WO2008046003A2 - Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases - Google Patents

Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases Download PDF

Info

Publication number
WO2008046003A2
WO2008046003A2 PCT/US2007/081098 US2007081098W WO2008046003A2 WO 2008046003 A2 WO2008046003 A2 WO 2008046003A2 US 2007081098 W US2007081098 W US 2007081098W WO 2008046003 A2 WO2008046003 A2 WO 2008046003A2
Authority
WO
WIPO (PCT)
Prior art keywords
formula
mmol
compound
c6alkyl
compounds
Prior art date
Application number
PCT/US2007/081098
Other languages
French (fr)
Other versions
WO2008046003A3 (en
Inventor
Peter A. Petillo
Michael D. Kaufman
Daniel L. Flynn
Original Assignee
Deciphera Pharmaceuticals, Llc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to JP2009532577A priority Critical patent/JP5042314B2/en
Priority to RU2009117615/04A priority patent/RU2482112C2/en
Application filed by Deciphera Pharmaceuticals, Llc filed Critical Deciphera Pharmaceuticals, Llc
Priority to CA2666563A priority patent/CA2666563C/en
Priority to EP07844173.0A priority patent/EP2073811B1/en
Priority to DK07844173.0T priority patent/DK2073811T3/en
Priority to MX2009003704A priority patent/MX2009003704A/en
Priority to CN2007800455912A priority patent/CN101553233B/en
Priority to BR122020010667A priority patent/BR122020010667B8/en
Priority to BRPI0719195A priority patent/BRPI0719195B8/en
Priority to AU2007307679A priority patent/AU2007307679B9/en
Priority to KR1020097009667A priority patent/KR101439823B1/en
Priority to ES07844173.0T priority patent/ES2538215T3/en
Publication of WO2008046003A2 publication Critical patent/WO2008046003A2/en
Publication of WO2008046003A3 publication Critical patent/WO2008046003A3/en
Priority to IL197933A priority patent/IL197933A/en
Priority to HK10103426.6A priority patent/HK1139036A1/en

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D401/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
    • C07D401/14Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing three or more hetero rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D239/00Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings
    • C07D239/02Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/44Non condensed pyridines; Hydrogenated derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/06Antiasthmatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/16Central respiratory analeptics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/06Antipsoriatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/06Antigout agents, e.g. antihyperuricemic or uricosuric agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/04Antineoplastic agents specific for metastasis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P39/00General protective or antinoxious agents
    • A61P39/02Antidotes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D215/00Heterocyclic compounds containing quinoline or hydrogenated quinoline ring systems
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D401/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
    • C07D401/02Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings
    • C07D401/12Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings linked by a chain containing hetero atoms as chain links
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D413/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/14Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing three or more hetero rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D417/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00
    • C07D417/14Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing three or more hetero rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D471/00Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00
    • C07D471/02Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00 in which the condensed system contains two hetero rings
    • C07D471/04Ortho-condensed systems

Definitions

  • the present invention relates to novel kinase inhibitors and modulator compounds useful for the treatment of various diseases. More particularly, the invention is concerned with such compounds, methods of treating diseases, and methods of synthesis of the compounds. Preferrably, the compounds are useful for the modulation of kinase activity of C-AbI, c-Kit, VEGFR, PDGFR, FIt-3, c-MET, the HER family, the Raf kinase family and disease polymorphs thereof.
  • proliferative diseases include cancer, rheumatoid arthritis, atherosclerosis, and retinopathies.
  • C-AbI kinase and the oncogenic fusion protein bcr-Abl kinase include C-AbI kinase and the oncogenic fusion protein bcr-Abl kinase; c-Kit kinase, c-MET, the HER family, PDGF receptor kinase, VEGF receptor kinases, Flt-3 kinase and the Raf kinase family.
  • C-AbI kinase is an important non-receptor tyrosine kinase involved in cell signal transduction.
  • This ubiquitously expressed kinase upon activation by upstream signaling factors including growth factors, oxidative stress, integrin stimulation, and ionizing radiation — localizes to the cell plasma membrane, the cell nucleus, and other cellular compartments including the actin cytoskeleton (Van Etten, Trends Cell Biol. (1999) 9; 179).
  • AbI kinase There are two normal isoforms of AbI kinase: AbI-I A and AbI-IB.
  • the N-terminal half of c-Abl kinase is important for autoinhibition of the kinase domain catalytic activity (Pluk et at, Cell (2002) 108: 247).
  • c-Abl An aberrant dysregulated form of c-Abl is formed from a chromosomal translocation event, referred to as the Philadelphia chromosome (P. C. Nowell et al, Science (1960) 132: 1497; J.D. Rowley, Nature (1973) 243: 290).
  • This abnormal chromosomal translocation leads aberrant gene fusion between the AbI kinase gene and the breakpoint cluster region (BCR) gene, thus encoding an aberrant protein called bcr-Abl (G. Q. Daley et al, Science (1990) 247: 824; M. L. Gishizky et al, Proc. Natl. Acad. ScL USA (1993) 90: 3755; S.
  • the bcr-Abl fusion protein does not include the regulatory myristolylation site (B. Nagar et al, Cell (2003) 1 12: 859) and as a result functions as an oncoprotein which causes chronic myeloid leukemia (CML).
  • CML chronic myeloid leukemia
  • CML is a malignancy of pluripotent hematopoietic stem cells.
  • the p210 form of bcr-Abl is seen in 95% of patients with CML, and in 20% of patients with acute lymphocytic leukemia.
  • a pi 85 form has also been disclosed and has been linked to being causative of up to 10% of patients with acute lymphocytic leukemia.
  • kinases are regulated by a common activatio ⁇ /deactivation mechanism wherein a specific activation loop sequence of the kinase protein binds into a specific pocket on the same protein which is referred to as the switch control pocket (see WO 200380110049 for further details).
  • a specific activation loop sequence of the kinase protein binds into a specific pocket on the same protein which is referred to as the switch control pocket (see WO 200380110049 for further details).
  • Such binding occurs when specific amino acid residues of the activation loop are modified for example by phosphorylation, oxidation, or nitrosylation.
  • the binding of the activation loop into the switch pocket results in a conformational change of the protein into its active form (Huse, M. and Kuriyan, J. Cell (109) 275-282).
  • Compounds of the present invention find utility in the treatment of hyperproliferative diseases, mammalian cancers and especially human cancers including but not limited to malignant, melanomas, glioblastomas, ovarian cancer, pancreatic cancer, prostate cancer, lung cancers, breast cancers, kidney cancers, cervical carcinomas, thyroid cancer metastasis of primary solid tumor secondary sites, myeloproliferative diseases, chronic myelogenous leukemia, acute lymphocytic leukemia, other myeloproliferative disorders, papillary thyroid carcinoma, non small cell lung cancer, mesothelioma, hypereosinophilic syndrome, gastrointestinal stromal tumors, colonic cancers, ocular diseases characterized by hyperproliferation leading to blindness including various retinopathies, i.e.
  • rheumatoid arthritis chronic obstructive pulmonary disorder
  • human inflammation rheumatoid spondylitis
  • ostero-arthritis asthma, gouty arthritis, sepsis, septic shock, endotoxic shock, Gram-negative sepsis, toxic shock syndrome, adult respiratory distress syndrome, stroke, reperfusion injury, neural trauma, neural ischemia, psoriasis, restenosis, chronic obstructive pulmonary disease, bone resorptive diseases, graft-versus-host reaction, Chron's disease, ulcerative colitis, inflammatory bowel disease, pyresis, and combinations thereof, a disease caused by c-Abl kinase, oncogenic forms thereof, aberrant fusion proteins thereof and polymorphs thereof, a disease caused by a Raf kinase, oncogenic forms thereof, aberrant fusion proteins thereof and polymorphs thereof, c-
  • Carbocyclyl refers to carbon rings taken from cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptanyl, cyclooctanyl, norboranyl, norborenyl, bicyclo[2.2.2]octanyl, and bicyclo[2.2.2]octenyl;
  • Halogen refers to fluorine, chlorine, bromine and iodine
  • Aryl refers to monocyclic or fused bicycHc ring systems characterized by delocalized ⁇ electrons (aromaticity) shared among the ring carbon atoms of at least one carbocyclic ring; preferred aryl rings are taken from phenyl, naphthyl, tetrahydronaphthyl, indenyl, and indanyl;
  • Heteroaryl refers to monocyclic or fused bicyclic ring systems characterized by delocalized ⁇ electrons (aromaticity) shared among the ring carbon or heteroatoms including nitrogen, oxygen, or sulfur of at least one carbocyclic or heterocyclic ring; heteroaryl rings are taken from, but not limited to, pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl, pyridinyl, pyrimidinyl, pyrazinyl, pyridazinyl, triazinyl, indolyl, indolinyl, isoindolyl, isoindolinyl, indazolyl, benzofuranyl, benzothienyl, benzotbJazolyl
  • Heterocyclyl refers to monocyclic rings containing carbon and heteroatoms taken from oxygen, nitrogen, or sulfur and wherein there is not delocalized ⁇ electrons (aromaticity) shared among the ring carbon or heteroatoms; heterocyclyl rings include, but are not limited to, oxetanyl, azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl, oxazolidinyl, thiazolinyl, thiazolidinyl, pyranyl, thiopyranyl, tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl, thiomorpholinyl, thiomorpholinyl S-oxide, thiomorpholinyl S-dioxide, piperazinyl, azepinyl, oxepinyl, diazepinyl, tropanyl, and homotropanyl;
  • Poly-ary ⁇ refers to two or more monocyclic or fused aryl bicyclic ring systems characterized by delocalized ⁇ electrons (aromaticity) shared among the ring carbon atoms of at least one carbocyclic ring wherein the rings contained therein are optionally linked together;
  • Poly-heteroaryl refers to two or more monocyclic or fused bicyclic systems characterized by delocalized ⁇ electrons (aromaticity) shared among the ring carbon or heteroatoms including nitrogen, oxygen, or sulfur of at least one carbocyclic or heterocyclic ring wherein the rings contained therein are optionally linked together, wherein at least one of the monocyclic or fused bicyclic rings of the poly-heteroaryl system is taken from heteroaryl as defined broadly above and the other rings are taken from either aryl, heteroaryl, or heterocyclyl as defined broadly above;
  • Poly-heterocyclyl refers to two or more monocyclic or fused bicyclic ring systems containing carbon and heteroatoms taken from oxygen, nitrogen, or sulfur and wherein there is not delocalized ⁇ electrons (aromaticity) shared among the ring carbon or heteroatoms wherein the rings contained therein are optionally linked, wherein at least one of the monocyclic or fused bicyclic rings of the poly-heteroaryl system is taken from heterocyclyl as defined broadly above and the other rings are taken from either aryl, heteroaryl, or heterocyclyl as defined broadly above;
  • Lower alkyl refers to straight or branched chain Cl-C6alkyls
  • Substituted in connection with a moiety refers to the fact that a further substituent may be attached to the moiety to any acceptable location on the moiety.
  • salts embraces pharmaceutically acceptable salts commonly used to form alkali metal salts of free acids and to form addition salts of free bases.
  • the nature of the salt is not critical, provided that it is pharmaceutically-acceptable.
  • Suitable pharmaceutically- acceptable acid addition salts may be prepared from an inorganic acid or from an organic acid. Examples of such inorganic acids are hydrochloric, hydrobromic, hydroiodic, nitric, carbonic, sulfuric and phosphoric acid.
  • Appropriate organic acids may be selected from aliphatic, cycloaliphatic, aromatic, aryl aliphatic, and heterocyclyl containing carboxylic acids and sulfonic acids, examples of which are formic, acetic, propionic, succinic, glycolic, gluconic, lactic, malic, tartaric, citric, ascorbic, glucuronic, maleic, fumaric, pyruvic, aspartic, glutamic, benzoic, anthranilic, mesylic, stearic, salicylic, p- hydroxybenzoic, phenylacetic, mandelic, embonic (pamoic), methanesulfonic, ethanesulfonic, 2-hydroxyethanesulfonic, benzenesulfomc, pantothenic, toluenesulfonic, 2-hydroxyethanesulfonic, sulfanilic, cyclohexylaminosulfonic,
  • Suitable pharmaceutically-acceptable salts of free acid-containing compounds of the invention include metallic salts and organic salts. More preferred metallic salts include, but are not limited to appropriate alkali metal (group Ia) salts, alkaline earth metal (group Ha) salts and other physiological acceptable metals. Such salts can be made from aluminum, calcium, lithium, magnesium, potassium, sodium and zinc.
  • Preferred organic salts can be made from primary amines, secondary amines, tertiary amines and quaternary ammonium salts, including in part, tromethamine, diethyl amine, te/ra-N-methylammonium, N,N'-dibenzylethylenediamine, chloroprocaine, choline, diethanolamine, ethylenediamine, meglumine (N-methylglucamine) and procaine.
  • prodrug refers to derivatives of active compounds which revert in vivo into the active form.
  • a carboxylic acid form of an active drug may be esterified to create a prodrug, and the ester is subsequently converted in vivo to revert to the carboxylic acid form. See Ettmayer et. al, J. Med. Chem, 2004, 47(10), 2393-2404 and Lorenzi et. al, J. Pharm. Exp. Therpeutics, 2005, 883-8900 for reviews.
