WO2009120366A2 - Algal glycerol-3 phosphate acyltransferase - Google Patents

Algal glycerol-3 phosphate acyltransferase Download PDF

Info

Publication number
WO2009120366A2
WO2009120366A2 PCT/US2009/001912 US2009001912W WO2009120366A2 WO 2009120366 A2 WO2009120366 A2 WO 2009120366A2 US 2009001912 W US2009001912 W US 2009001912W WO 2009120366 A2 WO2009120366 A2 WO 2009120366A2
Authority
WO
WIPO (PCT)
Prior art keywords
spp
sequence
plant
nucleic acid
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2009/001912
Other languages
French (fr)
Other versions
WO2009120366A3 (en
Inventor
Jitao Zou
Zhifu Zheng
Jingyu Xu
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
National Research Council of Canada
Corteva Agriscience LLC
Original Assignee
National Research Council of Canada
Dow AgroSciences LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by National Research Council of Canada, Dow AgroSciences LLC filed Critical National Research Council of Canada
Priority to CA2717940A priority Critical patent/CA2717940C/en
Priority to US12/736,170 priority patent/US20110093983A1/en
Publication of WO2009120366A2 publication Critical patent/WO2009120366A2/en
Publication of WO2009120366A3 publication Critical patent/WO2009120366A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8242Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
    • C12N15/8243Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine
    • C12N15/8247Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine involving modified lipid metabolism, e.g. seed oil composition
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/1025Acyltransferases (2.3)
    • C12N9/1029Acyltransferases (2.3) transferring groups other than amino-acyl groups (2.3.1)
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02EREDUCTION OF GREENHOUSE GAS [GHG] EMISSIONS, RELATED TO ENERGY GENERATION, TRANSMISSION OR DISTRIBUTION
    • Y02E50/00Technologies for the production of fuel of non-fossil origin
    • Y02E50/10Biofuels, e.g. bio-diesel
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02PCLIMATE CHANGE MITIGATION TECHNOLOGIES IN THE PRODUCTION OR PROCESSING OF GOODS
    • Y02P30/00Technologies relating to oil refining and petrochemical industry
    • Y02P30/20Technologies relating to oil refining and petrochemical industry using bio-feedstock

