WO2008145675A2 - Transgenic plants with increased stress tolerance and yield - Google Patents
Transgenic plants with increased stress tolerance and yield Download PDFInfo
- Publication number
- WO2008145675A2 WO2008145675A2 PCT/EP2008/056553 EP2008056553W WO2008145675A2 WO 2008145675 A2 WO2008145675 A2 WO 2008145675A2 EP 2008056553 W EP2008056553 W EP 2008056553W WO 2008145675 A2 WO2008145675 A2 WO 2008145675A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- amino acids
- plant
- sequence
- plants
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8271—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
- C12N15/8273—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for drought, cold, salt resistance
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A40/00—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production
- Y02A40/10—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production in agriculture
- Y02A40/146—Genetically Modified [GMO] plants, e.g. transgenic plants
Definitions
- This invention relates generally to transgenic plants which overexpress nucleic acid sequences encoding polypeptides capable of conferring increased stress tolerance and consequently, increased plant growth and crop yield, under normal or abiotic stress conditions. Additionally, the invention relates to novel isolated nucleic acid sequences encoding polypeptides that confer upon a plant increased tolerance under abiotic stress conditions, and/or increased plant growth and/or increased yield under normal or abiotic stress conditions.
- Crop yield is defined herein as the number of bushels of relevant agricultural product (such as grain, forage, or seed) harvested per acre. Crop losses and crop yield losses of major crops such as soybean, rice, maize (corn), cotton, and wheat caused by these stresses represent a significant economic and political factor and contribute to food shortages in many underdeveloped countries.
- WUE has been defined and measured in multiple ways. One approach is to calculate the ratio of whole plant dry weight, to the weight of water consumed by the plant throughout its life. Another variation is to use a shorter time interval when biomass accumulation and water use are measured. Yet another approach is to use measurements from restricted parts of the plant, for example, measuring only aerial growth and water use.
- WUE also has been defined as the ratio of CO2 uptake to water vapor loss from a leaf or portion of a leaf, often measured over a very short time period (e.g. seconds/minutes).
- An increase in WUE is informative about the relatively improved efficiency of growth and water consumption, but this information taken alone does not indicate whether one of these two processes has changed or both have changed. In selecting traits for improving crops, an increase in WUE due to a decrease in water use, without a change in growth would have particular merit in an irrigated agricultural system where the water input costs were high.
- plant size as measured by total plant dry weight, above-ground dry weight, above-ground fresh weight, leaf area, stem volume, plant height, rosette diameter, leaf length, root length, root mass, tiller number, and leaf number.
- Plant size at an early developmental stage will typically correlate with plant size later in development. A larger plant with a greater leaf area can typically absorb more light and carbon dioxide than a smaller plant and therefore will likely gain a greater weight during the same period. This is in addition to the potential continuation of the micro-environmental or genetic advantage that the plant had to achieve the larger size initially.
- Newly generated stress tolerant plants and/or plants with increased water use efficiency will have many advantages, such as an increased range in which the crop plants can be cultivated, by for example, decreasing the water requirements of a plant species.
- Other desirable advantages include increased resistance to lodging, the bending of shoots or stems in response to wind, rain, pests, or disease.
- the present inventors have discovered that transforming a plant with certain polynucleotides results in enhancement of the plant' s growth and response to environmental stress, and accordingly the yield of the agricultural products of the plant is increased, when the polynucleotides are present in the plant as transgenes.
- the polynucleotides capable of mediating such enhancements have been isolated from Physcomitrella patens, Hordeum vulgare, Brassica napus, Linum usitatissimum, Orzya sativa, Helianthus annuus, Triticum aestivum, and Glycine max and are listed in Table 1 , and the sequences thereof are set forth in the Sequence Listing as indicated in Table 1.
- Table 1 Table 1
- the invention provides a transgenic plant transformed with an expression cassette comprising an isolated polynucleotide encoding a CBL- interacting protein kinase having a sequence as set forth in SEQ ID NO:2.
- the invention provides a transgenic plant transformed with an expression cassette comprising an isolated polynucleotide encoding a 14-3-3 protein having a sequence as set forth in SEQ ID NO:4.
- the invention provides a transgenic plant transformed with an expression cassette comprising an isolated polynucleotide encoding a RING H2 zinc finger protein or a RING H2 zinc finger protein domain.
- the invention provides a transgenic plant transformed with an expression cassette comprising an isolated polynucleotide encoding a GTP binding protein or a GTP binding protein domain.
- the invention provides a seed produced by the transgenic plant of the invention, wherein the seed is true breeding for a transgene comprising the polynucleotide described above. Plants derived from the seed of the invention demonstrate increased tolerance to an environmental stress, and/or increased plant growth, and/or increased yield, under normal or stress conditions as compared to a wild type variety of the plant.
- the invention provides products produced by or from the transgenic plants of the invention, their plant parts, or their seeds, such as a foodstuff, feedstuff, food supplement, feed supplement, cosmetic or pharmaceutical. [0020] The invention further provides the isolated polynucleotides identified in Table
- the invention is also embodied in recombinant vector comprising an isolated polynucleotide of the invention.
- the invention concerns a method of producing the aforesaid transgenic plant, wherein the method comprises transforming a plant cell with an expression vector comprising an isolated polynucleotide of the invention, and generating from the plant cell a transgenic plant that expresses the polypeptide encoded by thepolynucleotide. Expression of the polypeptide in the plant results in increased tolerance to an environmental stress, and/or growth, and/or yield under normal or stress conditions as compared to a wild type variety of the plant.
- the invention provides a method of increasing a plant' s tolerance to an environmental stress, and/or growth, and/or yield.
- the method comprises the steps of transforming a plant cell with an expression cassette comprising an isolated polynucleotide of the invention, and generating a transgenic plant from the plant cell, wherein the transgenic plant comprises the polynucleotide.
- Figure 1 is an alignment of EST462 of P. patens with the known CBL- interacting protein kinases identified in Table 2.
- Figure 2 is an alignment of EST329 of P. patens with the known 14-3-3 proteins identified in Table 3.
- Figure 3 is an alignment of EST373 with the known RING H2 zinc finger proteins identified in Table 4.
- Figures 4A and 4B contain an alignment of EST548 with the known GTP binding proteins identified in Table 5.
- the invention provides a transgenic plant that overexpresses an isolated polynucleotide identified in Table 1 , or a homolog thereof.
- the transgenic plant of the invention demonstrates an increased tolerance to an environmental stress as compared to a wild type variety of the plant.
- the overexpression of such isolated nucleic acids in the plant may optionally result in an increase in plant growth or in yield of associated agricultural products, under normal or stress conditions, as compared to a wild type variety of the plant.
- the increased tolerance to an environmental stress, increased growth, and/or increased yield of a transgenic plant of the invention is believed to result from an increase in water use efficiency of the plant.
- a "transgenic plant” is a plant that has been altered using recombinant DNA technology to contain an isolated nucleic acid which would otherwise not be present in the plant.
- the term " plant” includes a whole plant, plant cells, and plant parts. Plant parts include, but are not limited to, stems, roots, ovules, stamens, leaves, embryos, meristematic regions, callus tissue, gametophytes, sporophytes, pollen, microspores, and the like.
- the transgenic plant of the invention may be male sterile or male fertile, and may further include transgenes other than those that comprise the isolated polynucleotides described herein.
- variety refers to a group of plants within a species that share constant characteristics that separate them from the typical form and from other possible varieties within that species. While possessing at least one distinctive trait, a variety is also characterized by some variation between individuals within the variety, based primarily on the Mendelian segregation of traits among the progeny of succeeding generations. A variety is considered " true breeding" for a particular trait if it is genetically homozygous for that trait to the extent that, when the true-breeding variety is self-pollinated, a significant amount of independent segregation of the trait among the progeny is not observed.
- the trait arises from the transgenic expression of one or more isolated polynucleotides introduced into a plant variety.
- wild type variety refers to a group of plants that are analyzed for comparative purposes as a control plant, wherein the wild type variety plant is identical to the transgenic plant (plant transformed with an isolated polynucleotide in accordance with the invention) with the exception that the wild type variety plant has not been transformed with an isolated polynucleotide in accordance with the invention.
- nucleic acid and " polynucleotide” are interchangeable and refer to RNA or DNA that is linear or branched, single or double stranded, or a hybrid thereof. The term also encompasses RNA/DNA hybrids.
- An " isolated" nucleic acid molecule is one that is substantially separated from other nucleic acid molecules which are present in the natural source of the nucleic acid (i.e., sequences encoding other polypeptides). For example, a cloned nucleic acid is considered isolated.
- a nucleic acid is also considered isolated if it has been altered by human intervention, or placed in a locus or location that is not its natural site, or if it is introduced into a cell by transformation.
- an isolated nucleic acid molecule such as a cDNA molecule
- the term " environmental stress” refers to a sub-optimal condition associated with salinity, drought, nitrogen, temperature, metal, chemical, pathogenic, or oxidative stresses, or any combination thereof.
- water use efficiency and “ WUE” refer to the amount of organic matter produced by a plant divided by the amount of water used by the plant in producing it, i.e., the dry weight of a plant in relation to the plant' s water use.
- dry weight refers to everything in the plant other than water, and includes, for example, carbohydrates, proteins, oils, and mineral nutrients.
- transgenic plant of the invention may be a dicotyledonous plant or a monocotyledonous plant.
