin-resistant GILT tag also indicates that the furin-resistant tag retains high affinity for the CI- MPR.
EQUIVALENTS
[0148] Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. The scope of the present invention is not intended to be limited to the above Description, but rather is as set forth in the appended claims. The articles "a", "an", and "the" as used herein in the specification and in the claims, unless clearly indicated to the contrary, should be understood to include the plural referents. Claims or descriptions that include "or" between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The invention also includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process. Furthermore, it is to be understood that the invention encompasses variations, combinations, and permutations in which one or more limitations, elements, clauses, descriptive terms, etc., from one or more of the claims is introduced into another claim dependent on the same base claim (or, as relevant, any other claim) unless otherwise indicated or unless it would be evident to one of ordinary skill in the art that a contradiction or inconsistency would arise. Where elements are presented as lists, e.g., in Markush group or similar format, it is to be understood that each subgroup of the elements is also disclosed, and any element(s) can be removed from the group. It should it be understood that, in general, where the invention, or aspects of the invention, is/are referred to as comprising particular elements, features, etc., certain embodiments of the invention or aspects of the invention consist, or consist essentially of, such elements, features, etc. For purposes of simplicity those embodiments have not in every case been specifically set forth herein. It should also be understood that any embodiment of the invention, e.g., any embodiment found within the prior art, can be explicitly excluded from the claims, regardless of whether the specific exclusion is recited in the specification.
[0149] It should also be understood that, unless clearly indicated to the contrary, in any methods claimed herein that include more than one act, the order of the acts of the method is not necessarily limited to the order in which the acts of the method are recited, but the invention includes embodiments in which the order is so limited. Furthermore, where the claims recite a composition, the invention encompasses methods of using the composition and methods of making the composition. Where the claims recite a composition, it should be understood that the invention encompasses methods of using the composition and methods of making the composition.
INCORPORATION OF REFERENCES
[0150] All publications and patent documents cited in this application are incorporated by reference in their entirety to the same extent as if the contents of each individual publication or patent document were incorporated herein.
[0151] What is claimed is:

Claims

1. A targeted therapeutic fusion protein comprising: a lysosomal enzyme; and an IGF-II mutein having an amino acid sequence at least 70% identical to mature human IGF-II (SEQ ID NO:1), wherein the IGF-II mutein is resistant to furin cleavage and binds to the human cation-independent mannose-6-phosphate receptor in a mannose-6-phosphate- independent manner.
2. A targeted therapeutic fusion protein comprising: a lysosomal enzyme; and an IGF-II mutein having an amino acid sequence at least 70% identical to mature human IGF-II (SEQ ID NO:1), and having diminished binding affinity for the insulin receptor relative to the affinity of naturally-occurring human IGF-II for the insulin receptor; wherein the IGF-II mutein binds to the human cation-independent mannose-6-phosphate receptor in a mannose-6-phosphate-independent manner.
3. A targeted therapeutic fusion protein comprising: a lysosomal enzyme; and an IGF-II mutein having an amino acid sequence at least 70% identical to mature human IGF-II (SEQ ID NO:1), and having diminished binding affinity for the insulin receptor relative to the affinity of naturally-occurring human IGF-II for the insulin receptor; wherein the IGF-II mutein is resistant to furin cleavage and binds to the human cation- independent mannose-6-phosphate receptor in a mannose-6-phosphate-independent manner.
4. The targeted therapeutic fusion protein of any one of claims 1-3, wherein the IGF-II mutein comprises a mutation within a region corresponding to amino acids 30-40 of SEQ ID NO:1.
5. The targeted therapeutic fusion protein of any one of the preceding claims, wherein the IGF-II mutein comprises a mutation within a region corresponding to amino acids 34-40 of SEQ ID NO:1 such that the mutation abolishes at least one furin protease cleavage site
6. The targeted therapeutic fusion protein of claim 4 or 5, wherein the mutation is an amino acid substitution, deletion and/or insertion.
7. The targeted therapeutic fusion protein of claim 6, wherein the mutation is an amino acid substitution at a position corresponding to Arg37 or Arg40 of SEQ ID NO: 1.
8. The targeted therapeutic fusion protein of claim 7, wherein the amino acid substitution is a Lys or Ala substitution.
9. The targeted therapeutic fusion protein of claim 6, wherein the mutation is a deletion or replacement of amino acid residues corresponding to positions selected from the group consisting of 31-40, 32-40, 33-40, 34-40, 30-39, 31-39, 32-39, 34-37, 32-39, 33-39, 34-39, 35- 39, 36-39, 37-40, 34-40 of SEQ ID NO:1, and combinations thereof.
10. The targeted therapeutic fusion protein of any one of the preceding claims, wherein the IGF- II mutein further comprises a deletion or a replacement of amino acids corresponding to positions 2-7 of SEQ ID NO:1.
11. The targeted therapeutic fusion protein of any one of claims 1-10, wherein the IGF-II mutein further comprises a deletion or a replacement of amino acids corresponding to positions 1-7 of SEQ ID NO: 1.
12. The targeted therapeutic fusion protein of any one of the preceding claims, wherein the IGF- II mutein further comprises a deletion or a replacement of amino acids corresponding to positions 62-67 of SEQ ID NO:1.
13. The targeted therapeutic fusion protein of any one of the preceding claims, wherein the IGF- II mutein further comprises an amino acid substitution at a position corresponding to Tyr27, Leu43, or Ser26 of SEQ ID NO:1.
14. The targeted therapeutic fusion protein of claim 13, wherein the IGF-II mutein comprises at least an amino acid substitution selected from the group consisting of Tyr27Leu, Leu43Val, Ser26Phe and combinations thereof.
15. The targeted therapeutic fusion protein of any one of the preceding claims, wherein the IGF- II mutein comprises amino acids corresponding to positions 48-55 of SEQ ID NO:1.
16. The targeted therapeutic fusion protein of any one of the preceding claims, wherein the IGF- II mutein comprises at least three amino acids selected from the group consisting of amino acids corresponding to positions 8, 48, 49, 50, 54, and 55 of SEQ ID NO:1.
17. The targeted therapeutic fusion protein of any one of the preceding claims, wherein the IGF- II mutein comprises, at positions corresponding to positions 54 and 55 of SEQ ID NO:1, amino acids each of which is uncharged or negatively charged at pH 7.4.
18. The targeted therapeutic fusion protein of any one of the preceding claims, wherein the IGF- II mutein has diminished binding affinity for the IGF-I receptor relative to the affinity of naturally-occurring human IGF-II for the IGF-I receptor.
19. The targeted therapeutic fusion protein of any one of the preceding claims, wherein the lysosomal enzyme is human acid alpha-glucosidase (GAA), or a functional variant thereof.
20. The targeted therapeutic fusion protein of claim 18, wherein the lysosomal enzyme comprises amino acids 70-952 of human GAA.
21. The targeted therapeutic fusion protein of any one of the preceding claims, wherein the targeted therapeutic fusion protein further comprises a spacer between the lysosomal enzyme and the IGF-II mutein.
22. The targeted therapeutic fusion protein of claim 21, wherein the spacer comprises an amino acid sequence Gly-Ala-Pro.
23. A nucleic acid encoding the targeted therapeutic fusion protein of any one of the preceding claims.
24. A cell containing the nucleic acid of claim 23.
25. A pharmaceutical composition suitable for treating lysosomal storage disease comprising a targeted therapeutic fusion protein of any one of the preceding claims.
26. A method of treating lysosomal storage disease comprising administering to a subject in need of treatment a targeted therapeutic fusion protein of any one of the preceding claims.
27. The method of claim 26, wherein the lysosomal storage disease is Pompe Disease.
28. The method of claim 26, wherein the lysosomal storage disease is Fabry Disease.
29. The method of claim 26, wherein the lysosomal storage disease is Gaucher Disease.
30. A method of producing a targeted therapeutic fusion protein comprising a step of: culturing mammalian cells in a cell culture medium, wherein the mammalian cells carry the nucleic acid of claim 23; and the culturing is performed under conditions that permit expression of the targeted therapeutic fusion protein.
31. A method of producing a targeted therapeutic fusion protein comprising a step of: culturing furin-deficient cells in a cell culture medium, wherein the furin-deficient cells carry a nucleic acid encoding a fusion protein comprising a lysosomal enzyme and an IGF-II mutein having an amino acid sequence at least 70% identical to mature human IGF-II (SEQ ID NO:1), wherein the IGF-II mutein binds to the human cation-independent mannose-6-phosphate receptor in a mannose-6-phosphate- independent manner; and wherein the culturing is performed under conditions that permit expression of the targeted therapeutic fusion protein.
PCT/US2009/043207 2008-05-07 2009-05-07 Lysosomal targeting peptides and uses thereof WO2009137721A2 (en)