Definitions

  • the invention relates generally to biotechnology and, more particularly, to genes useful for the genetic manipulation of plant characteristics.
  • the disclosure relates to isolated and/or purified polypeptides and nucleic acids encoding glycerol-3-phosphate acyltransferase (TpGPATl) and methods of their use.
  • TAGS neutral glycerolipid triacylglycerols
  • the initial step of glycerolipid biosynthesis in diatoms is the fatty acid acylation of glycerol-3-phosphate (G-3-P) at the sn-1 position by G-3-P acyltransferase (GPAT) to form lysophosphatidic acid (LPA).
  • G-3-P glycerol-3-phosphate
  • GPAT G-3-P acyltransferase
  • LPA lysophosphatidic acid
  • LPA acyltransferase then catalyzes the acylation of LPA at the sn-2 position to generate phosphatide acid (PA), which serves as a general precursor for all glycerophospholipids, including TAG.
  • PA phosphatide acid
  • TAG synthesis involves further conversion of PA into diacylglycerol (DAG) by PA phosphatase, and subsequent acylation of DAG by either fatty acyl-CoA-dependent or phospholipid-dependent DAG acyltransferases.
  • DAG diacylglycerol
  • Eukaryotic diatoms have a unique fatty acid profile, distinctive in their high levels of 16:0, 16:1 ⁇ 7 and 20:5 ⁇ 3 and a low content of Cl 8 fatty acids.
  • the fatty acid composition of the marine diatom Thalassiosira pseudonana is typical of most diatoms, with a predominance of 16:0, 16: 1 ⁇ 7 and 20:5 ⁇ 3. However, small amounts of 18:4 ⁇ 3 and 20:6 ⁇ 3, not usually found in diatoms, are also present.
  • GPAT glycerol-3-phosphate acyltransferase
  • microsomal GPAT which are thought to mediate oil synthesis as well as membrane lipid synthesis in eukaryotes. These microsomal GPAT were identified from the unicellular eukaryotes Saccharomyces cerevisiae (Zheng and Zou, 2001; Zaremberg and McMaster 2002), Plasmodium falciparum (Santiago et al., 2004) and Leishmania major (Zufferey and Marnoun, 2005) and the higher eukaryotes Arabidopsis (Zheng et al, 2003) and human and mouse (Cao et al., 2006). The sequences of these enzymes are highly divergent except for the conserved acyltransferase domains.
  • TpGPAT membrane-bound glycerol-3-phosphate acyltransferase
  • TpGPAT exerts a key role in determining the fatty acid composition in glycerohpids and can be used to alter fatty acid composition and/or increase oil synthesis in oil-producing organisms
  • TpGPAT can be used to produce 16 0- ⁇ ch oil in the oil-producing organisms such as oilseeds (eg , Brassica, sunflower, flax, soybean, etc) through overexpression
  • oilseeds eg , Brassica, sunflower, flax, soybean, etc
  • the fatty acid composition of glycerohpids is dictated by at least three factors (i) the size of individual fatty acyl pools, (n) the relative activity and specificity of fatty acyltransferases, and (in) the relative activity and specificity of enzymes responsible for the deacylation-reacylation process
  • GPAT catalyzes the initial and committed step of glycerolipid synthesis, acylating glycerol-3-phosphate to form lysophosphatidic acid (LPA), which is further acylated by LPA acyltransferase to yield phosphatide acid (PA) as a general precursor for all glycerophospholipids
  • TpGPAT or "TpGPATl”
  • TpGPATl encoding a membrane-bound GPAT, from T pseudonana GPAT prefers 16 0-Co
  • TpGPAT membrane bound glycerol-3-phosphate acyltransferase
  • the primary sequence of TpGPAT is composed of 674 amino acids, which shows much higher similarity to the GPAT sequences from the unicellular eukaryotes Saccharomyces cerevisiae, Leishmama major, and Plasmodium falciparum than to those from higher plants and mammals
  • a transgenic plant containing a nucleic acid construct is also disclosed
  • a method of transforming a cell or a plant is described, the method comprising introducing the isolated, purified or recombinant nucleic acid into the cell or plant
  • a process for producing a genetically transformed plant seed comprises introducing the nucleic acid into the plant seed In some embodiments, these methods may be used for modifying plants to change their seed oil content
  • TpGPA T in, for example, canola, soybean, and other oilseeds is expected to produce high-palmitate oils
  • oils can be used for the production of margarine and as oleochemical, soap, and animal feed raw material
  • oils with high contents of long-chain or very long-chain polyunsaturated fatty acids are desirable for many purposes including human nutrition
  • oils with highly saturated 16-carbon-chain length fatty acids can provide the starting materials for many industrial applications
  • Also desc ⁇ bed is a process of producing biodiesel from algal cells, wherein the improvement comprises using, as an algal cell in the process, the algal cell transformed as descnbed herein to overexpress TpGPA T
  • FIG IA is an alignment of the four conserved acyltransferase domains of TpGPAT (SEQ ID NO 2) with glycerol-3-phosphate acyltransferases (GPAT) and dihydroxyacetone-phosphate acyltransferase (DHAPAT) from other species PfGAT from P falciparum (accession no XP 001350533, SEQ ID NO 12), LmGAT from L major (accession no XP 001687304, SEQ ID NO 13), Gatlp (SEQ ID NO 14) and Gat2p (SEQ ID NO 15) from S cerevisiae (accession no AJ311354 and AJ314608, respectively), hGPATl (SEQ ID NO 16), hGPAT2 (SEQ ID NO 17) and hGPAT3 (SEQ ID NO 18) from H sapiens (accession no NP 065969, AAH68596 and NP l 16106, respectively), mGPATl (
  • FIG IB is a phylogenic tree of TpGPATl and acyltransferases from other species.
  • the partial amino acid sequences encompassing the 4 acyltransferase motifs were aligned using the Clustal W method of Lasergene analysis software (DNAStar, Madison, WI).
  • FIG. 1C is the predicted topology of TpGPATl using the TMHMM algorithm indicating the presence of five transmembrane domains ATI, AT2, AT3 and AT4 represent the four conserved acyltransferase motifs.
  • FIG. 2 depicts GPAT activity of TpGPATl expressed in yeast gatl mutant.
  • microsomal membrane fractions prepared from lysates of the induced yeast cells harboring TpGPATl or empty vector pYES2.1 were assayed for GPAT activity with 400 ⁇ M [ 14 C]glycerol 3-phosphate (2.5 nCi/nmol), 45 ⁇ M palmitoyl-CoA, 75 mM T ⁇ s-HCl, pH 7 5, 1 mM DTT, and 2 mM MgCl 2 for 10 mm at room temperature. After extraction of the phospholipid products, the radioactivity was measured by scintillation count.
  • FIG. 3 depicts substrate specificity of TpGPATl.
  • microsomal membrane fractions prepared from lysates of the induced yeast cells harboring TpGPATl or empty vector pYES2.1 were assayed for GPAT activity with 400 ⁇ M [ l4 C]glycerol 3-phosphate (2 5 nCi/nmol) and different acyl-CoAs as acyl donor . After extraction of the phospholipid products, the radioactivity was measured by scintillation count.
  • FIG. 4 graphically depicts the results of the lipidomic analysis (fatty acid composition) of the lipids from yeast gatl mutants transformed with either TpGPATl or GATl .
  • Yeast cells expressing TpGPAT or yeast GATl were fed with EPA (20.5) or DHA (22:6) upon induction of the genes.
  • Total lipids from the yeast cells were extracted and subjected to lipidomic analysis using a tandem mass spectrometer. The results are presented as the molar ratio of EPA- or DHA-containing phospholipids (PC, PE, PS, PI) in the total phospholipids
  • FIG. 5 graphically depicts the results of the analysis of the fatty acid 16O content of T2 seeds from TpGPAT transgenic Arabidopsis
  • Fatty acid analysis was performed on TpGPA T transformed Arabidopsis seeds.
  • Fatty acid composition (as molar percentage) was determined in the seed oil extracted from 200 T2 seeds of 13 TpGPAT pSE transformed Arabidopsis lines (GW4-GW17).
  • pSE129A empty plasmid transformed wild-type Arabidopsis was used as a control
  • FIG. 6 graphically depicts the results of the analysis of the fatty acid 16:0 content of Tl seeds from TpGPAT transgenic Brassica napus.
  • Fatty acid analysis was performed on TpGPA T transformed B napus seeds.
  • Fatty acid composition (as molar percentage) was determined in the seed oil extracted from Tl seeds of five independent TpGPAT pSE transformed Brassica napus events (GPATl, 3, 4, 7 and 12). Wild-type B napus was used as a control.
  • FIG. 7 graphically depicts the total oil content of TpGPA T transformed Arabidopsis seeds. Oil contents (as percentage of dry weight) were determined in 200 T2 seeds of the 13 TpGPATpSE transformed Arabidopsis lines (GW4-12; GW14-17). Wild-type Arabidopsis was used as a control (Con).
  • Some of the manipulations that are possible using the TPGPATl gene or a part thereof, include, but are not limited to, the following: seeds or plants with increased or decreased oil content; seeds or plants containing oils with an enhanced polyunsaturated fatty acid content, and plants exhibiting an enhanced or altered capacity to accumulate various fatty acids.
  • Degree or percentage of sequence homology refers to degree or percentage of sequence identity between two sequences after optimal alignment. Percentage of sequence identity (or degree of identity) is determined by comparing two optimally aligned sequences over a comparison window, where the portion of the peptide or polynucleotide sequence in the comparison window may comprise additions or deletions ⁇ i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences.
  • the percentage is calculated by determining the number of positions at which the identical amino-acid residue or nucleic acid base occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
  • Homologous isolated and/or purified sequence is understood to mean an isolated and/or purified sequence having a percentage identity with the bases of a nucleotide sequence, or the amino acids of a polypeptide sequence, of at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99 5%, 99 6%, or 99 7% This percentage is purely statistical, and it is possible to distribute the differences between the two nucleotide sequences at random and over the whole of their length Sequence identity can be determined, for example, by computer programs designed to perform single and multiple sequence alignments It will be appreciated that this disclosure embraces the degeneracy of codon usage as would be understood by one of ordinary skill in the art Furthermore, it will be understood by one skilled in the art that conservative substitutions may be made in the amino acid sequence of
  • Nucleotide, polynucleotide, or nucleic acid sequence "Nucleotide, polynucleotide, or nucleic acid sequence” will be understood as meaning both a double-stranded and single-stranded DNA in the monomenc and dimeric (so-called in tandem) forms and the transcription products of the DNAs Sequence identity
  • Two ammo-acids or nucleotide sequences are "identical” if the sequence of amino-acids or nucleotide residues in the two sequences is the same when aligned for maximum correspondence as described below
  • Sequence comparisons between two (or more) peptides or polynucleotides are typically performed by comparing sequences of two optimally aligned sequences over a segment or "comparison window" to identify and compare local regions of sequence similarity
  • Optimal alignment of sequences for comparison may be conducted by the local homology algorithm of Smith and Waterman, Ad App Math 2 482 (1981), by the homology alignment algorithm of Ne
  • Stringent hybridization Hybridization under conditions of stringency with a nucleotide sequence is understood as meaning hybridization under conditions of temperature and ionic strength chosen in such a way that they allow the maintenance of the hybridization between two fragments of complementary DNA Homologs of the TPGPATl genes descnbed herein obtained from other organisms, for example plants, may be obtained by screening appropriate libraries that include the homologs, wherein the screening is performed with the nucleotide sequence of the specific TpGPATl genes disclosed herein, or portions or probes thereof, or identified by sequence homology search using sequence alignment search programs such as BLAST, FASTA Proteins that are homologous to full-length T pseudonana TPGPATl can be found by searching protein databases, such as the NCBI protein database, with search engines, such as BLAST They may also be identified by rational design The process of rational design may comprise identifying conservative amino acid substitutions within the desired polypeptide sequence length, and making those substitutions in the encoded protein
  • Hybndization conditions may be stringent in that hybndization will occur if there is at least a 90%, 95% or 97% identity with the nucleic acid molecule that encodes the disclosed TPGPATl molecules
  • the stringent conditions may include those used for known Southern hybridizations such as, for example, incubation overnight at 42°C in a solution having 50% formamide, 5xSSC (150 mM NaCl, 15 mM tnsodium citrate), 50 mM sodium phosphate (pH 7 6), 5x Denhardt's solution, 10% dextran sulfate, and 20 micrograms/milliliter denatured, sheared salmon sperm DNA, following by washing the hybndization support in 0 Ix SSC at about 65°C
  • Other known hybridization conditions are well known and are descnbed in Sambrook, et al , Molecular Cloning A Laboratory Manual, Third Edition, Cold Spring
  • ID NO 1 may be transformed into an organism, for example a plant
  • Such homologous sequences are exemplified by SEQ ID NOS 5-6
  • SEQ ID NOS 5-6 As known in the art, a number of ways exist by which genes and gene constructs can be introduced into organisms, for example plants, and a combination of transformation and tissue culture techniques have been successfully integrated into effective strategies for creating transgenic organisms, for example crop plants These methods have been descnbed elsewhere (Potrykus, 1991, Vasil, 1994, Walden and Wingender, 1995, Songstad, et al , 1995), and are well known to persons skilled in the art
  • one skilled in the art will certainly be aware that, in addition to Agrobactenum-mediated transformation of Ambidopsis by vacuum infiltration (Bechtold et al , 1993) or wound inoculation (Katavic, et al , 1994), it is equally possible to transform other plant and crop species, using Agwbactenum Ti-plasmid mediated transformation ⁇ e g
  • plant promoters to direct any intended up- or down-regulation of transgene expression using constitutive promoters (e g , those based on CaMV35S), or by using promoters which can target gene expression to particular cells, tissues (e g , napm promoter for expression of transgenes in developing seed cotyledons), organs (e g , roots), to a particular developmental stage, or in response to a particular external stimulus (e g , heat shock)
  • constitutive promoters e g , those based on CaMV35S
  • Promoters for use herein may be inducible, constitutive, or tissue-specific or have va ⁇ ous combinations of such characteristics
  • Useful promoters include, but are not limited to, constitutive promoters, e g , carnation etched ring virus (CERV), cauliflower mosaic virus (CaMV) 35S promoter, or more particularly the double enhanced cauliflower mosaic virus promoter, comprising two CaMV 35S promoters in tandem (referred to as a "Double 35S" promoter)
  • tissue-specific or developmentally regulated promoter allows for overexpression in certain tissues without affecting expression in other tissues
  • a promoter used in overexpression of enzymes in seed tissue is an ACP promoter as descnbed in PCT International Publication WO 92/18634, published October 29, 1992, the contents of which is herein incorporated by reference
  • the promoter and termination regulatory regions may be functional in the host plant cell and may be heterologous (that is, not naturally occurring) or homologous (de ⁇ ved from the plant host species) to the plant cell and the gene Suitable promoters which may be used are descnbed herein
  • the termination regulatory region may be denved from the 3' region of the gene from which the promoter was obtained or from another gene Suitable termination regions which may be used are well known in the art and include Agwbactenum tumefaciens nopaline synthase terminator (Tnos), A tumefaciens mannopine synthase terminator (Tmas) and the CaMV 35S terminator (T35S), the pea nbulose bisphosphate carboxylase small subunit termination region (TrbcS), or the Tnos termination region
  • Tnos Agwbactenum tumefaciens nopaline synthase terminator
  • Tmas A tumefaciens mannopine synthase terminator
  • T35S the CaMV 35S terminator
  • TrbcS pea nbulose bisphosphate carboxylase small subunit termination region
  • Tnos termination region Such gene constructs may suitably be screened for activity by transformation into a host plant via Agrobacterium and
  • a DNA construct for use herein may be comprised within a vector, most suitably an expression vector adapted for expression in an appropnate host cell, for example a plant cell It will be appreciated that any vector which is capable of producing a cell comprising the introduced DNA sequence will be sufficient
  • Suitable vectors are well known to those skilled in the art and are described in general technical references, such as Pouwels et al , Cloning Vectors A Laboratory Manual, Elsevier, Amsterdam (1986) Particularly suitable vectors include the Ti plasmid vectors
  • Transformation techniques for introducing the DNA constructs into host cells are well known in the art and include such methods as micro-injection, using polyethylene glycol, electroporation, high velocity ballistic penetration, or Agrobactei ⁇ m-mediated transformation After transformation of the plant cells or plant, those plant cells or plants uito which the desired DNA has been incorporated may be selected by such methods as antibiotic resistance, herbicide resistance, tolerance to ammo-acid analogues, or using phenotypic markers
  • RNA samples may be regenerated from the transformed cell by conventional methods
  • transgenic plants having improved isoprenoid levels may be propagated and self-pollinated to produce homozygous lines
  • Such plants produce seeds containing the genes for the introduced trait and can be grown to produce plants that will produce the selected phenotype
  • Particularly preferred plants for modification according to the present disclosure include Aiabidopsis thahana, borage (Boiago spp ), Canola, castor (Ricinus communis) (Ricinus spp ), cocoa bean (Theobroma cacao) (Theobi oma spp ), corn (Zea mays) (Zea spp ), cotton (Gossypium spp), Crambe spp , Cuphea spp , flax (Linum spp ), Lesquerella spp and Limnanthes spp , Linola, nasturtium (Tropaeolum spp ), Oenothera spp , olive (Olea spp ), palm (Elaeis spp ), peanut (Arachis spp ), rapeseed, safflower (Carthamus spp ), soybean (Glycine spp and Soja
  • oilseed crops are plant species that are capable of generating edible or industrially useful oils in commercially significant yields, and include many of the plant species listed herein Such oilseed crops are well known to persons skilled in the art
  • plants transformed with a nucleotide sequence that codes for a TPGPATl are grown Seeds of the transgenic plants are harvested and fatty acids of the seeds are extracted The extracted fatty acids are used for subsequent incorporation into a composition, for example a pharmaceutical composition, a nutraceutical composition, or a food composition
  • other methods of enhancing or altering oil production may also be used with the plant to be transformed (eg , incorporating, for expression in the plant, a nucleic acid sequence selected from the group comprising a nucleic acid sequence encoding a peptide having, for example, Brassica pyruvate dehydrogenase kinase activity (see, e g , U S Patent 7,214,859 to Manila, et al (May 8, 2007), U S Patent 6,500,670 to Zou, et al (Dec 2002), and U S Patent 6,256,636 to Randall, et al (July 2001), the contents of the entirety of each of which is incorporated herein by this reference), a nucleic acid sequence encoding a peptide having diacylglycerol acyltransferase activity (see, e g , U S Patent 7,015,373 and U S Patent 6,500,670 to Zou, et al (Dec 2002), the contents of the entirety of
  • Embodiments are susceptible to various modifications and alternative forms in addition to those specific Examples described in detail herein. Thus, embodiments are not limited to the particular forms disclosed. Rather, the scope of the disclosure encompasses all modifications, equivalents, and alternatives falling within the following appended claims.
  • TpGPAT The draft genome of the diatom T. pseudonana was searched using the yeast Gatlp and Gat2p sequences as query. ⁇ See, Zheng and Zou, 2001).
  • TpGPAT One homologous nucleotide sequence, designated TpGPAT, was retrieved and amplified by PCR as described herein.
  • Plasmid from a cDNA library of T. pseudonana was used as template.
  • a 50 ⁇ l PCR reaction containing 50 ng of plasmid DNA, 20 pM of each primer: 5'- GGTATGCTCATCTGCTACCCCCTC -3' (SEQ ID NO:7) and 5'-TTAAGTCTCCTTCGTCTTTGGTGTAG -3' (SEQ ID NO:8) and 1 ⁇ l of BD ADVANTAGETM 2 Polymerase Mix (Clontech Laboratories, Inc.) was incubated for 30 cycles according to the following thermocycle program: 94°C for 30 sec, 58°C for 30 sec, and 72°C for 1 min. 30 sec.
  • the PCR product was purified and subsequently cloned into the pYES2.1/N5-His-TOPO expression vector (Invitrogen).
  • the TpGPAT in pYES2.1 N5-His-TOP0 plasmid was transformed into yeast gatl A (BY4742, Mat a, his3Cl, leu2C0, lys2C0, ura3C0, YKR067w::kanMX4) using the method provided by the producer's manual (Invitrogen).
  • yeast cells transformed with pYES2.1/V5-His-TOPO plasmid only were used as a control. Transformants were selected by growth on synthetic complete medium lacking uracil (SC-ura), supplemented with 2% (w/v) glucose. The colonies were transferred into liquid SC-ura with 2% (w/v) glucose and grown at 28°C overnight.
  • the overnight cultures were diluted to an OD 0.4 in induction medium (SC-ura + 2% Galactose + 1% Raffinose), and were induced by incubating at 28°C overnight.
  • the yeast cells were collected and broken using glass beads.
  • the protein concentrations in the lysates were normalized using a Biorad assay (Bradford, 1976) and then assayed for GPAT activity.
  • Enzyme Assays were conducted at 30 0 C for 10 min. in a 200-pL reaction mixture containing 40 mM Hepes, pH 7.0, 400 pM 14 C-glycerol-3-phosphate (2.5 nCi/nmol), 67.5 pM palmitoyl-CoA and/or stearoyl-CoA or other fatty acyl donors, 1 mM DTT, 2 mM MgCl 2 ,, and 2.5 mg/mL BSA unless stated otherwise. The reaction was stopped, and products were extracted as described previously. (Zheng and Zou, 2001). The formed products were subjected to scintillation counting for radioactivity and thin layer chromatography analysis as described.
  • Yeast DHA/EPA feeding and total lipid analysis Yeast cultures were grown at 28°C in the presence of 2% (w/v) glucose and 1% (w/v) Tergitol NP-40 (Sigma,
  • TpGPA Tl DNA sequences encoding the peptide(s) similar to yeast Gatlp and Gat2p Zheng Z , and Zou J , supia A homologous sequence was identified, designated TpGPA Tl
  • TpGPAT DNA sequences encoding the peptide(s) similar to yeast Gatlp and Gat2p Zheng Z , and Zou J , supia A homologous sequence was identified, designated TpGPA Tl
  • TpGPAT A full-length cDNA clone was amplified by PCR from a cDNA library of T pseudonana It contains an open reading frame of 2,025 bp, which encodes a polypeptide of 674 amnio acids with a calculated molecular mass of 75 2 kD
  • TpGPAT A relatively high similarity to P falciparum GPAT (PfGPAT, 27% identity) and Leishmama major GPAT (LmGPAT, 25% identity) was registered for TpGPAT
  • PfGPAT shares little homology with bacte ⁇ al, mammalian, and Arabidopsis membrane-bound GPATs on the full-length scale (data not shown)
  • a remarkable feature shared among TpGPAT, yeast Gatlp and GatZp, PfGPAT and LmGPAT is a long stretch of more than 100 amino acids between conserved acyltransferase motifs II and III (FIG IA) This distinguishes them from other known GPATs, LPATs and dihydroxyacetone phosphate acyltransferases (DHAPATs) that are characteristic of a much shorter spacer less than 60 amino acids) between the two motifs
  • DHAPATs dihydroxyacetone phosphate acyltransferases
  • TpGPA T contains all four acyltransferase motifs Mohf I of TpGPAT contains the ammo acid sequence
  • HANQFMDGLMIT SEQ ID NO 28
  • Motif II of TpGPAT contains the amino acid sequence
  • VPVKRAQD (SEQ ID NO 29)
  • Motif III of TpGPAT contains the amino acid sequence
  • IGIFPEGGSHD SEQ ID NO 30
  • Motif IV of TpGPAT contains the amino acid sequence
  • IVPVGLNY SEQ ID NO 31
  • the histidine and aspartate residues in motif I which are catalytically important, remain invariant among all the sequences Nevertheless, five residues, instead of four for most of known fatty acyltransferases, are present between the conserved histidine and aspartate in TpGPAT This feature is shared among the known GPATs from unicellular eukaryotes (FIG LA) In motif II, arginine is most conserved, as
  • TpGPAT A Kyte-Doohttle hydropathy analysis of the amino acid sequence of the TpGPAT revealed several hydrophobic domains (data not shown) Protein topology analysis with the algorithms (TMHHM, SOSUI, and TMAP) predicted 5 transmembrane domains, with 2 of them close to the N-terminus and 3 close to the C-terminus (FIG 1C) This topology strongly suggests that TpGPAT has the membrane-bound nature like other ER- or mitochondria-based GPATs from lower and higher eukaryotes As shown in FIG 1C, the N- and C-termim of TpGPAT are located on the cytosohc (outside) and lumenal (inside) sides, respectively In the middle, a long stretch of more than 400 amino acids encompassing all 4 acyltransferase motifs is exposed to the cytosol, which allows the binding and catalysis of the substrates to take place in the same space (FIG 1C)
  • the full-length coding region of TpGPAT was cloned into a yeast expression vector pYES2 l/V5-His-TOPO under the control of the galactose-inducible GALl promoter, and the construct was used to transform a GPAT-deficient yeast strain, gatl (EUROSCARF accession no Y 15983)
  • the gatl cells harboring an empty pYES2 1 vector were used as a control
  • the microsomal membrane fractions prepared from lysates of the induced yeast cells were assayed for GPAT activity using l4 C-labelled glycerol-3-phosphate as acceptor, and palmitoyl (16 O)-CoA as acyl donor
  • expression of the TpGPAT in yeast gatl mutant resulted in a restoration of TpGPA T function with about seven- fold higher activity than that found in control cells transformed with empty pYES2 1 vector
  • TpGPAT t ⁇ acylglycerols
  • Table 1 the expression of TpGPAT in gatl resulted in a significant change in the fatty acid composition of both TAG and phospholipids as compared to the control with empty vector
  • the unsaturated fatty acids, 16 1 and 18 1 were reduced to 15% and 21% in these two lipid
  • glycerolipids of T pseudonana contain a high percentage of a very-long chain polyunsaturated fatty acid (VLGPUFA), EPA (20 5n3), we tested if the expression of the TpGPA T gene could increase the accumulation of EPA and DHA in yeast glycerolipids
  • Yeast gatl strain transformed with TpGPAT or empty vector pYES2 1 was grown in the presence of EPA or DHA, while being induced by galactose T ⁇ acylglycerols (TAGS) and phospholipids from the 3-day culture were extracted and analyzed by gas chromatography for fatty acid composition
  • TpGPAT in gatl did not have much impact on the incorporation of LCPUFAs into either TAG or phospholipids as compared to the empty vector control (Table 2). It was not clear if this were due to the low GPAT activity for these VLCPUFAs or the lack of EPA and DHA-CoA in the cells.
  • yeast gatl strain transformed with TpGPAT or GATl under the control of the GALl promoter was grown in the presence of EPA (20:5) or DHA (22:6) upon induction of the genes.
  • Phospholipids were extracted and subjected to lipidomic analysis using a tandem mass spectrometer (testing conducted by the Kansas Lipidomics Research Center).
  • TpGPAT has a role in controlling PUFA accumulation in glycerolipid.
  • GPAT catalyzes the first (and potentially rate-limiting) step in glycerolipid biosynthesis in eukaryotes.
  • GPAT plays a role in determining the fatty acid composition of glycerolipids was lacking. Owing to the membrane-bound nature, no GPAT has been purified to an apparent purity sufficient for accurate in vitro biochemical assay. Studies using partially purified membrane-bound GPATs, which are often contaminated with other fatty acyltransferases, suggested a broad range of fatty acids as acyl donors for this enzyme. Nonetheless, it would be a reasonable assumption that substrate specificity of GPATs varies among different species. This assumption is supported by the present study revealing that TpGPAT shows high specificity for palmitate as fatty acyl donor in both in vitro and in vivo assays.
  • TpGPAT Heterologous expression of TpGPAT led to increases of palmitate in phospholipids and triacylglycerols by approximately 12% and 18%, respectively, in the gatl cells (Table 1). Accordingly, unsaturated fatty acids, mainly 16:1 and 18:1, dropped by 15% and 21% in phospholipids and triacylglycerols (Table 1). This unique substrate specificity of TpGPAT may constitute one of main factors controlling the fatty acid profile of T. pseudonana in which fatty acid 16:0 is predominant, accounting for up to 28% and 36% of fatty acids in total lipids and triacylglycerols, respectively.
  • fatty acyltransferases not only directly control the fatty acid composition in glycerolipids through their preferential incorporation of fatty acids into glycerol backbone, but also indirectly monitor fatty acyl pools that they use.
  • Example VII Amino acid sequence of prophetic GPAT I (SEQ ID NO:3)
  • Example VIII Amino acid sequence of prophetic GPAT II (SEQ ID NO:4)
  • Example XII A first prophetic nucleotide sequence of T. pseudonana GPAT (SEQ ID NO:8)
  • Example XIII A second prophetic nucleotide sequence of T. pseudonana GPAT (SEQ ID NO:9) ATGGGUGTCGAGAAAAAAGGAACGATGATGTCCGAGTTGGACTATACGAAGGCACAACTCG
  • Example XIV A nucleotide sequence of prophetic GPATI (SEQ ID NO: 10)
  • the full length coding region of the TpGPAT gene was amplified using pfu DNA polymerase and primers designed with two restriction sites (Kpnl and Xbal) added for subsequent cloning. Then, the PCR product was digested and inserted in a plant transformation vector (pSE129A) under the control of a seed-specific promoter (Napin). The binary vector was introduced by electroporation into Agrobacterium tumefaciens strain GV3101 containing helper plasmid pMP90 (Koncz and Schell, 1986).
  • TpGPAT Use of TpGPAT to increase yield and modify the composition of oilseed produced from two oilseed crops; Arabidopsis thaliana and Brassica napus Wild-type A. thaliana (ecotype Columbia) were subjected to Agrobacte ⁇ um-me ⁇ iated transformation by the floral dip method using the A. tumefaciens carrying the TpGPAT gene under the control of the Napin promoter produced in Example XVI. (Clough and Bent, 1998). Seeds from Agrobacterium transformed plants were then plated on selective medium and kanamycin resistant Tl plants were transferred to soil and their genotype characterized. DNA was isolated from 150 mg of Arabidopsis leaf material.
  • T2 seeds were harvested for fatty acid composition analysis. More than half of the identified transgenic lines (GW) showed an increase of 16:0 compared to the non-transformed control (WT). (FIG. 5). Since not all T2 seeds are homozygous for the transgene, it is anticipated that homozygous T3 seeds will have exhibit a further change in 16 O compared to wild-type seeds Total oil content in T2 seeds from TpGPAT transgenic Arabidopsis lines also increased (FIG 7) The absolute increase values ranged 6%
  • TpGPA T/pSEl29A construct Transgenic TO plants were regenerated, selected for resistance to kanamycin and grown in soil Individual plants were bagged to allow self-pollination Presence of the TpGPA T and Kan genes in the resistant plants was verified by PCR with the approp ⁇ ate primers in 18 independent events Tl seeds from the first set of 5 transgenic events were harvested and analyzed (FIG 6) Tl seeds showed increased 16 0 percentage with
  • Example XVIII Use of TpGPATl to produce ethanol and biodiesel
  • U S Patent 5,578,472 to Ueda et al and U S Patent 7,135,308 to Bush et al the contents of the entirety of each of which are incorporated herein by this reference, descnbe a process for the production of ethanol by harvesting starch-accumulating filament-forming or colony-forming algae to form a biomass, initiating cellular decay of the biomass in a dark and anaerobic environment, fermenting the biomass in the presence of a yeast, and the isolating the ethanol produced Bush et al further relates to processing of the biomass remaining after ethanol production to recovering biodiesel starting materials and/or generation of heat and carbon dioxide via combustion Algal cells overexpressing the TpGPATl gene as described herein are used in the process of Bush et al to produce ethanol and biodiesel
  • hpids/oils which are useful for forming biodiesel typically, remain in the biomass after it has been subjected to fermentation, and the fermentation solution has been removed
  • These hpids/oils are isolated from the biomass and then used to form biodiesel using methods known to form biodiesel
  • a convenient method of separating hpids/oils from the biomass is by pressure
  • the biomass can be pressed and the resulting hpid- ⁇ ch liquid separated
  • a process for forming biodiesel starting materials comprises recovering the hpids/oils remaining in the biomass after fermentation and ethanol separating This process can further comprise converting the recovered hpids/oils into biodiesel
  • U S Patent Application 20070048848 to Sears et al (March 1, 2007), the contents of the entirety of which are incorporated by this reference, descnbe a "Method, apparatus and system for biodiesel production from algae " See, also, separating oil from the algal cells and processing it into diesel using standard transestenfication technologies such as the Connemann process (see, eg , U S Patent 5,354,878, the entire contents of which are incorporated herein by this reference) Tablel.
  • Yeast cells were harvested after 3 -day induction with 2% galactose. Values, expressed as mol % of total fatty acids represent the average ⁇ SD for three replicates.
  • Yeast cells were harvested after 3-day induction with 2% galactose in the presence of EPA or DHA. Values, expressed as mol% of total fatty acids represent the average ⁇ SD for three replicates.
  • the Plasmodium falciparum PfGatp is an endoplasmic reticulum membrane protein important for the initial step of malarial glycerolipid synthesis J Biol Chem 279 9222-9232 9 Zufferey R, and Mamoun C B (2005)
  • the initial step of glycerolipid metabolism in Leishmania major promastigotes involves a single glycerol-3-phosphate acyltransferase enzyme important for the synthesis of t ⁇ acylglycerol but not essential for virulence MoI Microbial 56 800-810 17 10 Le win TM, Wang P, Coleman RA (1999) Analysis of ammo acid motifs diagnostic for the sn-glycerol-3 -phosphate acyltransferase reaction Biochemistry 38 5764-5771 1 1 Zaremberg V, and McMaster C R (2002) Differential partitioning of lipids metabolized
  • Arabidopsis AtGPATl a member of the membrane-bound glycerol-3-phosphate acyltransferase gene family, is essential for tapetum differentiation and male fertility Plant Cell 15 1872-1887
  • TL-DNA gene 5 controls the tissue-specific expression of chimae ⁇ c genes earned by a novel type of Agrobacte ⁇ um vector MoI Gen Genet 204 383-396