- transgenic plants of the invention may be derived from any of the following diclotyledonous plant families: Leguminosae, including plants such as pea, alfalfa and soybean; Umbelliferae, including plants such as carrot and celery; Solanaceae, including the plants such as tomato, potato, aubergine, tobacco, and pepper; Cruciferae, particularly the genus Brassica, which includes plant such as oilseed rape, beet, cabbage, cauliflower and broccoli); and Arabidopsis thaliana; Compositae, which includes plants such as lettuce; Malvaceae, which includes cotton; Fabaceae, which includes plants such as peanut, and the like.
- Transgenic plants of the invention may be derived from monocotyledonous plants, such as, for example, wheat, barley, sorghum, millet, rye, triticale, maize, rice, oats, switchgrass, miscanthus and sugarcane.
- Transgenic plants of the invention are also embodied as trees such as apple, pear, quince, plum, cherry, peach, nectarine, apricot, papaya, mango, and other woody species including coniferous and deciduous trees such as poplar, pine, sequoia, cedar, oak, willow, and the like.
- Arabidopsis thaliana are also embodied as trees such as apple, pear, quince, plum, cherry, peach, nectarine, apricot, papaya, mango, and other woody species including coniferous and deciduous trees such as poplar, pine, sequoia, cedar, oak, willow, and the like.
- one embodiment of the invention is a transgenic plant transformed with an expression cassette comprising an isolated polynucleotide encoding a CBL-interacting protein kinase.
- the calcineurin B-like protein interacting protein kinase (CIPK) family of proteins represents a family of calcium dependent serine-threonine protein kinases.
- CIPKs have a two-domain structure consisting of a highly conserved N-terminal catalytic kinase domain and a less conserved C-terminal domain. It is this C-terminal domain that interacts with calcineurin B-like proteins (CBLs).
- the CIPK and CBL proteins interact directly in a calcium dependent manner to form a complex, which provides a regulatory mechanism for translating cellular calcium signals.
- a class of CIPKs has been identified distinguished by containing a minimum 24 amino acid protein interaction module that is both necessary and sufficient to mediate the interaction of CIPK and CBL proteins. This motif has been designated the NAF domain because of the characteristic asparagine, alanine, and phenylalanine residues it contains.
- An additional layer of regulation has been proposed for the NAF containing CIPK proteins by calcium dependent reversible membrane association following myristylation.
- the transgenic plant of this embodiment may comprise any polynucleotide encoding a CBL-interacting protein kinase having a sequence comprising amino acids 1 to 449 of SEQ ID NO:2.
- the transgenic plant of this embodiment may comprise a polynucleotide encoding a CBL-interacting protein kinase domain having a sequence comprising amino acids 21 to 293 of SEQ ID NO:2 or a NAF domain having a sequence comprising amino acids 315 to 376 of SEQ ID NO:2.
- the invention provides a transgenic plant transformed with an expression cassette comprising an isolated polynucleotide encoding a 14-3-3 protein.
- the 14-3-3 family of proteins form highly conserved dimeric proteins. They bind a diverse set of cellular proteins, over 200 of which are known to date.
- the structure of each monomer of 14-3-3 proteins consists of nine alpha helicies arranged in an antiparallel bundle creating a groove, which binds a phosphorylated ligand.
- the 14-3-3 proteins themselves can also be regulated by phosphorylation, dimerization, cAMP, and Ca ++ ions.
- the dimeric form of 14-3-3 proteins can accommodate two ligands, one in each groove of the monomer; thereby, 14-3-3 proteins play a role in scaffolding diverse protein targets and modifying the structure of individual protein targets. Binding of 14-3-3 proteins has been demonstrated to alter enzymes in a reversible manner, activation or inactivation, and can alter proteins via stabilization or degradation.
- 14-3-3 proteins have a highly conserved central domain, and variable N- and
- the transgenic plant of this embodiment may comprise any polynucleotide encoding the 14-3-3 protein having the sequence comprising amino acids 1 to 257 of SEQ ID NO:4.
- the transgenic plant of this embodiment may comprise a polynucleotide encoding a 14-3-3 protein domain having a sequence comprising amino acids 6 to 243 of SEQ ID NO:4 or a C-terminal functional domain having a sequence comprising amino acids 245 to 258 of SEQ ID NO:4 [0039]
- one embodiment of the invention is a transgenic plant transformed with an expression cassette comprising a polynucleotide encoding a RING H2 zinc finger protein or a RING H2 zinc finger protein domain.
- One of the regulators of protein degradation via the ubiquitin/26S proteasome pathway in Eukaryotes is ubiquitin ligases, also referred to as E3 enzymes.
- E3 enzymes are responsible for recruiting the proteins that will be targeted for ubiquitination and thus act as the major substrate for the recognition component of the ubiquitination pathway.
- E3 ligases are grouped into 3 classes based upon the presence of a conserved domain.
- the RING type of E3 ligases can further be subdivided into simple and complex types.
- the simple type contains both the substrate-binding domain and the E2 binding RING domain in a single protein.
- the RING domain is similar to the zinc finger domain in containing cysteine and/or histidine to co- ordinate two zinc ions, but unlike a zinc finger, the RING domain functions as a protein- protein interaction domain.
- the canonical RING motif contains seven cysteines and one histidine.
- a family of C3H2C3/RING-H2 E3 ligases contains a substitution of the fifth cysteine for histidine. In Arabidopsis, this family of RING-H2 ligases has some evidence of being involved in growth regulator response, response to biotic stress, and plant development based upon elicitor and mutant studies.
- the transgenic plant of this embodiment may comprise any polynucleotide encoding a RING H2 zinc finger protein.
- the transgenic plant of this embodiment comprises a polynucleotide encoding a zinc finger, C3HC4 type domain having a sequence comprising amino acids 88 to 129 of SEQ ID NO:6; amino acids 98 to 139 of SEQ ID NO: 8; amino acids 121 to 162 of SEQ ID NO: 10; amino acids 123 to 164 of SEQ ID NO: 12; amino acids 84 to 125 of SEQ ID NO: 14; amino acids 117 to 158 of SEQ ID NO: 16; amino acids 80 to 121 of SEQ ID NO: 18.
- the transgenic plant of this embodiment comprises a polynucleotide encoding a RING H2 zinc finger protein having a sequence comprising amino acids 1 to381 of SEQ ID NO:6; amino aicds 1 to 199 of SEQ ID NO: 8; amino acids 1 to 268 of SEQ ID NO: 10; amino acids 1 to 278 of SEQ ID NO: 12; amino acids 1 to 320 of SEQ ID NO: 14; amino acids 1 to 219 of SEQ ID NO: 16; amino acids 1 to 177 of SEQ ID NO: 18.
- the invention provides a transgenic plant transformed with an expression cassette comprising an isolated polynucleotide encoding a GTP binding protein or a GTP binding protein domain.
- GTP proteins Monomeric/small G-proteins are involved in many different cellular processes and have been implicated in vesicle traffic/transport systems, cell cycle regulation, and protein import into organelles.
- GTP proteins When bound to a GTP nucleotide, GTP proteins activate cellular processes and become inactive when GTP is hydrolyzed to GDP.
- These proteins may be classified into five superfamilies based on structural and functional similarities: Ras, Rho/Rac/Cda42, Rab, Sar1/Arf, and Ran.
- Ras Ras, Rho/Rac/Cda42, Rab, Sar1/Arf, and Ran.
- members of only the Sari and Rab families of small G proteins are involved in vesicle trafficking in yeast and mammalian cells.
- Rab G proteins In plants, Rab G proteins have been shown to function in a manner similar to their yeast and mammalian counterparts. Rab G proteins regulate endocytic trafficking pathways and biosynthetic trafficking pathways.
- the transgenic plant of this embodiment may comprise any polynucleotide encoding a GTP binding protein.
- the transgenic plant of this embodiment comprises a polynucleotide encoding a Ras family domain having a sequence comprising amino acids 17 to 179 of SEQ ID NO:20; amino acids 21 to 182 of SEQ ID NO: 22; amino acids 19 to 179 of SEQ ID NO: 24; amino acids 17 to 179 of SEQ ID NO: 26; amino acids 19 to 179 of SEQ ID NO: 28; amino acids 19 to 179 of SEQ ID NO: 30; amino aics 22 to 193 of SEQ ID NO: 32; amino acids 19 to 179 of SEQ ID NO: 34; amino acids 22 to 193 of SEQ ID NO: 36; amino acids 22 to 193 of SEQ ID NO: 38; amino acids 22 to 193 of SEQ ID NO: 40; amino acids 19 to 179 of SEQ ID NO: 42; amino acids 22 to 193 of SEQ ID NO: 44; amino acids 10 to
- the transgenic plant of this embodiment comprises a polynucleotide encoding a GTP binding protein having a sequence comprising amino acids 1 to 216 of SEQ ID NO:20; amino acids 1 to 184 of SEQ ID NO: 22; amino acids 1 to 191 of SEQ ID NO: 24; amino acids 1 to 214 of SEQ ID NO: 26; amino acids 1 to 182 of SEQ ID NO: 28; amino acids 1 to 181 of SEQ ID NO: 30, amino acids 1 to 193 of SEQ ID NO: 32; amino acids 1 to 183 of SEQ ID NO: 34; amino acids 1 to 193 of SEQ ID NO: 36; amino acids 1 to 193 of SEQ ID NO: 38; amino acids 1 to 193 of SEQ ID NO: 40; amino acids 1 to 181 of SEQ ID NO: 42; amino acids 1 to 193 of SEQ ID NO: 44; amino acids 1 to 204 of SEQ ID NO: 46; amino acids 1 to 182 of SEQ ID NO: 48; amino acids 1 to 214 of SEQ ID NO:
- the invention further provides a seed produced by a transgenic plant expressing polynucleotide listed in Table 1 , wherein the seed contains the polynucleotide, and wherein the plant is true breeding for increased growth and/or yield under normal or stress conditions and/or increased tolerance to an environmental stress as compared to a wild type variety of the plant.