  • the invention includes compounds of the formula Ia: wherein Ql and Q2 are each individually and independently selected from the group consisting of N and C-Z6, provided that both Ql and Q2 are not simultaneously C-Z6;
  • El is selected from the group consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, pyrrolidinyl piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl and wherein the El ring is substituted with one or more Rl 6 moieties and wherein the El ring is substituted with one or more Rl 8 moieties;
  • A is selected from the group consisting of phenyl, C3-C8carbocyclyl, pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl, pyrazinyl, pyridazinyl, triazinyl, pyridinyl, pyrimidinyl, and G4;
  • Gl is a heteroaryl taken from the group consisting of pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl, pyrazinyl, pyridazinyl, triazinyl, pyridinyl, and pyrimidinyl;
  • G2 is a fused bicyclic heteroaryl taken from the group consisting of indolyl, indolinyl, isoindolyl, isoindolinyl, indazolyl, benzofuranyl, benzothienyl, benzothiazolyl, benzothiazolonyl, benzoxazolyl, benzoxazolonyl, benzisoxazolyl, benzisothiazolyl, benzimidazolyl, benzimidazolonyl, benztriazolyl, imidazopyridinyl, pyrazolopyridinyl, imidazolonopyridinyl, thiazolopyridinyl, thiazolonopyridinyl, oxazolopyridinyl, oxazolonopyridinyl, isoxazolopyridinyl, isothiazolopyridinyl, triazolopyridinyl, imidazopyr
  • a ring is substituted at any substitutable position with one Al moiety, wherein Al is selected from the group consisting of A2, A3 and A4;
  • A2 is selected from the group consisting of
  • A3 is selected from the group consisting of
  • A4 is selected from the group consisting of
  • the A ring is optionally substituted with one or more R2 moieties
  • X2 is selected from the group consisting of C1-C6 alkyl, C2-C6 branched alkyl, and a direct bond wherein El is directly linked to the NR3 group of fo ⁇ nula Ia;
  • V, Vl, and V2 are each independently and respectively selected from the group consisting of O and H 2 ;
  • each Z2 is independently and individually selected from the group consisting of hydrogen, aryl, Cl-C ⁇ alkyl, C3-C8carbocyclyl, hydroxyl, hydroxyCl-C ⁇ alkyl-, cyano, (R3) 2 N-, (R4) 2 N-, (R4) 2 NC1-C ⁇ alkyl-, (R4) 2 NC2-C6alkylN(R4)-(CH 2 ) ⁇ -, (R4) 2 NC2- C6alkylO(CH 2 ) n -, (R3) 2 NC(O)-, (R4) 2 NC(O) ⁇ , (R4) 2 NC(O)C1-C6alkyl-, carboxyl, carboxyCl-C6 alkyl-, Cl-C ⁇ alkoxycarbonyl-, Cl-C6alkoxycarbonylCl-C6alkyI-, (R3) 2 NSO 2 -, (R4) 2 NSO 2 -, -SO 2 RS, -SO 2 R
  • each Z3 is independently and individually selected from the group consisting of H, Cl- C ⁇ alkyl, branched C3-C7alkyl, C3-C8carbocyclyl, halogen, fluoroCl-C ⁇ alkyl wherein the alkyl moiety can be partially or fully fluorinated, cyano, hydroxyl, methoxy, oxo, (R3) 2 NC(O)-, (R4) 2 NC(O)-, -N(R4)C(O)R8, (R3) 2 NSO 2 -, (R4) 2 NSO 2 -, -N(R4)SO 2 R5, - N(R4)SO 2 R8, -(CH 2 ) n N(R3) 2 , -(CH 2 ) n N(R4) 2 , -O(CH 2 ) q N(R4) 2j -O(CH 2 ) q O-Cl-C6alkyl, -N(R3)(CH 2 ) q O-
  • each Z4 is independently and individually selected from the group consisting of H, Cl- C ⁇ alkyl, hydroxyC2-C6alkyl, Cl-C6alkoxyC2-C6alkyl-, (R4) 2 N-C2-C6alkyl-, (R4) 2 N- C2-C6alkylN(R4)-C2-C6alkyl-, (R4) 2 N-C2-C6alkyl-O-C2-C6alkyl- (R4) 2 NC(O)-C 1 - C ⁇ alkyl-, carboxyCl-C ⁇ alkyl-, Cl-C6alkoxycarbonylCl-C6alkyl-, -C2-
  • each Z6 is independently and individually selected from the group consisting of H, Cl- C ⁇ alkyl, branched C3-C7alkyl, hydroxyl, hydroxyCl -C ⁇ alkyl, hydroxyC2-C6 branched alkyl-, Cl-C6alkoxy, C l-C6alkoxyCl -C ⁇ alkyl-, Cl-C6alkoxyC2-C6 branched alkyl-, branched C2-C6alkoxy-, Cl-C ⁇ alkylthio, (R3) 2 N-, -N(R3)COR8, (R4) 2 N-, -R5, - N(R4)C(O)R8, -N(R3)SO 2 R6, -C(O)N(R3) 2 , -C(O)N(R4) 2 , -C(O)RS, -SO 2 NHR4, halogen, fluoroCl -C ⁇ alkyl wherein the alkyl is fully or partially fluorin
  • each R2 is selected from the group consisting of Z3-substituted aryl, Z3 -substituted Gl, Z3-substituted G4, Cl-C6alkyl, branched C3-C8alkyl, Rl 9 substituted C3- C8carbocyclyl, hydroxylCl-C6alky, hydroxyl branched C3-C6alkyl-, hydroxyl substituted C3-C8carbocyclyl-, cyanoCl -C ⁇ alkyl-, cyano substituted branched C3- C ⁇ alkyl-, cyano substituted C3-C8carbocyclyl-, (R4) 2 NC(O)C1 -C ⁇ alkyl-, (R4) 2 NC(O) substituted branched C3-C6alkyl-, (R4) 2 NC(O) substituted C3-C8carbocyclyl-, fluoroCl - C ⁇ alkyl
  • each R3 is independently and individually selected from the group consisting of H, Cl- C ⁇ alkyl, branched C3-C7alkyl, C3-C7cycloalkyl, and Z3-substituted phenyl-;
  • each R4 is independently and individually selected from the group consisting of H, Cl- C ⁇ alkyl, hydroxyCl -C ⁇ alkyl-, dihydroxyCl -C ⁇ alkyl-, Cl -C ⁇ alkoxyCl -C ⁇ alkyl-, branched C3-C7alkyl-, branched hydroxyCl -C ⁇ alkyl-, branched C 1 -C ⁇ alkoxyCl - C ⁇ alkyl-, branched dihydroxyC2-C6alkyl-, -(CH 2 ) P N(R7) 2 , - ⁇ CH 2 ) P R5, - (CH 2 ) P C(O)N(R7) 2, -(CH 2 ) n C(O)R5, -(CH 2 ) n C(O)OR3, C3-C8carbocyclyl, hydroxyl substituted C3-C8carbocyclyl- S alkoxy substituted C3-C8carbocyclyl-
  • each R5 is independently and individually selected from the group consisting of
  • each R6 is independently and individually selected from the group consisting of Cl- C ⁇ alkyl, branched C3-C7alkyl, C3-C8carbocyclyl, phenyl, Gl , and G4;
  • each R7 is independently and individually selected from the group consisting of H, Cl- C ⁇ alkyl, hydroxyC2-C ⁇ alkyI-, dihydroxyC2-C6alkyl-, C2-C6alkoxyC2-C6alkyl-, branched C3-C7alkyl-, branched hydroxyC2-C ⁇ alkyl-, branched C2-C6alkoxyC2- C ⁇ alkyl-, branched dihydroxyC2 -C ⁇ alkyl-, -(CH 2 ) q R5, -(CH 2 ) n C(O)R5, - (CH 2 ) n C(O)OR3, C3-C8carbocyclyl, hydroxyl substituted C3-C8carbocyclyl-, alkoxy substituted C3-C8carbocyclyl-, dihydroxy substituted C3-C8carbocyclyl, and - (CH 2 ) n Rl 7; each R8 is independently and individually selected from the group
  • each R9 is independently and individually selected from the group consisting of H, F, Cl- C ⁇ alkyl, branched C3-C7alkyl, C3-C7cycloalkyl, phenyl, phenyl-Cl-C6alkyl-, - (CH 2 ) n Gl, and -(CH 2 ) n G4;
  • each RlO is independently and individually selected from the group consisting of CO 2 H, CO 2 Cl -C ⁇ alkyl, -C(O)N(R4) 2 , OH, Cl-C ⁇ alkoxy, and -N(R4) 2 ;
  • each Rl 3 is independently and individually selected from the group consisting of H, Cl- C ⁇ alkyl, branched C3-C7alkyl, carbocyclyl, hydroxyC2-C7alkyl, Cl-C6alkoxyC2- C7alkyl-, (R4) 2 NC(O)-, (R4) 2 NC(O)C1-C6alkyl-, carboxyCl -C ⁇ alkyl-, Cl- C ⁇ alkoxycarbonyl-, C 1 -C6 alkoxycarbonylCl -C ⁇ alkyl-, (R4) 2 N-C2-C6alkyl-, ⁇ R4) 2 N- C2-C6alkylN(R4)(CH 2 ) q -, R5-C2-C6alkylN(R4)(CH 2 ) q -, (R4) 2 N-C2-C6alkyl0(CH 2 ) q -, R5-C2-C6alkylO(CH 2 ) q
  • each R14 is independently and respectively selected from the group consisting of H, Cl- C ⁇ alkyl, branched C3-C6alkyl, and C3-C7carbocyclyl;
  • each Rl 6 is independently and individually selected from the group consisting of Cl-
  • each Rl 7 is taken from the group comprising phenyl, naphthyl, pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl, pyrazinyl, pyridazinyl, triazinyl, oxetanyl, azetadinyl, tetrahydrofuranyl, oxazolinyl, oxazolidinyl, pyranyl, thiopyranyl, tetrahydropyranyl, dioxalinyl, azepinyl, oxepinyl, diazepinyl, pyrrolidinyl, and piperidinyl;
  • Rl 7 can be further substituted with one or more Z2, Z3 or Z4 moieties
  • Rl 8 is independently and individually selected from the group consisting of hydrogen, Cl-C6alkyl, branched C3-C7alkyl, C3-C8carbocyclyl, halogen, fluoroCl-C ⁇ alkyl wherein the alkyl moiety can be partially or fully fluorinated, cyano, hydroxyl, Cl- C6alkoxy, fluoroCl-C ⁇ alkoxy wherein the alkyl moiety can be partially or fully fluorinated, -N(R3) 2 , -N(R4) 2 , C2-C3alkynyl, and nitro;
  • R19 is H or Cl-C6alkyl
  • R3 or R4 moieties are independently and individually taken from the group consisting of Cl-C6alkyl and branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen atom, said moieties may cyclize to form a C3-C7 heterocyclyl ring;
  • a ring is pyrazolyl
  • Z6 is -C(O)NHR4, -NHR4 or Rl 9 substituted pyrazole
  • Al is selected from the group consisting of
  • Z ⁇ is -C(O)NHR4, -NHR4 or Rl 9 substituted pyrazole
  • Al is selected from the group consisting of
  • said compounds have structures of formula I-3h: wherein Z6 is -C(O)NHR4, -NHR4 or Rl 9 substituted pyrazole;
  • a ring is furyl
  • Al is selected from the group consisting of
  • said compounds have structures of formula I-4h: wherein Z6 is -C(O)NHR4, -NHR4 or Rl 9 substituted pyrazole; 1.5 Compounds of Formula Ia which exemplify preferred A andX2-El Moieties In a preferred embodiment of compounds of formula Ia, said compounds have structures of formula 1-5 a:
  • Al is selected from the group consisting of
  • said compounds have structures of formula I-5h: wherein Z6 is -C(O)NHR4, -NHR4 or Rl 9 substituted pyrazole;
  • a ring is imidazolyl
  • Al is selected from the group consisting of
  • said compounds have structures of formula I-6h: wherein Z6 is -C(O)NHR4 5 -NHR4 or Rl 9 substituted pyrazole;
  • Al is selected from the group consisting of
  • a ring is oxazolyl
  • Al is selected from the group consisting of
  • said compounds have structures of formula I-8h: wherein Z6 is -C(O)NHR4, -NHR4 or Rl 9 substituted pyrazole;
  • a ring is isothiazolyl
  • Al is selected from the group consisting of
  • said compounds have structures of formula I-9h: wherein Z6 is -C(O)NHR4, -NHR4 or Rl 9 substituted pyrazole;
  • a ring is phenyl
  • Al is selected from the group consisting of
  • a ring is pyrimidinyl
  • Al is selected from the group consisting of
  • a ring is pyridinyl
  • Al is selected from the group consisting of
  • the invention includes methods of modulating kinase activity of a variety of kinases, e.g. C-AbI kinase, bcr-Abl kinase, Flt-3, c-Kit, PDGFR, VEGFR, c-MET, the HER family of kinases and the Raf family of kinases.
  • the kinases may be wildtype kinases, oncogenic forms thereof, aberrant fusion proteins thereof or polymorphs of any of the foregoing.
  • the method comprises the step of contacting the kinase species with compounds of the invention and especially those set forth in sections 1.1-1.12.
  • the kinase species may be activated or iraactivated, and the species may be modulated by phosphorylations, sulfation, fatty acid acylations glycosylations, nitrosylation, cystinylation (i.e. proximal cysteine residues in the kinase react with each other to form a disulfide bond) or oxidation.
  • the kinase activity may be selected from the group consisting of catalysis of phospho transfer reactions, inhibition of phosphorylation, oxidation or nitrosylation of said kinase by another enzyme, enhancement of dephosphorylation, reduction or denitrosylation of said kinase by another enzyme, kinase cellular localization, and recruitment of- other proteins into signaling complexes through modulation of kinase conformation.
  • the methods of the invention also include treating individuals suffering from a condition selected from the group consisting of cancer and hyperproliferative diseases. These methods comprise administering to such individuals compounds of the invention, and especially those of sections 1.1-1.12, said diseases including, but not limited to, a disease caused by c-Abl kinase, oncogenic forms thereof, aberrant fusion proteins thereof and polymorphs thereof, chronic myelogenous leukemia, acute lymphocytic leukemia, other myeloproliferative disorders, gastrointestinal stromal tumors, age-related macular degeneration, liypereosinophilic syndrome, glioblastomas, ovarian cancer, pancreatic cancer, prostate cancer, lung cancers, breast cancers, kidney cancers, cervical carcinomas, metastasis of primary solid tumor secondary sites, ocular diseases characterized by hyperproliferation leading to blindness including various retinopathies, i.e.
  • the administration method is not critical, and may be from the group consisting of oral, parenteral, inhalation, and subcutaneous.
  • the compounds of the invention may form a part of a pharmaceutical composition by combining one or more such compounds with a pharmaceutically acceptable carrier.
  • the compositions may include an additive selected from the group consisting of adjuvants, excipients, diluents, and stablilizers.
  • ureas of general formula I can be readily prepared by the union of amines of general formula 2 with isocyanates 3_ or isocyanate surrogates 4 (trichloroethyl carbamates) or 5 (isopropenyl carbamates).
  • Preferred conditions for the preparation of compounds of general formula I involve heating a solution of 4 or 5 with 2 in the presence of a tertiary base such as diisopropylethylamine, trieihyl amine or N- methylpyrrolidine in a solvent such as dirnethylforraamide, dimethylsulfoxide, tetrahydrofuran or 1,4-dioxane at a temperature between 50 and 100 0 C for a period of time ranging from 1 hour to 2 days.