Priority Applications (23)

Application Number Priority Date Filing Date Title
EP17182845.2A EP3272773B8 (en) 2008-05-07 2009-05-07 Lysosomal targeting peptides and uses thereof
US12/991,104 US20110223147A1 (en) 2008-05-07 2009-05-07 Lysosomal targeting peptides and uses thereof
EP20184387.7A EP3778652A1 (en) 2008-05-07 2009-05-07 Lysosomal targeting peptides and uses thereof
ES09743707.3T ES2629853T3 (en) 2008-05-07 2009-05-07 Lysosomal direction peptides and uses thereof
CN200980123156.6A CN102066422B (en) 2008-05-07 2009-05-07 Lysosomal targeting peptides and uses thereof
AU2009244148A AU2009244148B2 (en) 2008-05-07 2009-05-07 Lysosomal targeting peptides and uses thereof
JP2011508686A JP5627571B2 (en) 2008-05-07 2009-05-07 Lysosomal targeting peptides and uses thereof
CA2723412A CA2723412A1 (en) 2008-05-07 2009-05-07 Lysosomal targeting peptides and uses thereof
BRPI0912225-7A BRPI0912225A2 (en) 2008-05-07 2009-05-07 lysosomal targeting peptides and uses thereof
DK09743707.3T DK2279210T3 (en) 2008-05-07 2009-05-07 Lysosomal targeting peptides and uses thereof
PL09743707T PL2279210T3 (en) 2008-05-07 2009-05-07 Lysosomal targeting peptides and uses thereof
EP09743707.3A EP2279210B1 (en) 2008-05-07 2009-05-07 Lysosomal targeting peptides and uses thereof
BR122017015900A BR122017015900A2 (en) 2008-05-07 2009-05-07 nucleic acid and cells
IL209091A IL209091A (en) 2008-05-07 2010-11-03 Lysosomal targeted fusion proteins and uses thereof
US13/399,844 US8563691B2 (en) 2008-05-07 2012-02-17 Lysosomal targeting peptides and uses thereof
US14/535,505 US9469683B2 (en) 2008-05-07 2014-11-07 Lysosomal targeting peptides and uses thereof
US15/274,115 US20170007680A1 (en) 2008-05-07 2016-09-23 Lysosomal Targeting Peptides and Uses Thereof
HRP20170698TT HRP20170698T1 (en) 2008-05-07 2017-05-10 Lysosomal targeting peptides and uses thereof
CY20171100545T CY1119183T1 (en) 2008-05-07 2017-05-25 Lysosomal Targeting Peptides And Their Uses
US15/657,764 US11351231B2 (en) 2008-05-07 2017-07-24 Lysosomal targeting peptides and uses thereof
US16/869,862 US20210069304A1 (en) 2008-05-07 2020-05-08 Lysosomal Targeting Peptides and Uses Thereof
US17/829,620 US20220354934A1 (en) 2008-05-07 2022-06-01 Lysosomal Targeting Peptides and Uses Thereof
US17/815,468 US20230241187A1 (en) 2008-05-07 2022-07-27 Lysosomal Targeting Peptides and Uses Thereof

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US5133608P 2008-05-07 2008-05-07
US61/051,336 2008-05-07
US14410609P 2009-01-12 2009-01-12
US61/144,106 2009-01-12

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US12/991,104 A-371-Of-International US20110223147A1 (en) 2008-05-07 2009-05-07 Lysosomal targeting peptides and uses thereof
US13/399,844 Continuation US8563691B2 (en) 2008-05-07 2012-02-17 Lysosomal targeting peptides and uses thereof
US14/535,505 Continuation US9469683B2 (en) 2008-05-07 2014-11-07 Lysosomal targeting peptides and uses thereof

Publications (2)

Publication Number Publication Date
WO2009137721A2 true WO2009137721A2 (en) 2009-11-12
WO2009137721A3 WO2009137721A3 (en) 2010-04-08

Family

ID=41265422

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2009/043207 WO2009137721A2 (en) 2008-05-07 2009-05-07 Lysosomal targeting peptides and uses thereof

Country Status (17)

Country Link
US (8) US20110223147A1 (en)
EP (4) EP2279210B1 (en)
JP (1) JP5627571B2 (en)
CN (1) CN102066422B (en)
AU (1) AU2009244148B2 (en)
BR (2) BRPI0912225A2 (en)
CA (1) CA2723412A1 (en)
CY (1) CY1119183T1 (en)
DK (1) DK2279210T3 (en)
ES (2) ES2830350T3 (en)
HK (1) HK1250042A1 (en)
HR (1) HRP20170698T1 (en)
HU (1) HUE034850T2 (en)
IL (1) IL209091A (en)
PL (1) PL2279210T3 (en)
PT (1) PT2279210T (en)
WO (1) WO2009137721A2 (en)