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Biotechnology (AREA)
  • Organic Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Nutrition Science (AREA)
  • Plant Pathology (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Medicinal Chemistry (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Immobilizing And Processing Of Enzymes And Microorganisms (AREA)
  • Breeding Of Plants And Reproduction By Means Of Culturing (AREA)

Abstract

The present disclosure relates to the isolation of, purification of, characterization of, and uses for a glycerol-3-phosphate acyltransferase (TpGPAT1), and genes encoding TpGPAT1, from algae.

Description

ALGAL GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE
CROSS-REFERENCE TO RELATED APPLICATION This application claims the benefit under 35 U.S.C. § 119(e) of U. S. Provisional Patent Application Serial
No. 61/072,083, filed March 26, 2008, for "ALGAL GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE," the contents of the entirety of which are incorporated herein by this reference.
TECHNICAL FIELD The invention relates generally to biotechnology and, more particularly, to genes useful for the genetic manipulation of plant characteristics. In certain embodiments, the disclosure relates to isolated and/or purified polypeptides and nucleic acids encoding glycerol-3-phosphate acyltransferase (TpGPATl) and methods of their use.
BACKGROUND The majority of fatty acids synthesized in eukaryotic diatoms are incorporated into either membrane glycerolipids or the neutral glycerolipid triacylglycerols (TAGS). The initial step of glycerolipid biosynthesis in diatoms is the fatty acid acylation of glycerol-3-phosphate (G-3-P) at the sn-1 position by G-3-P acyltransferase (GPAT) to form lysophosphatidic acid (LPA). LPA acyltransferase (LPAT) then catalyzes the acylation of LPA at the sn-2 position to generate phosphatide acid (PA), which serves as a general precursor for all glycerophospholipids, including TAG. TAG synthesis involves further conversion of PA into diacylglycerol (DAG) by PA phosphatase, and subsequent acylation of DAG by either fatty acyl-CoA-dependent or phospholipid-dependent DAG acyltransferases.
DISCLOSURE OF THE INVENTION
Eukaryotic diatoms have a unique fatty acid profile, distinctive in their high levels of 16:0, 16:1 ω 7 and 20:5 ω 3 and a low content of Cl 8 fatty acids. The fatty acid composition of the marine diatom Thalassiosira pseudonana is typical of most diatoms, with a predominance of 16:0, 16: 1 ω 7 and 20:5 ω 3. However, small amounts of 18:4 ω 3 and 20:6 ω 3, not usually found in diatoms, are also present.
Identified is the glycerol-3-phosphate acyltransferase (GPAT) from T. pseudonana. T. pseudonana shows a unique fatty acid profile. GPAT's role in determining such a profile has remained unknown however. GPAT catalyzes a rate-limiting and committed step of glycerolipid synthesis, thereby serving as a potential target for genetic 'engineering of glycerolipid biosynthesis.
Heretofore, only a small number of microsomal GPAT, which are thought to mediate oil synthesis as well as membrane lipid synthesis in eukaryotes, have been reported. These microsomal GPAT were identified from the unicellular eukaryotes Saccharomyces cerevisiae (Zheng and Zou, 2001; Zaremberg and McMaster 2002), Plasmodium falciparum (Santiago et al., 2004) and Leishmania major (Zufferey and Marnoun, 2005) and the higher eukaryotes Arabidopsis (Zheng et al, 2003) and human and mouse (Cao et al., 2006). The sequences of these enzymes are highly divergent except for the conserved acyltransferase domains.
A gene encoding a membrane-bound glycerol-3-phosphate acyltransferase, designated TpGPAT, from the marine diatom T. pseudonana has been isolated. Heterologous expression of TpGPAT in a yeast GPAT mutant (gatl) conferred a seven-fold increase in GPAT activity. Enzyme property assessment using microsomal proteins indicated that TpGPAT was highly specific for 16:0. Accordingly, expression of TpGPAT in gatl resulted in approximately a 12% and an 18% increase of 16:0 in phospholipids and triacylglycerols, respectively. The unsaturated fatty acids, 16:1 and 18: 1, on the other hand, were reduced by 15% and 21% respectively in these two lipid species. The results indicate that TpGPAT exerts a key role in determining the fatty acid composition in glycerohpids and can be used to alter fatty acid composition and/or increase oil synthesis in oil-producing organisms
Descπbed is a GPAT that shows highly specific preference for palmitate (16 0) and its expression in yeast dramatically increases 16 0 contents in both phospholipids and tπacylglycerols Thus, TpGPAT can be used to produce 16 0-πch oil in the oil-producing organisms such as oilseeds (eg , Brassica, sunflower, flax, soybean, etc) through overexpression
Generally, the fatty acid composition of glycerohpids is dictated by at least three factors (i) the size of individual fatty acyl pools, (n) the relative activity and specificity of fatty acyltransferases, and (in) the relative activity and specificity of enzymes responsible for the deacylation-reacylation process Herein, we elucidate the role of GPAT in determining the glycerolipid fatty acid composition in T pseudonana GPAT catalyzes the initial and committed step of glycerolipid synthesis, acylating glycerol-3-phosphate to form lysophosphatidic acid (LPA), which is further acylated by LPA acyltransferase to yield phosphatide acid (PA) as a general precursor for all glycerophospholipids Herein, we identify TpGPAT (or "TpGPATl"), encoding a membrane-bound GPAT, from T pseudonana GPAT prefers 16 0-CoA as acyl donor and mediates the synthesis of glycerolipid molecules enriched with 16 0 fatty acid Glycerohpids of the marine diatom T pseudonana have predominantly 16 0, 16 1 ω 7 and 20 5 ω 3 fatty acids
We studied a membrane bound glycerol-3-phosphate acyltransferase (GPAT), designated TpGPAT, in this algal species The primary sequence of TpGPAT is composed of 674 amino acids, which shows much higher similarity to the GPAT sequences from the unicellular eukaryotes Saccharomyces cerevisiae, Leishmama major, and Plasmodium falciparum than to those from higher plants and mammals A transgenic plant containing a nucleic acid construct is also disclosed A method of transforming a cell or a plant is described, the method comprising introducing the isolated, purified or recombinant nucleic acid into the cell or plant A process for producing a genetically transformed plant seed comprises introducing the nucleic acid into the plant seed In some embodiments, these methods may be used for modifying plants to change their seed oil content
Expression of TpGPA T in, for example, canola, soybean, and other oilseeds is expected to produce high-palmitate oils Such oils can be used for the production of margarine and as oleochemical, soap, and animal feed raw material Whereas oils with high contents of long-chain or very long-chain polyunsaturated fatty acids are desirable for many purposes including human nutrition, oils with highly saturated 16-carbon-chain length fatty acids can provide the starting materials for many industrial applications
Also descπbed is a process of producing biodiesel from algal cells, wherein the improvement comprises using, as an algal cell in the process, the algal cell transformed as descnbed herein to overexpress TpGPA T
BRIEF DESCRIPTION OF THE FIGURES
FIG IA is an alignment of the four conserved acyltransferase domains of TpGPAT (SEQ ID NO 2) with glycerol-3-phosphate acyltransferases (GPAT) and dihydroxyacetone-phosphate acyltransferase (DHAPAT) from other species PfGAT from P falciparum (accession no XP 001350533, SEQ ID NO 12), LmGAT from L major (accession no XP 001687304, SEQ ID NO 13), Gatlp (SEQ ID NO 14) and Gat2p (SEQ ID NO 15) from S cerevisiae (accession no AJ311354 and AJ314608, respectively), hGPATl (SEQ ID NO 16), hGPAT2 (SEQ ID NO 17) and hGPAT3 (SEQ ID NO 18) from H sapiens (accession no NP 065969, AAH68596 and NP l 16106, respectively), mGPATl (SEQ ID NO 19), mGPAT2 (SEQ ID NO 20)and mGPAT3 (SEQ ID NO 21)from M musculus (accession no NP 032175, BAF03614 and NP 766303, respectively), PIsB (SEQ ID NO 22) from E coli (accession no NP 756863), AtGPATl (SEQ ID NO 23) and AtGPATό (SEQ ID NO 24) from A thaliana (accession no Atlg06520 and At2g38110, respectively), hDHAPAT (SEQ ID NO 25) from H sapiens (accession no BAD96493); mDHAPAT (SEQ ID NO:26) from M musculus (accession no. NP 034452), and LmDAT (SEQ ID NO 27) from L major (accession no. XP_001686202) Identical amino acid residues are highlighted in black, and conserved residues are shaded The four conserved acyltransferase motifs are donated with motifs I, II, III and IV, respectively FIG IB is a phylogenic tree of TpGPATl and acyltransferases from other species. The partial amino acid sequences encompassing the 4 acyltransferase motifs were aligned using the Clustal W method of Lasergene analysis software (DNAStar, Madison, WI).
FIG. 1C is the predicted topology of TpGPATl using the TMHMM algorithm indicating the presence of five transmembrane domains ATI, AT2, AT3 and AT4 represent the four conserved acyltransferase motifs. FIG. 2 depicts GPAT activity of TpGPATl expressed in yeast gatl mutant. The microsomal membrane fractions prepared from lysates of the induced yeast cells harboring TpGPATl or empty vector pYES2.1 were assayed for GPAT activity with 400 μM [14C]glycerol 3-phosphate (2.5 nCi/nmol), 45 μM palmitoyl-CoA, 75 mM Tπs-HCl, pH 7 5, 1 mM DTT, and 2 mM MgCl2 for 10 mm at room temperature. After extraction of the phospholipid products, the radioactivity was measured by scintillation count. FIG. 3 depicts substrate specificity of TpGPATl. The microsomal membrane fractions prepared from lysates of the induced yeast cells harboring TpGPATl or empty vector pYES2.1 were assayed for GPAT activity with 400 μM [l4C]glycerol 3-phosphate (2 5 nCi/nmol) and different acyl-CoAs as acyl donor . After extraction of the phospholipid products, the radioactivity was measured by scintillation count.
FIG. 4 graphically depicts the results of the lipidomic analysis (fatty acid composition) of the lipids from yeast gatl mutants transformed with either TpGPATl or GATl . Yeast cells expressing TpGPAT or yeast GATl were fed with EPA (20.5) or DHA (22:6) upon induction of the genes. Total lipids from the yeast cells were extracted and subjected to lipidomic analysis using a tandem mass spectrometer. The results are presented as the molar ratio of EPA- or DHA-containing phospholipids (PC, PE, PS, PI) in the total phospholipids
FIG. 5 graphically depicts the results of the analysis of the fatty acid 16O content of T2 seeds from TpGPAT transgenic Arabidopsis Fatty acid analysis was performed on TpGPA T transformed Arabidopsis seeds. Fatty acid composition (as molar percentage) was determined in the seed oil extracted from 200 T2 seeds of 13 TpGPAT pSE transformed Arabidopsis lines (GW4-GW17). pSE129A empty plasmid transformed wild-type Arabidopsis was used as a control
FIG. 6 graphically depicts the results of the analysis of the fatty acid 16:0 content of Tl seeds from TpGPAT transgenic Brassica napus. Fatty acid analysis was performed on TpGPA T transformed B napus seeds. Fatty acid composition (as molar percentage) was determined in the seed oil extracted from Tl seeds of five independent TpGPAT pSE transformed Brassica napus events (GPATl, 3, 4, 7 and 12). Wild-type B napus was used as a control.
FIG. 7 graphically depicts the total oil content of TpGPA T transformed Arabidopsis seeds. Oil contents (as percentage of dry weight) were determined in 200 T2 seeds of the 13 TpGPATpSE transformed Arabidopsis lines (GW4-12; GW14-17). Wild-type Arabidopsis was used as a control (Con).
DETAILED DESCRIPTION The nucleotide sequence of T pseudonana GPAT (SEQ ID NO:1)
ATGGGCGTTGAAAAGAAGGGCACAATGATGTCCGAGTTGGACTATACGAAGGCACAACTCGCCTTCT TCn-ACATCGTCGTCCTTCTATCACTCGATATGCTCAACCCAGTCAAGATCITTTTACACGTCTTTCCTG CAATTAAGTCATGGCACATCGCGACATTTGCAATTGCCTGCATGTCATACATCTTCATCGTGAACTTG AGGGAACTGCTATACTTCGCTACCAAGGTCTTCTTCCATTCAATCCTATCAATCTTTTTCAACGACGTG ACCGTGGTTGGCAGAGAGAATATCCCGAGCCATGGCCCTGTTATCTTTACCTCCAACCACGCTAATCA GTTTATGGATGGGTTGATGATTATGTGTACTTGCCAAAGGACGATCTCGTATCTTGTAGCAGACAAGT CTTGGAATAGACCAATCATTGGGCATCTGGCTTGGATGATGGGGGGAGTGCCAGTCAAACGTGCACA AGATAGTGCCTGTAAAGGAACTGGAAAAATCAGCATTGACTTGAACGCTCTCGCGGGATCGGATGCA GTCATCAATGTCGTTGGAAAGGGAACATCGTTCACGTCTCAGATAAAAGCCGGGGATAAGATTCGCC TACCAAACAATGCAATCGGCATCAAAGTTGAATCTATCGAAAGTGATGAATCAATGTCGCTCAAAGT GGAAGATGGTGTGGCTGAAGTATTATCATCCCATCCATTTCCTGAGTACGTCACATACGATATTCTGC CTCGAATTGATCAGAAGGACGTCTACCAAAATGTACTGGAGAAACTAGCATCAGGCGGGACGATTGG AATCTTTCCAGAGGGTGGCTCCCACGATAGGACTGACTTGCTCCCATTGAAAGTTGGTGTGGCACTCA TTGCATACTCGGAACTTGAAAAGGATGGAATCAACGTGCCGATTGTCCCAGTTGGATTGAACTACTTT CGGGCTCATCGCTTCCGTGGCAAAGCAACTGTTGAGTTTGGTTCTCCAACTTATATTGAACCATCGAC ACTTGCAGACTACAAAAAGGGAGGTGCCGATAAGCGACGCGTTTGCAATGATCTTTTGGCTCGTATT GAGAACAGTATGAGATCTGTCATTGTGTCGGTGCCCGACTTTGAAACACTTCAGACCATCCATGCTGC GAGGAGGCTATACAGACAAGATGGCAGAAACGAAACTGCTGAACAAAGGCAGGACATGGGCAGGC GATTTGCAGAGGGGTACAAACGCGTTCTTCTCCAATTAGGAGGAGAGCCGCCAGAGGAGTGGCTCAG TCTGCAGTCGAGGATATTGGCGTACCAAAAGGAATTGAACGAGCTCGGTATCAGGGACTATCAGGTT GTTGGTCTTGATCACGAGGAGGTGGAACTCGGTTCAGAGTCGCAAGGTCATTCCAAAGCAGATACTG TTCTTCACAGGATGAATGTGTTTGGACACATCGTTCATCTGTTTGTCATTGCGGTCTTGGCAGCACTGC CAGCTATGTTGTTAAACCTTCCAGTTGGGTTGGCATCACGAATCTACTCCAATCGTAGGCGAAAGGTT GCATTGGCAGCATCAAAAGTGAAGGTGAAGGGATATGATGTGATGCTCTCAGAACGTGTACTGGCAT GTATCGTTCTCGTTCCTTCTCTGTGGGTAGTGTATGGATTGCTTCTCTCCCTGTTCACCTCTCTCGACG GACCGTCACTTGCTGTATGCTTCACCTGCTTTCCTTTGTTCTCATATTGGAGTATTATGGCTACGGAAT CAGGAATGGTTGATATCAAAGATTTGAGGCCGTACGTTATGAGAATGATTCCATCAGCACGACGCAG GTTAGCAGCATTGCCAGCAACGAGGAAGGCTCTCCGGTCGGATCTTAGAGCAATGATTAAGAAGATT GGCCCCAGCTTGGGTGATATTTACTACGAAAAGGACTTGAACTGGCAGAAGATTCAAATGGAGACGA AGAGGATGTCAATGGAGGAGTTGGATCCAGCTCAAAAAGACGAAGCAGCGAAGAAGGAAGAGTAA
The amino acid sequence of T. pseudonana GPAT (SEQ ID NO: 2)