  • a tertiary base such as diisopropylethylamine, trieihyl amine or N- methylpyrrolidine
  • a solvent such as dirnethylforraamide, dimethylsulfoxide, tetrahydrofuran or 1,4-dioxane
  • isocyanates 3 can be prepared from amines A-NH 2 6 with phosgene, or a phosgene equivalent such as diphosgene, triphosgene, or N,N- dicarbonylimidazole.
  • Trichloroethyl carbamates 4 and isopropenyl carbamates 5 are readily prepared from amines A-NH 2 (6) by acylation with trichloroethyl chloroformate or isopropenyl chloroformate by standard conditions familiar to those skilled in the art. Preferred conditions for the preparation of 4 and 5 .
  • compound 6 include include include treatment of compound 6 with the appropriate chloroformate in the presence of pyridine in an aprotic solvent such as dichloromethane or in the presence of aqueous hydroxide or carbonate in a biphasic aqueous/ethyl acetate solvent system.
  • aprotic solvent such as dichloromethane
  • aqueous hydroxide or carbonate in a biphasic aqueous/ethyl acetate solvent system.
  • compounds of formula I can also be prepared from carboxylic acids 7 by the intermediacy of in-situ generated acyl azides (Curtius rearrangement) as indicated in Scheme 3.
  • Preferred conditions for Scheme 3 include the mixing of acid 7 with amine 2 and diphenylphosphoryl azide in a solvent such as 1,4-dioxane or dimethylformamide in the presence of base, such as triethylamine, and raising the temperature of the reaction to about 80-120 °C to affect the Curtius rearrangement.
  • Hydrazines 8 are in turn available by the diazotization of amines Jj. followed by reduction or, alternately from the hydrolysis of hydrazones ,13, obtained by the palladium mediated coupling of benzophenone hydrazone with compounds of formula Al-X 12, wherein X represents a halogen or triflate moiety.
  • hydrazine 1/7 Reaction of 16 with ethanolic HCl at reflux provides the hydrazine 1/7, which can be combined with keto nitriles of general formula 18 by further heating in ethanolic HCl to provide quinoline pyrazole amines of formula 19.
  • hydrazone 16 can be converted directly to pyrazole 19 by the direct reaction with keto nitrile 18 upon heating in ethanolic HCl.
  • esters for this transformation include ethyl, tert-butyl and benzyl esters.
  • the esters 21 in turn can be converted to acids 22 by standard conditions familiar to those skilled in the art, such as saponification, acidic hydrolysis or hydrogenation.
  • the X-groups in Scheme 7 are complementary moieties for cross coupling processes such that when Al-X Y2 is a halide or trifiate, A-X 23 or A-X 24 will be a complementary organometallic, such as a stannane or the like or a boronic acid or ester. Likewise, if Al -X 12 is an organometallic reagent or a boronic acid or ester, A-X will be a halide or trifiate.
  • the Y group of 23 might also be a protected amino group such as N-Boc or a surrogate amino group such as nitro that would give rise to compounds of formula 25 after acidic hydrolysis or reduction respectively.
  • the Y group of 24 might also be an ester or nitrile which could be hydrolyzed to an acid of formula 26 by standard synthetic methods.
  • Scheme 11 illustrates the preparation of meta-substituted pyridyl ether amines 47 and 48, examples of general intermediate 2, above.
  • commercially available 2-chloro-4-fiuorophenol 4J is treated with methyl chloroformate to provide carbonate 42. Nitration under standard conditions then provides adduct 43. Hydrolysis of the carbonate provides phenol 44. Concomitant reduction of both the nitro and chloro moieties provides aminophenol 45.
  • Treatment of phenol 45 sequentially with potassium tert-butoxide and 3,5-dichloropyridine and heating in dimethylacetamide provides the compound 47. Removal of the chlorine atom of 47 by hydrogenation provides the amine of formula 48, an aspect of general amine 2.
  • halo pyridine 49 (X is halogen) or halo pyrimidine 50 (X is halogen) can be converted to Z6-substituted pyridine 51 or Z6-substituted pyrimidine 52, respectively.
  • Z6-substituted pyridine 51 or Z6-substituted pyrimidine 52, respectively.
  • preferred methods include heating compounds of formula 49 or 50 with an excess of the amine Z6-H either neat or in a solvent such as N- methylpyrrolidinone, DMF, DMSO or an alcoholic solvent at temperatures ranging from RT to 200 0 C.
  • additional preferred methods include the heating of compounds 49 or 50 with an excess of the amine Z6-H and an acid catalyst (for example, TsOH, HCl, HOAc or the like) in a suitable solvent such as DMF, DMSO or an alcoholic solvent.
  • acid catalyst for example, TsOH, HCl, HOAc or the like
  • suitable solvent such as DMF, DMSO or an alcoholic solvent.
  • Additional preferred methods for aryl and heter ⁇ arylamines Z6-H include combining Z6-H with compounds 49 or .50 in the presence of a transition metal catalyst such as a palladium catalyst in a suitable solvent like 1 ,4-dioxane or DMF with heating if necessary.
  • preferred methods include heating 49-50 with alcohol or thiol Z6-H in the presence of a strong base (for example, NaH or potassium tert-butoxide) either neat using Z6-H as the solvent, or in a polar solvent such as DMF or DMSO at temperatures ranging from RT to 200 0 C.
  • a strong base for example, NaH or potassium tert-butoxide
  • preferred methods include contacting compounds 49 or 50 with a species of formula Z6-M in the presence of a palladium catalyst, wherein M is a species that participates in transition- metal catalyzed cross-coupling reactions.
  • Suitable M groups include but are not limited to, boronic acids, boronic esters, zinc, trialkyltin, silicon, magnesium, lithium, and aluminum.
  • the transformations shown in Scheme 13 may be performed with microwave heating. It will be understood by those skilled in the art that the Z6 moieties introduced in Scheme 13 may contain optional protecting groups that will be removed in subsequent transformations (not shown).
  • Some non-limiting examples of general Scheme 13 are shown in Schemes 14 and 15, below.
  • Scheme 14 shows the preparation of amino pyridine 55 from chloropyridine 52 by the general route of Scheme 13.
  • Preferred conditions for this transformation include the contacting of chloropyridine 52 with isopropyl amine in N-methylpyrrolidinone with microwave heating.
  • amine 2 can be converted to an isopropenyl carbamate 56, tricliloroethyl carbamate 57, or 4-nitrophenyl carbamate 58 by reaction with isopropenyl chloroformate, trichloroethyl chloroformate or 4-nitrophenyl chloroformate, respectively.
  • reaction of carbamates 56-5_8 or isocyanate 59 with R3-substituted amine 60 provides urea 6_I, an example of general formula 1.
  • ureas of general formula I can be prepared as illustrated in Scheme 17. hi the instances when R3 is not H, the mono-substituted ureas I or 6J . can be optionally further transformed into bis-R3 -substituted ureas 62 (Formula I).
  • a base for example potassium carbonate, sodium hydride or potassium tert-butoxide in a suitable solvent such as DMF provides ureas 62 wherein the newly incorporated R3 group is alkyl or cycloalkyl.
  • amines 68 and 69 can be converted to ureas of general formula 1.
  • Al -moiety of 68-70 may contain protecting groups that may be removed prior to or after conversion to ureas of formula 1 by appropriate de-protection conditions.
  • the amino group of 64-69 may be optionally protected with a suitable protecting group (such as a tert-butylcarbamate) if desired to facilitate the bromination or palladium coupling steps.
  • Example Al 4-Amino-2 ⁇ fluorophenol (1.13 g, 8.9 mmol) and Example A22 (1.5 g, 8.9 mmol) were combined by the procedure of Example A2 to provide 4-(4-amino-2- fluorophenoxy)-N-methylpicolinamide (300 mg, 13% yield).
  • Example A2 A solution of 4-amino-3-fluorophenol (2.00 g, 15.7 mmol) in anhydrous DMA (32 mL) was degassed by evacuation of the head space and backfilling with argon (repeated 3x). The solution was treated with potassium tert-butoxide (2.12 g, 18.9 mmol) and the resultant mixture was sonicated briefly to bring all solids into the solvent volume and was stirred at RT for 30 min.
  • Example A22 (2.68 g, 15.7 mmol) was added. The reaction mixture was degassed a second time and the reaction mixture was heated to 100 °C overnight under argon.
  • Example A3 In NMP (15 mL) was placed 3-amino-4-ch ⁇ orophenol (1.70 g, 11.8 mmol) and potassium t-butoxide (1.40 g, 12.4 mmol) and the mixture was stirred overnight at RT. The dark solution was treated with the 3,5-difluoropyridine (2.73 g, 23.7 mmol) and powdered potassium carbonate (818 mg, 5.92 mmol) and the mixture was then warmed to 80 0 C and stirred for 24 h. The resulting black mixture was cooled to RT, diluted with brine (100 mL) and extracted with ethyl acetate (3 x 50 mL).
  • Example A4 A mixture of Example AlO (4.6 g, 19.3 mmol) and 10% Pd(OH) 2 /C (0.5 g, 0.35 mmol) in EtOH (50 mL) was stirred under a H 2 atmosphere at RT for 3h. The mixture was filtered through Celite and washed with EtOH. The filtrate was concentrated to give 2-fluoro-5-(pyridine-3-yloxy) aniline (3.5 g, 88 % yield). 1 H NMR
  • Example A5 To a solution of 2,4-difluorophenol (2 g, 15.4 mmol) in CH 2 Cl 2 (20 mL) was added triethyl amine (3.21 ml, 23 mmol) and ethyl chloroformate (1.77 ml, 18.4 mmol) at 0 0 C. After stirring the mixture for Ih at RT, sat. NaHCO 3 solution (30 mL) was added, the organic layer was separated and the aqueous layer was extracted with CH 2 Cl 2 (1x25 ml). The combined organic layers were washed with brine, dried (Na 2 SO 4 ) and concentrated to afford 2,4-difluorophenyl ethyl carbonate (3.11 g, 100% yield) as a liquid.
  • Example A6 A solution of 4-amino-o-cresol (0.301 g, 2.44 mmol) in anhydrous dimethylacetamide (6 mL) was de-gassed in vacuo and treated with potassium tert- butoxide (0.33 g, 2.93 mmol) under argon. The reaction mixture was sonicated briefly to suspend all solid matter in the liquid volume. The reaction was further stirred at RT for 30 min. Example A22 (0.417 g, 2.44 mmol) was added and the resultant mixture was heated to 100 0 C overnight. The cooled reaction mixture was partitioned between ethyl acetate (50 mL) and water (20 mL).
  • Example A7 Using a procedure analogous to Example A2, 4-amino-3-fluorophenol (14 g, 0.11 mmol) and Example A25 (16 g, O.lOmmol) were combined to provide 4-(4- amino-3-fluorophenoxy)picolinamide (8.8 g, 36% yield).
  • Example A8 A solution of Example A23 (2.0 g, 8.4 mmol) in 2-amino-ethanol (6.0 mL) was heated to 150 0 C for 3 h. The solvent was removed under reduced pressure and the residue was purified by silica gel column chromatography to provide 2-(4-(4-amino- 3-fIuorophenoxy)- ⁇ yridin-2-yIamino)-ethanol (1.2 g, 54% yield). !
  • Example A9 A solution of Example A23 (4.0 g, 16.8 mmol) and N 5 O- dimethylhydroxylamine HCl (3.3 g, 34 mmol) were combined in 1,4-dioxane (50 mL) and the reaction mixture was heated overnight at 110 0 C. The reaction mixture was concentrated in vacuo, neutralized with 3M NaOH and extracted with EtOAc (3x). The combined organic phases were washed with brine, dried (MgSO 4 ) and concentrated in vacuo to obtain 4-(4-amino-3-fluorophenoxy)-N-methoxy-N-metliylpyridin-2-aniine (4.4 g, 99% yield).
  • Example AlO A solution of Example A24 (0.95 g, 7.47 mmol) and potassium tert- butoxide (0.92 g, 8.2 mmol) in dimethylacetamide (2.0 mL) was degassed under vacuum and backfilled with N 2 (4x) and then stirred for 30 min. 3,5-Dichloropyridine was added and the resulting solution was heated to 80 0 C overnight. The mixture was filtered and the filtrate was concentrated in vacuo and purified by silica gel chromatography to provide 5-(5-chloropyridin-3-yloxy)-2-fluoroaniline (0.5 g, 28% yield).
  • Example All A mixture of Example A8 (0.263 g, 1.0 mmol), imidazole (0.0749g, 1.1 mmol) and TBSCl (0.181 g, 1.2 mmol) in DMF (10 mL) was stirred at RT overnight. Solvent was removed under reduced pressure. The residue was quenched with H 2 O (10 mL) and the pH was adjusted to ⁇ 8 by using NaHCO 3 .
  • Example A12 To a solution of Example A17 (7.5 g, 32.5 mmol) in EtOH (60 mL) was added 1.0 M aqueous NaOH (10 mL, 100 mmol). The resultant mixture was heated at 85 °C overnight. The majority of ethanol was removed in vacuo and the concentrate was diluted with water (50 mL) and washed with ethyl acetate. The aqueous layer was acidified to pH 1-2 by the addition of 3 M HCl.
  • Example A13 NaH (100 mg, 3.3 mmol) was slowly added to a solution of Example A12 (0.5Og, 2.1 mmol) in dry THF (50 mL) at 0 °C. After 30 min, CS 2 (0.49 g, 6.4 mmol) was added and the reaction mixture was stirred at 0 0 C for 1 hour. Methyl iodide (2.4 g, 17 mmol) was added at 0 0 C and the reaction mixture was allowed to warm to RT overnight. The solvent was removed under reduced pressure to obtain the crude product.
  • Example A14 A solution of 4-amino-3-fluorophenol (0.20 g, 1.6 mmol) in 4 mL of anhydrous DMA was treated with potassium tert-butoxide (0.24 g, 1.9 mmol). The resultant dark-red solution was stirred at RT for 1 hour in a capped vial. 4-Chloro-2- methoxypyridine (0.26 g, 1.6 mmol) was added and the reaction mixture was heated overnight at 100 0 C. Water (50 mL) was added and the solution was extracted with ethyl acetate (3 x 50 mL).