- the invention also provides a product produced by or from the transgenic plants expressing the polynucleotide, their plant parts, or their seeds.
- the product can be obtained using various methods well known in the art.
- the word " product” includes, but not limited to, a foodstuff, feedstuff, a food supplement, feed supplement, cosmetic or pharmaceutical.
- Foodstuffs are regarded as compositions used for nutrition or for supplementing nutrition.
- Animal feedstuffs and animal feed supplements, in particular, are regarded as foodstuffs.
- the invention further provides an agricultural product produced by any of the transgenic plants, plant parts, and plant seeds.
- Agricultural products include, but are not limited to, plant extracts, proteins, amino acids, carbohydrates, fats, oils, polymers, vitamins, and the like.
- an isolated polynucleotide of the invention comprises a polynucleotide having a sequence selected from the group consisting of the nucleotide sequences listed in Table 1. These polynucleotides may comprise sequences of the coding region, as well as 5' untranslated sequences and 3' untranslated sequences.
- a polynucleotide of the invention can be isolated using standard molecular biology techniques and the sequence information provided herein. For example, P. patens cDNAs of the invention were isolated from a P. patens library using a portion of the sequence disclosed herein.
- Synthetic oligonucleotide primers for polymerase chain reaction amplification can be designed based upon the nucleotide sequence shown in Table 1.
- a nucleic acid molecule of the invention can be amplified using cDNA or, alternatively, genomic DNA, as a template and appropriate oligonucleotide primers according to standard PCR amplification techniques.
- the nucleic acid molecule so amplified can be cloned into an appropriate vector and characterized by DNA sequence analysis.
- oligonucleotides corresponding to the nucleotide sequences listed in Table 1 can be prepared by standard synthetic techniques, e.g., using an automated DNA synthesizer.
- Homologs are defined herein as two nucleic acids or polypeptides that have similar, or substantially identical, nucleotide or amino acid sequences, respectively. Homologs include allelic variants, analogs, and orthologs, as defined below. As used herein, the term “ analogs” refers to two nucleic acids that have the same or similar function, but that have evolved separately in unrelated organisms. As used herein, the term “ orthologs” refers to two nucleic acids from different species, but that have evolved from a common ancestral gene by speciation.
- homolog further encompasses nucleic acid molecules that differ from one of the nucleotide sequences shown in Table 1 due to degeneracy of the genetic code and thus encode the same polypeptide.
- a "natural occurring" nucleic acid molecule refers to an RNA or DNA molecule having a nucleotide sequence that occurs in nature (e.g., encodes a natural polypeptide).
- the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of one polypeptide for optimal alignment with the other polypeptide or nucleic acid).
- the amino acid residues at corresponding amino acid positions are then compared. When a position in one sequence is occupied by the same amino acid residue as the corresponding position in the other sequence then the molecules are identical at that position. The same type of comparison can be made between two nucleic acid sequences.
- the isolated amino acid homologs, analogs, and orthologs of the polypeptides of the present invention are at least about 50-60%, preferably at least about 60-70%, and more preferably at least about 70-75%, 75-80%, 80-85%, 85-90%, or 90-95%, and most preferably at least about 96%, 97%, 98%, 99%, or more identical to an entire amino acid sequence identified in Table 1.
- an isolated nucleic acid homolog of the invention comprises a nucleotide sequence which is at least about 40-60%, preferably at least about 60-70%, more preferably at least about 70-75%, 75-80%, 80-85%, 85-90%, or 90-95%, and even more preferably at least about 95%, 96%, 97%, 98%, 99%, or more identical to a nucleotide sequence shown in Table 1.
- the percent sequence identity between two nucleic acid or polypeptide sequences is determined using Align 2.0 (Myers and Miller, CABIOS (1989) 4:11-17) with all parameters set to the default settings or the Vector NTI 9.0 (PC) software package (Invitrogen, 1600 Faraday Ave., Carlsbad, CA92008).
- PC Vector NTI 9.0
- a gap opening penalty of 15 and a gap extension penalty of 6.66 are used for determining the percent identity of two nucleic acids.
- a gap opening penalty of 10 and a gap extension penalty of 0.1 are used for determining the percent identity of two polypeptides. All other parameters are set at the default settings.
- the gap opening penalty is 10
- the gap extension penalty is 0.05 with blosum62 matrix. It is to be understood that for the purposes of determining sequence identity when comparing a DNA sequence to an RNA sequence, a thymidine nucleotide is equivalent to a uracil nucleotide.
- Nucleic acid molecules corresponding to homologs, analogs, and orthologs of the polypeptides listed in Table 1 can be isolated based on their identity to said polypeptides, using the polynucleotides encoding the respective polypeptides or primers based thereon, as hybridization probes according to standard hybridization techniques under stringent hybridization conditions.
- stringent conditions refers to hybridization overnight at 60 0 C in 10X Denhart' s solution, 6X SSC, 0.5% SDS, and 100 ⁇ g/ml denatured salmon sperm DNA. Blots are washed sequentially at 62°C for 30 minutes each time in 3X SSC/0.1% SDS, followed by 1X SSC/0.1 % SDS, and finally 0.1X SSC/0.1 % SDS.
- stringent conditions refers to hybridization in a 6X SSC solution at 65°C.
- highly stringent conditions refers to hybridization overnight at 65°C in 10X Denhart' s solution, 6X SSC, 0.5% SDS and 100 ⁇ g/ml denatured salmon sperm DNA. Blots are washed sequentially at 65°C for 30 minutes each time in 3X SSC/0.1 % SDS, followed by 1 X SSC/0.1 % SDS, and finally 0.1 X SSC/0.1 % SDS. Methods for nucleic acid hybridizations are described in Meinkoth and Wahl, 1984, Anal. Biochem.
- an isolated nucleic acid molecule of the invention that hybridizes under stringent or highly stringent conditions to a nucleotide sequence listed in Table 1 corresponds to a naturally occurring nucleic acid molecule.
- an optimized nucleic acid encodes a polypeptide that has a function similar to those of the polypeptides listed in Table 1 and/or modulates a plant' s growth and/or yield under normal or water- limited conditions and/or tolerance to an environmental stress, and more preferably increases a plant' s growth and/or yield under normal or water-limited conditions and/or tolerance to an environmental stress upon its overexpression in the plant.
- optimized refers to a nucleic acid that is genetically engineered to increase its expression in a given plant or animal.
- the DNA sequence of the gene can be modified to: 1) comprise codons preferred by highly expressed plant genes; 2) comprise an A+T content in nucleotide base composition to that substantially found in plants; 3) form a plant initiation sequence; 4) to eliminate sequences that cause destabilization, inappropriate polyadenylation, degradation and termination of RNA, or that form secondary structure hairpins or RNA splice sites; or 5) elimination of antisense open reading frames.
- Increased expression of nucleic acids in plants can be achieved by utilizing the distribution frequency of codon usage in plants in general or in a particular plant.
- An isolated polynucleotide of the invention can be optimized such that its distribution frequency of codon usage deviates, preferably, no more than 25% from that of highly expressed plant genes and, more preferably, no more than about 10%.
- the invention further provides an isolated recombinant expression vector comprising a polynucleotide as described above, wherein expression of the vector in a host cell results in the plant' s increased growth and/or yield under normal or water-limited conditions and/or increased tolerance to environmental stress as compared to a wild type variety of the host cell.
- the recombinant expression vectors of the invention comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory sequences, selected on the basis of the host cells to be used for expression, which is operatively linked to the nucleic acid sequence to be expressed.
- operatively linked is intended to mean that the nucleotide sequence of interest is linked to the regulatory sequence(s) in a manner which allows for expression of the nucleotide sequence (e.g., in a bacterial or plant host cell when the vector is introduced into the host cell).
- regulatory sequence is intended to include promoters, enhancers, and other expression control elements (e.g., polyadenylation signals). Such regulatory sequences are well known in the art. Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cells and those that direct expression of the nucleotide sequence only in certain host cells or under certain conditions.
- the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression of polypeptide desired, etc.
- the expression vectors of the invention can be introduced into host cells to thereby produce polypeptides encoded by nucleic acids as described herein.
- Plant gene expression should be operatively linked to an appropriate promoter conferring gene expression in a timely, cell specific, or tissue specific manner.
- Promoters useful in the expression cassettes of the invention include any promoter that is capable of initiating transcription in a plant cell. Such promoters include, but are not limited to, those that can be obtained from plants, plant viruses, and bacteria that contain genes that are expressed in plants, such as Agrobacterium and Rhizobium.
- the promoter may be constitutive, inducible, developmental stage-preferred, cell type-preferred, tissue-preferred, or organ-preferred. Constitutive promoters are active under most conditions.
- constitutive promoters examples include the CaMV 19S and 35S promoters (Odell et al., 1985, Nature 313:810-812), the sX CaMV 35S promoter (Kay et al., 1987, Science 236:1299-1302) the Sep1 promoter, the rice actin promoter (McElroy et al., 1990, Plant Cell 2:163-171), the Arabidopsis actin promoter, the ubiquitan promoter (Christensen et al., 1989, Plant Molec. Biol. 18:675-689), pEmu (Last et al., 1991 , Theor. Appl. Genet.
- the figwort mosaic virus 35S promoter the Smas promoter (Velten et al., 1984, EMBO J 3:2723-2730), the super promoter (U.S. Patent No. 5, 955,646), the GRP1-8 promoter, the cinnamyl alcohol dehydrogenase promoter (U.S. Patent No. 5,683,439), promoters from the T-DNA of Agrobacterium, such as mannopine synthase, nopaline synthase, and octopine synthase, the small subunit of ribulose biphosphate carboxylase (ssuRUBISCO) promoter, and the like.