Cited By (37)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010148253A2 (en) 2009-06-17 2010-12-23 Zystor Therapeutics, Inc. Formulations for lysosomal enzymes
CN102121021A (en) * 2010-12-21 2011-07-13 南京师范大学 cDNA of interferon (IFN)-gamma inducible lysosomal thiol reductase of sheep, cloning method and recombinant application thereof
WO2011163652A2 (en) 2010-06-25 2011-12-29 Shire Human Genetic Therapies, Inc. Treatment of sanfilippo syndrome type b
US20120232021A1 (en) * 2011-03-04 2012-09-13 Paolo Martini Peptide linkers for polypeptide compositions and methods for using same
WO2012122042A2 (en) 2011-03-04 2012-09-13 Shire Human Genetic Therapies, Inc. Peptide linkers for polypeptide compositions and methods for using same
US8540985B2 (en) 2008-06-26 2013-09-24 Orphazyme Aps Use of Hsp70 as a regulator of enzymatic activity
US8545837B2 (en) 2010-06-25 2013-10-01 Shire Human Genetic Therapies, Inc. Methods and compositions for CNS delivery of iduronate-2-sulfatase
WO2014085621A1 (en) * 2012-11-27 2014-06-05 Biomarin Pharmaceutical Inc. Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof
US9220677B2 (en) 2010-06-25 2015-12-29 Shire Human Genetic Therapies, Inc. Methods and compositions for CNS delivery of iduronate-2-sulfatase
US9283181B2 (en) 2010-06-25 2016-03-15 Shire Human Genetic Therapies, Inc. CNS delivery of therapeutic agents
US9320711B2 (en) 2010-06-25 2016-04-26 Shire Human Genetic Therapies, Inc. Methods and compositions for CNS delivery of heparan N-sulfatase
WO2016065319A1 (en) * 2014-10-24 2016-04-28 Shire Human Genetic Therapies, Inc. Lysosomal targeting of enzymes, and uses thereof
WO2016085820A1 (en) * 2014-11-24 2016-06-02 Shire Human Genetic Therapies, Inc. Lysosomal targeting and uses thereof
US9545450B2 (en) 2011-05-27 2017-01-17 Amicus Therapeutics Inc. Methods for coupling targeting peptides onto recombinant lysosomal enzymes for improved treatments of lysosomal storage diseases
US9598682B2 (en) 2009-09-29 2017-03-21 Vib Vzw Hydrolysis of mannose-1-phospho-6-mannose linkage to phospho-6-mannose
US9662375B2 (en) 2010-11-30 2017-05-30 Orphazyme Aps Methods for increasing intracellular activity of Hsp70
US9689015B2 (en) 2010-09-29 2017-06-27 Oxyrane Uk Limited De-mannosylation of phosphorylated N-glycans
WO2017147414A1 (en) 2016-02-24 2017-08-31 Biomarin Pharmaceutical Inc. Targeted therapeutic lysosomal enzyme fusion proteins, associated formulations and uses thereof
US9770410B2 (en) 2010-06-25 2017-09-26 Shire Human Genetic Therapies, Inc. Methods and compositions for CNS delivery of arylsulfatase A
US10011857B2 (en) 2010-09-29 2018-07-03 Oxyrane Uk Limited Mannosidases capable of uncapping mannose-1-phospho-6-mannose linkages and demannosylating phosphorylated N-glycans and methods of facilitating mammalian cellular uptake of glycoproteins
US10023854B2 (en) 2007-04-03 2018-07-17 Oxyrane Uk Limited Microorganisms genetically engineered to have modified N-glycosylation activity
US10287557B2 (en) 2009-11-19 2019-05-14 Oxyrane Uk Limited Yeast strains producing mammalian-like complex N-glycans
EP2825193B1 (en) * 2012-03-15 2019-11-13 Oxyrane UK Limited Methods and materials for treatment of pompe's disease
US10660944B2 (en) 2011-12-23 2020-05-26 Shire Human Genetic Therapies, Inc. Stable formulations for CNS delivery of arylsulfatase A
WO2020132452A1 (en) 2018-12-20 2020-06-25 Shire Human Genetic Therapies, Inc. Purification of iduronate-2-sulfatase immunoglobulin fusion protein
US10709700B2 (en) 2014-09-15 2020-07-14 Orphazyme A/S Arimoclomol formulation
US10874750B2 (en) 2018-04-30 2020-12-29 Amicus Therapeutics, Inc. Gene therapy constructs and methods of use
US10898476B2 (en) 2016-04-13 2021-01-26 Orphazyme A/S Heat shock proteins and cholesterol homeostasis
US11097015B2 (en) 2018-10-10 2021-08-24 Amicus Therapeutics, Inc. Disulfide bond stabilized polypeptide compositions and methods of use
US11253505B2 (en) 2016-04-29 2022-02-22 Orphazyme A/S Arimoclomol for treating glucocerebrosidase associated disorders
EP3880823A4 (en) * 2018-11-16 2022-08-17 Asklepios Biopharmaceutical, Inc. Therapeutic adeno-associated virus for treating pompe disease
US11512145B2 (en) 2007-07-27 2022-11-29 Armagen, Inc. Methods and compositions for increasing alpha-L-iduronidase activity in the CNS
US11707456B2 (en) 2020-11-19 2023-07-25 Kempharm Denmark A/S Processes for preparing arimoclomol citrate and intermediates thereof
WO2023204714A1 (en) 2022-04-22 2023-10-26 Erasmus University Medical Center Rotterdam Gene therapy for pompe disease
WO2024096738A1 (en) 2022-11-01 2024-05-10 Erasmus University Medical Center Rotterdam Gene therapy constructs for metabolic disorders
US12043661B2 (en) 2009-10-09 2024-07-23 Armagen, Inc. Methods and compositions for increasing iduronate 2-sulfatase activity in the CNS
US12121569B2 (en) 2022-01-18 2024-10-22 Takeda Pharmaceutical Company Limited Methods and compositions for CNS delivery of iduronate-2-sulfatase