  • Example A15 A teflon capped vial was charged with 4-amino-3-fluorophenol (0.291 g, 2.29 mmol) and anhydrous DMF (2.3 mL). The resultant solution was de-gassed in vacuo and backfilled with argon (3x). The vial was treated with sodium tert-butoxide (0.27 g, 2.41 mmol) under argon and quickly capped. The reaction mixture was stirred at RT for Ih. After addition of 4-chloropicolinonitrile (0.317 g, 2.29 mmol) and K 2 CO 3 (0.174 g, 1.26 mmol), the vial was de-gassed again and heated in a 90 0 C oil bath overnight.
  • Example A16 A solution of 5-amino-2-chIoro-4-fluorophenol (100 mg, 0.619 mmol) in degassed dimethylacetamide (2 mL) was treated with potassium t-butoxide (83 mg, 0.743 mmol) and 5-chloro-2-cyanopyridine (86 mg, 0.619 mmol). The resultant mixture was heated to 80 0 C overnight, then cooled to RT and diluted with water (10 mL). The mixture was extracted with EtOAc (30 mL).
  • Example A17 A solution of 3 ⁇ amino-4-fluoro-pheriol (5.6 g, 44 mmol) in dimethylacetamide (60 mL) was degassed in vacuo and was treated with potassium tert- butoxide (5.3 g, 47 mmol). The resulting solution was stirred for 30 min. 5-Bromo- pyridine-2-carbonitrile (6.6 g, 36 mmol) was added in one-portion and the mixture was heated at 80 0 C overnight. The solvent was removed in vacuo and the residue was purified by silica gel chromatography to provide 5-(3 ⁇ amino ⁇ 4- fluorophenoxy)picolinonitrile (3.5 g, 44 % yield). !
  • Example A18 In DMA (10 mL) was placed 3-amino-4-fluorophenol (500 mg, 3.93 mmol), potassium t-butoxide (441 mg, 3.93 mmol) and 4-chloro-2- (methylthio)pyrimidine (632 mg, 3.93 mmol). The mixture was warmed to 50 0 C and stirred overnight. The mixture was cooled to RT and diluted with water (30 mL), extracted with ethyl acetate (2 x 25 mL) and the combined organic phases washed with brine, dried (Na 2 SO 4 ) and concentrated to yield a dark oil.
  • 3-amino-4-fluorophenol 500 mg, 3.93 mmol
  • potassium t-butoxide 441 mg, 3.93 mmol
  • 4-chloro-2- (methylthio)pyrimidine 632 mg, 3.93 mmol
  • Example A19 A solution of pyridine-3-boronic acid (0.68 g, 5.5 mmol) and 2-methyl-5- nitro phenol (0.85 g, 5.5 mmol) in DCM (10 mL) was treated with pyridine (1.00 mL, 12.4 mmol), copper acetate (1.5 g, 8.3 mmol) and powdered 4A molecular sieves (330 mg). The reaction mixture was stirred for 7 days at RT open to air. The mixture was poured into water (50 mL) and extracted with DCM (2 x 50 mL).
  • Example A20 hi DMA (8 mL) was placed 3-amino-4-fluorophenol (281 mg, 2.21 mmol), potassium t-butoxide (248 mg, 2.21 mmol) and 5-bromo-2- (trifluoromethyl)pyridine (500 mg, 2.21 mmol). The mixture was warmed to 75 0 C overnight , then cooled to RT and diluted with water (75 mL).
  • Example A21 In DMF (5 mL) was placed 5-(3-amino-4-fluorophenoxy)picolinic acid from Example A12 (500 mg, 2.01 mmol), 2.0 M methylamine solution/THF (10 mL, 20.1 mmol) and HOBt (324 mg, 2.12 mmol). To this was added Nl- ((etliylimino)methylene)-N3,N3-dimethylpropane-l,3-diamine hydrochloride (772 mg, 4.03 rnmol) and the solution stirred overnight at RT.
  • Nl- ((etliylimino)methylene)-N3,N3-dimethylpropane-l,3-diamine hydrochloride 772 mg, 4.03 rnmol
  • Example A22 To stirring anhydrous DMF (25 mL) was slowly added SOCl 2 (125 mL) at such a rate that the reaction temperature was maintained at 40-50 0 C. Pyridine-2- carboxylic acid (25 g, 0.2 mol) was added in portions over 30 min and the resulting mixture was heated at reflux for 16h during which time a yellow solid precipitated. After cooling to RT, the mixture was diluted with toluene (80 mL) and concentrated. This process was repeated three times.
  • Example A23 Using a procedure analogous to Example A2, 2,4-dichloropyridine (8.0 g, 54 mmol) and 3-fluoro-4-arninophenol (8.0 g, 62.9 mmol) were combined to provide
  • Example A24 Methyl chloroformate (77.3 g, 0.82 mol) was added dropwise to a -10 0 C solution of 2-chloro-4-fluorophenol (10Og, 0.68 mol) and sodium hydroxide (32.8 g, 0.82 mol) in water (550 mL). After complete addition, the precipitated solid was collected by filtration and washed with water to give 2-chloro-4-fluorophenyl methyl carbonate (1 10 g, 79 % yield).
  • Example A25 4-Chloropicolinamide was prepared using a procedure analogous to Example A22 by substituting NH 3 for MeNH 2 .
  • Example A26 Using a procedure analogous to Example A2, 2-fluoro-4-aminophenol (2.6 g, 24 mmol) and 2,4-dichloropyridine (2.88 g, 20 mol) were combined to provide 4- (2-chloropyridin-4-yIoxy)-3-fluoro-phenylamine (3.2 g, 67% yield).
  • Example A27 Example A23 (0.597 g, 2.5 mmol), 4-(4,4,5,5-tetramethyI-l,3,2- dioxahorolan-2-yl)-lH-pyrazole (0.728g, 3.75 mmol), Cs 2 CO 3 (3.10 g, 9.5 mmol) and Pd(PPh 3 ) 4 (0.289 g, 0.25 mmol) were combined in DMFYH 2 O (20 mL). The reaction mixture was degassed, blanketed with N 2 and heated at 90 0 C overnight. The completed reaction was diluted with H 2 O (5 mL) and extracted with EtOAc (3 x 50 mL).
  • Example A28 A solution of Example A23 (3 g, 12.6 mmol), l-methyl-3-(4,4,5,5- tetrame ⁇ yl-[l,3,2]dioxaborolan-2-yl)-lH-pyrazole (5.2 g, 25.2 mmol), and Na 2 CO 3 (2.7 g, 25.2 mmol) in DME (18 mL) and water (6 mL) was sparged with nitrogen for 20 min. Pd(PPh 3 ) 4 (729 mg, 0.63 mmol) was added and die resulting mixture was heated to 100 0 C for 16 h. The solvent was removed under reduced pressure and the crude product was suspended in water and extracted with EtOAc.
  • Example A29 By analogy to Example A2, 4-amino-3-fluorophenol (0.12 g, 0.53 mmol), potassium tert-butoxide (0.080 g, 0.71 mmol) and tert-butyl 4-chloropicolinate (159 rag, 0.53 mmol) were combined to provide tert-butyl 4-(4-amino-3- fluorophenoxy)picolinate (151 mg, 67% yield). MS (ESI) m/z: 305.0 (M+H + ).
  • Example A30 Example A23 (1 g, 4.2 mmol) and ethyl(4-methoxy-benzyl)amine (10 mL) were combined and heated to 200 0 C for 30 hours. The reaction solution was poured into HO Ac/water (20%, V/V) and extracted with EtOAc (3 x 100 mL).
  • Trifluoroacetic acid (10 mL) was added to a solution of [4-(4-amino-3-fluoro- phenoxy)-pyridin-2-yl]-ethyl-(4-methoxybenzyl)amine (1.2 g, 3.27 mmol) in CH 2 Cl 2 (50 mL) and the resulting solution was heated to 40 0 C overnight.
  • Example A31 To a solution of Example A23 (0.30 g, 1.3 mmol) in NMP (5 mL) was added isopropylamine (0.54 mL, 6.3 mmol) and it was heated under microwave at 200 °C for 6 hours. Water was added and the solution was extracted with ethyl acetate. The organic layer was washed with brine, dried (MgSO 4 ), concentrated in vacuo and purified by silica gel column chromatography (EtOAc/hexane: EtOAc: MeOHZCH 2 Cl 2 ) to obtain
  • Example A32 A solution of 3,5-dinitro-benzomtrile (5 g, 25.9 mol), 5-chloro-pyridin-3- ol (3.35 g, 25.9 mol) and K 2 CO 3 (7.2 g, 52 mol) in DMF (150 mL) was heated at 100 0 C overnight. The mixture was concentrated in vacuo and the residue was poured into water.
  • Iron powder (6.3 g, 112 mmol) was added to a mixture of 3-(5-chloro-pyridin-3- yloxy)-5-nitro-benzonitrile (3.1 g, 11.2 mol) in acetic acid (100 mL) and the reaction was stirred at RT for 6 h. Water (200 mL) was added and the mixture was neutralized to pH 7 with saturated Na 2 CO 3 solution and was extracted with EtOAc (3 x 150 mL).
  • Example A33 3,5-dinitro-benzonitrile (3 g, 16 mmol), 6-methylpyridin-3-ol (1.7 g, 16 mmol), and K 2 CO 3 (4.3 g, 31 mmol) were dissolved in DMF and heated to 110 0 C overnight. The reaction mixture was poured into water and the mixture was extracted with EtOAc. The combined organics were washed with brine, dried (Na 2 SO ⁇ , concentrated in vacuo and purified by silica gel chromatography to provide 3-(6- metliylpyridin-3-yloxy)-5-nitrobenzonitrile (3 g, 76% yield ).
  • Example A34 3,5-Dinitrobenzonitrile(1.50 g, 7.77 mmol) was added to a slurry of pyridin-3-ol (739 mg, 7.77 mmol) and potassium carbonate (10.7 g, 77.7 mmol) in DMF (15 mL), the mixture was warmed to 60 0 C and stirred overnight. After cooling to RT the reaction was diluted with ethyl acetate (50 mL) and water (100 mL).
  • Example A3S Using a procedure analogous to Example A3, 3-amino-4-fluorophenol (491 mg, 3.86 mmol) and 4-chioropyrimidin-2-amine (500 mg, 3.86 mmol) were combined to give 4-(3-amino-4-fluorophenoxy)pyrimidin-2-amine (509 mg, 59% yield). MS (ESI) m/z: 221.0 (M+H + ).
  • Example A36 A solution of l,3-difluoro-2-methylbenzene (15 g, 0.12 mol) in H 2 SO 4 (100 mL) was treated dropwise with HNO 3 (65 %, 11.4 g, 0.12 mol) at -10 0 C. The resultant mixture was stirred for about 30 min. The mixture was poured into ice- water and extracted with EtOAc (3 x 200 mL). The combined organics were washed with brine, dried (NaSO 4 ) and concentrated in vacuo to give l,3-difluoro ⁇ 2-methyl-4-nitrobenzene
  • Example A37 A solution of 1,2,3 -trifluoro-4-nitro-benzene (30 g, 0.17 mol) and benzyl alcohol (18.4 g, 0.17 mol) in DMF (300 mL) was treated with K 2 CO 3 (35 g, 0.25 mol) and the resulting mixture was stirred at RT for 8 h. Water (300 mL) was added, and the mixture was extracted with EtOAc (3 x 500 mL). The combined organics were washed with brine, dried (MgSO 4 ), concentrated in vacuo and chromatographed on silica gel to give l-benzyloxy-2,3-difluoro-4-nitrobenzene (16 g, 36% yield).
  • 1 H NMR 400 MHz, DMSO-J 6 ): ⁇ 8.06 (m, 1 H), 7.49-7.30 (m, 6 H), 5.37 (s, 2 H).
  • Example A38 A solution of Example A37 (2 g, 7.8 mmol), l-methyl-4-(4,4,5,5- tetramethyl-[l,3,2]dioxaborolan-2-yl)-lH-pyrazole (1.6 g, 7.8 mmol) and Na 2 CO 3 (1.65 mg, 15.6 mmol) in DME (12 mL) and H 2 O (4 mL) was sparged with nitrogen for 20 min. Pd(PPh 3 ) 4 (450 mg, 0.4 mmol) was added and the resulting mixture was heated to 70 0 C under nitrogen for 16 h. The solvent was removed under reduced pressure and the crude product was suspended in water and extracted with EtOAc (3 x 10 mL).
  • Example A39 Example A23 (2.0 g, 8.4 mmol) and 4-methoxybenzyl amine (50 mL) were combined in a steel bomb and heated to 160 C for 3h. The reaction mixture was concentrated under reduced pressure and purified by reverse prep-HPLC to give N-(4- rnethoxybenzyl)-4-(4-amino ⁇ 3- fluorophenoxy)pyridin-2-amine (1.0 g, 35% yield).
  • Example A40 A solution of 4-amino-2-methyl-phenol (4.25 g, 34.5 mmol) in dimethylacetamide (50 mL) was degassed in vacuo and blanketed with argon. Potassium tert-butoxide (5.0 g, 44.6 mmol) was added and the reaction mixture was de-gassed a second time and stirred at RT under argon for 30 min. 2,4-Dichloro-pyridine (4.6 g, 31.3 mmol) was added and the mixture was heated to 100 0 C overnight.
  • Example A41 4-Chloro-2-methylsulfanyl-pyrimidine (1.4 g, 8.8 mmol), 4-(4,4,5,5- tetramethyl-[l,3,2]dioxaborolan-2-yl)-lH-pyrazole (2.0 g, 10.3 mmol), Na 2 CO 3 (2.8 g, 26.4) and Pd(PPh 3 J 4 (500 mg, 0.43 mmol) were combined in a solvent comprised of toluene/EtOH/H 2 O (4/4/1, 20 mL). The mixture was degassed by applying a vacuum and backfilling the headspace with argon. The reaction mixture was heated overnight at 100 0 C.
  • Example A42 Using a procedure analogous to Example A3, 3-amino-4-fluorophenol (0.127 g, 1.0 mrnol) and 5-bromo-2-nitropyridine (0.203 g, 1.0 mmol) were combined to afford 2-fluoro-5-(6-nitropyridin-3-yloxy)benzenarnine (0.098 g, 39% yield) as a yellow solid.