- ssuRUBISCO small subunit of ribulose biphosphate carboxylase
- Inducible promoters are preferentially active under certain environmental conditions, such as the presence or absence of a nutrient or metabolite, heat or cold, light, pathogen attack, anaerobic conditions, and the like.
- the hsp80 promoter from Brassica is induced by heat shock
- the PPDK promoter is induced by light
- the PR-1 promoters from tobacco, Arabidopsis, and maize are inducible by infection with a pathogen
- the Adh1 promoter is induced by hypoxia and cold stress.
- Plant gene expression can also be facilitated via an inducible promoter (For a review, see Gatz, 1997, Annu. Rev. Plant Physiol. Plant MoI. Biol. 48:89-108).
- Chemically inducible promoters are especially suitable if gene expression is wanted to occur in a time specific manner.
- Examples of such promoters are a salicylic acid inducible promoter (PCT Application No. WO 95/19443), a tetracycline inducible promoter (Gatz et al., 1992, Plant J. 2: 397-404), and an ethanol inducible promoter (PCT Application No. WO 93/21334).
- the inducible promoter is a stress-inducible promoter.
- stress-inducible promoters are preferentially active under one or more of the following stresses: sub-optimal conditions associated with salinity, drought, nitrogen, temperature, metal, chemical, pathogenic, and oxidative stresses.
- Stress inducible promoters include, but are not limited to, Cor78 (Chak et al., 2000, Planta 210:875-883; Hovath et al., 1993, Plant Physiol.
- KST1 Methyl-R ⁇ ber et al., 1995, EMBO 14:2409-16
- Rha1 Teryn et al., 1993, Plant Cell 5:1761-9; Terryn et al., 1992, FEBS Lett. 299(3):287-90
- ARSK1 Atkinson et al., 1997, GenBank Accession # L22302, and PCT Application No.
- Tissue and organ preferred promoters include those that are preferentially expressed in certain tissues or organs, such as leaves, roots, seeds, or xylem.
- tissue-preferred and organ-preferred promoters include, but are not limited to fruit-preferred, ovule-preferred, male tissue-preferred, seed-preferred, integument-preferred, tuber-preferred, stalk-preferred, pericarp-preferred, leaf-preferred, stigma-preferred, pollen-preferred, anther-preferred, petal-preferred, sepal-preferred, pedicel-preferred, silique-preferred, stem-preferred, root-preferred promoters, and the like. Seed-preferred promoters are preferentially expressed during seed development and/or germination.
- seed-preferred promoters can be embryo-preferred, endosperm-preferred, and seed coat-preferred (See Thompson et al., 1989, BioEssays 10:108).
- seed-preferred promoters include, but are not limited to, cellulose synthase (celA), Cim1 , gamma-zein, globulin-1 , maize 19 kD zein (cZ19B1), and the like.
- Other suitable tissue-preferred or organ-preferred promoters include the napin-gene promoter from rapeseed (U.S. Patent No.
- WO 91/13980 or the legumin B4 promoter (LeB4; Baeumlein et al., 1992, Plant Journal, 2(2): 233-9), as well as promoters conferring seed specific expression in monocot plants like maize, barley, wheat, rye, rice, etc.
- Suitable promoters to note are the Ipt2 or Ipt1-gene promoter from barley (PCT Application No. WO 95/15389 and PCT Application No. WO 95/23230) or those described in PCT Application No.
- WO 99/16890 promoters from the barley hordein-gene, rice glutelin gene, rice oryzin gene, rice prolamin gene, wheat gliadin gene, wheat glutelin gene, oat glutelin gene, Sorghum kasirin-gene, and rye secalin gene).
- promoters useful in the expression cassettes of the invention include, but are not limited to, the major chlorophyll a/b binding protein promoter, histone promoters, the Ap3 promoter, the ⁇ -conglycin promoter, the napin promoter, the soybean lectin promoter, the maize 15kD zein promoter, the 22kD zein promoter, the 27kD zein promoter, the g-zein promoter, the waxy, shrunken 1 , shrunken 2, and bronze promoters, the Zm13 promoter (U.S. Patent No. 5,086,169), the maize polygalacturonase promoters (PG) (U.S. Patent Nos.
- heterologous gene expression in plants may be obtained by using DNA binding domains and response elements from heterologous sources (i.e., DNA binding domains from non-plant sources).
- An example of such a heterologous DNA binding domain is the LexA DNA binding domain (Brent and Ptashne, 1985, Cell 43:729-736).
- the polynucleotides listed in Table 1 are expressed in plant cells from higher plants (e.g., the spermatophytes, such as crop plants).
- a polynucleotide may be " introduced" into a plant cell by any means, including transfection, transformation or transduction, electroporation, particle bombardment, agroinfection, and the like. Suitable methods for transforming or transfecting plant cells are disclosed, for example, using particle bombardment as set forth in U.S. Pat. Nos. 4,945,050; 5,036,006; 5,100,792; 5,302,523; 5,464,765; 5,120,657; 6,084,154; and the like. More preferably, the transgenic corn seed of the invention may be made using Agrobacterium transformation, as described in U.S. Pat. Nos.
- Transformation of soybean can be performed using for example a technique described in European Patent No. EP 0424047, U.S. Patent No. 5,322,783, European Patent No.EP 0397 687, U.S. Patent No. 5,376,543, or U.S. Patent No. 5,169,770.
- a specific example of wheat transformation can be found in PCT Application No. WO 93/07256.
- Cotton may be transformed using methods disclosed in U.S. Pat. Nos. 5,004,863; 5,159,135; 5,846,797, and the like.
- Rice may be transformed using methods disclosed in U.S. Pat. Nos. 4,666,844; 5,350,688; 6,153,813; 6,333,449;
- the introduced polynucleotide may be maintained in the plant cell stably if it is incorporated into a non-chromosomal autonomous replicon or integrated into the plant chromosomes.
- the introduced polynucleotide may be present on an extra-chromosomal non-replicating vector and may be transiently expressed or transiently active.
- Another aspect of the invention pertains to an isolated polypeptide having a sequence selected from the group consisting of the polypeptide sequences listed in Table 1.
- An " isolated” or “ purified” polypeptide is free of some of the cellular material when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized.
- the language "substanti free of cellular material” includes preparations of a polypeptide in which the polypeptide is separated from some of the cellular components of the cells in which it is naturally or recombinantly produced.
- the language "substanti free of cellular material” includes preparations of a polypeptide of the invention having less than about 30% (by dry weight) of contaminating polypeptides, more preferably less than about 20% of contaminating polypeptides, still more preferably less than about 10% of contaminating polypeptides, and most preferably less than about 5% contaminating polypeptides.
- the invention is also embodied in a method of producing a transgenic plant comprising at least one polynucleotide listed in Table 1 , wherein expression of the polynucleotide in the plant results in the plant' s increased growth and/or yield under normal or water-limited conditions and/or increased tolerance to an environmental stress as compared to a wild type variety of the plant comprising the steps of: (a) introducing into a plant cell an expression vector comprising at least one polynucleotide listed in Table 1 , and (b) generating from the plant cell a transgenic plant that expresses the polynucleotide, wherein expression of the polynucleotide in the transgenic plant results in the plant' s increased growth and/or yield under normal or water-limited conditions and/or increased tolerance to environmental stress as compared
- the plant cell may be, but is not limited to, a protoplast, gamete producing cell, and a cell that regenerates into a whole plant.
- transgenic refers to any plant, plant cell, callus, plant tissue, or plant part, that contains at least one recombinant polynucleotide listed in Table 1.
- the recombinant polynucleotide is stably integrated into a chromosome or stable extra-chromosomal element, so that it is passed on to successive generations.
- the present invention also provides a method of increasing a plant' s growth and/or yield under normal or water-limited conditions and/or increasing a plant' s tolerance to an environmental stress comprising the steps of increasing the expression of at least one polynucleotide listed in Table 1 in the plant. Expression of a protein can be increased by any method known to those of skill in the art. [0069] The effect of the genetic modification on plant growth and/or yield and/or stress tolerance can be assessed by growing the modified plant under less than suitable conditions and then analyzing the growth characteristics and/or metabolism of the plant.
- Such analysis techniques are well known to one skilled in the art, and include dry weight, wet weight, polypeptide synthesis, carbohydrate synthesis, lipid synthesis, evapotranspiration rates, general plant and/or crop yield, flowering, reproduction, seed setting, root growth, respiration rates, photosynthesis rates, etc., using methods known to those of skill in biotechnology.
- Canola, soybean, rice, maize, linseed, and wheat plants were grown under a variety of conditions and treatments, and different tissues were harvested at various developmental stages. Plant growth and harvesting were done in a strategic manner such that the probability of harvesting all expressable genes in at least one or more of the resulting libraries is maximized.
- the mRNA was isolated from each of the collected samples, and cDNA libraries were constructed. No amplification steps were used in the library production process in order to minimize redundancy of genes within the sample and to retain expression information. All libraries were 3' generated from mRNA purified on oligo dT columns. Colonies from the transformation of the cDNA library into E. coli were randomly picked and placed into microtiter plates.