MGVEKKGTMMSELD YTKAQLAFFYIWLLSLDMLNP VKIFLHVFP AIKSWHIATFAIACMSYIFIVNLRELLY FATK VFFHSILSIFFND VTWGRENIPSHGPVIFTSNHANQFMDGLMIMCTCQRTISYLVADKSWNRPIIGHLA WMMGGXΦVKRAQDSACKGTGKISIDLNALAGSDAVINVVGKGTSFTSQIKAGDKIRLPNNAIGIKVESIESD ESMSLKVEDGVAEVLSSHPFPEYVTYDILPRIDQKDVYQNVLEKLASGGTIGIFPEGGSHDRTDLLPLKVGVA LIAYSELEKDGINVPIVPVGLNYFRAHRFRGKATVEFGSPTYIEPSTLAD YKKGGADKRRVCNDLLARIENSM RSVΓVSVPDFETLQTIHAARRLYRQDGRNETAEQRQDMGRRF AEGYKRVLLQLGGEPPEEWLSLQSRILA YQ
KELNELGIRDYQWGLDHEEVELGSESQGHSKADTVLHRMNVFGHIVHLFVIAVLAALPAMLLNLPVGLAS RIYSNRRRKVALAASKVKVKGYDVMLSERVLACΓVLVPSLWWYGLLLSLFTSLDGPSLAVCFTCFPLFSYW
SIMATESGMVDIKDLRP YVMRMIPSARRRLAALP ATRKALRSDLRAMIKKIGPSLGDIYYEKDLNWQKIQME TKRMSMEELDPAQKDEAAKKEE
Some of the manipulations that are possible using the TPGPATl gene or a part thereof, include, but are not limited to, the following: seeds or plants with increased or decreased oil content; seeds or plants containing oils with an enhanced polyunsaturated fatty acid content, and plants exhibiting an enhanced or altered capacity to accumulate various fatty acids.
In order to facilitate review of the various embodiments of the disclosure, the following explanations of specific terms are provided: Degree or percentage of sequence homology: The term "degree or percentage of sequence homology" refers to degree or percentage of sequence identity between two sequences after optimal alignment. Percentage of sequence identity (or degree of identity) is determined by comparing two optimally aligned sequences over a comparison window, where the portion of the peptide or polynucleotide sequence in the comparison window may comprise additions or deletions {i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical amino-acid residue or nucleic acid base occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity. Homologous isolated and/or purified sequence "Homologous isolated and/or purified sequence" is understood to mean an isolated and/or purified sequence having a percentage identity with the bases of a nucleotide sequence, or the amino acids of a polypeptide sequence, of at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99 5%, 99 6%, or 99 7% This percentage is purely statistical, and it is possible to distribute the differences between the two nucleotide sequences at random and over the whole of their length Sequence identity can be determined, for example, by computer programs designed to perform single and multiple sequence alignments It will be appreciated that this disclosure embraces the degeneracy of codon usage as would be understood by one of ordinary skill in the art Furthermore, it will be understood by one skilled in the art that conservative substitutions may be made in the amino acid sequence of a polypeptide without disrupting the structure or function of the polypeptide Conservative substitutions are accomplished by the skilled artisan by substituting amino acids with similar hydrophobicity, polarity, and R-chain length for one another Additionally, by comparing aligned sequences of homologous proteins from different species, conservative substitutions may be identified by locating amino acid residues that have been mutated between species without altering the basic functions of the encoded proteins Isolated As will be appreciated by one of skill in the art, "isolated" refers to polypeptides that have been
"isolated" from their native environment
Nucleotide, polynucleotide, or nucleic acid sequence "Nucleotide, polynucleotide, or nucleic acid sequence" will be understood as meaning both a double-stranded and single-stranded DNA in the monomenc and dimeric (so-called in tandem) forms and the transcription products of the DNAs Sequence identity Two ammo-acids or nucleotide sequences are "identical" if the sequence of amino-acids or nucleotide residues in the two sequences is the same when aligned for maximum correspondence as described below Sequence comparisons between two (or more) peptides or polynucleotides are typically performed by comparing sequences of two optimally aligned sequences over a segment or "comparison window" to identify and compare local regions of sequence similarity Optimal alignment of sequences for comparison may be conducted by the local homology algorithm of Smith and Waterman, Ad App Math 2 482 (1981), by the homology alignment algorithm of Neddleman and Wunsch, J MoI Biol 48 443 (1970), by the search for similarity method of Pearson and Lipman, Proc Natl Acad Sci (U S A ) 85 2444 (1988), by computerized implementation of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group (GCG), 575 Science Dr , Madison, Wis ), or by visual inspection The definition of sequence identity given herein is the definition that would be used by one of skill in the art The definition by itself does not need the help of any algorithm, the algorithms being helpful only to achieve the optimal alignments of sequences, rather than the calculation of sequence identity From the definition given herein, it follows that there is a well defined and only one value for the sequence identity between two compared sequences which value corresponds to the value obtained for the best or optimal alignment In the BLAST N or BLAST P "BLAST 2 sequence," software which is available in the web site http //worldwideweb ncbi nlranih gov/gorf7bl2 html, and habitually used by the inventors and in general by the skilled man for comparing and determining the identity between two sequences, gap cost which depends on the sequence length to be compared is directly selected by the software
Stringent hybridization Hybridization under conditions of stringency with a nucleotide sequence is understood as meaning hybridization under conditions of temperature and ionic strength chosen in such a way that they allow the maintenance of the hybridization between two fragments of complementary DNA Homologs of the TPGPATl genes descnbed herein obtained from other organisms, for example plants, may be obtained by screening appropriate libraries that include the homologs, wherein the screening is performed with the nucleotide sequence of the specific TpGPATl genes disclosed herein, or portions or probes thereof, or identified by sequence homology search using sequence alignment search programs such as BLAST, FASTA Proteins that are homologous to full-length T pseudonana TPGPATl can be found by searching protein databases, such as the NCBI protein database, with search engines, such as BLAST They may also be identified by rational design The process of rational design may comprise identifying conservative amino acid substitutions within the desired polypeptide sequence length, and making those substitutions in the encoded protein
Searching the NCBI protein database with the full-length amino acid sequence of T pseudonana TpGPATl (BLASTP) reveals polypeptides with significant sequence homology to TpTPGPATl, several of which are shown aligned with TpTPGPATl in FIG IA The conserved diacylglycerol transferase domain is described within NCBFs conserved domain database (WorldWideWeb ncbi nlm nih gov/Structure/cdd/cdd shtml) Polypeptide sequences that are homologous to this conserved domain impart the type 2 diacylglycerol activity of TpTPGPATl to proteins wherein it is contained It is understood by those of skill in the art that polypeptides with homologous sequences may be designed to exhibit the same structure and function as their homologs The skilled artisan is, for example, able to design homologous polypeptides to those specifically descnbed m the Examples of this disclosure and by the sequence alignment of FIG IA Such homologous polypeptides may be those that contain conservative substitutions to polypeptides of the present disclosure, for example the polypeptides of SEQ ID NOS 3 and 4 Simple experimental assays that determine which homologous proteins exhibit substantially similar diacylglycerol transferase activity to TpTPGPATl are known to those skilled in the art Such assays are not unduly time-consuming, expensive, or technically difficult For example, conventional gas chromatography may be used to detect TAG produced by TpTPGPATl Several of these assays are descnbed in the detailed examples below
Further included are nucleic acid molecules that hybndize to the herein disclosed sequences Hybndization conditions may be stringent in that hybndization will occur if there is at least a 90%, 95% or 97% identity with the nucleic acid molecule that encodes the disclosed TPGPATl molecules The stringent conditions may include those used for known Southern hybridizations such as, for example, incubation overnight at 42°C in a solution having 50% formamide, 5xSSC (150 mM NaCl, 15 mM tnsodium citrate), 50 mM sodium phosphate (pH 7 6), 5x Denhardt's solution, 10% dextran sulfate, and 20 micrograms/milliliter denatured, sheared salmon sperm DNA, following by washing the hybndization support in 0 Ix SSC at about 65°C Other known hybridization conditions are well known and are descnbed in Sambrook, et al , Molecular Cloning A Laboratory Manual, Third Edition, Cold Spring Harbor, N Y (2001), incorporated herein in its entirety by this reference
DNA isolation and cloning is well established Similarly, DNA encoding an isolated enzyme may be inserted into a vector and transformed into yeast cells by conventional techniques However, because no cloned GPAT gene has been shown to efficiently use VLCPUFAs, it has not previously been possible to address the possibility of genetic modifications of GPAT, for example to modulate GPATl activity to efficiently use VLCPUFA We confirmed that TPGPATl is involved with TAG synthesis and utilizes VLCPUFA more efficiently than other GPATs Therefore, genetic engineering of GPAT polypeptides that compnse desireable fatty acid profiles is now possible, in view of the present disclosure Nucleic acid molecules that code for TPGPATl, for example sequences having at least 80% identity to SEQ
ID NO 1 may be transformed into an organism, for example a plant Such homologous sequences are exemplified by SEQ ID NOS 5-6 As known in the art, a number of ways exist by which genes and gene constructs can be introduced into organisms, for example plants, and a combination of transformation and tissue culture techniques have been successfully integrated into effective strategies for creating transgenic organisms, for example crop plants These methods have been descnbed elsewhere (Potrykus, 1991, Vasil, 1994, Walden and Wingender, 1995, Songstad, et al , 1995), and are well known to persons skilled in the art For example, one skilled in the art will certainly be aware that, in addition to Agrobactenum-mediated transformation of Ambidopsis by vacuum infiltration (Bechtold et al , 1993) or wound inoculation (Katavic, et al , 1994), it is equally possible to transform other plant and crop species, using Agwbactenum Ti-plasmid mediated transformation {e g , hypocotyl (DeB lock, et al , 1989) or cotyledonary petiole (Moloney, et al , 1989) wound infection), particle bombardment/biolishc methods (Sanford, et al , 1987, Nehra, et al , 1994, Becker, et al , 1994) or polyethylene glycol-assisted, protoplast transformation (Rhodes, et al , 1988, Shimamoto, et al , 1989) methods
Many examples exist of successful modifications to plant metabolism that have been achieved by genetic engineering to transfer new genes or to alter the expression of existing genes, in plants It is now routinely possible to introduce genes into many plant species of agronomic significance to improve crop performance (e g , seed oil or tuber starch content/composition, meal improvement, herbicide, disease or insect resistance, heavy metal tolerance, etc ) (MacKenzie and Jain, 1997, Budziszewski, et al , 1996, Somerville, 1993, Kishore and Somerville, 1993)
As will also be apparent to persons skilled in the art, and as described elsewhere (Meyer, 1995, Dada, et al , 1997), it is possible to utilize plant promoters to direct any intended up- or down-regulation of transgene expression using constitutive promoters (e g , those based on CaMV35S), or by using promoters which can target gene expression to particular cells, tissues (e g , napm promoter for expression of transgenes in developing seed cotyledons), organs (e g , roots), to a particular developmental stage, or in response to a particular external stimulus (e g , heat shock)
Promoters for use herein may be inducible, constitutive, or tissue-specific or have vaπous combinations of such characteristics Useful promoters include, but are not limited to, constitutive promoters, e g , carnation etched ring virus (CERV), cauliflower mosaic virus (CaMV) 35S promoter, or more particularly the double enhanced cauliflower mosaic virus promoter, comprising two CaMV 35S promoters in tandem (referred to as a "Double 35S" promoter)
It may be desirable to use a tissue-specific or developmentally regulated promoter instead of a constitutive promoter in certain circumstances A tissue-specific promoter allows for overexpression in certain tissues without affecting expression in other tissues By way of illustration, a promoter used in overexpression of enzymes in seed tissue is an ACP promoter as descnbed in PCT International Publication WO 92/18634, published October 29, 1992, the contents of which is herein incorporated by reference
The promoter and termination regulatory regions may be functional in the host plant cell and may be heterologous (that is, not naturally occurring) or homologous (deπved from the plant host species) to the plant cell and the gene Suitable promoters which may be used are descnbed herein