  • Example Bl To a stirring solution of benzyl 6-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan ⁇ 2-yl)-3,4-dihydroisoquinoline-2(lH)-carboxylate (0.991 g, 2.52 mmol, 1.00 eq) in THF
  • Example B2 Ethyl 3-t-butyl-l-(2-(trifluoromethylsulfonyloxy)quinolin-6-yl)-ii/- pyrazole-5-carboxylate (see WO 2006/071940A2, 0.380 g, 0.806 mmol), MeNH 2 -HCl
  • Example B3 A solution of triflic anhydride (42.8 g, 0.15 mol) in CH 2 Cl 2 (10OmL) was added dropwise to a 0 °C solution of 6-hydroxyquinoline (20.00 g, 0.138 mol) and pyridine (23 g, 0.277 mol) in CH 2 Cl 2 (500 mL). The cooling bath was removed and the resulting solution was stirred at RT for 4 h. The reaction mixture was washed with water (3 x 300 mL) and the organic phase was dried (MgSO 4 ) and concentrated under vacuum to afford crude quinolin-6-yl trifluoromethanesulfonate (4Og, >100% yield) as an oil.
  • Example B4 Quinolin-6-ylboronic acid (0.34 g, 2.0 mrnol) was dissolved in CH 2 Cl 2 (30 mL) and pyridine (1 mL) with MS (activated 4A) and stirred at RT for 6 hours. Ethyl 3- tert-butyl-lH-pyrazole-5-carboxylate (0.39 g, 2.0 mmol) and copper(II) acetate (0.36 g, 2.0 mmol) were added and the reaction was stirred at RT for 3 days open to air.
  • Lithium hydroxide (62 mg, 2.6 mmol) was added to a solution of ethyl 3-tert- butyl-l-(quinolin-6-yl)-lH-pyrazole-5-carboxylate (0.21 g, 0.65 mmol) in dioxane-H 2 O- EtOH (1 :1 :1, 6 mL). The reaction mixture was stirred overnight at RT. The solution was concentrated and the residue was dissolved in H 2 O (2 mL). 3M HCl was added and the precipitate was collected by filtration and washed with water.
  • Example B5 [3-(5-amino-3-t-butyl-pyrazol-l-yl)naphthalen-l-yl]acetic acid ethyl ester hydrochloride (see WO 2006/071940, 1.60 g, 4.55 mmol) was treated with ammonia in methanol (7 M, 13 mL, 91 mmol) and the reaction mixture was heated in a sealed tube for 6 days. The solvent was removed in vacuo and the residue was chromatographed to provide 2-(3-(5-amino-3-tert-butyl-lH-pyrazoI-l-yl)naphthalen-l-yl)acetamide (610 mg, 41 % yield). MS (ESI) m/z: 323.3 (M+H + ). To a mixture of saturated sodium bicarbonate (20 mL), ethyl acetate (20 mL) and 2-
  • Example B6 To a stirring suspension of tert-butyl 5-(5-amino-3-tert-butyl-lH-pyrazoI- l-yl)-lH-indazole-l-carboxylate (see WO 2006/071940 A2, 0.250 g, 0.70 mmol) and Troc-Cl (0.10 ml, 0.74 mmol) in EtOAc (7 ml) at RT was added sat'd. NaHCO 3 (2.9 ml, 2.1 mmol). After 3h, the completed reaction was diluted with hexanes (35 ml) and filtered.
  • Example B7 To a stirring solution of t-butyl 6-(5-amino-3 -t-butyl-1 H-pyrazol- 1 -yl)- 3,4-dihydroisoquinoline-2(lH)-carboxylate (see WO 2006/071940A2, 0.075 g, 0.20 mmol) and Troc-Cl (0.028 ml, 0.21 mmol) in EtOAc (2 ml) was added sat'd. NaHCO 3 (0.82 ml, 0.61 mmol). The resulting biphasic solution was stirred at RT overnight. The layers were separated and the aqueous phase was extracted with EtOAc (2x).
  • Example B8 A solution of tert-butyl 5-(5-amino-3-tert-butyl ⁇ lH-pyrazol-l-yl)-lH- indazole-1 -carboxylate (see WO 2006/071940 A2, 0.64 g, 1.80 mmol) in EtOAc (6 mL) was treated with IM aq NaOH (2.7 mL). To the stirring biphasic reaction mixture at 0 0 C was added isopropenyl chlorofo ⁇ nate (0.26 mL) dropwise over 1 min. The reaction mixture was stirred for 4 h at RT. The reaction was diluted with EtOAc (20 ml).
  • Example B9 Using a procedure analogous to Example B3, 6-(2- (diphenylmethylene)hydrazinyl)quinoline (4.0 g, 12.3 mmol) and 4-methyl-3-oxo- pentanenitrile (1.5 g, 13.5 mmol) were combined to provide to 3 ⁇ isopropyl-l-(quinolin-6- yl)-lH-pyrazol-5-amine. (1.1 g, 36% yield).
  • 1 H NMR 400 MHz, CDCl 3
  • ⁇ 8.93 (dd, J
  • Example BlO Using a procedure analogous to Example B3, 6-(2-
  • Example BIl Using a procedure analogous to a procedure analogous to Example B3, ⁇ -(2-(diphenylmethylene)hydraziny ⁇ )quinoline (5.0 g, 15.5 mmol) and 4,4,4-trifluoro-3- oxo-butyronitrile (2.3 g, 16.8 mmol) were combined to yield 2-quinolin-6-yl-5- trifluoromethyl-2H-pyrazol-3-ylamine (2.3 g, 53% yield).
  • Example B12 Using a procedure analogous to Example B3, 6-(2- (diphenylmethylene)hydrazinyl)quinoline (5.0 g, 15.5 mmol) and 3-cyclopentyl-3- oxopropanenitrile (3.0 g, 1.1 eq) were combined to yield 3-cyclopentyl-l-(quinolin-6-yl)- lH-pyrazol-5-amine (2.3 g, 53% yield).
  • Example B13 Using a procedure analogous to Example B3, 6-(2- (diphenylmethylene)hydrazinyl)quinoline (4.0 g, 12.3 mmol) and 3-cyclobutyl-3-oxo- propionitrile (1.7 g, 1.1 eq) were combined to provide 5-cyclobutyl-2-qumolm-6-yl-2H- pyrazol-3-ylamine (1.3 g, 40% yield).
  • Example B14 A degassed mixture of ethyl 5-chloro-2-iodobenzoate (0.621 g, 2.00 mmol), Pd(PPh 3 ) 4 (0.116 rag, 0.1 mmol), quinolin-6-ylboronic acid (0.381 g, 2.2 mmol), K 2 CO 3 (0.553 g, 4.0 mmol), dimethoxyethane (20 mL), and water (5 mL) was heated under reflux overnight. Solvents were removed under reduced pressure. The residue was diluted with sat'd NH 4 Cl (15 mL) and extracted with EtOAc (3 x 30 mL).
  • Example B15 2,2,2-Trichloroethyl 4-chloro-2-(quinolin-6-yl)phenylcarbamate was prepared from ethyl 4-chloro-2-iodobenzoate using a procedure analogous to Example B14. MS (ESI) m/z: 431.0 (M+H + ).
  • Example B16 A mixture of 5-ratro-lH-indazole (50 g, 0.31 mol) and 10 % Pd/C (5.0 g) in MeOH (400 mL) was heated under H 2 (30 psi) atmosphere overnight.
  • Example B17 Using a procedure analogous to Example B16, lH-indazol-5-ylamine (5.0 g, 37.5 mmol) and 3-oxo-pentanenitrile (4.0 g, 1.1 eq) were combined and purified by silica gel chromatography to give 5-ethyl-2-(lH-indazol-5-yl)-2H-pyrazol-3-ylamine (5.2 g, 61% yield, two steps).
  • Example B18 A solution of N-benzhydrylidene-N'-quinolin- ⁇ -yl-hydrazine (32 g, 0.099 mol) in EtOH (500 mL) was treated with cone. HCl (80 ml, 0.96 mmol). After stirring for 10 min, 5,5-dimethyl-2,4-dioxo-hexanoic acid ethyl ester (26 g, 0.15 mol) was added, and the mixture was heated to 80°C overnight.
  • the aqueous phase was acidified to pH 3 and the resultant precipitate was collected by filtration, washed with cold ether and dried in vacuo to provide 5-tert-butyl-l-(quinolin-6-yl)-lH-pyrazole-3-carboxylic acid (21 g, 71% yield).
  • Example B19 A solution of sodium nitrite (502 mg, 7.27 rnmol) in H 2 O (8 ml) was added dropwise to a well-stirred 0 0 C mixture of 2-methylquinolin-6-arnine (1.00 g, 6.32 mmol) in cone. HCl (10 ml). The resulting mixture was stirred at 0 0 C for 1 h. Tin(II) chloride dihydrate (6.13 g, 27.2 mmol) in cone. HCl (8 ml) was added and stirring was continued at 0 0 C for 1 h and then RT for 2h.
  • Example B20 Using a procedure analogous to Example B4, imidazo[l,2-a]pyridin-6- ylboronic acid (0.200 g, 1.23 mmol) and ethyl 3-tert-butyl-lH-pyrazole-5-carboxylate (0.267 g, 1.36 mmol) were combined to afford ethyl 3-tert-butyl-l ⁇ (H-imidazo[l,2- a]pyridin-6-yl)-lH-pyrazole-5-carboxylate (0.0355g, 9% yield) as a colorless oil.
  • Example B21 Using a procedure analogous to Example B4, imidazo[l,2-a]pyridin-6- ylboronic acid (0.500 g, 3.09 mmol) and ethyl 3-isopro ⁇ yl-lH-pyrazole ⁇ 5-carboxylate (0.619 g, 3.40 mmol) were combined to afford ethyl 3-isopropyl-l-(H-imidazo[l,2- a]pyridin-6-yl)-lH-pyrazole-5-carboxylate (0.098 g, 11% yield) as a colorless oil. MS (ESI) m/z: 299.3 (M+H + ).
  • Example B22 To a stirring suspension of 6-aminobenzothiazole (0.500 g, 3.33 mmol) in cone. HCl (5 ml) at 0-5 0 C was added a solution Of NaNO 2 (0.276 g, 3.99 mmol) in H 2 O (5 ml). The mixture was stirred at 0-5 0 C for 75 min until a clear yellow solution was obtained. To this was then added a solution of SnCl2-2H 2 O (2.76 g, 13.3 mmol) in cone. HCl (5 ml). After completing the addition, the suspension was stirred at RT for 2h.
  • Example B23 l-Methyl ⁇ 5 ⁇ nitro-lH-benzo[d]imidazole (prepared as described in WO 2005/092899; 1.14 g, 6.43 mmol) in EtOH (50 ml) was stirred under H 2 (1 atm) at RT in the presence of 10% Pd/C (50 wt% H 2 O, 1.37 g, 0.643 mmol). After 18 h, the completed reaction was filtered on Celite, rinsing forward with EtOH. The combined filtrates were concentrated to afford crude l-methyl-lH-benzo[d]imidazol-5-amine (1.02 g, 108% yield) as a dark orange oil which was used as is in the next reaction.
  • Example B24 To a stirring solution of l-(2-(benzyloxycarbonyl)-l, 2,3,4- tetrahydroisoquinolin-6-yl)-3-tert-butyl-lH-pyrazole-5-carboxylic acid from Example Bl (0.320 g, 0.738 mmol, 1.0 eq) and TEA ( 0.118 ml, 0.849 mmol, 1.15 eq) in 1,4- dioxane (7.5 ml) at 20 0 C was added DPPA (0.183 ml, 0.849 mmol, 1.15 eq).
  • Example B25 Using the procedure of Example B26, 3-isopropyl-l-(quinolin-6-yl)-lH- pyrazol-5 -amine from Example B9 (1.0Og, 4.0 mmol), lithium bis(trimethylsilyl)amide (1.0 M in THF, 7.9 mL, 7.9 mmol) and isopropenyl chloroformate (0.48 mL, 4.4 mmol) were combined to provide prop-l-en-2-yl 3-isopropyl-l-(quinolin-6-yl)-lH-pyrazol ⁇ 5- ylcarbamate (0.85 g, 65% yield). MS (ESI) m/z: 337.2 (MfH + ).
  • Example B26 A solution of 5-ter ⁇ butyl-2-quinolin-6-yl-2H-pyrazol-3-ylaraine from
  • Example B3 (1.00 g, 3.8 mmol) in THF (20 mL) was cooled to -78 0 C and treated with lithium bis(trimethylsilyl)amide (1.0 M in THF, 7.5 mL, 7.5 mmol). The resultant mixture was stirred at -78 0 C for 30 min. Isopropenyl chloroformate (0.45 mL, 0.41 mmol) was added and stirring was continued at -78 0 C for 30 min. The reaction mixture was quenched at -78 0 C with aq HCl (2 N, 4 mL, 8 mmol), was warmed to RT and partitioned between water (200 mL) and EtOAc (20OmL).
  • Example B27 4-Fluoro-3-nitrophenylboronic acid (0.9 g, 4.9 mmol) was dissolved in CH 2 Cl 2 (10 mL) and pyridine (1 mL) with MS (activated 4A) and dried for 6 hours. A mixture of 4-fluoro-3-nitrophenylboronic acid, tert-butyl 3-isopropyl-lH-pyrazole-5- carboxylate (1.0 g, 4.9 mmol), copper(II) acetate (0.88 g, 4.9 mmol) and molecular sieves (4A activated, powder) was stirred at RT for 7 days open to the air. The reaction mixture was filtered through a pad of Celite.
  • Example B28 In toluene (8 mL) was placed l-(diphenylmethylene)hydrazine (1.00 g, 5.10 mmol), palladium acetate (10.4 mg, 0.0464 mmol) and 2-(diphenylphosphino)-l-(2- (diphenylphosphino)naphthalen ⁇ l ⁇ yl)naphthalene (44 mg, 0.0696 mmol) and the reaction was stirred at 100 0 C under Ar for 5 min and then cooled to RT. To this dark purple solution was added 6-bromoquinoxaline (970 mg, 4.64 mmol), sodium t-butoxide (624 mg, 6.50 mmol) and toluene (2 mL).
  • the reaction was placed under Ar and warmed to 100 0 C for 5 hrs, cooled to RT and stirred overnight.
  • the reaction was diluted with ether (50 mL) and water (30 mL) and filtered through a Celite pad. The pad was washed with ether (20 mL) and water (20 mL). The combined organic layers were washed with brine (50 mL), dried (Na 2 SO 4 ), concentrated in vacuo and purified by chromatography (ethyl acetate/hexanes) to give l-(diphenylmethylene)-2-(quinoxalin-6-yl)hydrazine (305 mg, 20% yield) as a bright yellow foam.