- Plasmid DNA was isolated from the E. coli colonies and then spotted on membranes. A battery of 288 33 P radiolabeled 7-mer oligonucleotides were sequentially hybridized to these membranes. To increase throughput, duplicate membranes were processed. After each hybridization, a blot image was captured during a phosphorimage scan to generate a hybridization profile for each oligonucleotide. This raw data image was automatically transferred to a computer. Absolute identity was maintained by barcoding for the image cassette, filter, and orientation within the cassette. The filters were then treated using relatively mild conditions to strip the bound probes and returned to the hybridization chambers for another round of hybridization. The hybridization and imaging cycle was repeated until the set of 288 oligomers was completed. [0075] After completion of the hybridizations, a profile was generated for each spot
- the clones were sorted into various clusters based on their having identical or similar hybridization signatures.
- a cluster should be indicative of the expression of an individual gene or gene family.
- a by-product of this analysis is an expression profile for the abundance of each gene in a particular library.
- One-path sequencing from the 5' end was used to predict the function of the particular clones by similarity and motif searches in sequence databases.
- a fragment containing the P. patens polynucleotide was ligated into a binary vector containing a selectable marker gene.
- the resulting recombinant vector contained the corresponding gene in the sense orientation under the constitutive super promoter.
- the recombinant vectors were transformed into Agrobacterium tumefaciens C58C1 and PMP90 plants according to standard conditions.
- A. thaliana ecotype C24 plants were grown and transformed according to standard conditions. T1 plants were screened for resistance to the selection agent conferred by the selectable marker gene, and T1 seeds were collected.
- the P. patens polynucleotides were overexpressed in A. thaliana under the control of a constitutive promoter. T2 and/or T3 seeds were screened for resistance to the selection agent conferred by the selectable marker gene on plates, and positive plants were transplanted into soil and grown in a growth chamber for 3 weeks. Soil moisture was maintained throughout this time at approximately 50% of the maximum water-holding capacity of soil. [0081] The total water lost (transpiration) by the plant during this time was measured. After 3 weeks, the entire above-ground plant material was collected, dried at 65°C for 2 days and weighed. The ratio of above-ground plant dry weight (DW) to plant water use is water use efficiency (WUE).
- DW above-ground plant dry weight
- WUE water use efficiency
- Tables 40 through 43 present WUE and DW for independent transformation events (lines) of transgenic plants overexpressing the P. patens polynucleotides.
- LSM least square means
- P significant value
- A. thaliana lines overexpressing EST462 (SEQ ID NO:2).
- A. thaliana lines overexpressing EST548 (SEQ ID NO:20).
- Canola cotyledonary petioles of 4 day-old young seedlings are used as explants for tissue culture and transformed according to EP1566443.
- the commercial cultivar Westar (Agriculture Canada) is the standard variety used for transformation, but other varieties can be used.
- A. tumefaciens GV3101 :pMP90RK containing a binary vector is used for canola transformation.
- the standard binary vector used for transformation is pSUN (WO02/00900), but many different binary vector systems have been described for plant transformation (e.g. An, G. in Agrobacterium Protocols, Methods in Molecular Biology vol 44, pp 47-62, Gartland KMA and MR Davey eds.
- a plant gene expression cassette comprising a selection marker gene and a plant promoter regulating the transcription of the cDNA encoding the polynucleotide is employed.
- selection marker genes can be used including the mutated acetohydroxy acid synthase (AHAS) gene disclosed in US Pat. Nos. 5,767,366 and 6,225,105.
- a suitable promoter is used to regulate the trait gene to provide constitutive, developmental, tissue or environmental regulation of gene transcription.
- Canola seeds are surface-sterilized in 70% ethanol for 2 min, incubated for
- the explants are then cultured for 3 days on MS medium including vitamins containing 3.75 mg/l BAP, 3% sucrose, 0.5 g/l MES, pH 5.2, 0.5 mg/l GA3, 0.8% Oxoidagar at 24 0 C, 16 hours of light.
- the petiole explants are transferred to regeneration medium containing 3.75 mg/l BAP, 0.5 mg/l GA3, 0.5 g/l MES, pH 5.2, 300 mg/l timentin and selection agent until shoot regeneration.
- Seed is produced from the primary transgenic plants by self-pollination.
- the second-generation plants are grown in greenhouse conditions and self-pollinated.
- the plants are analyzed by qPCR using TaqMan probes to confirm the presence of T-DNA and to determine the number of T-DNA integrations.
- Homozygous transgenic, heterozygous transgenic and azygous (null transgenic) plants are compared for their stress tolerance, for example, in the assays described in Example 3, and for yield, both in the greenhouse and in field studies.
- Transgenic rice plants comprising a polynucleotide of the invention are generated using known methods. Approximately 15 to 20 independent transformants (TO) are generated. The primary transformants are transferred from tissue culture chambers to a greenhouse for growing and harvest of T1 seeds. Five events of the T1 progeny segregated 3:1 for presence/absence of the transgene are retained. For each of these events, 10 T1 seedlings containing the transgene (hetero- and homozygotes), and 10 T1 seedlings lacking the transgene (nullizygotes) are selected by visual marker screening. The selected T1 plants are transferred to a greenhouse. Each plant receives a unique barcode label to link unambiguously the phenotyping data to the corresponding plant.
- Transgenic plants and the corresponding nullizygotes are grown side-by-side at random positions. From the stage of sowing until the stage of maturity, the plants are passed several times through a digital imaging cabinet. At each time point digital, images (2048x1536 pixels, 16 million colours) of each plant are taken from at least 6 different angles.
- the polynucleotides of Tables 1 and 2 are transformed into soybean using the methods described in commonly owned copending international application number WO 2005/121345, the contents of which are incorporated herein by reference. [0090] The transgenic plants generated are then screened for their improved growth under water-limited conditions and/or drought, salt, and/or cold tolerance, for example, using the assays described in Example 3, and for yield, both in the greenhouse and in field studies.
- Transformation of wheat is performed with the method described by lshida et al., 1996, Nature Biotech. 14745-50. Immature embryos are co-cultivated with Agrobacterium tumefaciens that carry " super binary" vectors, and transgenic plants are recovered through organogenesis. This procedure provides a transformation efficiency between 2.5% and 20%. The transgenic plants are then screened for their improved growth and/or yield under water-limited conditions and/or stress tolerance, for example, is the assays described in Example 3, and for yield, both in the greenhouse and in field studies.
- Agrobacterium cells harboring the genes and the maize ahas gene on the same plasmid are grown in YP medium supplemented with appropriate antibiotics for 1 -3 days.
- a loop of Agrobacterium cells is collected and suspended in 1.5 ml M-LS-002 medium (LS-inf) and the tube containing Agrobacterium cells is kept on a shaker for 1-4 hours at 1 ,000 rpm.
- Corncobs [genotype J553x(HIIIAxA188)] are harvested at 7-12 days after pollination. The cobs are sterilized in 20% Clorox solution for 15 minutes followed by thorough rinse with sterile water. Immature embryos with size 0.8-2.0 mm are dissected into the tube containing Agrobacterium cells in LS-inf solution.
- Agro-infection is carried out by keeping the tube horizontally in the laminar hood at room temperature for 30 minutes. Mixture of the agro infection is poured on to a plate containing the co-cultivation medium (M-LS-011). After the liquid agro-solution is piped out, the embryos transferred to the surface of a filter paper that is placed on the agar co-cultivation medium. The excess bacterial solution is removed with a pipette. The embryos are placed on the co-cultivation medium with scutellum side up and cultured in the dark at 22°C for 2-4 days.
- M-LS-011 co-cultivation medium
- Embryos are transferred to M-MS-101 medium without selection. Seven to ten days later, embryos are transferred to M-LS-401 medium containing 0.50 ⁇ M imazethapyr and grown for 4 weeks (two 2-week transfers)to select for transformed callus cells. Plant regeneration is initiated by transferring resistant calli to M-LS-504 medium supplemented with 0.75 ⁇ M imazethapyr and grown under light at 25-27 0 C for two to three weeks. Regenerated shoots are then transferred to rooting box with M-MS-618 medium (0.5 ⁇ M imazethapyr). Plantlets with roots are transferred to potting mixture in small pots in the greenhouse and after acclimatization are then transplanted to larger pots and maintained in greenhouse till maturity.
- transgene expression is assayed using qRT-PCR of total RNA isolated from leaf samples.
- assays such as the assay described in Example 3
- each of these plants is uniquely labeled, sampled and analyzed for transgene copy number.
- Transgene positive and negative plants are marked and paired with similar sizes for transplanting together to large pots. This provides a uniform and competitive environment for the transgene positive and negative plants.
- the large pots are watered to a certain percentage of the field water capacity of the soil depending the severity of water-stress desired. The soil water level is maintained by watering every other day.
- Plant growth and physiology traits such as height, stem diameter, leaf rolling, plant wilting, leaf extension rate, leaf water status, chlorophyll content and photosynthesis rate are measured during the growth period. After a period of growth, the above ground portion of the plants is harvested, and the fresh weight and dry weight of each plant are taken. A comparison of the drought tolerance phenotype between the transgene positive and negative plants is then made. [0098] Using assays such as the assay described in Example 3, the pots are covered with caps that permit the seedlings to grow through but minimize water loss. Each pot is weighed periodically and water added to maintain the initial water content. At the end of the experiment, the fresh and dry weight of each plant is measured, the water consumed by each plant is calculated and WUE of each plant is computed.
- assays such as the assay described in Example 3
- Plant growth and physiology traits such as WUE, height, stem diameter, leaf rolling, plant wilting, leaf extension rate, leaf water status, chlorophyll content and photosynthesis rate are measured during the experiment. A comparison of WUE phenotype between the transgene positive and negative plants is then made.