The termination regulatory region may be denved from the 3' region of the gene from which the promoter was obtained or from another gene Suitable termination regions which may be used are well known in the art and include Agwbactenum tumefaciens nopaline synthase terminator (Tnos), A tumefaciens mannopine synthase terminator (Tmas) and the CaMV 35S terminator (T35S), the pea nbulose bisphosphate carboxylase small subunit termination region (TrbcS), or the Tnos termination region Such gene constructs may suitably be screened for activity by transformation into a host plant via Agrobacterium and screening for increased isoprenoid levels Suitably, the nucleotide sequences for the genes may be extracted from the GenBank® (a registered trademark of the U S Department of Health and Human Services) nucleotide database and searched for restriction enzymes that do not cut These restriction sites may be added to the genes by conventional methods such as incorporating these sites in PCR primers or by sub-clonrng
A DNA construct for use herein may be comprised within a vector, most suitably an expression vector adapted for expression in an appropnate host cell, for example a plant cell It will be appreciated that any vector which is capable of producing a cell comprising the introduced DNA sequence will be sufficient
Suitable vectors are well known to those skilled in the art and are described in general technical references, such as Pouwels et al , Cloning Vectors A Laboratory Manual, Elsevier, Amsterdam (1986) Particularly suitable vectors include the Ti plasmid vectors
Transformation techniques for introducing the DNA constructs into host cells are well known in the art and include such methods as micro-injection, using polyethylene glycol, electroporation, high velocity ballistic penetration, or Agrobactei ωm-mediated transformation After transformation of the plant cells or plant, those plant cells or plants uito which the desired DNA has been incorporated may be selected by such methods as antibiotic resistance, herbicide resistance, tolerance to ammo-acid analogues, or using phenotypic markers
Various assays may be used to determine whether the plant cell shows an increase in gene expression, for example, Northern blotting or quantitative reverse transcriptase PCR (RT-PCR) Whole transgenic plants may be regenerated from the transformed cell by conventional methods Such transgenic plants having improved isoprenoid levels may be propagated and self-pollinated to produce homozygous lines Such plants produce seeds containing the genes for the introduced trait and can be grown to produce plants that will produce the selected phenotype
Particularly preferred plants for modification according to the present disclosure include Aiabidopsis thahana, borage (Boiago spp ), Canola, castor (Ricinus communis) (Ricinus spp ), cocoa bean (Theobroma cacao) (Theobi oma spp ), corn (Zea mays) (Zea spp ), cotton (Gossypium spp), Crambe spp , Cuphea spp , flax (Linum spp ), Lesquerella spp and Limnanthes spp , Linola, nasturtium (Tropaeolum spp ), Oenothera spp , olive (Olea spp ), palm (Elaeis spp ), peanut (Arachis spp ), rapeseed, safflower (Carthamus spp ), soybean (Glycine spp and Soja spp ), sunflower (Hehanthus spp ), tobacco (Nicotiana spp ), Vernoma spp , wheat (Tnticum spp ), barley (Hordeum spp ), πce (Oryza spp ), oat (A vena spp ) sorghum (Soighum spp ), rye (Secale spp ) or other members of the plant family Gramineae
Some embodiments are used to modify the yield or composition of oilseed produced from oilseed crops Oilseed crops are plant species that are capable of generating edible or industrially useful oils in commercially significant yields, and include many of the plant species listed herein Such oilseed crops are well known to persons skilled in the art In one example, plants transformed with a nucleotide sequence that codes for a TPGPATl are grown Seeds of the transgenic plants are harvested and fatty acids of the seeds are extracted The extracted fatty acids are used for subsequent incorporation into a composition, for example a pharmaceutical composition, a nutraceutical composition, or a food composition
In certain embodiments, other methods of enhancing or altering oil production may also be used with the plant to be transformed (eg , incorporating, for expression in the plant, a nucleic acid sequence selected from the group comprising a nucleic acid sequence encoding a peptide having, for example, Brassica pyruvate dehydrogenase kinase activity (see, e g , U S Patent 7,214,859 to Manila, et al (May 8, 2007), U S Patent 6,500,670 to Zou, et al (Dec 2002), and U S Patent 6,256,636 to Randall, et al (July 2001), the contents of the entirety of each of which is incorporated herein by this reference), a nucleic acid sequence encoding a peptide having diacylglycerol acyltransferase activity (see, e g , U S Patent 7,015,373 and U S Patent 6,500,670 to Zou, et al (Dec 2002), the contents of the entirety of each of which is incorporated herein by this reference), and a nucleic acid sequence encoding a peptide having glycerol-3-phosphate dehydrogenase activity {see, e.g., U.S. Patent 7,112,724, the contents of the entirety of which is incorporated herein by this reference, and combinations thereof).
Embodiments are susceptible to various modifications and alternative forms in addition to those specific Examples described in detail herein. Thus, embodiments are not limited to the particular forms disclosed. Rather, the scope of the disclosure encompasses all modifications, equivalents, and alternatives falling within the following appended claims.
EXAMPLES
Example I Isolation of a GPAT cDNA from T. pseudonana
The draft genome of the diatom T. pseudonana was searched using the yeast Gatlp and Gat2p sequences as query. {See, Zheng and Zou, 2001). One homologous nucleotide sequence, designated TpGPAT, was retrieved and amplified by PCR as described herein.
Plasmid from a cDNA library of T. pseudonana was used as template. A 50 μl PCR reaction containing 50 ng of plasmid DNA, 20 pM of each primer: 5'- GGTATGCTCATCTGCTACCCCCTC -3' (SEQ ID NO:7) and 5'-TTAAGTCTCCTTCGTCTTTGGTGTAG -3' (SEQ ID NO:8) and 1 μl of BD ADVANTAGE™ 2 Polymerase Mix (Clontech Laboratories, Inc.) was incubated for 30 cycles according to the following thermocycle program: 94°C for 30 sec, 58°C for 30 sec, and 72°C for 1 min. 30 sec. The PCR product was purified and subsequently cloned into the pYES2.1/N5-His-TOPO expression vector (Invitrogen).
Example II
Heterologous expression of TpGPAT in yeast
The TpGPAT in pYES2.1 N5-His-TOP0 plasmid was transformed into yeast gatl A (BY4742, Mat a, his3Cl, leu2C0, lys2C0, ura3C0, YKR067w::kanMX4) using the method provided by the producer's manual (Invitrogen). Yeast cells transformed with pYES2.1/V5-His-TOPO plasmid only were used as a control. Transformants were selected by growth on synthetic complete medium lacking uracil (SC-ura), supplemented with 2% (w/v) glucose. The colonies were transferred into liquid SC-ura with 2% (w/v) glucose and grown at 28°C overnight. The overnight cultures were diluted to an OD 0.4 in induction medium (SC-ura + 2% Galactose + 1% Raffinose), and were induced by incubating at 28°C overnight. The yeast cells were collected and broken using glass beads. The protein concentrations in the lysates were normalized using a Biorad assay (Bradford, 1976) and then assayed for GPAT activity.
Enzyme Assays: GPAT assays were conducted at 300C for 10 min. in a 200-pL reaction mixture containing 40 mM Hepes, pH 7.0, 400 pM 14C-glycerol-3-phosphate (2.5 nCi/nmol), 67.5 pM palmitoyl-CoA and/or stearoyl-CoA or other fatty acyl donors, 1 mM DTT, 2 mM MgCl2,, and 2.5 mg/mL BSA unless stated otherwise. The reaction was stopped, and products were extracted as described previously. (Zheng and Zou, 2001). The formed products were subjected to scintillation counting for radioactivity and thin layer chromatography analysis as described.
Example EU
Yeast DHA/EPA feeding and total lipid analysis Yeast cultures were grown at 28°C in the presence of 2% (w/v) glucose and 1% (w/v) Tergitol NP-40 (Sigma,
St. Louis, MO, US). Expression of the transgene was induced at OD600 nm 0.2 to 0.3 by supplementing galactose to 2% (w/v). At that time, the appropriate FAs were added to a final concentration of 50 or 100 μM in the presence of 1% (w/v) Tergitol NP-40 (Sigma, St Louis, MO, US) Yeast cells (20 ml) were harvested after a 3-day incubation, total lipids from yeast homogenates were extracted using the procedure of Schneiter (2005) Separation of neutral lipids and polar lipids was performed by running the thin layer chromatography plates (Si 250-PA, Baker, Philhpsburg, NJ) in a developing solvent of hexane ether acetic acid (70 30 1, v/v) and identified by co-migration with known standards Spots corresponding to TAG and phospholipid were scraped off the TLC plates and were transmethylated with methanolic HCl and quantified by gas chromatography as descπbed previously (Zheng and Zou, 2001)
Results Isolation and characterization of the TpGPAT cDNA from T pseudonana To identify GPAT enzyme(s) from T pseudonana, the v3 0 draft genome of this diatom was searched for
DNA sequences encoding the peptide(s) similar to yeast Gatlp and Gat2p Zheng Z , and Zou J , supia A homologous sequence was identified, designated TpGPA Tl A full-length cDNA clone was amplified by PCR from a cDNA library of T pseudonana It contains an open reading frame of 2,025 bp, which encodes a polypeptide of 674 amnio acids with a calculated molecular mass of 75 2 kD The predicted coding sequence in the T pseudonana genome data base, with the transcript sequence being 2,334 bp, could not be amplified Comparison of the genomic and cDNA sequences of TpGPAT revealed one intron of 102 bp near the 5-'end The amino acid sequence of TpGPAT exhibits 24% and 23% identity to yeast Gatlp and Gatzp, respectively
A relatively high similarity to P falciparum GPAT (PfGPAT, 27% identity) and Leishmama major GPAT (LmGPAT, 25% identity) was registered for TpGPAT In contrast, TpGPAT shares little homology with bacteπal, mammalian, and Arabidopsis membrane-bound GPATs on the full-length scale (data not shown) A remarkable feature shared among TpGPAT, yeast Gatlp and GatZp, PfGPAT and LmGPAT is a long stretch of more than 100 amino acids between conserved acyltransferase motifs II and III (FIG IA) This distinguishes them from other known GPATs, LPATs and dihydroxyacetone phosphate acyltransferases (DHAPATs) that are characteristic of a much shorter spacer less than 60 amino acids) between the two motifs Together with previous findings that PfGPAT and LmGPAT are a yeast-like GPAT (Santiago et al , 2004, Zufferey and Mamoun, 2005), the results suggest that the four unicellular eukaryotes T pseudonana, P falciparum, L majoi, and S cerevisiae are evolutionarily closely related (FIGs LA & IB)
The alignment of multiple partial sequences revealed that TpGPA T contains all four acyltransferase motifs Mohf I of TpGPAT contains the ammo acid sequence, HANQFMDGLMIT (SEQ ID NO 28) Motif II of TpGPAT contains the amino acid sequence, VPVKRAQD (SEQ ID NO 29) Motif III of TpGPAT contains the amino acid sequence, IGIFPEGGSHD (SEQ ID NO 30) Motif IV of TpGPAT contains the amino acid sequence, IVPVGLNY (SEQ ID NO 31) The histidine and aspartate residues in motif I, which are catalytically important, remain invariant among all the sequences Nevertheless, five residues, instead of four for most of known fatty acyltransferases, are present between the conserved histidine and aspartate in TpGPAT This feature is shared among the known GPATs from unicellular eukaryotes (FIG LA) In motif II, arginine is most conserved, as is glutamate in motif III These two residues have been shown to be important in binding glycerol-3 -phosphate Motif IV is highly hydrophobic and has been suggested to be involved in acyl-CoA binding The proline in motif IV appears to be most conserved (FIG IA) The substitution of serine for proline in motif IV can lead to a 2-5 fold higher Km for palmitoyl-CoA
A Kyte-Doohttle hydropathy analysis of the amino acid sequence of the TpGPAT revealed several hydrophobic domains (data not shown) Protein topology analysis with the algorithms (TMHHM, SOSUI, and TMAP) predicted 5 transmembrane domains, with 2 of them close to the N-terminus and 3 close to the C-terminus (FIG 1C) This topology strongly suggests that TpGPAT has the membrane-bound nature like other ER- or mitochondria-based GPATs from lower and higher eukaryotes As shown in FIG 1C, the N- and C-termim of TpGPAT are located on the cytosohc (outside) and lumenal (inside) sides, respectively In the middle, a long stretch of more than 400 amino acids encompassing all 4 acyltransferase motifs is exposed to the cytosol, which allows the binding and catalysis of the substrates to take place in the same space (FIG 1C)
Example IV
Heterologous Expression of TpGPAT in the Yeast gatl mutant
To determine the functionality of the protein encoded by the TpGPAT, the full-length coding region of TpGPAT was cloned into a yeast expression vector pYES2 l/V5-His-TOPO under the control of the galactose-inducible GALl promoter, and the construct was used to transform a GPAT-deficient yeast strain, gatl (EUROSCARF accession no Y 15983) The gatl cells harboring an empty pYES2 1 vector were used as a control The microsomal membrane fractions prepared from lysates of the induced yeast cells were assayed for GPAT activity using l4C-labelled glycerol-3-phosphate as acceptor, and palmitoyl (16 O)-CoA as acyl donor Under our assay conditions, expression of the TpGPAT in yeast gatl mutant resulted in a restoration of TpGPA T function with about seven- fold higher activity than that found in control cells transformed with empty pYES2 1 vector (FIG 2) When different unlabeled acyl-CoAs were used as acyl donors, it was shown that the recombinant TpGPAT protein possesses the highest activity toward 16 0 In contrast, the GPAT activities toward other fatty acyl donors including 14 0-,16 0-, 16 1-, 18 0-, 18 1-, and 22 6 DHA)-CoA are much lower (FIG 3) Example V
Fatty Acids Profile in Yeast gatl Mutant Expressing TpGPAT