  • Example B30 To a solution of 7-(5-amino-3-t-butyl ⁇ pyrazol-l-yl)-3,4-dihydro-2H- isoquinolin-1-one hydrochloride from Example B29 (20 g, 0.070 mol) in THF (400 mL) was added LAH (15 g, 0.395 mol) in portions at 0-5 0 C. The resulting mixture was heated at reflux overnight, followed by the addition of 10% NaOH solution. After stirring for Ih at RT, BoC 2 O (23g, 0.106 mol) was added and the solution stirred overnight.
  • Example 1 A solution of Example B3 ( 7.0 g, 15.8 mmol ), Example A2 ( 4.14 g, 15.8 mmol ) and DIEA ( 4.5 g, 34.9 mmol ) in DMSO ( 70 ml) was heated in an oil-bath at 70 0 C for 8 hrs. The reaction mixture was poured into water (500 ml), stirred overnight and the solids were separated by filtration.
  • Example2 Example Bl (142 mg, 0.33 mmol) and Et 3 N (0.15 mL, 0.72 mmol) were combined in dioxane (3 mL). DPPA (0.13 mL, 0.59 mmol) was added and the reaction mixture was stirred at RT for 90 min. Example A2 (94 mg, 0.36 mmol) was added and the resultant mixture was heated to 95 0 C for 4 h.
  • Example 3 Using general method A, Example B4 (80 mg, 0.27 mmol), Example Al (0.18 g, 0.68 mmol), Methyl amine (30 mg, 0.30 mmol), and DPPA (82 mg, 0.30 mmol) were combined to yield l-(3-tert-butyl-l-(quinoIin-6-yl)-lH-pyrazol-5-yl)-3-(3-fluoro-4- (2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea which was treated with 3M HCl/EtOAc to obtain its HCl salt (125 mg, 78% yield).
  • Example 4 To a solution of Example B8 (0.132 g, 0.30 mmol) in THF (1.0 ml) were added Example A2 (0.083 g, 0.315 mmol) and 1 -methyl pyrrolidine (2.6 mg, 0.03 mmol). The mixture was heated at 55 °C overnight. Solvent was removed and the residue was dissolved in MeOH (4.5 ml), to which 3M HCl/EtOAc (1.3 ml, 3.8 mmol) was added. The resulting mixture was stirred at RT overnight, followed by heating at 55 0 C for 3 h. The reaction mixture was concentrated to dryness, diluted with sat'd. NaHCO 3 (7 ml) and extracted with EtOAc (3x20 ml).
  • Example S Using general method A, Example B4 (80 mg, 0.27 mmol) and Example A6 (99 mg, 0.38 mmol) were combined to provide l-(3-tert-butyl-l-(quinolin-6-yl)-lH- pyrazol-5-yl)-3-(3-methyl-4-(2-(metliylcarbamoyl)pyridin-4-yloxy)phenyl)urea (149 mg, 99% yield).
  • Example 6 Using a procedure analogous to Example 1, Example B3 (0.19 g, 0.43 mmol) and Example A7 (0.11 g, 0.43 mmol) were combined to provide l-(3-tert-butyl-l- (quinolin-6-yl)-lH-pyrazol-5-yl)-3-(4-(2-carbainoylpyridin-4-yloxy)-2-fluorophenyl)urea hydrochloride (0.160 g, 64% yield).
  • Example 7 Example B3 (0.12 g, 0.27 mmol), Example A9 (63 mg, 0.27 mmol) and DIEA (77 mg, 0.60 mmol) were combined in DMSO (1 mL) and heated overnight at 50- 55 0 C.
  • Example 8 Using a procedure analogous to Example 1, Example B6 (0.178 g, 0.335 mmol), Example AlO (0.0840 g, 0.352 mmol) and DIEA (0.0701 ml, 0.402 mmol) were combined, purified by flash column chromatography (EtOAc/hexanes) and purified a second time by flash column chromatography (EtOAc/CH 2 Cl 2 ) to afford t-butyl 5-(3-t- butyl-5-(3-(5-(5-chloropyridin-3-yloxy)-2-fluorophenyl)ureido)-lH-pyrazol-l-yl)-lH- indazole-1-carboxylate (0.0486 g, 23% yield) as a solid.
  • Example 9 Using a procedure analogous to Example 1, Example B7 (0.300 g, 0.550 mmol), Example AlO (0.138 g, 0.577 mmol) and DIEA (0.115 ml, 0.659 mmol) were combined and purified by flash column chromatography (EtOAc/hexanes) to afford tert- butyl 6-(3-tert-butyl-5-(3-(5-(5-chloropyridin-3-yloxy)-2-fluorophenyl)ureido)-lH- pyrazol-l-yl)-3,4-dihydroisoquinoline-2(lH)-carboxylate (0.090 g, 26% yield) as a film.
  • Example 10 Using a procedure analogous to Example 1, Example B9 (0.150 g, 0.351 mmol) and Example A2 (0.101 g, 0.386 mmol) were combined to provide 1 -(2-fluoro-4- (2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)-3-(3-isopro ⁇ yl-l -(quinolin-6-yl)-l H- pyrazol-5-yl)urea hydrochloride (0.126 g, 62% yield).
  • Example 11 Using a procedure analogous to Example 1, Example BlO (0.15 g, 0.363 mmol) and Example A2 (0.100 g, 0.38 mmol) were combined to provide l-(3-ethyl-l- (quinolin-6-yl)-lH-pyrazol-5-yl)-3-(2-fluoro-4-(2-(methylcarbamoyl)pyridin-4- yloxy)phenyl)urea hydrochloride (0.120 g, 58% yield).
  • Example 12 Using a procedure analogous to Example 1, Example B3 (0.195 g, 0.441 mmol), Example AlO (0.1 11 g, 0.464 mmol) and DIEA (0.0923 ml, 0.530 mmol) were combined and purified first by flash column chromatography (EtOAc/hexanes) and then by reverse phase chromatography (MeCN (w/ 0.1% TFA)/ H 2 O (w/0.1% TFA)) to provide an aqueous solution of the TFA salt of the desired product. The aqueous residue was treated with satd. NaHCO 3 (pH 8) and extracted with EtOAc (3x).
  • Example 13 Using a procedure analogous to Example 1, Example B3 (100 mg, 0.226 mmol), DIEA (73 mg, 0.566 mmol) and Example A18 (63 mg, 0.25 mmol) were combined to yield l-(3-tert-butyl-l-(quinolin-6-yl)-lH-pyrazoI-5-yl)-3-(2-fluoro-5-(2-
  • Example 14 Using a procedure analogous to Example 1, Example B3 (0.10 g, 0.23 mmol), Example Al 2 (53 mg, 0.23 mmol) and DIEA (64 mg, 0.50 mmol) were combined and purified by reverse phase column chromatography to obtain l-(3-tert- butyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)-3-(2-fluoro-5-(6-(hydroxymethyl)pyridin-3- yloxy)phenyl)urea TFA salt. The residue was dissolved in 3M HCl and co-evaporated with isopropyl alcohol (3x).
  • Example 15 Using a procedure analogous to Example 1, Example B9 (0.120 g, 0.281 mmol) and Example A7 (0.0763 g, 0.309 mr ⁇ ol) were combined to provide l-(4-(2- carbamoylpyridin-4-yloxy)-2-iluoroprienyl)-3-(3-isopropyl- 1 -(quinolin-6-yl)-l H-pyrazol- 5-yl)urea hydrochloride (0.101 g, 65% yield).
  • Example 16 Using a procedure analogous to Example 1, Example B3 (85 mg, 0.19 mmol), Example A13 (42 mg, 0.19 mmol) and DIEA (55 mg, 0.42 mmol) were combined in DMSO (1 mL) and heated overnight at 50-55 0 C. Water was added (50 mL) and the mixture was extracted with EtOAc (3 x 100 mL), dried (MgSO 4 ), concentrated in vacuo and purified by silica gel column chromatography to obtain l-(3-tert-butyl-l-
  • Example 17 Using a procedure analogous to Example 1, Example B9 (213 mg, 0.50 mmol), Example A6 (145 mg, 0.56 mmol) and DIEA (0.09 mL, 0.517 mmol) were combined in DMF (2 mL) to provide l-(3-isopropyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)- 3-(3-methyl ⁇ 4 ⁇ (2-(methyIca ⁇ bamoyl)pyridin-4-yloxy)phenyl)urea (194 mg, 73% yield).
  • Example 18 mCPBA (1.07 g of -70%, 4.34 mmol) was added to a solution of Example A18 (545 mg, 2.17 mmol) in CH 2 Cl 2 (15 niL) and the solution was stirred at RT. The mixture was washed with saturated sodium bicarbonate (3 x 20 mL) and brine (30 mL), dried (Na 2 SO 4 ) and concentrated in vacuo to yield 0.65 g of a tan foam, which proved to be a mixture of the sulfoxide and sulfone, and which was used as is.
  • Example 19 Using a procedure analogous to Example 1, Example B9 (85 mg, 0.20 mmol), Example A9 (46 mg, 0.20 mmol) and DIEA (57 mg, 0.44 mmol) were combined in DMSO (1 mL) to obtain l ⁇ (2-fluoro-4-(2-(methylamino)pyridin-4-yloxy)phenyl)-3-(3- isopropyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)urea.
  • Example 20 Using a procedure analogous to Example 1, Example BlO (0.13 g, 0.314 rranol), Example A7 (0.086 g, 0.346 mmol) and DIEA (0.12 mL, 0.69 mmol) were dissolved in DMSO (1.5 mL) and the mixture was heated at 55 °C overnight to afford 1- (4-(2-carbamoylpyridin-4-yloxy)-2-fluorophenyl)-3-(3-ethyl-l-(quinolin-6-yl)-lH- pyrazol-5-yl)urea (0.088 g, 55% yield).
  • Example 21 Using a procedure analogous to Example 1, Example B3 (198 mg, 373 mmol), DIEA (121 mg, 0.933 mmol) and Example A21 (117 mg, 0.448 mmol) were combined to yield l-(3-tert-butyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)-3-(2-fluoro-5-(6 ⁇ (methylcarbamoyl)pyridin-3-yloxy)phenyI)urea (140 mg, 67% yield) as the hydrochloride salt.
  • Example 22 Using a procedure analogous to Example 1, Example B14 (0.125 g, 0.291 mmol) and Example A7 (0.079 g, 0.320 mmol) were combined to provide l-(4-(2- carbaraoylpyridm-4-yloxy)-2-fluorophenyl)-3-(5-chloro-2-(quinolin-6-yl)phenyl)urea hydrochloride (0.070 g, 43% yield).
  • Example 23 Using a procedure analogous to Example 1, Example B9 (35 mg, 0.02 mmol), Example A14 (47 mg, 0.20 mmol) and DIEA were combined in DMSO and heated overnight at 60 0 C to obtain l-(2-fluoro-4-(2-methoxypyridin-4 ⁇ yloxy)phenyl)-3- (3-isopropyl-l-(quinolin-6-yI)-lH-pyrazol-5-yl)urea HCl salt (54 mg, 49% yield).
  • Example 24 Using a procedure analogous to Example 1, Example B19 (150 mg, 0.329 mmol) and Example A2 (94 mg, 0.362 mmol) were combined to provide 1 -(3-tert-butyl- l-(2-methylquinolin-6-yl)-lH-pyrazol-5-yl)-3-(2-fluoro-4-(2-(methylcarbamoyl)pyridin- 4-yloxy)phenyl)urea hydrochloride (113 mg, 60% yield).
  • Example 25 Using a procedure analogous to Example 1, Example B9 (120 mg, 0.28 mmol), Example A20 (80 mg, 0.29 m ⁇ iol), and DIEA (110 mg, 0.84 mmol) were combined to yield l-(2-fluoro-5-(6-(trifluoromethyI)pyridin-3-yloxy)phenyl)-3-(3- isopropyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)urea hydrochloride (62 mg, 40% yield).
  • Example 26 Using a procedure analogous to Example 1, Example B9 (0.200 g, 0.468 mmol) and Example A15 (0.1 13 g, 0.491 mmol) were combined to provide l-(4-(2- cyanopyridin-4-yloxy)-2-fluorophenyl)-3-(3-isopropyl-l ⁇ (quinolin-6-yI)-lH-pyrazol-5- yl)urea (0.238 g, 100%).
  • Example 27 Using a procedure analogous to Example 1, Example B7 (159 mg, 0.291 mmol), DIEA (45 mg, 0.35 mmol) and Example A34 (74 mg, 0.35 mmol) were combined to give tert-butyl 6-(3-tert-butyl-5-(3-(3-cyano-5-(pyridin-3- yloxy)phenyl)ureido)-lH-pyrazol-l-yl)-3,4-dihydroisoquinoIine-2(lH)-carboxylate (83 mg, 47% yield). MS (ESI) m/z: 608.3 (M+H + ).
  • Example 28 Using a procedure analogous to Example 1, Example A35 (95 mg, 0.428 mmol), DIEA (158 mg, 1.22 mmol) and Example B3 (180 mg, 0.407 mmol) were combined to give l-(5-(2-aminopyrimidin-4-yloxy)-2-fluorophenyl)-3-(3-tert-butyl-l- (quinolin-6-yl)-lH- ⁇ yrazol-5-yl)urea hydrochloride salt (102 mg, 48% yield).
  • Example 29 Using a procedure analogous to Example 1, Example B9 (0.200 g, 0.468 mmol) and Example A15 (0.113 g, 0.491 mmol) in presence of DIEA (0.179 mL, 0.1.03 mmol) were combined to afford l-(4-(2 ⁇ cyanopyridin-4-yloxy)-2-fluorophenyl)-3-(3- isopropyI-l-(quinolin-6-yl)-lH-pyrazol-5-yl)urea (0.238 g, 100%) as a colorless oil. It was converted to corresponding HCl salt by reacting with HCl (4.0 M in dioxane, 1.0 eq.). !
  • Example 30 Using a procedure analogous to Example 1, Example B3 ( 0.2 g, 0.453 mmol ) and Example A29 (0.158 g, 0.453 mmol ) were combined in DMSO ( 4 mL) at
  • Example 31 Using a procedure analogous to Example 4, Example B25 (0.30 g, 0.89 mmol) and Example A31 (0.26 g, 0.98 mmol) in presence of N-methyl pyrrolidine (catalytic amount) were combined to afford l-(2-fluoro-4-(2-(iso ⁇ ro ⁇ ylamino) ⁇ yridin-4- yloxy)phenyl)-3-(3-isopropyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)urea (0.26 g, 54% yield).