- these pots are kept in an area in the greenhouse that has uniform environmental conditions, and cultivated optimally. Each of these plants is uniquely labeled, sampled and analyzed for transgene copy number. The plants are allowed to grow under theses conditions until they reach a predefined growth stage. Water is then withheld. Plant growth and physiology traits such as height, stem diameter, leaf rolling, plant wilting, leaf extension rate, leaf water status, chlorophyll content and photosynthesis rate are measured as stress intensity increases. A comparison of the dessication tolerance phenotype between transgene positive and negative plants is then made.
- a Taqman transgene copy number assay is used on leaf samples to differentiate the transgenics from null-segregant control plants. Plants that have been genotyped in this manner are also scored for a range of phenotypes related to drought-tolerance, growth and yield.
- phenotypes include plant height, grain weight per plant, grain number per plant, ear number per plant, above ground dry- weight, leaf conductance to water vapor, leaf CO2 uptake, leaf chlorophyll content, photosynthesis-related chlorophyll fluorescence parameters, water use efficiency, leaf water potential, leaf relative water content, stem sap flow rate, stem hydraulic conductivity, leaf temperature, leaf reflectance, leaf light absorptance, leaf area, days to flowering, anthesis-silking interval, duration of grain fill, osmotic potential, osmotic adjustment, root size, leaf extension rate, leaf angle, leaf rolling and survival. All measurements are made with commercially available instrumentation for field physiology, using the standard protocols provided by the manufacturers. Individual plants are used as the replicate unit per event.
- a null segregant is progeny (or lines derived from the progeny) of a transgenic plant that does not contain the transgene due to Mendelian segregation. Additional replicated paired plots for a particular event are distributed around the trial. A range of phenotypes related to drought-tolerance, growth and yield are scored in the paired plots and estimated at the plot level. When the measurement technique could only be applied to individual plants, these are selected at random each time from within the plot.
- phenotypes include plant height, grain weight per plant, grain number per plant, ear number per plant, above ground dry-weight, leaf conductance to water vapor, leaf CO2 uptake, leaf chlorophyll content, photosynthesis-related chlorophyll fluorescence parameters, water use efficiency, leaf water potential, leaf relative water content, stem sap flow rate, stem hydraulic conductivity, leaf temperature, leaf reflectance, leaf light absorptance, leaf area, days to flowering, anthesis-silking interval, duration of grain fill, osmotic potential, osmotic adjustment, root size, leaf extension rate, leaf angle, leaf rolling and survival. All measurements are made with commercially available instrumentation for field physiology, using the standard protocols provided by the manufacturers. Individual plots are used as the replicate unit per event. [00103] To perform multi-location testing of transgenic corn for drought tolerance and yield, five to twenty locations encompassing major corn growing regions are selected.
- Trial layout is designed to pair a plot containing a non-segregating transgenic event with an adjacent plot of null-segregant controls.
- a range of phenotypes related to drought-tolerance, growth and yield are scored in the paired plots and estimated at the plot level. When the measurement technique could only be applied to individual plants, these are selected at random each time from within the plot.
- phenotypes included plant height, grain weight per plant, grain number per plant, ear number per plant, above ground dry-weight, leaf conductance to water vapor, leaf CO2 uptake, leaf chlorophyll content, photosynthesis-related chlorophyll fluorescence parameters, water use efficiency, leaf water potential, leaf relative water content, stem sap flow rate, stem hydraulic conductivity, leaf temperature, leaf reflectance, leaf light absorptance, leaf area, days to flowering, anthesis-silking interval, duration of grain fill, osmotic potential, osmotic adjustment, root size, leaf extension rate, leaf angle, leaf rolling and survival. All measurements are made with commercially available instrumentation for field physiology, using the standard protocols provided by the manufacturers. Individual plots are used as the replicate unit per event.
- the EST 462 cDNA is translated into the following amino acid sequence (SEQ ID NO:2):
- the EST329 cDNA is translated into the following amino acid sequence (SEQ ID NO:4):
- the EST373 cDNA is translated into the following amino acid sequence (SEQ ID N0:6):
- the BN43173847cDNA is translated into the following amino acid sequence (SEQ ID NO:10):
- the BN46735603 cDNA is translated into the following amino acid sequence (SEQ ID N0:12):
- the GM52504443 cDNA is translated into the following amino acid sequence (SEQ ID NO:14):
- the GM47122590 cDNA is translated into the following amino acid sequence (SEQ ID NO:16):
- This cDNA is translated into the following amino acid sequence (SEQ ID NO:18): msatfivfvctnicgrlrggvesrmmyeiesridmeqpehhvndpesdpvlldaiptlkfnqeafsslehtqcvicladyrerevlr impkcghtfhlscidiwlrkqstcpvcrlplknssetkhvrpvtftmsqsldeshtsdrnddieryveptptaasnslqptsgeqea rq
- the EST 548 cDNA is translated into the following amino acid sequence (SEQ ID NO:20):
- the GM50181682 cDNA is translated into the following amino acid sequence (SEQ ID NO:22): mglweaflnwlrslffkqemelsliglqnagktslvnvvatggysedmiptvgfnmrkvtkgnvtiklwdlggqprfrsmwerycr avsaivyvvdaadpdnlsisrselhdllskpslggipllvlgnkidkagalskqaltdqmdlksitdrevccfrniscknstnidsvid wlvkhsksksks
- the HV62638446 cDNA is translated into the following amino acid sequence (SEQ ID NO:24):
- the HV62624858 cDNA is translated into the following amino acid sequence (SEQ ID NO:28):
- the LU61640267 cDNA is translated into the following amino acid sequence (SEQ ID NO:30):
- the LU61872929 cDNA is translated into the following amino acid sequence (SEQ ID NO:32):
- the LU61896092 cDNA is translated into the following amino acid sequence (SEQ ID NO:34):
- the LU61748785 cDNA is translated into the following amino acid sequence (SEQ ID NO:36):
- the OS34706416 cDNA is translated into the following amino acid sequence (SEQ ID NO:38):
- the GM49750953 cDNA is translated into the following amino acid sequence (SEQ ID NO:40):
- the HA66696606 cDNA is translated into the following amino acid sequence (SEQ ID NO:42):
- the HA66783477 cDNA is translated into the following amino acid sequence (SEQ ID NO:44):
- the HA66705690 cDNA is translated into the following amino acid sequence (SEQ ID NO:46):
- the TA59921546 cDNA is translated into the following amino acid sequence (SEQ ID NO:48):
- the HV62657638 cDNA is translated into the following amino acid sequence (SEQ ID NO:50):
- the BN43540204 cDNA is translated into the following amino acid sequence (SEQ ID NO:52):
- the BN45139744 cDNA is translated into the following amino acid sequence (SEQ ID NO:54):
- the BN43613585 cDNA is translated into the following amino acid sequence (SEQ ID NO:56): mgillvydvtdessfnsnfcfclsidifyfiyifalfwtcfldlvadirnwirnieqhasdnvnkilvgnkadmdeskravptskgqala deygikffetsaktnlnveevffsiakdikqrltdtdsraepatirisqtdqaagagqatqksaccgt
- the LU61965240 cDNA is translated into the following amino acid sequence (SEQ ID NO:58):
- the LU62294414 cDNA is translated into the following amino acid sequence (SEQ ID NO:60):
- the LU61723544 cDNA is translated into the following amino acid sequence (SEQ ID NO:62):
- the LU61871078 cDNA is translated into the following amino acid sequence (SEQ ID NO:64):
- the LU61569070 cDNA is translated into the following amino acid sequence (SEQ ID NO:66):
- the OS34999273 cDNA is translated into the following amino acid sequence (SEQ ID NO:68):
- the HA66779896 cDNA is translated into the following amino acid sequence (SEQ ID NO:70):
- the OS32667913 cDNA is translated into the following amino acid sequence (SEQ ID NO:72):
- the HA66453181 cDNA is translated into the following amino acid sequence (SEQ ID NO:74):
- the HA66709897 cDNA is translated into the following amino acid sequence (SEQ ID NO:76):
- the ABJ91230 amino acid sequence (SEQ ID NO:78):
- the ABJ91231 amino acid sequence (SEQ ID NO:79): msssrsggggggggggsgsktrvgryelgrtlgegnfakvkfarnvetkenvaikildkenvlkhkmigqi Vietnamesetmklirhpn vvrmyevmasktkiyivlqfvtggelfdkiaskgrlkedearkyfqqlicavdychsrgvyhrdlkpenllmdangilkvsdfglsa Ipqqvredgllhttcgtpnyvapevinnkgydgakadlwscgvilfvlmagylpfeeanlmalykkifkadftcppwfsssakkli krildpnpstritiaelienewfkkgykppafeqanvslddvnsifnesvdsrnlvverreegfigpmap