To investigate if the over-expression of TpGPAT has any effect on the fatty acids composition of yeast lipids in vivo, the gatl cells harbonng TpGPAT or an empty vector as control were induced for 3 days by galactose at 28°C The total lipids was extracted and then separated into tπacylglycerols (TAGS) and phospholipids by TLC for the analysis of fatty acid composition As shown in Table 1, the expression of TpGPAT in gatl resulted in a significant change in the fatty acid composition of both TAG and phospholipids as compared to the control with empty vector Approximately 12% and 18% increase of 16 0 in phospholipids and tnacylglycerols, respectively, turned 16 0 into the most dominant fatty acid in the TpGPAT expressing yeast cells, instead of 16 1 fatty acid in the mutant cells harbonng the empty vector Conversely, the unsaturated fatty acids, 16 1 and 18 1, were reduced to 15% and 21% in these two lipid species In addition, a slight increase of 3-4% was observed for 18 0 in both the lipid species Collectively, the results strongly support the finding in the in vitro substrate specificity assay that 16 0 is the most preferred substrate for TpGPAT
Example VI Incorporation of EPA/DHA into lipids in yeast gatl Mutant Expressing TpGPAT
Since glycerolipids of T pseudonana contain a high percentage of a very-long chain polyunsaturated fatty acid (VLGPUFA), EPA (20 5n3), we tested if the expression of the TpGPA T gene could increase the accumulation of EPA and DHA in yeast glycerolipids
Yeast gatl strain transformed with TpGPAT or empty vector pYES2 1 was grown in the presence of EPA or DHA, while being induced by galactose Tπacylglycerols (TAGS) and phospholipids from the 3-day culture were extracted and analyzed by gas chromatography for fatty acid composition The expression of TpGPAT in gatl did not have much impact on the incorporation of LCPUFAs into either TAG or phospholipids as compared to the empty vector control (Table 2). It was not clear if this were due to the low GPAT activity for these VLCPUFAs or the lack of EPA and DHA-CoA in the cells.
To further determine the role of TpGPAT in the incorporation of VLGPUFAs into glycerolipids, yeast gatl strain transformed with TpGPAT or GATl under the control of the GALl promoter was grown in the presence of EPA (20:5) or DHA (22:6) upon induction of the genes. Phospholipids were extracted and subjected to lipidomic analysis using a tandem mass spectrometer (testing conducted by the Kansas Lipidomics Research Center). The results revealed that PC38:7, PC38:6, PC38:5, PC36:6, PC36:5, LPC20:5, LPC22:6, PE38:6, PE36:5, LPE20:5, LPE22:6, and PI36:5 from TpGPAT-expressing cells contain much higher EPA or DHA than those from GATl -expressing cells. As shown in FIG. 4, the molar percentage of PUFA in phospholipids from TpGPAT-expressing yeast cells contain 0.563% DHA and 3.696% EPA respectively, while the GATl -expressing yeast cells contain only 0.235% DHA and 2.025% EPA respectively. This experiment directly compares the activity of expressed TpGPAT with GATl, and the result suggests that TpGPAT enhances PUFA incorporation into the sn-1 position of a glycerol backbone and/or that LPA synthesized through a TpGPAT-mediated initial reaction is a more favorable acceptor for PUFA. It was thus concluded that TpGPAT has a role in controlling PUFA accumulation in glycerolipid.
DISCUSSION: GPAT catalyzes the first (and potentially rate-limiting) step in glycerolipid biosynthesis in eukaryotes. However, clear evidence that GPAT plays a role in determining the fatty acid composition of glycerolipids was lacking. Owing to the membrane-bound nature, no GPAT has been purified to an apparent purity sufficient for accurate in vitro biochemical assay. Studies using partially purified membrane-bound GPATs, which are often contaminated with other fatty acyltransferases, suggested a broad range of fatty acids as acyl donors for this enzyme. Nonetheless, it would be a reasonable assumption that substrate specificity of GPATs varies among different species. This assumption is supported by the present study revealing that TpGPAT shows high specificity for palmitate as fatty acyl donor in both in vitro and in vivo assays.
In order to assess the substrate specificity TpGPAT, we conducted heterologous expression in yeast gatl mutant, which possesses very low GPAT activity. This experiment restored GPAT activity, demonstrating close to seven-fold increase in enzyme activity when compared to gatl cells harboring empty pYES2.1 vector (FIG. 2). Hence, the substrate specificity resulting from this heterologous system can be ascribed to TpGPAT because the interference caused by the native Gat2p in yeast is relatively low. Our in vitro assays revealed that TpGPAT is highly specific for saturated C16 fatty acids although low activities toward other fatty acids were also detected. This finding is further consolidated by examining the fatty acid composition in the gatl cells expressing
TpGPAT. Heterologous expression of TpGPAT led to increases of palmitate in phospholipids and triacylglycerols by approximately 12% and 18%, respectively, in the gatl cells (Table 1). Accordingly, unsaturated fatty acids, mainly 16:1 and 18:1, dropped by 15% and 21% in phospholipids and triacylglycerols (Table 1). This unique substrate specificity of TpGPAT may constitute one of main factors controlling the fatty acid profile of T. pseudonana in which fatty acid 16:0 is predominant, accounting for up to 28% and 36% of fatty acids in total lipids and triacylglycerols, respectively.
It is noteworthy that the marine diatom T. pseudonana has a very low level of Cl 8 fatty acids. (Tonon et al., 2002; Tonon et al., 2005). One possible explanation is that this species has much lower steady levels of 18:0-CoA and 18:l-CoA pools relative to 16:0-CoA, 16:l-CoA and 205-CoA, as suggested by Tonon et al. (2005). However, an important aspect of fatty acyl pool is its dynamic nature. If 18:0-CoA and 18: 1-CoA pools are not channeled away by fatty acyltransferases, they can be converted to other fatty acid pools through processes such as fatty acid elongation and β-oxidation. Thus, we suggest that fatty acyltransferases not only directly control the fatty acid composition in glycerolipids through their preferential incorporation of fatty acids into glycerol backbone, but also indirectly monitor fatty acyl pools that they use.
Example VII Amino acid sequence of prophetic GPAT I (SEQ ID NO:3)
MGVΕKKGTMMSELDYTKAQLAFFYIVVLLSLDMLNPVTUFLHWPAIKSWHIATFAIACMSYIFIVN
LRELLYF ATKXΦFHSILSffFTSTDVTVVGRENIPSHGPVIFTSNHANQFMDGLMIMCTCQRTISYLVADKSWNR
PπGHLAWMMGGλΦVKRAQDSACKGTGKISIDLNALAGSDAVrNVVGKGTSFTSQIKAGDKIRLPNNAIGIK
VESIESDESMSLKVEDGVAEVLSSHPFPEYVTYDILPRIDQKDVYQNVLEKLASGGTIGIFPEGGSHDRTDLLP LKVGVALIAYSELEKDGINVPIVP VGLNYFRAHRFRGKATVEFGSPTYIEPSTLAD YKKGGADKRRVCNDLL
ARIENSMRSVIVSVPDFETLQTIHAARRLYRQDGRNETAEQRQDMGRRFAEGYKRVLLQLGGEPPEEWLSL QSRILAYQKELNELGIRDYQWGLDHEEVELGSESQGHSKADTVLHRMNVFGHIVHLFVIAVLAALPAMLL NLPVGLASRIYSNRRRKVALAASKVKVKGYD VMLSERVLACIVLVPSLWVVYGLLLSLFTSLDGPSLA VCFT
CFPLFSYWSIMATESGMVDIKDLRP YVMRMIPSARRYDVSSDATRKALRSDLRAMIKKIGPSLGDIYYEKDL NWQKIQMETKRMSMEELDPAQKDEAAKKEE
Example VIII Amino acid sequence of prophetic GPAT II (SEQ ID NO:4)
MGVEKKGTMMSELDYTKAQLAFFYIWLLSLDMLNPVKIFLHVFP AIKSWHIATF AIACMSYIFIVN LRELLYF ATKVFFHSILSIFFNDVTWGRENIPSHGPVIFTSNHANQFMDGLMIMCTCQRTISYLV ADKSWNR PIIGHLAWMMGGVPX^KRAQDSACKGTGKISroLNALAGSDAVrNVVGKGTSFTSQIKAGDKIRLPNNAIGIK VESIESDESMSLKVEDGVAEVLSSHPFPEYVTYDILPRIDQKDVYQNVLEKLASGGTIGIFPEGGSHDRTDLLP LKVGVALIAYSELEKDGINVPIVPVGLNYFRAHRFRGKATVEFGSPTYIEPSTLAD YKKGG ADKRRVCNDLL ARIENSMRSVIVSVPDFETLQTIHAARRLYRQDGRNETAEQRQDMGRRFAEGYKRVLLQLGGEPPEEWLSL QSRILAYQKELNELGIRDYQWGLDHEEVELGSESQGHSKADTVLHRMNVFGHIVHLFVIAVLAALPAMLL
NLPVGLASRiYSNRRRKV ALAASKVKVKGYD VMLSERVLACIVLVPSLWWYGLLLSLFTSLDGPSLAVCFT
CFPLFSYWSIMATESGMVDIKDLRP YVMRMIPSARRRKTSELNRRKALRSDLRAMIKKIGPSLGDIYYEKDL NWQKIQMETKRMSMEELDPAQKDEAAKKEE
Example IX
Amino acid sequence of prophetic GPAT III (SEQ ID NO:5)
MGVEKKGTMMMELWPGA WTALLQLLLLLLSTLWFCSSSAKYFFKMAFYSWHIATFAIACMSYIFI VNLRELLYF ATKVFFHSILSIFFND VTVVGRENIPSHGPVIFTSNHANQFMDGLMIMCTCQRP VRFLMAEKSF QRPVIGHLAWMMGGWVKRAQDSACKGTGKISIDLNALAGSDAVINVVGKGTSFTSQIKAGDKIRLPNNAIS WGVPGNAKCRAQ VSRITSDEEVELSSHPFPEYVTYDILPRIDQKD VYQNVLEKLASGGTIGIFPEGGSHDRTD
LLPLKVGV ALIAYSELEKDGINVPIVPVGLNYFRAHRFRGKATVEFGSPTYIEPSTLAD YKKGGADKRRVCN DLLARIENSMRSVIVSVPDFETLQTIHAARRLYRQDGRNETAEQRQDMGRRFAEGYKRVLLQLGGEPPEEW LSLQSRILAYQKELNELGIRDYQWGLDHEEVELGSESQGHSKADTVLHRMNVFGHIVHLFVIAVLAALPAM LLNLPVGLASRiYSNRRRKVALAASKVKVKGYD VMLSERVLACΓVLVPSLWWYGLLLSLFTSLDGPSLAV CFTCFPLFSYWSDvIATESGMX^IKDLRPYVMRMIPSARRRLAALPATRKALRSDLRARSRSSGPSLGDrYYEK DLNWQKIQMETKRMSMEELDPAQKDEAAKKEE
Example X
Amino acid sequence of prophetic GPAT IV (SEQ ID NO:6) MGVEKKGTMMSELDYTKAQLAFMP APKLTEKF ASSKKSTQKHVFPAIKSWHIATFAIACMSYIFIV
NLRELL YF ATKVFFHSILSIFFND VTWGRENIPSHGPVIFTSNHANQFMDGLMIMCTCQRP VRFLMAEKSFQ RPVIGHLA WMMGGVP VKRAQDSACKGTGKISIDLNALAGSDA VINWGKGTSFTSQIKAGDKIRLPNNAIS WGVPGNAKCRAQVSRITSDEEVELSSHPFPEYVTYDILPRIDQKD VYQNVLEKLASGGTIGIFPEGGSHDRTD LLPLKVGVALIAYSELEKDGINVPΓVPVGLNYFRAHRFRGKATVEFGSPTYIEPSTLAD YKKGGADKRRVCN DLLARIENSMRSVΓVSVPDFETLQΉHAARRLYRQDGRNETAEQRQDMGRRF AEGYKRVLLQLGGEPPEEW LSLQSRILA YQKELNELGIRDYQWGLDHEEVELGSESQGHSKADTVLHRMNVFGHIVHLFVIA VLAALP AM LLNLPVGLASRiYSNRRRKVALAASKVKVKGYD VMLSERVLACΓVLVPSLWWYGLLLSLFTSLDGPSLAV
CFTCFPLFSYWSIMATESGMVDIKDLRP YVMRMIPSARRRLAALP ATRKALRSDLRARSRSSGPSLGDIYYEK DLNWQKIQMETKRMSMEELDPAQKDEAAKKEE Example XI Amino acid sequence of prophetic GPAT V (SEQ ID NO:7)
MGVEKKGTMMSELD YTKAQLAFFYIWLLSLDMLNP VKIFLHVFPAIKSWHIATFAIACMSYIFIVN LRELLYF ATKVFFHSILSIFFND VTVVGRENIPSHGPVIFTSNHANQFMDGLMIMCTCQRTISYLVADKSWNR PIIGHLAWMMGGVPVKRAQDSACKGTGKISIDLNALAGSDA VINWGKGTSFTSQIKAGDKIRLPNNAIGIK
VESIESDESMSLKVEDGVAEVLSSHPFPEYVTYDILPRIDQKDVYQNVLEKLASGGTIGIFPEGGSHDRTDLLP LKVGVALIAYSELEKDGINVPIVPVGLNYFRAHRFRGKATVEFGSPTYIEPSTLAD YKKGGADKRRVCNDLL ARIENSMRSVIVSVPDFETLQTIHAARRLYRQDGRNETAEQRQDMGRRFAEGYKRVLLQLGGEPPEEWLSL QSRILAYQKELNELGIRDYQWGLDHEEVELGSESQGHSKADTVLHRMNVFGHIVΉLFVIAVLAALPAMLL NLPVGLASRIYSNRRRKVALAASKVKVKGYDVMLSERVLACIVL VPSLWWYGLLLSLFTSLDGPSLAVCFT
CFPLFSYWSIMATEIGMDGFKSLRPLVLSLTSPARRRLAALP ATRKALRSDLRAMIKKIGPSLGDIYYEKDLN WQKIQMETKRMSMEELDPAQKDEAAKKEE
Example XII A first prophetic nucleotide sequence of T. pseudonana GPAT (SEQ ID NO:8)
ATGGGUGTCGAGAAAAAAGGAACGATGATGTCCGAGTTGGACTATACGAAGGCACAACTCG CCTTCTTCTACATCGTCGTCCTTCTATCACTCGATATGCTCAACCCAGTCAAGATCTTTTTACACGTCT TTCCTGCAATTAAGTCATGGCACATCGCGACATTTGCAATTGCCTGCATGTCATACATCTTCATCGTG ' AACTTGAGGGAACTGCTATACTTCGCTACCAAGGTCITCTTCCATTCAATCCTATCAATCTTTTTCAAC GACGTGACCGTGGTTGGCAGAGAGAATATCCCGAGCCATGGCCCTGTTATCTTTACCTCCAACCACG cfAATCAGTTTATGGATGGGTTGATGATTATGTGTACTTGCCAAAGGACGATCTCGTATCTTGTAGCA GACAAGTCTTGGAATAGACCAATCATTGGGCATCTGGCTTGGATGATGGGGGGAGTGCCAGTCAAAC GTGCACAAGATAGTGCCTGTAAAGGAACTGGAAAAATCAGCATTGACTTGAACGCTCTCGCGGGATC GGATGCAGTCATCAATGTCGTTGGAAAGGGAACATCGTTCACGTCTCAGATAAAAGCCGGGGATAAG ATTCGCCTACCAAACAATGCAATCGGCATCAAAGTTGAATCTATCGAAAGTGATGAATCAATGTCGC TCAAAGTGGAAGATGGTGTGGCTGAAGTATTATCATCCCATCCATTTCCTGAGTACGTCACATACGAT ATTCTGCCTCGAATTGATCAGAAGGACGTCTACCAAAATGTACTGGAGAAACTAGCATCAGGCGGGA CGATTGGAATCTTTCCAGAGGGTGGCTCCCACGATAGGACTGACTTGCTCCCATTGAAAGTTGGTGTG GCACTCATTGCATACTCGGAACTTGAAAAGGATGGAATCAACGTGCCGATTGTCCCAGTTGGATTGA ACTACTTTCGGGCTCATCGCTTCCGTGGCAAAGCAACTGTTGAGTTTGGTTCTCCAACTTATATTGAA CCATCGACACTTGCAGACTACAAAAAGGGAGGTGCCGATAAGCGACGCGTTTGCAATGATCTTTTGG CTCGTATTGAGAACAGTATGAGATCTGTCATTGTGTCGGTGCCCGACTTTGAAACACTTCAGACCATC CATGCTGCGAGGAGGCTATACAGACAAGATGGCAGAAACGAAACTGCTGAACAAAGGCAGGACATG GGCAGGCGATTTGCAGAGGGGTACAAACGCGTTCTTCTCCAATTAGGAGGAGAGCCGCCAGAGGAG TGGCTCAGTCTGCAGTCGAGGATATTGGCGTACCAAAAGGAATTGAACGAGCTCGGTATCAGGGACT ATCAGGTTGTTGGTCTTGATCACGAGGAGGTGGAACTCGGTTCAGAGTCGCAAGGTCATTCCAAAGC AGATACTGTTCTTCACAGGATGAATGTGTTTGGACACATCGTTCATCTGTTTGTCATTGCGGTCTTGGC AGCACTGCCAGCTATGTTGTTAAACCTTCCAGTTGGGTTGGCATCACGAATCTACTCCAATCGTAGGC GAAAGGTTGCATTGGCAGCATCAAAAGTGAAGGTGAAGGGATATGATGTGATGCTCTCAGAACGTGT ACTGGCATGTATCGTTCTCGTTCCTTCTCTGTGGGTAGTGTATGGATTGCTTCTCTCCCTGTTCACCTC TCTCGACGGACCGTCACTTGCTGTATGCTTCACCTGCTTTCCTTTGTTCTCATATTGGAGTATTATGGC TACGGAATCAGGAATGGTTGATATCAAAGATTTGAGGCCGTACGTTATGAGAATGATTCCATCAGCA CGACGCAGGTTAGCAGCATTGCCAGCAACGAGGAAGGCTCTCCGGTCGGATCTTAGAGCAATGATTA AGAAGATTGGCCCCAGCTTGGGTGATATTTACTACGAAAAGGACTTGAACTGGCAGAAGATTCAAAT GGAGACGAAGAGGATGTCAATGGAGGAGTTGGATCCAGCTCAAAAAGACGAAGCAGCGAAGAAGG AAGAGTAA
Example XIII A second prophetic nucleotide sequence of T. pseudonana GPAT (SEQ ID NO:9) ATGGGUGTCGAGAAAAAAGGAACGATGATGTCCGAGTTGGACTATACGAAGGCACAACTCG
CCTTCTTCTACATCGTCGTCCTTCTATCACTCGATATGCTCAACCCAGTCAAGATCITTIT ACACGTCT TTCCTGCAATTAAGTCATGGCACATCGCGACATTTGCAATTGCCTGCATGTCATACATCTTCATCGTG AACTTGAGGGAACTGCTATACΠTCGCTACCAAGGTCTTCTTCCATTCAATCCTATCAATCTTTTTCAAC GACGTGACCGTGGTTGGCAGAGAGAATATCCCGAGCCATGGCCCTGTTATCTTTACCTCCAACCACG CTAATCAGTTTATGGATGGGTTGATGATTATGTGTACTTGCCAAAGGACGATCTCGTATCTTGTAGCA GACAAGTCTTGGAATAGACCAATCATTGGGCATCTGGCTTGGATGATGGGGGGAGTGCCAGTCAAAC GTGCACAAGATAGTGCCTGTAAAGGAACTGGAAAAATCAGCATTGACTTGAACGCTCTCGCGGGATC GGATGCAGTCATCAATGTCGTTGGAAAGGGAACATCGTTCACGTCTCAGATAAAAGCCGGGGATAAG ATTCGCCTACCAAACAATGCAATCGGCATCAAAGTTGAATCTATCGAAAGTGATGAATCAATGTCGC TCAAAGTGGAAGATGGTGTGGCTGAAGTATTATCATCCCATCCATTTCCTGAGTACGTCACATACGAT ATTCTGCCTCGAATTGATCAGAAGGACGTCTACCAAAATGTACTGGAGAAACTAGCATCAGGCGGGA CGATTGGAATCTTTCCAGAGGGTGGCTCCCACGATAGGACTGACTTGCTCCCATTGAAAGTTGGTGTG GCACTCATTGCATACTCGGAACTTGAAAAGGATGGAATCAACGTGCCGATTGTCCCAGTTGGATTGA ACTACTTTCGGGCTCATCGCTTCCGTGGCAAAGCAACTGTTGAGTTTGGTTCTCCAACTTATATTGAA CCATCGACACTTGCAGACTACAAAAAGGGAGGTGCCGATAAGCGACGCGTTTGCAATGATCTTTTGG CTCGTATTGAGAACAGTATGAGATCTGTCATTGTGTCGGTGCCCGACTTTGAAACACTTCAGACCATC CATGCTGCGAGGAGGCTATACAGACAAGATGGCAGAAACGAAACTGCTGAACAAAGGCAGGACATG GGCAGGCGATTTGCAGAGGGGTACAAACGCGTTCTTCTCCAATTAGGAGGAGAGCCGCCAGAGGAG TGGCTCAGTCTGCAGTCGAGGATATTGGCGTACCAAAAGGAATTGAACGAGCTCGGTATCAGGGACT ATCAGGTTGTTGGTCTTGATCACGAGGAGGTGGAACTCGGTTCAGAGTCGCAAGGTCATTCCAAAGC AGATACTGTTCTTCACAGGATGAATGTGTTTGGACACATCGTTCATCTGTTTGTCATTGCGGTCTTGGC AGCACTGCCAGCTATGTTGTTAAACCTTCCAGTTGGGTTGGCATCACGAATCTACTCCAATCGTAGGC GAAAGGTTGCATTGGCAGCATCAAAAGTGAAGGTGAAGGGATATGATGTGATGCTCTCAGAACGTGT ACTGGCATGTATCGTTCTCGTTCCTTCTCTGTGGGTAGTGTATGGATTGCTTCTCTCCCTGTTCACCTC TCTCGACGGACCGTCACTTGCTGTATGCTTCACCTGCTTTCCTTTGTTCTCATATTGGAGTATTATGGC TACGGAATCAGGAATGGTTGATATCAAAGATTTGAGGCCGTACGTTATGAGAATGATTCCATCAGCA CGACGCAGGTTAGCAGCATTGCCAGCAACGAGGAAGGCTCTCCGGTCGGATCTTAGAGCAATGATTA AGAAGATTGGCCCCAGCTTGGGTGATATTTACTACGAAAAGGACTTGAACTGGCAGAAGATTCAAAT GGAGACGAAGAGGATGTCAATGGAGGAGTTGGATCCAGCTCAAAAAGACGAAGCAGCGAAGAAAG AGGAATAA