  • Example 32 Using general method A, Example B20 (0.0643 g, 0.226 mmol) and Example A7 (0.168 g, 0.678 mmol) were combined to afford l-(3-tert-butyl-l-(H- imidazo[l,2-a]pyridin-6-yl)-lH-pyrazol-5-yI)-3-(4-(2-carbamoylpyridin-4-yloxy)-2- fluorophenyl)urea (0.071 g, 59%) as a white solid. It was converted to corresponding HCl salt by reacting with HCl (4.0 M in dioxane, 1.0 eq.).
  • Example 33 Using a procedure analogous to Example 1, Example B9 (100 mg, 0.23 mmol) and Example A12 (55 mg, 0.23 mmol) in presence of DIEA (90 ⁇ L, 0.51 mmol) were combined to afford l-(2-fluoro-5-(6-(hydroxymethyl)pyridin-3-yloxy)phenyl)-3-(3- isopropyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)urea (30 mg, 25% yield).
  • Example 34 Using a procedure analogous to Example B19 step 2, Example A2 (1.00 g, 3.83 mmol) and 2,2,2-trichloroethyl carbonochloridate (1.30 g, 6.12 mmol) were combined to give 2,2,2-trichloroethyl 2-fluoro-4-(2-(methylcarbamoyl)pyridin-4- yloxy) ⁇ henylcarbamate. MS (ESI) m/z: 436.0, 438.0 (M+H).
  • Example B28 A solution of Example B28 (57 mg, 0.213 mmol), 2,2,2-trichloroethyl 2-fluoro-4- (2-(methylcarbamoyl)pyridin-4-yloxy)phenylcarbamate (102 mg, 0.235 mmol) and DIEA (110 mg, 0.853 mmol) in DMSO (1.5 mL) was placed was warmed to 60 0 C overnight. It was then treated with additional 2,2,2-trichloroethyl 2-fluoro-4-(2- (methylcarbamoyl)pyridin-4-yloxy)phenylcarbamate (-200 mg), warmed to 60 0 C overnight.
  • Example 35 Using a procedure analogous to Example 1, Example B9 (0.145 g, 0.339 mmol) and Example A27 (0.087 g, 0.323 mmol) in presence of DIEA (0.124 mL, 0.710 mmol) were combined to afford l-(4-(2-(lH-pyrazol-4-yl)pyridin-4-yloxy) ⁇ 2- fiuorophenyl)-3-(3-isopropyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)urea (0.1 12 g, 63%) as a white foam. It was converted to corresponding mesylate salt by reacting with MsOH (1.0 eq.).
  • Example 36 Example B22 (0.310 g, 0.715 mmol), Example A2 (0.187 g, 0.715 mmol) and DIEA (0.274 ml, 1.57 mmol) were combined in DMSO (3 ml) and stirred at 70 0 C. After 18 h, the completed reaction was cooled to RT, diluted with brine and extracted with EtOAc (3x). The combined organics were washed with brine (2x), dried (MgSO 4 ), evaporated and purified by flash column chromatography (EtOAc/hexanes) to afford the free base (84.1 mg, 22% yield).
  • Example 37 Example B23 (0.200 g, 0.464 mmol), Example A2 (0.121 g, 0.464 mmol) and 1-Pr 2 NEt (0.178 ml, 1.02 mmol) were combined in DMSO (2 ml) and stirred with heating at 70 0 C. After 18 h, the completed reaction was cooled to RT, diluted with brine and extracted with EtOAc (3x). The combined organics were washed with brine (2x), dried (MgSO 4 ), concentrated in vacuo and purified by flash column chromatography (EtOAc/hexanes to EtOAc to THF) to afford impure product.
  • Example 38 Using general method A, Example B21 (0.0.054 g, 0.20 mmol) and Example A2 (0.16 g, 0.60 mrnol) were combined to afford l-(l-(H-imidazo[l,2- a]pyridin-6-yl)-3-isopropyl-lH-pyrazol-5-yl)-3-(2-fluoro-4-(2- (methylcarbamoyl)pyridin-4-yloxy)phenyl)urea (0.045g, 43% yield) as a white solid. It was converted to corresponding mesylate salt by reacting with MsOH (1.0 eq.).
  • Example 39 Using general method A, Example B21 (0.030 g, 0.11 mmol) and Example A7 (0.082 g, 0.33 mmol) were combined to afford l-(l ⁇ (H-imidazo[l,2- a]pyridin-6-yl)-3-isopropyl-lH-pyrazol-5-yl)-3-(4-(2-carbamoylpyridin-4-yloxy)-2- fluorophenyl)urea (0.0245g, 43% yield) as a white solid. It was converted to corresponding HCl salt by reacting with HCl (4.0 M in dioxane, 1.0 eq.).
  • Example 40 Using a procedure analogous to Example 1, Example A39 (63 mg, 0.29 mmol) and Example B9 (122 mg, 0.29 mmol) were combined to provide l-(4-(2- aminopyridm-4-yloxy)-2-fluorophenyl)-3-(3-isopropyl-l-(quinolin-6-yl)-lH-pyrazol-5- yl)urea contaminated with 2,2,2-trichloroethanol (56 mg, 28% yield).
  • Example 41 Using as procedure analogous to Example 4, Example B25 (100 mg, 0.30 mmol) and Example A30 (74 mg, 0.30 mmol) in presence of N-methyl pyrrolidine (catalytic amount) were combined to afford l-(4-(2-(ethylamino)pyridin-4-yloxy)-2- fJuorophenyl)-3-(3-isopropyl-l-(quinolm-6-yl)-lH-pyrazol-5-yl)urea (70 mg, 45% yield).
  • Example 42 Using a procedure analogous to Example 1, Example B9 (295 mg, 0.69 mmol) and Example A40 (214 mg, 0.763 mmol) were combined in DMF (3 rnL) to provide l-(3-isopropyI-l-(quinolin-6-yl)-lH-pyrazol-5-yl)-3-(3-metriyl-4-(2-(l-methyl- lH- ⁇ yrazol-4-yl) ⁇ yridin-4-yloxy) ⁇ henyl)urea (278 mg, 72% yield).
  • Example 43 Using a procedure analogous to Example 1, Example B3 (0.71 1 g, 1.66 mmol) and Example A28 ( 0.450 g, 1.58 mmol) in presence of DIEA (0.61 mL, 3.48 mmol) were combined to afford 1 -(2-fluoro-4-(2-(l -methyl- 1 H-pyrazol-4-yl)pyri din-4- yloxy)phenyl)-3-(3-isopropyl-l-(quinolin-6-yl) ⁇ l H-pyrazol-5-yl)urea (0.431 g, 48% yield) as a white solid. It was converted to corresponding mesylate salt by reacting with MsOH (1.0 eq.).
  • Example 44 Using a procedure analogous to Example 4, Example B26 (100 mg, 0.29 mmol) and Example A31 (75 mg, 0.29 mmol) in presence of N-methyl pyrrolidine (catalytic amount) were combined to afford l-(3-tert-butyl-l-(quinolin-6-yl)-lH-pyrazol- 5-yl)-3-(2-fluoro-4-(2-(isopropylamino)pyridin-4-yloxy)phenyl)urea (59 mg, 32% yield).
  • Example 45 Using a procedure analogous to Example 1, Example BlO (0.060 g, 0.15 mraol) and Example A28 (0.041 g, 0.15 mmol) in presence of DIEA (0.056 rnL, 0.32 mmol) were combined to afford l-(3-ethyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)-3-(2- fluoro-4-(2-(l -methyl- lH-pyrazol-4-yl)pyridin-4-yloxy)phenyl)urea (47.6 mg, 60% yield) as a white foam. It was converted to corresponding mesylate salt by reacting with MsOH (1.0 eq.).
  • Example 46 Using general method A, Example B27 (77 mg, 0.28 mmol) and Example A2 (150 mg, 0.57 mmol) in presence of DPPA (67 ⁇ L, 0.31 mmol) and Et 3 N (44 ⁇ L, 0.31 mmol) were combined to afford l-(l-(benzo[d]oxazol-5-yl)-3-isopropyl-lH- pyrazol-5-yl)-3-(2-fiuoro-4-(2-(methyIcarbamoyl)pyridin-4-yloxy)phenyl)urea (105 mg, 70% yield).
  • Example 47 To a suspension of 5-amino-2-fluorobenzonitrile (1.00 g, 7.38 mmol) in cone HCl (15 mL) at 0 0 C was added a solution Of NaNO 2 (0.64 g, 9.28 mmol) in water (15 mL) slowly over 15 min. The resultant mixture was stirred for 90 min at 0 0 C. A solution comprised of SnCl 2 .2H 2 O (3.37 g, 14.9 mmol), cone HCl (5 mL) and water (5 mL) was added drop wise over 20 min. The mixture was stirred for 2 h at 0 0 C, and was extracted with EtOAc (4 x 25 mL).
  • reaction mixture was concentrated in vacuo, diluted with EtOAc (30 mL) and washed with water (20 mL), satd aq NaHCO 3 (20 mL), water (20 mL) and brine (20 mL). The aqueous was further extracted with EtOAc (2 x 20 mL). The combined organics were dried (MgSO 4 ), concentrated in vacuo and purified by chromatography on silica gel to provide 5-(5-amino-3-tert-butyl ⁇ lH-pyrazol-l-yl)-2-fluorobeii2 ⁇ iutrile (1.24 g, 65% yield).
  • Example 48 Using a procedure analogous to Example 1, Example B9 (0.175 g, 0.41 mmol) and Example A42 (0.097 g, 0.389 mmol) were combined to afford 1 -(2-fluoro ⁇ 5- (6-nitropyridin-3-yloxy)phenyl) ⁇ 3-(3-isopropyl- 1 -(quinolin-6-yl)- 1 H-pyrazol-5-yl)urea (0.129g, 63% yield) as a light yellow oil.
  • Example 49 Using a procedure analogous to Example 1, Example B24 (150 mg, 0.26 mmol) and Example A28 (74 mg, 0.26 mmol) in presence of DIEA (90 ⁇ L, 0.52 mmol) were combined to afford benzyl 6-(3-tert-butyl-5-(3-(2-fluoro-4-(2-(l -methyl- IH- pyrazol-4-yl)pyridin-4-yloxy)phenyl)ureido)- 1 H-pyrazol- 1 -yl)-3 ,4-dihydroisoquinoline-
  • Example 50 Using a procedure analogous to Example 1, Example B29 (0.20 g, 0.43 mmol) and Example A27 (118 mg, 0.43mmol) were combined to afford 1-(4-(2-(1H- pyrazol-4-yl)pyridin-4-yloxy)-2-fluorophenyl)-3-(3-tert-butyl-l -(I -oxo-1 ,2,3,4- tetrahydroisoquinolin-7-yl)-lH-pyrazol ⁇ 5-yl)urea (123 mg, 47% yield).
  • Example 51 Using a procedure analogous to Example 1, Example B30 (0.20 g, 0.37 rnmol) and Example A27 (100 mg, 0.37 mmol) were combined to afford tert-butyl 7-(5- (3 ⁇ (4-(2-(lH-pyrazol-4-yl)pyridin-4-yloxy)-2-fluorophenyl)ureido)-3-tert-butyl-lH- pvrazol-1-yI)-3,4-dihydroisoqumoline-2(lH)-carboxylate (130 mg, 53% yield) which was treated with 4.0 M HCl/dioxane (2 mL) and it was stirred at RT for 4 hours.
  • Example 52 Using a procedure analogous to Example 1, Example A36 (110 mg, 0.363 mmol) and Example BlO (150 ing, 0.363 mmol) were combined and purified by chromatography (Si-25 column, methanol/ethyl acetate) to give l-(2,3-difluoro-4-(2-(l- methyl-lH-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-3-(3-ethyl-l-(quinoIin-6-yl)-lH- pyrazol-5-yl)urea as a white foam (66 mg, 32% yield).
  • Example 53 Using a procedure analogous to Example 1, Example A38 (108 mg, 0.363 mmol) and Example BlO (150 mg, 0.363 mmol) were combined and purified by chromatography (Si-25 column, methanol/ethyl acetate) to give l-(3-ethyl-l-(quinolin-6- yl)-lH-pyra2ol-5-yl)-3-(2-fluoro-3-meihyl-4-(2-(l-methyl4H-pyrazol-4-yl)pyridin-4- yloxy)phenyl)urea as a white foam (78 mg, 38% yield).
  • Example 54 Using a procedure analogous to Example 1, Example B3 (0.10 g, 0.23 mmol) and Example A32 (56 mg, 0.23 mmol) in the presence of DIEA (68 ⁇ L) were combined to afford l-(3-tert-butyl-l-(quinolin-6-yl)-lH-pyrazol ⁇ 5-yl)-3 ⁇ (3-(5- chloropyridin-3-yloxy)-5-cyanophenyl)urea (39 mg, 32% yield).
  • Example 55 Using a procedure analogous to Example 1, Example B3 (0.10 g, 0.23 mmol) and Example A33 (51 mg, 0.23 mmol) in presence of DIEA (68 ⁇ L) were combined to afford l-(3-tert-butyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)-3-(3-cyano-5-(6- methylpyridin-3-yloxy)phenyl)urea (31 mg, 27% yield).
  • Example 56 Using a procedure analogous to Example 1, Example A41 (15 mg, 0.055 mrnol) and Example B9 (24 mg, 0.056 mmol) were combined to provide 1-(5-(4-(1H- pyrazol-4-yl)pyrimidin-2-yloxy)-2-fluorophenyl)-3-(3-isopropyl- 1 -(quinolin-6-yl)-l H- pyrazol-5-yl)urea (9 mg, 29% yield) 1 H NMR (400 MHz, DMSO- ⁇ 6 ) ⁇ 13.36 (s, 1 H),
  • ADP from the kinase reaction through coupling with the pyruvate kinase/lactate dehydrogenase system e.g., Schindler, et al. Science (2000) 259, 1938-1942.
  • the oxidation of NADH was continuously monitored spectrophometrically.
  • the reaction mixture (100 ⁇ l) contained AbI kinase (1 nM.
  • the absorption at 340 nrn was monitored continuously for 2 hours at 30 0 C on Polarstar Optima plate reader (BMG).
  • the reaction rate was calculated using the 1.0 to 2.0 h time frame. Percent inhibition was obtained by comparison of reaction rate with that of a control (i.e. with no test compound).
  • IC 50 values were calculated from a series of percent inhibition values determined at a range of inhibitor concentrations using software routines as implemented in the GraphPad Prism software package.