- NP_001058901 amino acid sequence SEQ ID NO:80:
- the BAD12177 amino acid sequence (SEQ ID NO:83):
- the BAD12176 amino acid sequence (SEQ ID NO:85):
- the AAC04811 amino acid sequence (SEQ ID NO:86):
- the Q9SP07 amino acid sequence (SEQ ID NO:87):
- the EST217 amino acid sequence (SEQ ID NO:88):
Landscapes
- Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Biophysics (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Cell Biology (AREA)
- Botany (AREA)
- Gastroenterology & Hepatology (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Peptides Or Proteins (AREA)
- Agricultural Chemicals And Associated Chemicals (AREA)
Abstract
Description
Claims
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| BRPI0812060-9A2A BRPI0812060A2 (en) | 2007-05-29 | 2008-05-28 | TRANSGENIC PLANT, INSULATED POLYNUCLEOTIDE, ISOLATED POLYPEPTIDE, AND METHODS FOR PRODUCING A TRANSGENIC PLANT AND FOR INCREASING PLANT GROWTH AND / OR INCREASE UNDER NORMAL OR WATER GROWTH AND / OR INCREASING PLANTS |
| DE112008001277T DE112008001277T5 (en) | 2007-05-29 | 2008-05-28 | Transgenic plants with increased stress tolerance and increased yield |
| AU2008257531A AU2008257531A1 (en) | 2007-05-29 | 2008-05-28 | Transgenic plants with increased stress tolerance and yield |
| US12/601,531 US20100199388A1 (en) | 2007-05-29 | 2008-05-28 | Transgenic Plants with Increased Stress Tolerance and Yield |
| CN200880017835A CN101679999A (en) | 2007-05-29 | 2008-05-28 | Transgenic plants with increased stress tolerance and yield |
| EP08760148A EP2152886A2 (en) | 2007-05-29 | 2008-05-28 | Transgenic plants with increased stress tolerance and yield |
| MX2009012452A MX2009012452A (en) | 2007-05-29 | 2008-05-28 | Transgenic plants with increased stress tolerance and yield. |
| CA002687320A CA2687320A1 (en) | 2007-05-29 | 2008-05-28 | Transgenic plants with increased stress tolerance and yield |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US93214707P | 2007-05-29 | 2007-05-29 | |
| US60/932147 | 2007-05-29 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2008145675A2 true WO2008145675A2 (en) | 2008-12-04 |
| WO2008145675A3 WO2008145675A3 (en) | 2009-04-30 |
Family
ID=40075580
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2008/056553 Ceased WO2008145675A2 (en) | 2007-05-29 | 2008-05-28 | Transgenic plants with increased stress tolerance and yield |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US20100199388A1 (en) |
| EP (1) | EP2152886A2 (en) |
| CN (1) | CN101679999A (en) |
| AR (1) | AR066754A1 (en) |
| AU (1) | AU2008257531A1 (en) |
| BR (1) | BRPI0812060A2 (en) |
| CA (1) | CA2687320A1 (en) |
| DE (1) | DE112008001277T5 (en) |
| MX (1) | MX2009012452A (en) |
| WO (1) | WO2008145675A2 (en) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2010081987A2 (en) | 2009-01-13 | 2010-07-22 | Procedes Roland Pigeon | Use of a liquid mineral composition for improving the adaptive response of plants to a change in environmental conditions |
| US8722072B2 (en) | 2010-01-22 | 2014-05-13 | Bayer Intellectual Property Gmbh | Acaricidal and/or insecticidal active ingredient combinations |
| CN104232656A (en) * | 2014-06-17 | 2014-12-24 | 浙江理工大学 | Adversity regulation gene HsCBL8 for improving anti-adversity characteristics of crops and cloning method thereof |
| US9265252B2 (en) | 2011-08-10 | 2016-02-23 | Bayer Intellectual Property Gmbh | Active compound combinations comprising specific tetramic acid derivatives |
| CN110257404A (en) * | 2019-06-26 | 2019-09-20 | 合肥工业大学 | A kind of functional gene and application reducing Cd accumulation and increase that plant cadmium is resistant to |
| CN110684088A (en) * | 2018-07-04 | 2020-01-14 | 中国科学院植物研究所 | Application of protein ZmbZIPa3 and its encoding gene in regulating plant growth, development and stress tolerance |
Families Citing this family (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN105026563B (en) * | 2012-10-23 | 2017-09-22 | 创世纪种业有限公司 | A cotton protein kinase and its coding gene and application |
| CN103060360A (en) * | 2013-01-04 | 2013-04-24 | 昆明理工大学 | Prokaryotic expression vector of 14-3-3j protein gene of black soybean and application thereof |
| CN105026421B (en) * | 2013-09-25 | 2018-11-27 | 创世纪种业有限公司 | A kind of Bruguiera conjugata protein kinase C IPK1 and its encoding gene and application |
| CN104073504A (en) * | 2014-05-15 | 2014-10-01 | 中国农业科学院作物科学研究所 | Application of CDS (Coding Sequence) sequence of CBL9 (Calcineurin B-Like) gene of corn |
| CN104087598A (en) * | 2014-06-06 | 2014-10-08 | 中国农业科学院作物科学研究所 | Maize calcineurin B albuminoid ZmCBL10 gene and applications thereof |
| CN104498514B (en) * | 2015-01-20 | 2017-03-01 | 南京林业大学 | A kind of Nitraria tangutorum NtCIPK9 gene and its expressing protein and application |
| CN111303260B (en) * | 2020-02-10 | 2022-05-17 | 淮阴工学院 | Plant stress resistance related protein OsC3HC4, coding gene and application |
| CN111808870B (en) * | 2020-08-06 | 2023-05-05 | 云南省农业科学院生物技术与种质资源研究所 | Rice MeRING29 gene, encoding protein, recombinant vector and application |
| CN115807016B (en) * | 2022-11-22 | 2024-05-10 | 西南大学 | Application of Bna.Arf Gene in Rapeseed to Increase Plant Biomass |
Family Cites Families (56)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5504200A (en) | 1983-04-15 | 1996-04-02 | Mycogen Plant Science, Inc. | Plant gene expression |
| US5380831A (en) | 1986-04-04 | 1995-01-10 | Mycogen Plant Science, Inc. | Synthetic insecticidal crystal protein gene |
| US4666844A (en) | 1984-09-07 | 1987-05-19 | Sungene Technologies Corporation | Process for regenerating cereals |
| US5036006A (en) | 1984-11-13 | 1991-07-30 | Cornell Research Foundation, Inc. | Method for transporting substances into living cells and tissues and apparatus therefor |
| US5100792A (en) | 1984-11-13 | 1992-03-31 | Cornell Research Foundation, Inc. | Method for transporting substances into living cells and tissues |
| US4945050A (en) | 1984-11-13 | 1990-07-31 | Cornell Research Foundation, Inc. | Method for transporting substances into living cells and tissues and apparatus therefor |
| US5420034A (en) | 1986-07-31 | 1995-05-30 | Calgene, Inc. | Seed-specific transcriptional regulation |
| US5187073A (en) | 1986-06-30 | 1993-02-16 | The University Of Toledo | Process for transforming gramineae and the products thereof |
| US5004863B2 (en) | 1986-12-03 | 2000-10-17 | Agracetus | Genetic engineering of cotton plants and lines |
| US5120657A (en) | 1986-12-05 | 1992-06-09 | Agracetus, Inc. | Apparatus for genetic transformation |
| ATE105585T1 (en) | 1987-12-21 | 1994-05-15 | Univ Toledo | TRANSFORMATION OF GERMINATED PLANT SEEDS USING AGROBACTERIUM. |
| US5614395A (en) | 1988-03-08 | 1997-03-25 | Ciba-Geigy Corporation | Chemically regulatable and anti-pathogenic DNA sequences and uses thereof |
| US5350688A (en) | 1988-03-31 | 1994-09-27 | Kirin Beer Kabushiki Kaisha | Method for regeneration of rice plants |
| US5990387A (en) | 1988-06-10 | 1999-11-23 | Pioneer Hi-Bred International, Inc. | Stable transformation of plant cells |
| NZ230375A (en) | 1988-09-09 | 1991-07-26 | Lubrizol Genetics Inc | Synthetic gene encoding b. thuringiensis insecticidal protein |
| DE3843628A1 (en) | 1988-12-21 | 1990-07-05 | Inst Genbiologische Forschung | Wound-inducible and potato-tuber-specific transcriptional regulation |
| DK0413019T3 (en) | 1989-02-24 | 2001-11-12 | Monsanto Technology Llc | Synthetic plant genes and methods for their production |
| US5086169A (en) | 1989-04-20 | 1992-02-04 | The Research Foundation Of State University Of New York | Isolated pollen-specific promoter of corn |
| US5302523A (en) | 1989-06-21 | 1994-04-12 | Zeneca Limited | Transformation of plant cells |
| US5550318A (en) | 1990-04-17 | 1996-08-27 | Dekalb Genetics Corporation | Methods and compositions for the production of stably transformed, fertile monocot plants and cells thereof |
| US5322783A (en) | 1989-10-17 | 1994-06-21 | Pioneer Hi-Bred International, Inc. | Soybean transformation by microparticle bombardment |
| EP0472712B1 (en) | 1990-03-16 | 2001-09-12 | Calgene LLC | Novel sequences preferentially expressed in early seed development and methods related thereto |
| EP0528819A1 (en) | 1990-04-18 | 1993-03-03 | Plant Genetic Systems, N.V. | Modified bacillus thuringiensis insecticidal-crystal protein genes and their expression in plant cells |
| US5187267A (en) | 1990-06-19 | 1993-02-16 | Calgene, Inc. | Plant proteins, promoters, coding sequences and use |
| US5932782A (en) | 1990-11-14 | 1999-08-03 | Pioneer Hi-Bred International, Inc. | Plant transformation method using agrobacterium species adhered to microprojectiles |
| US5767366A (en) | 1991-02-19 | 1998-06-16 | Louisiana State University Board Of Supervisors, A Governing Body Of Louisiana State University Agricultural And Mechanical College | Mutant acetolactate synthase gene from Ararbidopsis thaliana for conferring imidazolinone resistance to crop plants |