Example XIV A nucleotide sequence of prophetic GPATI (SEQ ID NO: 10)
ATGGGCGTTGAAAAGAAGGGCACAATGATGTCCGAGTTGGACTATACGAAGGCACAACTCGCC TTCTTCTACATCGTCGTCCΠTCΓATCACTCGATATGCTCAACCCAGTCAAGATCTTΓITACACGTCTTTCC TGCAATTAAGTCATGGCACATCGCGACATTTGCAATTGCCTGCATGTCATACATCTTCATCGTGAACTTG AGGGAACTGCTATACTTCGCTACCAAGGTCTTCITCCATTCAATCCΓATCAATCTTTTTCAACGACGTGA CCGTGGTTGGCAGAGAGAATATCCCGAGCCATGGCCCTGTTATCTTTACCTCCAACCACGCTAATCAGT TTATGGATGGGTTGATGATTATGTGTACTTGCCAAAGGACGATCTCGTATCTTGTAGCAGACAAGTCTT GGAATAGACCAATCATTGGGCATCTGGCTTGGATGATGGGGGGAGTGCCAGTCAAACGTGCACAAGAT AGTGCCTGTAAAGGAACTGGAAAAATCAGCATTGACTTGAACGCTCTCGCGGGATCGGATGCAGTCAT CAATGTCGTTGGAAAGGGAACATCGTTCACGTCTCAGATAAAAGCCGGGGATAAGATTCGCCTACCAA ACAATGCAATCGGCATCAAAGTTGAATCTATCGAAAGTGATGAATCAATGTCGCTCAAAGTGGAAGAT GGTGTGGCTGAAGTATTATCATCCCATCCATTTCCTGAGTACGTCACATACGATATTCTGCCTCGAATTG ATCAGAAGGACGTCTACCAAAATGTACTGGAGAAACTAGCATCAGGCGGGACGATTGGAATCTTTCCA GAGGGTGGCTCCCACGATAGGACTGACTTGCTCCCATTGAAAGTTGGTGTGGCACTCATTGCATACTCG GAACTTGAAAAGGATGGAATCAACGTGCCGATTGTCCCAGTTGGATTGAACTACTTTCGGGCTCATCGC TTCCGTGGCAAAGCAACTGTTGAGTTTGGTTCTCCAACTTATATTGAACCATCGACACTTGCAGACTAC AAAAAGGGAGGTGCCGATAAGCGACGCGTTTGCAATGATCTTTTGGCTCGTATTGAGAACAGTATGAG ATCTGTCATTGTGTCGGTGCCCGACTTTGAAACACTTCAGACCATCCATGCTGCGAGGAGGCTATACAG ACAAGATGGCAGAAACGAAACTGCTGAACAAAGGCAGGACATGGGCAGGCGATTTGCAGAGGGGTAC AAACGCGTTCTTCTCCAATTAGGAGGAGAGCCGCCAGAGGAGTGGCTCAGTCTGCAGTCGAGGATATT GGCGTACCAAAAGGAATTGAACGAGCTCGGTATCAGGGACTATCAGGTTGTTGGTCTTGATCACGAGG AGGTGGAACTCGGTTCAGAGTCGCAAGGTCATTCCAAAGCAGATACTGTTCTTCACAGGATGAATGTGT TTGGACACATCGTTCATCTGTTTGTCATTGCGGTCTTGGCAGCACTGCCAGCTATGTTGTTAAACCTTCC AGTTGGGTTGGCATCACGAATCTACTCCAATCGTAGGCGAAAGGTTGCATTGGCAGCATCAAAAGTGA AGGTGAAGGGATATGATGTGATGCTCTCAGAACGTGTACTGGCATGTATCGTTCTCGTTCCTTCTCTGTG GGTAGTGTATGGATTGCTTCTCTCC(-TGTTCACCTCTCTCGACGGACCGTCACTTGCTGTATGCTTCACCT GCTTTCCTΓTGTTCTCATATTGGAGTATTATGGCTACGGAATCAGGAATGGTTGATATCAAAGATTTGAG GCCGTACGTTATGAGAATGATTCCATCAGCACGACGCTACGATGTATCATCGGATGCAACGAGGAAGG CTCTCCGGTCGGATCTTAGAGc AATGATTAAGAAGATTGGCCCCAGCTTGGGTGATATTTACΓACGAAA
AGGACTTGAACTGGCAGAAGATTCAAATGGAGACGAAGAGGATGTCAATGGAGGAGTTGGATCCAGCT CAAAAAGACGAAGCAGCGAAGAAGGAAGAGTAA Example XV A nucleotide sequence of prophetic GPATII (SEQ ID NO:11)
ATGGGCGTTGAAAAGAAGGGCACAATGATGTCCGAGTTGGACTATACGAAGGCACAACTCGCC TTCΓTCTACATCGTCGTCCTTCTATCACTCGATATGCTCAACCCAGTCAAGATCI'ITIT ACACGTCTTTCC TGCAATTAAGTCATGGCACATCGCGACATTTGCAATTGCCTGCATGTCATACATCTTCATCGTGAACTTG AGGGAACTGCTATACTTCGCTACCAAGGTCTTCITCCATTCAATCCTATCAATCTTTTTCAACGACGTGA CCGTGGTTGGCAGAGAGAATATCCCGAGCCATGGCCCTGTTATCTTTACCTCCAACCACGCTAATCAGT TTATGGATGGGTTGATGATTATGTGTACTTGCCAAAGGACGATCTCGTATCTTGTAGCAGACAAGTCTT GGAATAGACCAATCATTGGGCATCTGGCTTGGATGATGGGGGGAGTGCCAGTCAAACGTGCACAAGAT AGTGCCTGTAAAGGAACTGGAAAAATCAGCATTGACTTGAACGCTCTCGCGGGATCGGATGCAGTCAT CAATGTCGTTGGAAAGGGAACATCGTTCACGTCTCAGATAAAAGCCGGGGATAAGATTCGCCTACCAA ACAATGCAATCGGCATCAAAGTTGAATCTATCGAAAGTGATGAATCAATGTCGCTCAAAGTGGAAGAT GGTGTGGCTGAAGTATTATCATCCCATCCATTTCCTGAGTACGTCACATACGATATTCTGCCTCGAATTG ATCAGAAGGACGTCTACCAAAATGTACTGGAGAAACTAGCATCAGGCGGGACGATTGGAATCTTTCCA GAGGGTGGCTCCCACGATAGGACTGACTTGCTCCCATTGAAAGTTGGTGTGGCACTCATTGCATACTCG GAACTTGAAAAGGATGGAATCAACGTGCCGATTGTCCCAGTTGGATTGAACTACTTTCGGGCTCATCGC TTCCGTGGCAAAGCAACTGTTGAGTTTGGTTCTCCAACTTATATTGAACCATCGACACTTGCAGACTAC AAAAAGGGAGGTGCCGATAAGCGACGCGTTTGCAATGATCΓTTTGGCTCGTATTGAGAACAGTATGAG ATCTGTCATTGTGTCGGTGCCCGACTTTGAAACACTTCAGACCATCCATGCTGCGAGGAGGCTATACAG ACAAGATGGCAGAAACGAAACTGCTGAACAAAGGCAGGACATGGGCAGGCGATTTGCAGAGGGGTAC AAACGCGTTCTTCTCCAATTAGGAGGAGAGCCGCCAGAGGAGTGGCTCAGTCTGCAGTCGAGGATATT GGCGTACCAAAAGGAATTGAACGAGCTCGGTATCAGGGACTATCAGGTTGTTGGTCTTGATCACGAGG AGGTGGAACTCGGTTCAGAGTCGCAAGGTCATTCCAAAGCAGATACTGTTCTTCACAGGATGAATGTGT TTGGACACATCGTTCATCT'GTTTGTCATTGCGGTCTTGGCAGCACTGCCAGCTATGTTGTTAAACCTTCC AGTTGGGTTGGCATCACGAATCTACTCCAATCGTAGGCGAAAGGTTGCATTGGCAGCATCAAAAGTGA AGGTGAAGGGATATGATGTGATGCΓCTCAGAACGTGTACTGGCATGTATCGTTCTCGTTCCTTCTCTGTG GGTAGTGTATGGATTGCTTCTCTCCCTGTTCACCTCTCTCGACGGACCGTCACTTGCTGTATGCTTCACCT GCTTTCCΓTTGTTCΓCATATTGGAGTATTATGGCTACGGAATCAGGAATGGTTGATATCAAAGATTTGAG GCCGTACGTTATGAGAATGATTCCATCAGCACGACGCCGTAAAACATCAGAGTTAAACAGGAGGAAGG CTCTCCGGTCGGATCTTAGAGCAATGATTAAGAAGATTGGCCCCAGCTTGGGTGATATTTACTACGAAA AGGACTTGAACTGGCAGAAGATTCAAATGGAGACGAAGAGGATGTCAATGGAGGAGTTGGATCCAGCT CAAAAAGACGAAGCAGCGAAGAAGGAAGAGTAA
Example XVI Preparation of nucleic acid molecules for use in plant transformation
The full length coding region of the TpGPAT gene was amplified using pfu DNA polymerase and primers designed with two restriction sites (Kpnl and Xbal) added for subsequent cloning. Then, the PCR product was digested and inserted in a plant transformation vector (pSE129A) under the control of a seed-specific promoter (Napin). The binary vector was introduced by electroporation into Agrobacterium tumefaciens strain GV3101 containing helper plasmid pMP90 (Koncz and Schell, 1986).
Example XVII
Use of TpGPAT to increase yield and modify the composition of oilseed produced from two oilseed crops; Arabidopsis thaliana and Brassica napus Wild-type A. thaliana (ecotype Columbia) were subjected to Agrobacteήum-meάiated transformation by the floral dip method using the A. tumefaciens carrying the TpGPAT gene under the control of the Napin promoter produced in Example XVI. (Clough and Bent, 1998). Seeds from Agrobacterium transformed plants were then plated on selective medium and kanamycin resistant Tl plants were transferred to soil and their genotype characterized. DNA was isolated from 150 mg of Arabidopsis leaf material. Plants that contained the insertion (napin:TpGPAT:nos) cassette were identified by PCR amplification of genomic DNA, and the T2 seeds were harvested for fatty acid composition analysis. More than half of the identified transgenic lines (GW) showed an increase of 16:0 compared to the non-transformed control (WT). (FIG. 5). Since not all T2 seeds are homozygous for the transgene, it is anticipated that homozygous T3 seeds will have exhibit a further change in 16 O compared to wild-type seeds Total oil content in T2 seeds from TpGPAT transgenic Arabidopsis lines also increased (FIG 7) The absolute increase values ranged
Figure imgf000018_0001
6%
Biassica napus 5-day-old hypocotyls were also transformed with Agrobactenum containing the TpGPA T/pSEl29A construct Transgenic TO plants were regenerated, selected for resistance to kanamycin and grown in soil Individual plants were bagged to allow self-pollination Presence of the TpGPA T and Kan genes in the resistant plants was verified by PCR with the appropπate primers in 18 independent events Tl seeds from the first set of 5 transgenic events were harvested and analyzed (FIG 6) Tl seeds showed increased 16 0 percentage with
4 64-6 67% among the transgenic plants versus 4 27-4 64% for wild-type plants Given that Tl B napus seeds are a segregation population, it is expected that the effect of the TpGPAT gene on controlling 16 0 level in T2 homozygous seeds will be increased
Example XVIII Use of TpGPATl to produce ethanol and biodiesel U S Patent 5,578,472 to Ueda et al and U S Patent 7,135,308 to Bush et al , the contents of the entirety of each of which are incorporated herein by this reference, descnbe a process for the production of ethanol by harvesting starch-accumulating filament-forming or colony-forming algae to form a biomass, initiating cellular decay of the biomass in a dark and anaerobic environment, fermenting the biomass in the presence of a yeast, and the isolating the ethanol produced Bush et al further relates to processing of the biomass remaining after ethanol production to recovering biodiesel starting materials and/or generation of heat and carbon dioxide via combustion Algal cells overexpressing the TpGPATl gene as described herein are used in the process of Bush et al to produce ethanol and biodiesel
For instance, as descπbed in Bush et al , hpids/oils, which are useful for forming biodiesel typically, remain in the biomass after it has been subjected to fermentation, and the fermentation solution has been removed These hpids/oils are isolated from the biomass and then used to form biodiesel using methods known to form biodiesel A convenient method of separating hpids/oils from the biomass is by pressure For example, the biomass can be pressed and the resulting hpid-πch liquid separated
Thus, a process for forming biodiesel starting materials comprises recovering the hpids/oils remaining in the biomass after fermentation and ethanol separating This process can further comprise converting the recovered hpids/oils into biodiesel For instance, U S Patent Application 20070048848 to Sears et al (March 1, 2007), the contents of the entirety of which are incorporated by this reference, descnbe a "Method, apparatus and system for biodiesel production from algae " See, also, separating oil from the algal cells and processing it into diesel using standard transestenfication technologies such as the Connemann process (see, eg , U S Patent 5,354,878, the entire contents of which are incorporated herein by this reference) Tablel.
Table 1. Fatty acid composition of the lipids from yeast gat /mutants transformed with the TpGPATl and pYES2.1 empty vector pYES2.1.
Proportion of Fatty Acid (mol [%)
Lipid fraction 16:0 16:1 18:0 18:1 Sats Unsats
TAG
TpGPATl 41.80±2.17 29.15+1.61 9.1711.22 18.94±0.99 50.97+2.85 48.49±2.44 pYES2.1 23.53±4.33 42.58±4.48 5.86+0.78 26.91±1.41 29.39±4.94 69.93±5.55
Phospholipids
TpGPATl 31.10±3.78 34.15±2.74 8.92+1.49 25.45±2.25 40.02±4.57 59.83±4.61 pYES2.1 19.34+2.06 41.69+1.13 5.53±0.79 33.19+2.56 24.87+1.30 74.97±1.42
Yeast cells were harvested after 3 -day induction with 2% galactose. Values, expressed as mol % of total fatty acids represent the average ± SD for three replicates.
Table2.
Table 2. Incorporation of EPA or DHA into TAGs and phospholipids yeast gαtl mutants transformed with the TpGPATl and pYES2.1. mol% of FA in
Feeding mol% of FA in TAGS Phospholipids concentration Construct EPA DHA EPA DHA
50 μM TpGPATl 1.18 0.70±0.06 0.42±0.01 0.22+0.03 pYES2.1 1.51 0.65+0.19 0.51 0.17±0.01
100 μM TpGPATl 3.38±0.78 1.10±0.07 0.85±0.15 0.34+O.02 pYES2.1 3.60±1.94 1.37+0.05 1.12±0.40 0.28±0.04
Yeast cells were harvested after 3-day induction with 2% galactose in the presence of EPA or DHA. Values, expressed as mol% of total fatty acids represent the average ± SD for three replicates.
REFERENCES (the contents of each of which are incorporated herein by this reference)
1 Guschina, LA, and Harwood, J L (2006) Lipids and lipid metabolism in eukaryotic algae Prog Lipid Res 45, 160-186
2 Brent, M T , apd Miller-Navarra, D (1997) The role of highly unsaturated fatty acids in aquatic foodweb processes Freshwater Biology 38,483-499
3 Tonon, T , Harvey, D , Larson, T R , and Graham, LA (2002) Long chain polyunsaturated fatty acid production and partitioning to tπacylglycerols in four microalgae Phytochemistry 61, 15-24
4 Tonon T, Qing R, Harvey D, Li Y, Larson T R, and Graham LA (2005) Identification of a long-chain polyunsaturated fatty acid acyl-coenzyme A synthetase from the diatom T pseudonana Plant Physiol 138, 402-408
5 Zheng Z , and Zou J (2001) The initial step of the glycerolipid pathway identification of glycerol 3-phosphate/dihydroxyacetone phosphate dual substrate acyltransferases in Saccharomyces cerevisiae J Biol Chem. 276(45) 41710-41716
6 Bradford Mhrl (1976) A rapid and sensitive method for the quantification of microgram quantities of protein utilizing the principle of protein-dye binding Anal Biochem 72 248-254
7 Schneiter, R and Daum, G (2005) Extraction of yeast lipids Methods MoI Biol , 313, 41-46
8 Santiago T C, Zufferey R, Mehra R S, Coleman R A, and Mamoun C B (2004) The Plasmodium falciparum PfGatp is an endoplasmic reticulum membrane protein important for the initial step of malarial glycerolipid synthesis J Biol Chem 279 9222-9232 9 Zufferey R, and Mamoun C B (2005) The initial step of glycerolipid metabolism in Leishmania major promastigotes involves a single glycerol-3-phosphate acyltransferase enzyme important for the synthesis of tπacylglycerol but not essential for virulence MoI Microbial 56 800-810 17 10 Le win TM, Wang P, Coleman RA (1999) Analysis of ammo acid motifs diagnostic for the sn-glycerol-3 -phosphate acyltransferase reaction Biochemistry 38 5764-5771 1 1 Zaremberg V, and McMaster C R (2002) Differential partitioning of lipids metabolized by separate yeast glycerol-3-phosphate acyltransferases reveals that phosphohpase D generation of phosphatide acid mediates sensitivity to choline-containing lysolipids and drugs J Biol Chem. 277 39035-39044
12 Zheng Z, Xia Q, Dauk M, Shen W, Selvaraj G, and Zou J (2003) Arabidopsis AtGPATl, a member of the membrane-bound glycerol-3-phosphate acyltransferase gene family, is essential for tapetum differentiation and male fertility Plant Cell 15 1872-1887
13 Cao, J , Lib J L , Li, D , Tobin, J F , Gimeno, R E (2006) Molecular identification of microsomal acyl-CoA glycerol-3-phosphate acyltransferase, a key enzyme in de novo tπacylglycerol synthesis Proc Natl Acad Sci U S A 103 19695-19700
14 Koncz, C , and Schell, J (1986) The promoter of TL-DNA gene 5 controls the tissue-specific expression of chimaeπc genes earned by a novel type of Agrobacteπum vector MoI Gen Genet 204 383-396
15 Clough, S J , and Bent, A F (1998) Floral dip a simplified method for Agrobactenum-mediated transformation of Arabidopsis thahana Plant J 16 735-743
16 Zheng Z , and Zou J (2001) The initial step of the glycerolipid pathway identification of glycerol 3-phosphate/dihydroxyacetone phosphate dual substrate acyltransferases in Saccharomyces cerevisiae J Biol Chem 276(45) 41710-41716
These references are all hereby incorporated by this reference in their entirety