Families Citing this family (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2279210B1 (en) 2008-05-07 2017-04-12 BioMarin Pharmaceutical Inc. Lysosomal targeting peptides and uses thereof
WO2014082080A2 (en) * 2012-11-26 2014-05-30 Callidus Biopharma, Inc. Methods for coupling targeting peptides onto recombinant lysosomal enzymes for improved treatments of lysosomal storage diseases
CA2956469A1 (en) * 2014-08-11 2016-02-18 Shire Human Genetic Therapies, Inc. Mannose-6-phosphate bearing peptides fused to lysosomal enzymes
PT3201320T (en) 2014-09-30 2024-01-12 Amicus Therapeutics Inc Highly potent acid alpha-glucosidase with enhanced carbohydrates
WO2017079729A1 (en) 2015-11-06 2017-05-11 Biomarin Pharmaceutical Inc. Cell-based assays for detection of antibodies or other factors that neutralize uptake of lysosomal enzymes
NZ760232A (en) 2017-06-07 2023-05-26 Regeneron Pharma Compositions and methods for internalizing enzymes
CA3076369A1 (en) 2017-10-02 2019-04-11 Denali Therapeutics Inc. Fusion proteins comprising enzyme replacement therapy enzymes
US10325665B2 (en) * 2017-12-08 2019-06-18 Intel Corporation Block by deck operations for NAND memory
CN113105526B (en) * 2020-01-09 2022-04-26 北京鲲达宇科技有限公司 Polypeptide, application thereof, probe comprising polypeptide and kit
EP4243855A4 (en) * 2020-11-16 2024-10-16 Avrobio Inc Compositions and methods for treating pompe disease
CN114573714B (en) * 2021-03-15 2023-03-31 北京大学 Conjugate for target molecule modification and preparation method thereof
US20240279360A1 (en) 2021-06-23 2024-08-22 Lycia Therapeutics, Inc. Bifunctional compounds containing igf-2 polypeptides
CN115975039A (en) * 2021-10-15 2023-04-18 中山大学 Recombinant fusion antibodies and antibody-drug conjugates and uses thereof
CN114404615B (en) * 2022-02-11 2024-05-24 国家纳米科学中心 Polypeptide nano micelle preparation, and preparation method and application thereof
US12091694B2 (en) 2022-11-18 2024-09-17 Seismic Therapeutic, Inc. Fc fusion molecules and uses thereof

Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002087510A2 (en) 2001-04-30 2002-11-07 Symbiontics, Inc. Subcellular targeting of therapeutic proteins
US20030072761A1 (en) 2001-10-16 2003-04-17 Lebowitz Jonathan Methods and compositions for targeting proteins across the blood brain barrier
WO2003032913A2 (en) 2001-10-16 2003-04-24 Symbiontics Inc. Methods and compositions for targeting proteins across the blood brain barrier
WO2003102583A1 (en) 2002-05-29 2003-12-11 Symbiontics, Inc. Targeted therapeutic proteins
US20040006008A1 (en) 2001-04-30 2004-01-08 Symbiontics, Inc. Targeted therapeutic proteins
WO2005078077A2 (en) 2004-02-10 2005-08-25 Zystor Therapeutics, Inc. Acid alpha-glucosidase and fragments thereof
US20050281805A1 (en) 2002-05-29 2005-12-22 Symbiontics, Inc. Targeted therapeutic proteins