| ATE207126T1 (en) | 1991-05-15 | 2001-11-15 | Monsanto Technology Llc | METHOD FOR CREATION OF A TRANSFORMED RICE PLANT |
| AU2781892A (en) | 1991-10-07 | 1993-05-03 | Ciba-Geigy Ag | Particle gun for introducing dna into intact cells |
| TW261517B (en) | 1991-11-29 | 1995-11-01 | Mitsubishi Shozi Kk | |
| DK0637339T3 (en) | 1992-04-13 | 2001-12-03 | Syngenta Ltd | DNA constructs and plants in which they are incorporated |
| DE69334225D1 (en) | 1992-07-07 | 2008-07-31 | Japan Tobacco Inc | METHOD FOR TRANSFORMING A MONOCOTYLEDONE PLANT |
| BR9306689A (en) | 1992-07-09 | 1998-12-08 | Pioneer Hi Bred Int | Sequence of purified dna isolated pollen-specific hybrid gene process to confer pollen-specific expression to gene in pollen and transformed pollen |
| US5470353A (en) | 1993-10-20 | 1995-11-28 | Hollister Incorporated | Post-operative thermal blanket |
| CN1061376C (en) | 1993-11-19 | 2001-01-31 | 生物技术研究及发展有限公司 | Chimeric regulatory regions and gene cassettes for gene expression in plants |
| GB9324707D0 (en) | 1993-12-02 | 1994-01-19 | Olsen Odd Arne | Promoter |
| US5731179A (en) | 1993-12-08 | 1998-03-24 | Japan Tobacco Inc. | Method for introducing two T-DNAS into plants and vectors therefor |
| GB9403512D0 (en) | 1994-02-24 | 1994-04-13 | Olsen Odd Arne | Promoter |
| US5470359A (en) | 1994-04-21 | 1995-11-28 | Pioneer Hi-Bred Internation, Inc. | Regulatory element conferring tapetum specificity |
| GB9421286D0 (en) | 1994-10-21 | 1994-12-07 | Danisco | Promoter |
| US5846797A (en) | 1995-10-04 | 1998-12-08 | Calgene, Inc. | Cotton transformation |
| GB9524395D0 (en) | 1995-11-29 | 1996-01-31 | Nickerson Biocem Ltd | Promoters |
| JPH10117776A (en) | 1996-10-22 | 1998-05-12 | Japan Tobacco Inc | Indicine Transformation Method |
| US5981840A (en) | 1997-01-24 | 1999-11-09 | Pioneer Hi-Bred International, Inc. | Methods for agrobacterium-mediated transformation |
| BR9805900B1 (en) | 1997-02-20 | 2009-05-05 | A process for integrating a DNA fragment into the genome of a cell of a manocotiled plant. | |
| US5977436A (en) | 1997-04-09 | 1999-11-02 | Rhone Poulenc Agrochimie | Oleosin 5' regulatory region for the modification of plant seed lipid composition |
| US6162965A (en) | 1997-06-02 | 2000-12-19 | Novartis Ag | Plant transformation methods |
| ATE346944T1 (en) | 1997-09-30 | 2006-12-15 | Univ California | PRODUCTION OF PROTEINS IN PLANT SEEDS |
| US6153813A (en) | 1997-12-11 | 2000-11-28 | Mississippi State University | Methods for genotype-independent nuclear and plastid transformation coupled with clonal regeneration utilizing mature zygotic embryos in rice (Oryza sativa) seeds |
| US6153811A (en) | 1997-12-22 | 2000-11-28 | Dekalb Genetics Corporation | Method for reduction of transgene copy number |
| US6333449B1 (en) | 1998-11-03 | 2001-12-25 | Plant Genetic Systems, N.V. | Glufosinate tolerant rice |
| US6420630B1 (en) | 1998-12-01 | 2002-07-16 | Stine Biotechnology | Methods for tissue culturing and transforming elite inbreds of Zea mays L. |
| US20090087878A9 (en) * | 1999-05-06 | 2009-04-02 | La Rosa Thomas J | Nucleic acid molecules associated with plants |
| ATE418860T1 (en) * | 1999-12-22 | 2009-01-15 | Basf Plant Science Gmbh | STRESS-COUPLED PROTEIN KINASE PROTEINS AND THEIR USE IN PLANTS |
| AU7752001A (en) | 2000-06-28 | 2002-01-08 | Sungene Gmbh And Co Kgaa | Binary vectors for improved transformation of plant systems |
| EP1566443A1 (en) | 2004-02-23 | 2005-08-24 | SunGene GmbH & Co.KgaA | Improved transformation of brassica species |
| JP4744512B2 (en) | 2004-06-07 | 2011-08-10 | ビーエーエスエフ プラント サイエンス ゲーエムベーハー | Improved transformation of soybean |
-
2008
- 2008-05-28 AR ARP080102249A patent/AR066754A1/en unknown
- 2008-05-28 MX MX2009012452A patent/MX2009012452A/en not_active Application Discontinuation
- 2008-05-28 DE DE112008001277T patent/DE112008001277T5/en not_active Withdrawn
- 2008-05-28 BR BRPI0812060-9A2A patent/BRPI0812060A2/en not_active IP Right Cessation
- 2008-05-28 CA CA002687320A patent/CA2687320A1/en not_active Abandoned
- 2008-05-28 AU AU2008257531A patent/AU2008257531A1/en not_active Abandoned
- 2008-05-28 US US12/601,531 patent/US20100199388A1/en not_active Abandoned
- 2008-05-28 CN CN200880017835A patent/CN101679999A/en active Pending
- 2008-05-28 EP EP08760148A patent/EP2152886A2/en not_active Ceased
- 2008-05-28 WO PCT/EP2008/056553 patent/WO2008145675A2/en not_active Ceased
Non-Patent Citations (1)
| Title |
|---|
| DATABASE EPO Proteins [Online] 6 September 2001 (2001-09-06), "Sequence 7 from Patent WO0145492." XP002510307 retrieved from EBI accession no. EPOP:AX223927 Database accession no. AX223927 & WO 01/45492 A (BASF PLANT SCIENCE GMBH [DE]; COSTA E SILVA OSWALDO DA [US]; ISHITANI) 28 June 2001 (2001-06-28) * |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2010081987A2 (en) | 2009-01-13 | 2010-07-22 | Procedes Roland Pigeon | Use of a liquid mineral composition for improving the adaptive response of plants to a change in environmental conditions |
| US8617287B2 (en) | 2009-01-13 | 2013-12-31 | Prp Holding | Use of a liquid mineral composition for improving the adaptive response of plants to a change in environmental conditions |
| US8722072B2 (en) | 2010-01-22 | 2014-05-13 | Bayer Intellectual Property Gmbh | Acaricidal and/or insecticidal active ingredient combinations |
| US9265252B2 (en) | 2011-08-10 | 2016-02-23 | Bayer Intellectual Property Gmbh | Active compound combinations comprising specific tetramic acid derivatives |
| CN104232656A (en) * | 2014-06-17 | 2014-12-24 | 浙江理工大学 | Adversity regulation gene HsCBL8 for improving anti-adversity characteristics of crops and cloning method thereof |
| CN110684088A (en) * | 2018-07-04 | 2020-01-14 | 中国科学院植物研究所 | Application of protein ZmbZIPa3 and its encoding gene in regulating plant growth, development and stress tolerance |
| CN110684088B (en) * | 2018-07-04 | 2022-03-01 | 中国科学院植物研究所 | Application of protein ZmbZIPa3 and its encoding gene in regulating plant growth, development and stress tolerance |
| CN110257404A (en) * | 2019-06-26 | 2019-09-20 | 合肥工业大学 | A kind of functional gene and application reducing Cd accumulation and increase that plant cadmium is resistant to |
| CN110257404B (en) * | 2019-06-26 | 2020-07-14 | 合肥工业大学 | Functional gene for reducing cadmium accumulation and increasing plant cadmium tolerance and application |
Also Published As
| Publication number | Publication date |
|---|---|
| CN101679999A (en) | 2010-03-24 |
| AR066754A1 (en) | 2009-09-09 |
| EP2152886A2 (en) | 2010-02-17 |
| WO2008145675A3 (en) | 2009-04-30 |
| AU2008257531A1 (en) | 2008-12-04 |
| MX2009012452A (en) | 2010-03-30 |
| DE112008001277T5 (en) | 2010-04-22 |
| CA2687320A1 (en) | 2008-12-04 |
| BRPI0812060A2 (en) | 2014-10-07 |
| US20100199388A1 (en) | 2010-08-05 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US8338661B2 (en) | Transgenic plants with increased stress tolerance and yield | |
| US9328354B2 (en) | Transgenic plant with increased stress tolerance and yield | |
| US20100199388A1 (en) | Transgenic Plants with Increased Stress Tolerance and Yield | |
| US8637736B2 (en) | Stress-related polypeptides and methods of use in plants | |
| US20100333234A1 (en) | Transgenic Plants with Increased Stress Tolerance and Yield | |
| US20130139281A1 (en) | Transgenic Plants with Increased Stress Tolerance and Yield | |
| US20140230099A1 (en) | Transgenic Plants With Increased Stress Tolerance and Yield | |
| AU2013202535A1 (en) | Transgenic plants with increased stress tolerance and yield |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 200880017835.0 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 08760148 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2687320 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2009/012452 Country of ref document: MX Ref document number: 1120080012776 Country of ref document: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12601531 Country of ref document: US |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2008257531 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2008760148 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2008257531 Country of ref document: AU Date of ref document: 20080528 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 7650/CHENP/2009 Country of ref document: IN |
|
| RET | De translation (de og part 6b) |
Ref document number: 112008001277 Country of ref document: DE Date of ref document: 20100422 Kind code of ref document: P |
|
| ENP | Entry into the national phase |
Ref document number: PI0812060 Country of ref document: BR Kind code of ref document: A2 Effective date: 20091126 |













