Claims

CLAIMS What is claimed is
1 An isolated, purified or recombinantly produced polypeptide composing a sequence having at least 50% sequence identity to the sequence of SEQ ID NO 2, wherein the polypeptide further comprises a sequence having at least 90% identity to the sequence of SEQ ID NO 28, a sequence having at least 90% identity to the sequence of SEQ ID NO 29, a sequence having at least 90% identity to the sequence of SEQ ID NO 30, and a sequence having at least 90% identity to the sequence of SEQ ID NO 31
2 The isolated, purified or recombinantly produced polypeptide of claim 1, wherein the polypeptide consists of the amino acid sequence of SEQ ID NO 2
3 The isolated, purified or recombinantly produced polypeptide of claim 1 having glycerol-3-acyltransferase activity
4 An isolated or purified nucleic acid sequence encoding the isolated, purified or recombinantly produced polypeptide of claim 1
5 The nucleic acid sequence of claim 4, wherein the nucleic acid sequence is present in a vector
6 A transgenic plant including the isolated or purified nucleic acid sequence of claim 4
7 A transgenic plant including the isolated or purified nucleic acid sequence of claim 4, wherein the plant has altered levels of palmitate oils as compared to levels in a plant lacking the nucleic acid sequence
8 A yeast cell transformed with the isolated or purified nucleic acid sequence of claim 4
9 An algal cell transformed with the isolated or purified nucleic acid sequence of claim 4
10 A method of altering levels of high-palmitate oils in a plant, the method comprising introducing into the plant a nucleic acid composing a polynucleotide encoding a polypeptide having at least 90% sequence identity to a polypeptide consisting of SEQ ID NO 2
11 The method according to claim 10, wherein the nucleic acid construct is introduced into the plant by
Agi obactenum-mediated transformation
12. The method according to claim 10, the method further comprising: introducing a polynucleotide encoding a polypeptide with Brassica pyruvate dehydrogenase kinase activity into the plant.
13. The method according to claim 10, the method further comprising: introducing a polynucleotide encoding a polypeptide with diacylglycerol acetyltransferase activity.
14. The method according to claim 10, the method further comprising: introducing a polynucleotide encoding a polypeptide with glycerol-3-phosphate dehydrogenase activity.
15. The method according to claim 10, wherein the plant is selected from the group consisting of Arabidopsis thaliana, Borago spp., Canola, Ricinus spp., Theobroma spp., Zea spp., Gossypium spp, Crambe spp., Cuphea spp., Linum spp., Lesquerella spp., Limnanthes spp., Linola, Tropaeolum spp., Oenothera spp., Olea spp., Elaeis spp., Arachis spp., rapeseed, Carthamus spp., Glycine spp., Soja spp., Helianthus spp., Nicotiana spp., Vernonia spp., Triticum spp., Hordeum spp., Oryza spp., Avena spp., Sorghum spp., Secale spp., Brassicaceae, and other members of the plant family Gramineae.
16. A plant produced by the method according to claim 10.
17. A seed harvested from the plant of claim 16.
18. Oil extracted from the plant of claim 16.
19. The method according to claim 10, further comprising: harvesting a seed from the plant including the nucleic acid construct; and extracting oil from the harvested seed.
20. In a process of producing biodiesel from algal cells, the improvement comprising: using, as an algal cell in the process, the algal cell of claim 9.
PCT/US2009/001912 2008-03-26 2009-03-26 Algal glycerol-3 phosphate acyltransferase Ceased WO2009120366A2 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
CA2717940A CA2717940C (en) 2008-03-26 2009-03-26 Algal glycerol-3-phosphate acyltransferase
US12/736,170 US20110093983A1 (en) 2008-03-26 2009-03-26 Algal glycerol-3 phosphate acyltransferase

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US7208308P 2008-03-26 2008-03-26
US61/072,083 2008-03-26

Publications (2)

Publication Number Publication Date
WO2009120366A2 true WO2009120366A2 (en) 2009-10-01
WO2009120366A3 WO2009120366A3 (en) 2009-12-30

Family

ID=41114538

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2009/001912 Ceased WO2009120366A2 (en) 2008-03-26 2009-03-26 Algal glycerol-3 phosphate acyltransferase

Country Status (3)

Country Link
US (1) US20110093983A1 (en)
CA (1) CA2717940C (en)
WO (1) WO2009120366A2 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9228175B2 (en) 2006-12-13 2016-01-05 National Research Counsel Of Canada Genes encoding a novel type of lysophophatidylcholine acyltransferases and their use to increase triacylglycerol production and/or modify fatty acid composition
US10487344B2 (en) 2015-09-11 2019-11-26 Kao Corporation Method of producing fatty acids or lipids by using acyltransferase

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN118703465A (en) * 2024-07-08 2024-09-27 安阳工学院 Application of cotton glycerol-3-phosphate acyltransferase GhGPAT23 and its gene in regulating plant seed oil content

Family Cites Families (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE4209779C1 (en) * 1992-03-26 1993-07-15 Oelmuehle Leer Connemann Gmbh & Co., 2950 Leer, De
DE69427144T2 (en) * 1993-09-27 2001-10-11 Mitsubishi Jukogyo K.K., Tokio/Tokyo Process and system for producing ethanol from microalgae
US6256636B1 (en) * 1997-11-26 2001-07-03 International Business Machines Corporation Object server for a digital library system
US7015373B1 (en) * 1998-12-17 2006-03-21 National Research Council Of Canada Diacylglycerol acyltransferase gene from plants
US7112724B1 (en) * 1999-09-22 2006-09-26 National Research Council Of Canada Transgenic manipulation of sn-glycerol-3-phosphate and glycerol production with a feedback defective glycerol-3-phosphate dehydrogenese gene
US6500760B1 (en) * 2001-08-02 2002-12-31 Sandia Corporation Gold-based electrical interconnections for microelectronic devices
WO2003025165A1 (en) * 2001-09-21 2003-03-27 National Research Council Of Canada Higher plant cytosolic er-based glycerol-3-phosphate acyltransferase genes
US7214859B2 (en) * 2002-08-16 2007-05-08 National Research Council Of Canada Brassica pyruvate dehydrogenase kinase gene
EP1613746B1 (en) * 2003-03-31 2013-03-06 University Of Bristol Novel plant acyltransferases specific for long-chained, multiply unsaturated fatty acids
US7192762B2 (en) * 2004-11-04 2007-03-20 E. I. Du Pont De Nemours And Company Mortierella alpina glycerol-3-phosphate o-acyltransferase for alteration of polyunsaturated fatty acids and oil content in oleaginous organisms
EP1928994A2 (en) * 2005-08-25 2008-06-11 Solix Biofuels, Inc. Method, apparatus and system for biodiesel production from algae

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9228175B2 (en) 2006-12-13 2016-01-05 National Research Counsel Of Canada Genes encoding a novel type of lysophophatidylcholine acyltransferases and their use to increase triacylglycerol production and/or modify fatty acid composition
US10487344B2 (en) 2015-09-11 2019-11-26 Kao Corporation Method of producing fatty acids or lipids by using acyltransferase

Also Published As

Publication number Publication date
CA2717940C (en) 2019-08-13
WO2009120366A3 (en) 2009-12-30
CA2717940A1 (en) 2009-10-01
US20110093983A1 (en) 2011-04-21

Similar Documents

Publication Publication Date Title
US8658855B2 (en) Diacylglycerol acyltransferase 2 genes and proteins encoded thereby from algae
US6476294B1 (en) Plant phosphatidic acid phosphatases
Xu et al. Cloning and characterization of an acyl‐CoA‐dependent diacylglycerol acyltransferase 1 (DGAT1) gene from Tropaeolum majus, and a study of the functional motifs of the DGAT protein using site‐directed mutagenesis to modify enzyme activity and oil content
AU779969B2 (en) Diacylglycerol acyltransferase gene from plants
CA2671674C (en) Genes encoding a novel type of lysophophatidylcholine acyltransferases and their use to increase triacylglycerol production and/or modify fatty acid composition
Kim et al. Structurally divergent lysophosphatidic acid acyltransferases with high selectivity for saturated medium chain fatty acids from Cuphea seeds
Payá-Milans et al. Sunflower HaGPAT9-1 is the predominant GPAT during seed development
US10865421B2 (en) Acyltransferases and methods of using
US20040043449A1 (en) Glycerol-3-phosphate/dihydroxyacetone phosphate dual substrate acyltransferases
CA2717940C (en) Algal glycerol-3-phosphate acyltransferase
US8101818B2 (en) Enhancement of hydroxy fatty acid accumulation in oilseed plants
US20100024078A1 (en) Diacylglycerol acyltransferases from flax
Sun et al. Cloning and characterization of a cDNA encoding type 1 diacylglycerol acyltransferase from sunflower (Helianthus annuus L.)
Rahman et al. IDENTIFICATION AND FUNCTIONAL VALIDATION OF DIACYLGLYCEROL ACYLTRANSFERASES OF AVOCADO
Zhang Recombinant expression of plant diacylglycerol acyltransferases from tissues that accumulate saturated fatty acids
Cahoon et al. Acyltransferases and methods of using
MXPA00002972A (en) Plant phosphatidicacid phosphatases

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 09724664

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 2717940

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 12736170

Country of ref document: US

122 Ep: pct application non-entry in european phase

Ref document number: 09724664

Country of ref document: EP

Kind code of ref document: A2