Family Cites Families (96)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4309776A (en) * 1980-05-13 1982-01-12 Ramon Berguer Intravascular implantation device and method of using the same
US4749570A (en) * 1981-12-31 1988-06-07 The Governors Of The University Of Alberta Targeting conjugates of albumin and therapeutic agents
US4522811A (en) * 1982-07-08 1985-06-11 Syntex (U.S.A.) Inc. Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides
EP0189481B1 (en) * 1984-07-13 1991-01-23 Chiron Corporation Insulin-like growth factor ii
ATE63757T1 (en) 1985-03-28 1991-06-15 Chiron Corp EXPRESSION THROUGH USE OF FUSION GENES FOR PROTEIN PRODUCTION.
US4902505A (en) * 1986-07-30 1990-02-20 Alkermes Chimeric peptides for neuropeptide delivery through the blood-brain barrier
US4801575A (en) * 1986-07-30 1989-01-31 The Regents Of The University Of California Chimeric peptides for neuropeptide delivery through the blood-brain barrier
US5470828A (en) * 1987-12-24 1995-11-28 Gropep Pty. Ltd. Peptide analogs of insulin-like growth factor II
US5817623A (en) * 1995-03-06 1998-10-06 Univ Colorado State Res Found Method for treating diabetic peripheral neuropathy with IGF-I or IGF-II
US5236838A (en) * 1988-12-23 1993-08-17 Genzyme Corporation Enzymatically active recombinant glucocerebrosidase
US6451600B1 (en) * 1989-12-22 2002-09-17 Genzyme Corporation Enzymatically active recombinant glucocerebrosidase
US5549892A (en) * 1988-12-23 1996-08-27 Genzyme Corporation Enhanced in vivo uptake of glucocerebrosidase
US5399346A (en) * 1989-06-14 1995-03-21 The United States Of America As Represented By The Department Of Health And Human Services Gene therapy
US5672683A (en) 1989-09-07 1997-09-30 Alkermes, Inc. Transferrin neuropharmaceutical agent fusion protein
US5977307A (en) * 1989-09-07 1999-11-02 Alkermes, Inc. Transferrin receptor specific ligand-neuropharmaceutical agent fusion proteins
AU6501390A (en) 1989-09-21 1991-04-18 Synergen, Inc. Method for transporting compositions across the blood brain barrier
US6610299B1 (en) * 1989-10-19 2003-08-26 Aventis Pharma Deutschland Gmbh Glycosyl-etoposide prodrugs, a process for preparation thereof and the use thereof in combination with functionalized tumor-specific enzyme conjugates
WO1991014438A1 (en) 1990-03-20 1991-10-03 The Trustees Of Columbia University In The City Of New York Chimeric antibodies with receptor binding ligands in place of their constant region
US5248606A (en) 1990-06-11 1993-09-28 Dowelanco Dna encoding inactive precursor and active forms of maize ribosome inactivating protein
US5401650A (en) * 1990-10-24 1995-03-28 The Mount Sinai School Of Medicine Of The City University Of New York Cloning and expression of biologically active α-galactosidase A
US5356804A (en) * 1990-10-24 1994-10-18 Mount Sinai School Of Medicine Of The City Of New York Cloning and expression of biologically active human α-galactosidase A
US5206161A (en) 1991-02-01 1993-04-27 Genentech, Inc. Human plasma carboxypeptidase B
US5633235A (en) * 1991-04-19 1997-05-27 Regents Of The University Of Michigan Triciribine and analogs as antiviral drugs
FR2676058B1 (en) * 1991-04-30 1994-02-25 Hoechst Lab GLYCOSYLATED PRODUCTS, THEIR PREPARATION PROCESS AND THEIR USE IN THE TREATMENT OF CANCERS.
US6287792B1 (en) 1991-06-17 2001-09-11 The Regents Of The University Of California Drug delivery of antisense oligonucleotides and peptides to tissues in vivo and to cells using avidin-biotin technology
AU2368892A (en) * 1991-07-29 1993-03-02 British Bio-Technology Limited Igf-ii analogues
WO1993006216A1 (en) 1991-09-26 1993-04-01 Oklahoma Medical Research Foundation Fusion proteins targeted to lysosomes, for the treatment of aids
US6270989B1 (en) * 1991-11-05 2001-08-07 Transkaryotic Therapies, Inc. Protein production and delivery
US6310040B1 (en) * 1991-11-08 2001-10-30 Cephalon, Inc. Treating retinal neuronal disorders by the application of insulin-like growth factors and analogs
JPH07509444A (en) 1991-11-26 1995-10-19 アルカーメス・インコーポレーテツド Method for producing transferrin receptor-specific antibody-nerve drug or diagnostic drug complex
US5258453A (en) * 1992-01-21 1993-11-02 University Of Utah Drug delivery system for the simultaneous delivery of drugs activatable by enzymes and light
EP0646178A1 (en) * 1992-06-04 1995-04-05 The Regents Of The University Of California expression cassette with regularoty regions functional in the mammmlian host
US5981194A (en) * 1992-07-10 1999-11-09 University Of British Columbia Use of p97 and iron binding proteins as diagnostic and therapeutic agents
EP0652775B1 (en) 1992-07-27 2000-04-19 THE GOVERNMENT OF THE UNITED STATES OF AMERICA as represented by the SECRETARY OF THE DEPARTMENT OF HEALTH AND HUMAN SERVICES Targeting of liposomes to the blood-brain barrier
US5476779A (en) * 1992-09-30 1995-12-19 University Of Maryland At College Park DNA encoding insulin-like growth factor II isolated from rainbow trout
EP0599303A3 (en) 1992-11-27 1998-07-29 Takeda Chemical Industries, Ltd. Peptide conjugate
US5633234A (en) * 1993-01-22 1997-05-27 The Johns Hopkins University Lysosomal targeting of immunogens
US5798366A (en) * 1993-05-13 1998-08-25 Monsanto Company Method for treatment of CNS-involved lysosomal storage diseases
US5704910A (en) * 1995-06-05 1998-01-06 Nephros Therapeutics, Inc. Implantable device and use therefor
US6281010B1 (en) * 1995-06-05 2001-08-28 The Trustees Of The University Of Pennsylvania Adenovirus gene therapy vehicle and cell line
US5817789A (en) * 1995-06-06 1998-10-06 Transkaryotic Therapies, Inc. Chimeric proteins for use in transport of a selected substance into cells
US20020013953A1 (en) * 1995-08-02 2002-01-31 Reuser Arnold J. Compositions and methods for treating enzyme deficiency
US6118045A (en) * 1995-08-02 2000-09-12 Pharming B.V. Lysosomal proteins produced in the milk of transgenic animals
US20010006635A1 (en) * 1995-09-29 2001-07-05 D. Clark Bennett Use of heparinase to decrease inflammatory responses
US6348194B1 (en) * 1995-11-13 2002-02-19 Ixsys Incorporated Tumor specific internalizing antigens and methods for targeting therapeutic agents
US6344436B1 (en) * 1996-01-08 2002-02-05 Baylor College Of Medicine Lipophilic peptides for macromolecule delivery
JP2000501744A (en) * 1996-01-22 2000-02-15 クリエイティブ バイオモレキゥルズ，インコーポレーテッド Morphogen analogs and their preparation
US6020144A (en) * 1996-09-12 2000-02-01 Symbiontics, Inc. Sustained delivery device comprising a Leishmania protozoa and methods of making and using the same
US6458574B1 (en) 1996-09-12 2002-10-01 Transkaryotic Therapies, Inc. Treatment of a α-galactosidase a deficiency
US6083725A (en) * 1996-09-13 2000-07-04 Transkaryotic Therapies, Inc. Tranfected human cells expressing human α-galactosidase A protein
US6235874B1 (en) * 1997-01-10 2001-05-22 Academia Sinica Production of biologically active recombinant insulin-like growth factor II polypeptides
US6329501B1 (en) * 1997-05-29 2001-12-11 Auburn University Methods and compositions for targeting compounds to muscle
EP1025521B1 (en) * 1997-06-02 2007-04-11 The Johns Hopkins University Computer method utilizing free energy calculations for ligand design and the prediction of binding targets
US6472140B1 (en) * 1997-09-05 2002-10-29 The General Hospital Corporation α-2- macroglobulin therapies and drug screening methods for Alzheimer's disease.
EP2147681A1 (en) * 1997-10-29 2010-01-27 Genzyme Corporation Compositions and methods for treating lysosomal storage disease
MXPA01001445A (en) * 1998-08-11 2002-11-29 Large Scale Biology Corp Method for recovering proteins from the interstitial fluid of plant tissues.
ATE410506T1 (en) * 1998-12-07 2008-10-15 Genzyme Corp TREATMENT OF POMPES DISEASE
US6596500B1 (en) * 1998-12-08 2003-07-22 The General Hospital Corporation Binding of retinoids to M6P/IGF-II receptor
US6638727B1 (en) * 1999-01-26 2003-10-28 Cytyc Health Corporation Methods for identifying treating or monitoring asymptomatic patients for risk reduction or therapeutic treatment of breast cancer
US6537785B1 (en) * 1999-09-14 2003-03-25 Genzyme Glycobiology Research Institute, Inc. Methods of treating lysosomal storage diseases
US6770468B1 (en) * 1999-09-14 2004-08-03 Genzyme Glycobiology Research Institute, Inc. Phosphodiester-α-GlcNAcase of the lysosomal targeting pathway
US6426208B1 (en) 1999-11-12 2002-07-30 Harbor-Ucla Research And Education Institute Recombinant α-L-iduronidase, methods for producing and purifying the same and methods for treating diseases caused by deficiencies thereof
US6569661B1 (en) * 1999-11-12 2003-05-27 Biomarin Pharmaceutical Inc. Recombinant α-L-iduronidase, methods for producing and purifying the same and methods for treating diseases caused by deficiencies thereof
US6585971B1 (en) * 1999-11-12 2003-07-01 Harbor-Ucla Research And Education Institute Recombinant α-L-iduronidase, methods for producing and purifying the same and methods for treating disease caused by deficiencies thereof
DK174076B1 (en) 2000-01-21 2002-05-21 Flowcon Int As Control insert for valves and valve assembly
US20020081654A1 (en) * 2000-04-07 2002-06-27 Sandrin Mauro Sergio Targeting hydrolase enzymes
GR1004008B (en) 2000-07-13 2002-10-02 Environmental Focus International Bv (Efi) Method and metals for the construction of electrode anode for the electrolysis of liquid effluents
DK3108895T3 (en) * 2000-07-18 2018-11-26 Univ Duke Treatment of glycogen storage disease type II
AUPR030900A0 (en) * 2000-09-22 2000-10-12 Queensland University Of Technology Growth factor complex
AU2002241540A1 (en) 2000-11-30 2002-06-11 Symbiontics, Inc. Protozoan expression systems for lysosomal storage disease genes
US20020142299A1 (en) * 2001-01-09 2002-10-03 Davidson Beverly L. PTD-modified proteins
US7723296B2 (en) * 2001-01-18 2010-05-25 Genzyme Corporation Methods for introducing mannose-6-phosphate and other oligosaccharides onto glycoproteins and its application thereof
US7320793B2 (en) 2001-01-19 2008-01-22 Cytos Biotechnology Ag Molecular antigen array
US20030004236A1 (en) * 2001-04-20 2003-01-02 Meade Thomas J. Magnetic resonance imaging agents for detection and delivery of therapeutic agents and detection of physiological substances
US20040005309A1 (en) 2002-05-29 2004-01-08 Symbiontics, Inc. Targeted therapeutic proteins
US6905856B2 (en) * 2001-12-21 2005-06-14 Genzyme Glycobiology Research Institute, Inc. Soluble GlcNAc phosphotransferase
US6800472B2 (en) * 2001-12-21 2004-10-05 Genzyme Glycobiology Research Institute, Inc. Expression of lysosomal hydrolase in cells expressing pro-N-acetylglucosamine-1-phosphodiester α-N-acetyl glucosimanidase
EP1463512B1 (en) 2002-01-11 2014-05-28 biOasis Technologies Inc. Use of p97 as an enzyme delivery system for the delivery of therapeutic lysosomal enzymes
US7658916B2 (en) * 2002-04-05 2010-02-09 Genzyme Corporation Methods of enhancing lysosomal storage disease therapy by modulation of cell surface receptor density
US7485314B2 (en) * 2002-05-06 2009-02-03 Los Angeles Biomedical Research Institute At Harbor-Ucla Medical Center Induction of antigen specific immunologic tolerance
JP4828121B2 (en) * 2002-05-29 2011-11-30 バイオマリン ファーマシューティカル インコーポレイテッド Targeted therapeutic protein
US20050142141A1 (en) * 2002-11-27 2005-06-30 Pardridge William M. Delivery of enzymes to the brain
JP5433133B2 (en) * 2003-01-22 2014-03-05 デューク・ユニヴァーシティ Improved construct for expressing lysosomal polypeptides
US20050026823A1 (en) * 2003-06-20 2005-02-03 Biomarin Pharmaceutical Inc. Use of the chaperone receptor-associated protein (RAP) for the delivery of therapeutic compounds to the brain and other tissues
US7442372B2 (en) * 2003-08-29 2008-10-28 Biomarin Pharmaceutical Inc. Delivery of therapeutic compounds to the brain and other tissues
US20060078542A1 (en) * 2004-02-10 2006-04-13 Mah Cathryn S Gel-based delivery of recombinant adeno-associated virus vectors
US8017151B2 (en) * 2004-09-07 2011-09-13 Board Of Regents Of The University Of Nebraska By And Behalf Of The University Of Nebraska Medical Center Amphiphilic polymer-protein conjugates and methods of use thereof
HUE027645T2 (en) * 2005-01-07 2016-10-28 Regeneron Pharma IGF-1 fusion polypeptides and therapeutic uses thereof
EP1888098A2 (en) 2005-05-25 2008-02-20 Neose Technologies, Inc. Glycopegylated erythropoietin formulations
EP2005166B1 (en) * 2006-03-17 2011-06-01 BioMarin Pharmaceutical Inc. Assays for detection of antibodies to lysosomal enzymes
UA97953C2 (en) * 2006-06-09 2012-04-10 Новартіс Аг Stabilized insulin-like growth factor polypeptides
CA2680189A1 (en) * 2007-03-06 2008-09-12 Saint Louis University Modified enzyme and treatment method
EP2279210B1 (en) 2008-05-07 2017-04-12 BioMarin Pharmaceutical Inc. Lysosomal targeting peptides and uses thereof
ES2569514T3 (en) * 2009-06-17 2016-05-11 Biomarin Pharmaceutical Inc. Formulations for lysosomal enzymes
NZ702801A (en) * 2010-06-25 2016-08-26 Shire Human Genetic Therapies Treatment of sanfilippo syndrome type b
PL3115372T3 (en) * 2012-11-27 2019-09-30 Biomarin Pharmaceutical Inc. Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof

Patent Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002087510A2 (en) 2001-04-30 2002-11-07 Symbiontics, Inc. Subcellular targeting of therapeutic proteins
US20030082176A1 (en) 2001-04-30 2003-05-01 Symbiontics, Inc. Subcellular targeting of therapeutic proteins
US20040006008A1 (en) 2001-04-30 2004-01-08 Symbiontics, Inc. Targeted therapeutic proteins
US20030072761A1 (en) 2001-10-16 2003-04-17 Lebowitz Jonathan Methods and compositions for targeting proteins across the blood brain barrier
WO2003032913A2 (en) 2001-10-16 2003-04-24 Symbiontics Inc. Methods and compositions for targeting proteins across the blood brain barrier
WO2003032727A1 (en) 2001-10-16 2003-04-24 Symbiontics Inc. Methods and compositions for targeting underglycosylated proteins across the blood brain barrier
WO2003102583A1 (en) 2002-05-29 2003-12-11 Symbiontics, Inc. Targeted therapeutic proteins
US20050281805A1 (en) 2002-05-29 2005-12-22 Symbiontics, Inc. Targeted therapeutic proteins
WO2005078077A2 (en) 2004-02-10 2005-08-25 Zystor Therapeutics, Inc. Acid alpha-glucosidase and fragments thereof
US20050244400A1 (en) 2004-02-10 2005-11-03 Zystor Therapeutics, Inc. Acid alpha-glucosidase and fragments thereof

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP2279210A4

Cited By (85)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10023854B2 (en) 2007-04-03 2018-07-17 Oxyrane Uk Limited Microorganisms genetically engineered to have modified N-glycosylation activity
US11512145B2 (en) 2007-07-27 2022-11-29 Armagen, Inc. Methods and compositions for increasing alpha-L-iduronidase activity in the CNS
US11045460B2 (en) 2008-06-26 2021-06-29 Orphazyme A/S Use of Hsp70 as a regulator of enzymatic activity
US11938125B2 (en) 2008-06-26 2024-03-26 Zevra Denmark A/S Use of Hsp70 as a regulator of enzymatic activity
US11304941B2 (en) 2008-06-26 2022-04-19 Orphazyme A/S Use of HSP70 as a regulator of enzymatic activity
US9884058B2 (en) 2008-06-26 2018-02-06 Orphazyme Aps Use of Hsp70 as a regulator of enzymatic activity
US10543204B2 (en) 2008-06-26 2020-01-28 Orphazyme A/S Use of Hsp70 as a regulator of enzymatic activity
US8540985B2 (en) 2008-06-26 2013-09-24 Orphazyme Aps Use of Hsp70 as a regulator of enzymatic activity
US9289472B2 (en) 2008-06-26 2016-03-22 Orphazyme Aps Use of HSP70 as a regulator of enzymatic activity
EP3679942A1 (en) 2009-06-17 2020-07-15 BioMarin Pharmaceutical Inc. Formulations for lysosomal enzymes
WO2010148253A2 (en) 2009-06-17 2010-12-23 Zystor Therapeutics, Inc. Formulations for lysosomal enzymes
EP3075386A1 (en) 2009-06-17 2016-10-05 BioMarin Pharmaceutical Inc. Formulations for lysosomal enzymes
US10392609B2 (en) 2009-09-29 2019-08-27 Oxyrane Uk Limited Hydrolysis of mannose-1-phospho-6-mannose linkage to phospho-6-mannose
US9598682B2 (en) 2009-09-29 2017-03-21 Vib Vzw Hydrolysis of mannose-1-phospho-6-mannose linkage to phospho-6-mannose
US12043661B2 (en) 2009-10-09 2024-07-23 Armagen, Inc. Methods and compositions for increasing iduronate 2-sulfatase activity in the CNS
US10287557B2 (en) 2009-11-19 2019-05-14 Oxyrane Uk Limited Yeast strains producing mammalian-like complex N-glycans
US11225646B2 (en) 2009-11-19 2022-01-18 Oxyrane Uk Limited Yeast strains producing mammalian-like complex n-glycans
US11065308B2 (en) 2010-06-25 2021-07-20 Shire Human Genetic Therapies, Inc. Methods and compositions for CNS delivery of heparan n-sulfatase
US11065307B2 (en) 2010-06-25 2021-07-20 Shire Human Genetic Therapies, Inc. Therapeutic fusion protein comprising an alpha-n-acetylglucosaminidase and a lysosomal targeting moiety
US10646554B2 (en) 2010-06-25 2020-05-12 Shire Human Genetic Therapies, Inc. Methods and compositions for CNS delivery of arylsulfatase A
JP2016094451A (en) * 2010-06-25 2016-05-26 シャイアー ヒューマン ジェネティック セラピーズ インコーポレイテッド Treatment of sanfilippo syndrome type b
WO2011163652A2 (en) 2010-06-25 2011-12-29 Shire Human Genetic Therapies, Inc. Treatment of sanfilippo syndrome type b
JP2013542913A (en) * 2010-06-25 2013-11-28 シャイアー ヒューマン ジェネティック セラピーズ， インコーポレイテッド Treatment of Sanfilipo syndrome type B
US9283181B2 (en) 2010-06-25 2016-03-15 Shire Human Genetic Therapies, Inc. CNS delivery of therapeutic agents
US10456454B2 (en) 2010-06-25 2019-10-29 Shire Human Genetic Therapies, Inc. CNS delivery of therapeutic agents
US11471516B2 (en) 2010-06-25 2022-10-18 Shire Human Genetic Therapies, Inc. CNS delivery of therapeutic agents
US8545837B2 (en) 2010-06-25 2013-10-01 Shire Human Genetic Therapies, Inc. Methods and compositions for CNS delivery of iduronate-2-sulfatase
US9220677B2 (en) 2010-06-25 2015-12-29 Shire Human Genetic Therapies, Inc. Methods and compositions for CNS delivery of iduronate-2-sulfatase
EP2585105A4 (en) * 2010-06-25 2014-07-09 Shire Human Genetic Therapies Treatment of sanfilippo syndrome type b
CN103269709A (en) * 2010-06-25 2013-08-28 夏尔人类遗传性治疗公司 Treatment of sanfilippo syndrome type b
EP2585105A2 (en) * 2010-06-25 2013-05-01 Shire Human Genetic Therapies, Inc. Treatment of sanfilippo syndrome type b
US9770410B2 (en) 2010-06-25 2017-09-26 Shire Human Genetic Therapies, Inc. Methods and compositions for CNS delivery of arylsulfatase A
US11260112B2 (en) 2010-06-25 2022-03-01 Shire Human Genetic Therapies, Inc. Methods and compositions for CNS delivery of iduronate-2-sulfatase
US9814764B2 (en) 2010-06-25 2017-11-14 Shire Human Genetic Therapies, Inc. Treatment of sanfilippo syndrome type b by intrathecal administration of alpha-n-acetylglucosaminidase
US9320711B2 (en) 2010-06-25 2016-04-26 Shire Human Genetic Therapies, Inc. Methods and compositions for CNS delivery of heparan N-sulfatase
US10344310B2 (en) 2010-09-29 2019-07-09 Oxyrane Uk Limited De-mannosylation of phosphorylated N-glycans
US9689015B2 (en) 2010-09-29 2017-06-27 Oxyrane Uk Limited De-mannosylation of phosphorylated N-glycans
US10011857B2 (en) 2010-09-29 2018-07-03 Oxyrane Uk Limited Mannosidases capable of uncapping mannose-1-phospho-6-mannose linkages and demannosylating phosphorylated N-glycans and methods of facilitating mammalian cellular uptake of glycoproteins
US9662375B2 (en) 2010-11-30 2017-05-30 Orphazyme Aps Methods for increasing intracellular activity of Hsp70
US10532085B2 (en) 2010-11-30 2020-01-14 Orphazyme A/S Methods for increasing intracellular activity of Hsp70
CN102121021A (en) * 2010-12-21 2011-07-13 南京师范大学 cDNA of interferon (IFN)-gamma inducible lysosomal thiol reductase of sheep, cloning method and recombinant application thereof
JP2014515595A (en) * 2011-03-04 2014-07-03 シャイアー ヒューマン ジェネティック セラピーズ インコーポレイテッド Peptide linker for polypeptide composition and method of use thereof
WO2012122042A2 (en) 2011-03-04 2012-09-13 Shire Human Genetic Therapies, Inc. Peptide linkers for polypeptide compositions and methods for using same
EP2680879B1 (en) * 2011-03-04 2021-01-06 Shire Human Genetic Therapies, Inc. Peptide linkers for polypeptide compositions and methods for using same
US9932568B2 (en) 2011-03-04 2018-04-03 Shire Human Genetic Therapies, Inc. Peptide linkers for polypeptide compositions and methods for using same
US8580922B2 (en) * 2011-03-04 2013-11-12 Shire Human Genetic Therapies, Inc. Peptide linkers for polypeptide compositions and methods for using same
CN106279433A (en) * 2011-03-04 2017-01-04 夏尔人类遗传治疗公司 Peptide junctional complex and using method thereof for polypeptide constituent
US9206235B2 (en) 2011-03-04 2015-12-08 Shire Human Genetic Therapies, Inc. Peptide linkers for polypeptide compositions and methods for using same
US20120232021A1 (en) * 2011-03-04 2012-09-13 Paolo Martini Peptide linkers for polypeptide compositions and methods for using same
US9545450B2 (en) 2011-05-27 2017-01-17 Amicus Therapeutics Inc. Methods for coupling targeting peptides onto recombinant lysosomal enzymes for improved treatments of lysosomal storage diseases
US10660972B2 (en) 2011-05-27 2020-05-26 Amicus Therapeutics, Inc. Methods for coupling targeting peptides onto recombinant lysosomal enzymes for improved treatments of lysosomal storage diseases
US10660944B2 (en) 2011-12-23 2020-05-26 Shire Human Genetic Therapies, Inc. Stable formulations for CNS delivery of arylsulfatase A
EP2825193B1 (en) * 2012-03-15 2019-11-13 Oxyrane UK Limited Methods and materials for treatment of pompe's disease
US10648044B2 (en) 2012-03-15 2020-05-12 Oxyrane Uk Limited Methods and materials for treatment of Pompe's disease
US9834587B2 (en) 2012-11-27 2017-12-05 Biomarin Pharmaceutical Inc. Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof
US9834588B2 (en) 2012-11-27 2017-12-05 Biomarin Pharmaceutical Inc. Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof
US9376480B2 (en) 2012-11-27 2016-06-28 Biomarin Pharmaceutical Inc. Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof
US9771408B2 (en) 2012-11-27 2017-09-26 Biomarin Pharmaceutical Inc. Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof
WO2014085621A1 (en) * 2012-11-27 2014-06-05 Biomarin Pharmaceutical Inc. Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof
US11254725B2 (en) 2012-11-27 2022-02-22 Biomarin Pharmaceutical Inc. Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof
US10301369B2 (en) 2012-11-27 2019-05-28 Biomarin Pharmaceutical Inc. Nucleic acids encoding targeted therapeutic lysosomal enzyme fusion proteins
EP3115372A1 (en) * 2012-11-27 2017-01-11 BioMarin Pharmaceutical Inc. Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof
RU2680581C2 (en) * 2012-11-27 2019-02-22 Байомарин Фармасьютикал Инк. Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof
TWI626250B (en) * 2012-11-27 2018-06-11 拜奧馬林製藥公司 Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof
US9845346B2 (en) 2012-11-27 2017-12-19 BioMarin Pharmaceurical Inc. Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof
US11229633B2 (en) 2014-09-15 2022-01-25 Orphazyme A/S Arimoclomol formulation
US10709700B2 (en) 2014-09-15 2020-07-14 Orphazyme A/S Arimoclomol formulation
US10556015B2 (en) 2014-10-24 2020-02-11 Criteo S.A. Lysosomal targeting of enzymes, and uses thereof
WO2016065319A1 (en) * 2014-10-24 2016-04-28 Shire Human Genetic Therapies, Inc. Lysosomal targeting of enzymes, and uses thereof
WO2016085820A1 (en) * 2014-11-24 2016-06-02 Shire Human Genetic Therapies, Inc. Lysosomal targeting and uses thereof
EP4275751A2 (en) 2016-02-24 2023-11-15 BioMarin Pharmaceutical Inc. Improved naglu fusion protein formulation
WO2017147414A1 (en) 2016-02-24 2017-08-31 Biomarin Pharmaceutical Inc. Targeted therapeutic lysosomal enzyme fusion proteins, associated formulations and uses thereof
US10898476B2 (en) 2016-04-13 2021-01-26 Orphazyme A/S Heat shock proteins and cholesterol homeostasis
US11253505B2 (en) 2016-04-29 2022-02-22 Orphazyme A/S Arimoclomol for treating glucocerebrosidase associated disorders
US11491243B2 (en) 2018-04-30 2022-11-08 Amicus Therapeutics, Inc. Gene therapy constructs and methods of use
US10874750B2 (en) 2018-04-30 2020-12-29 Amicus Therapeutics, Inc. Gene therapy constructs and methods of use
US11097015B2 (en) 2018-10-10 2021-08-24 Amicus Therapeutics, Inc. Disulfide bond stabilized polypeptide compositions and methods of use
US12064485B2 (en) 2018-10-10 2024-08-20 Amicus Therapeutics, Inc. Disulfide bond stabilized polypeptide compositions and methods of use
EP3880823A4 (en) * 2018-11-16 2022-08-17 Asklepios Biopharmaceutical, Inc. Therapeutic adeno-associated virus for treating pompe disease
WO2020132452A1 (en) 2018-12-20 2020-06-25 Shire Human Genetic Therapies, Inc. Purification of iduronate-2-sulfatase immunoglobulin fusion protein
US11707456B2 (en) 2020-11-19 2023-07-25 Kempharm Denmark A/S Processes for preparing arimoclomol citrate and intermediates thereof
US12121569B2 (en) 2022-01-18 2024-10-22 Takeda Pharmaceutical Company Limited Methods and compositions for CNS delivery of iduronate-2-sulfatase
WO2023204714A1 (en) 2022-04-22 2023-10-26 Erasmus University Medical Center Rotterdam Gene therapy for pompe disease
NL2031676B1 (en) 2022-04-22 2023-11-07 Univ Erasmus Med Ct Rotterdam Gene therapy for Pompe Disease
WO2024096738A1 (en) 2022-11-01 2024-05-10 Erasmus University Medical Center Rotterdam Gene therapy constructs for metabolic disorders

Also Published As

Publication number Publication date
HUE034850T2 (en) 2018-03-28
ES2830350T3 (en) 2021-06-03
US20220354934A1 (en) 2022-11-10
BR122017015900A2 (en) 2019-09-10
JP5627571B2 (en) 2014-11-19
AU2009244148B2 (en) 2014-10-09
EP3778652A1 (en) 2021-02-17
US20230241187A1 (en) 2023-08-03
WO2009137721A3 (en) 2010-04-08
ES2629853T3 (en) 2017-08-16
US9469683B2 (en) 2016-10-18
IL209091A (en) 2015-04-30
EP3272773B1 (en) 2020-07-08
IL209091A0 (en) 2011-01-31
EP3272773B8 (en) 2020-11-18
HRP20170698T1 (en) 2017-09-22
CA2723412A1 (en) 2009-11-12
EP2279210A2 (en) 2011-02-02
AU2009244148A1 (en) 2009-11-12
CN102066422B (en) 2015-07-22
BRPI0912225A2 (en) 2018-03-20
CY1119183T1 (en) 2018-02-14
EP2279210A4 (en) 2011-09-14
US20150064157A1 (en) 2015-03-05
DK2279210T3 (en) 2017-07-24
PL2279210T3 (en) 2017-10-31
HK1250042A1 (en) 2018-11-23
US20210069304A1 (en) 2021-03-11
US8563691B2 (en) 2013-10-22
US20180125949A1 (en) 2018-05-10
JP2011521627A (en) 2011-07-28
EP3272773A1 (en) 2018-01-24
US20110223147A1 (en) 2011-09-15
CN102066422A (en) 2011-05-18
US20170007680A1 (en) 2017-01-12
EP3187508A1 (en) 2017-07-05
US20120213762A1 (en) 2012-08-23
US11351231B2 (en) 2022-06-07
PT2279210T (en) 2017-07-10
EP2279210B1 (en) 2017-04-12

Similar Documents

Publication Publication Date Title
US20230241187A1 (en) Lysosomal Targeting Peptides and Uses Thereof
US11254725B2 (en) Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200980123156.6

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 09743707

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 2723412

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 7803/DELNP/2010

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2011508686

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 2009244148

Country of ref document: AU

REEP Request for entry into the european phase

Ref document number: 2009743707

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2009743707

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2009244148

Country of ref document: AU

Date of ref document: 20090507

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 12991104

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: PI0912225

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20101105