  • Activity of pAbl kinase was determined by following the production of ADP from the kinase reaction through coupling with the pyruvate kinase/lactate dehydrogenase system (e.g., Schindler, et al. Science (2000) 289, 1938-1942). In this assay, the oxidation of NADH (thus the decrease at A 340nm ) was continuously monitored spectrophometrically. The reaction mixture (100 ⁇ l) contained pAbl kinase (2 nM.
  • pAbl from deCode Genetics peptide substrate (EAIYAAPFAKKK (SEQ ID NO: 3), 0.2 mM), MgCl 2 (10 mM), pyruvate kinase (4 units), lactate dehydrogenase (0.7 units), phosphoenol pyruvate (1 mM), and NADH (0.28 mM) in 90 mM Tris buffer containing 0.2 % octyl-glucoside and 3.5 % DMSO, pH 7.5. Test compounds were incubated with pAbl (SEQ ID NO: 1) and other reaction reagents at 30 C for 2 h before ATP (500 ⁇ M) was added to start the reaction.
  • the absorption at 340 nm was monitored continuously for 2 hours at 30 0 C on Polarstar Optima plate reader (BMG).
  • the reaction rate was calculated using the 1.0 to 2.0 h time frame. Percent inhibition was obtained by comparison of reaction rate with that of a control (i.e. with no test compound).
  • IC 50 values were calculated from a series of percent inhibition values determined at a range of inhibitor concentrations using software routines as implemented in the GraphPad Prism software package.
  • pAbl was obtained as a phosphorylated form of the enzyme used in the AbI assay (see above).
  • the absorption at 340 ran was monitored continuously for 2 hours at 30 0 C on Polarstar Optima plate reader (BMG).
  • the reaction rate was calculated using the 1.0 to 2.0 h time frame. Percent inhibition was obtained by comparison of reaction rate with that of a control (i.e. with no test compound).
  • IC 5 0 values were calculated from a series of percent inhibition values determined at a range of inhibitor concentrations using software routines as implemented in the GraphPad Prism software package.
  • BaF3 cells (parental or transfected with the following: wild type bcr-Abl or bcr- AbI point mutants T315I, E255K, Y253F, M351T) were obtained from Professor Richard Van Etten (New England Medical Center, Boston, MA). Briefly, cells were grown in RPMl 1640 supplemented with 10% characterized fetal bovine serum (HyClone, Logan, UT) at 37 degrees Celsius, 5% CO 2 , 95% humidity. Cells were allowed to expand until reaching 80% saturation at which point they were subcultured or harvested for assay use.
  • wild type bcr-Abl or bcr- AbI point mutants T315I, E255K, Y253F, M351T were obtained from Professor Richard Van Etten (New England Medical Center, Boston, MA). Briefly, cells were grown in RPMl 1640 supplemented with 10% characterized fetal bovine serum (HyClone, Logan, UT) at 37 degrees Celsius, 5%
  • compounds 1-56 disclosed herein exhibited >50% inhibition activity at 0.1-2 uM concentration against AbI kinase and T315I AbI kinase.
  • WO 2006/071940 A2 describes inhibitors of kinases, including C-AbI kinase, B- Raf kinase, c-MET, VEGF kinase, and the HER family wherein a central phenyl ring is unsubstituted.
  • Compounds A, B and C, discussed below, are taken from from WO 2006/071940A2.
  • Example 15 is > 14-times more potent than Compound B vs. p-Abl kinase, and 18 times more potent than Compound B vs. the T315I mutant AbI kinase.
  • the R16-substituted analogs are 2.6-4.5 times more potent than the unsubstituted analogs in BaF3 cells expressing oncogenic bcr-abl kinase, 1.5-3.5 times more potent in BaF3 cells expressing the T315I mutant oncogenic form of bcr-abl kinase, 3.5-7.2 times more potent in BaF3 cells expressing the Y253F mutant oncogenic form of bcr-abl kinase, 4.4-6 times more potent in BaF3 cells expressing the E255K mutant oncogenic form of bcr-abl kinase, and 3.2-4.2 times more potent in BaF3 cells expressing the M351T mutant oncogenic form of bcr-abl kinase.
  • bcr-abl kinase are oncogenic and are causative of human chronic myelogenous leukemia. Moreover, the four mutant forms of bcr-abl kinase are resistant to the currently available bcr-abl inhibitor Gleevec ®.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Diabetes (AREA)
  • Pulmonology (AREA)
  • Rheumatology (AREA)
  • Oncology (AREA)
  • Hematology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Pain & Pain Management (AREA)
  • Cardiology (AREA)
  • Biomedical Technology (AREA)
  • Dermatology (AREA)
  • Communicable Diseases (AREA)
  • Vascular Medicine (AREA)
  • Endocrinology (AREA)
  • Obesity (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Ophthalmology & Optometry (AREA)
  • Toxicology (AREA)
  • Emergency Medicine (AREA)
  • Urology & Nephrology (AREA)
  • Transplantation (AREA)
  • Epidemiology (AREA)

Abstract

The present invention is concerned with novel compounds useful in the treatment of hyperproliferative diseases and mammalian cancers, especially human cancers. The invention also pertains to methods of modulating kinase activities, pharmaceutical compositions, and methods of treating individuals, incorporating or using the compounds. The preferred compounds are active small molecules set forth in formulae Ia-Iww.

Description

Kinase Inhibitors Useful for the Treatment of Myleoproliferative Diseases and other Proliferative Diseases
Cross Reference to Related Application This application claims the benefit of Provisional Application 60/850834 filed October 11 , 2006. This application is incorporated by reference herein.
Field of the Invention
The present invention relates to novel kinase inhibitors and modulator compounds useful for the treatment of various diseases. More particularly, the invention is concerned with such compounds, methods of treating diseases, and methods of synthesis of the compounds. Preferrably, the compounds are useful for the modulation of kinase activity of C-AbI, c-Kit, VEGFR, PDGFR, FIt-3, c-MET, the HER family, the Raf kinase family and disease polymorphs thereof.
Background of the invention
Several members of the protein kinase family have been clearly implicated in the pathogenesis of various proliferative and myleoproliferative diseases and thus represent important targets for treatment of these diseases. Some of the proliferative diseases relevant to this invention include cancer, rheumatoid arthritis, atherosclerosis, and retinopathies. Important examples of kinases which have been shown to cause or contribute to the pathogensis of these diseases include C-AbI kinase and the oncogenic fusion protein bcr-Abl kinase; c-Kit kinase, c-MET, the HER family, PDGF receptor kinase, VEGF receptor kinases, Flt-3 kinase and the Raf kinase family. C-AbI kinase is an important non-receptor tyrosine kinase involved in cell signal transduction. This ubiquitously expressed kinase — upon activation by upstream signaling factors including growth factors, oxidative stress, integrin stimulation, and ionizing radiation — localizes to the cell plasma membrane, the cell nucleus, and other cellular compartments including the actin cytoskeleton (Van Etten, Trends Cell Biol. (1999) 9; 179). There are two normal isoforms of AbI kinase: AbI-I A and AbI-IB. The N-terminal half of c-Abl kinase is important for autoinhibition of the kinase domain catalytic activity (Pluk et at, Cell (2002) 108: 247). Details of the mechanistic aspects of this autoinhibition have recently been disclosed (Nagar et al, Cell (2003) 112: 859). The N-terminal myristolyl amino acid residue of AbI- IB has been shown to intrainolecularly occupy a hydrophobic pocket formed from alpha-helices in the C-lobe of the kinase domain. Such intramolecular binding induces a novel binding area for intramolecular docking of the SH2 domain and the SH3 domain onto the kinase domain, thereby distorting and inhibiting the catalytic activity of the kinase. Thus, an intricate intramolecular negative regulation of the kinase activity is brought about by these N- terminal regions of c-Abl kinase. An aberrant dysregulated form of c-Abl is formed from a chromosomal translocation event, referred to as the Philadelphia chromosome (P. C. Nowell et al, Science (1960) 132: 1497; J.D. Rowley, Nature (1973) 243: 290). This abnormal chromosomal translocation leads aberrant gene fusion between the AbI kinase gene and the breakpoint cluster region (BCR) gene, thus encoding an aberrant protein called bcr-Abl (G. Q. Daley et al, Science (1990) 247: 824; M. L. Gishizky et al, Proc. Natl. Acad. ScL USA (1993) 90: 3755; S. Li et al, J. Exp. Med. (1999) 189: 1399). The bcr-Abl fusion protein does not include the regulatory myristolylation site (B. Nagar et al, Cell (2003) 1 12: 859) and as a result functions as an oncoprotein which causes chronic myeloid leukemia (CML). CML is a malignancy of pluripotent hematopoietic stem cells. The p210 form of bcr-Abl is seen in 95% of patients with CML, and in 20% of patients with acute lymphocytic leukemia. A pi 85 form has also been disclosed and has been linked to being causative of up to 10% of patients with acute lymphocytic leukemia.
The majority of small molecule kinase inhibitors that have been reported have been shown to bind in one of three ways. Most of the reported inhibitors interact with the ATP binding domain of the active site and exert their effects by competing with ATP for occupancy. Other inhibitors have been shown to bind to a separate hydrophobic region of the protein known as the "DFG-in-conformation" pocket, and still others have been shown to bind to both the ATP domain and the "DFG-in-conformation" pocket. Examples specific to inhibitors of Raf kinases can be found in Lowinger et al, Current Pharmaceutical Design (2002) 8: 2269-2278; Dumas, J. et al, Current Opinion in Drug Discovery & Development (2004) 7: 600-616; Dumas, J. et al, WO 2003068223 Al (2003); Dumas, J., et al, WO 9932455 Al (1999), and Wan, P.T.C., et al, Cell (2004) 116: 855-867. Physiologically, kinases are regulated by a common activatioπ/deactivation mechanism wherein a specific activation loop sequence of the kinase protein binds into a specific pocket on the same protein which is referred to as the switch control pocket (see WO 200380110049 for further details). Such binding occurs when specific amino acid residues of the activation loop are modified for example by phosphorylation, oxidation, or nitrosylation. The binding of the activation loop into the switch pocket results in a conformational change of the protein into its active form (Huse, M. and Kuriyan, J. Cell (109) 275-282).
Summary of the Invention
Compounds of the present invention find utility in the treatment of hyperproliferative diseases, mammalian cancers and especially human cancers including but not limited to malignant, melanomas, glioblastomas, ovarian cancer, pancreatic cancer, prostate cancer, lung cancers, breast cancers, kidney cancers, cervical carcinomas, thyroid cancer metastasis of primary solid tumor secondary sites, myeloproliferative diseases, chronic myelogenous leukemia, acute lymphocytic leukemia, other myeloproliferative disorders, papillary thyroid carcinoma, non small cell lung cancer, mesothelioma, hypereosinophilic syndrome, gastrointestinal stromal tumors, colonic cancers, ocular diseases characterized by hyperproliferation leading to blindness including various retinopathies, i.e. diabetic retinopathy and age-related macular degeneration, rheumatoid arthritis, asthma, chronic obstructive pulmonary disorder, human inflammation, rheumatoid spondylitis, ostero-arthritis, asthma, gouty arthritis, sepsis, septic shock, endotoxic shock, Gram-negative sepsis, toxic shock syndrome, adult respiratory distress syndrome, stroke, reperfusion injury, neural trauma, neural ischemia, psoriasis, restenosis, chronic obstructive pulmonary disease, bone resorptive diseases, graft-versus-host reaction, Chron's disease, ulcerative colitis, inflammatory bowel disease, pyresis, and combinations thereof, a disease caused by c-Abl kinase, oncogenic forms thereof, aberrant fusion proteins thereof and polymorphs thereof, a disease caused by a Raf kinase, oncogenic forms thereof, aberrant fusion proteins thereof and polymorphs thereof, c-Kit kinase, oncogenic forms thereof, aberrant fusion proteins thereof and polymorphs thereof, Flt-3 kinase, oncogenic forms thereof, aberrant fusion proteins thereof and polymorphs thereof, VEGFR kinase, oncogenic forms thereof, aberrant fusion proteins thereof and polymorphs thereof, PDGFR kinase, oncogenic forms thereof, aberrant fusion proteins thereof and polymorphs thereof, c-MET kinase, oncogenic forms thereof, aberrant fusion proteins thereof and polymorphs thereof and a disease caused by a HER kinase, oncogenic forms thereof, aberrant fusion proteins thereof and polymorphs thereof.
Description of the Preferred Embodiments
The following descriptions refer to various compounds and moieties thereof.
Carbocyclyl refers to carbon rings taken from cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptanyl, cyclooctanyl, norboranyl, norborenyl, bicyclo[2.2.2]octanyl, and bicyclo[2.2.2]octenyl;
Halogen refers to fluorine, chlorine, bromine and iodine;
Aryl refers to monocyclic or fused bicycHc ring systems characterized by delocalized π electrons (aromaticity) shared among the ring carbon atoms of at least one carbocyclic ring; preferred aryl rings are taken from phenyl, naphthyl, tetrahydronaphthyl, indenyl, and indanyl;
Heteroaryl refers to monocyclic or fused bicyclic ring systems characterized by delocalized π electrons (aromaticity) shared among the ring carbon or heteroatoms including nitrogen, oxygen, or sulfur of at least one carbocyclic or heterocyclic ring; heteroaryl rings are taken from, but not limited to, pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl, pyridinyl, pyrimidinyl, pyrazinyl, pyridazinyl, triazinyl, indolyl, indolinyl, isoindolyl, isoindolinyl, indazolyl, benzofuranyl, benzothienyl, benzotbJazolyl, benzothiazolonyl, benzoxazolyl, benzoxazolonyl, benzisoxazolyl, benzisothiazolyl, benzimidazolyl, benzimidazolonyl, benztriazolyl, imidazopyridinyl, pyrazolopyridinyl, iraidazolonopyridinyl, thiazolopyridinyl, thiazolonopyridinyl, oxazolopyridinyl, oxazolonopyridinyl, isoxazolopyridinyl, isothiazolopyridinyl, triazolopyridinyl, imidazopyrimidinyl, pyrazolopyrimidinyl, imidazolonopyrimidinyl, thiazolopyridiminyl, thiazolonopyrimidinyl, oxazolopyridiminyl, oxazolonopyrimidinyl, isoxazolopyrimidinyl, isothiazolopyrimidinyl, triazolopyrimidinyl, dihydropurinonyl, pyrrolopyrimidinyl, purinyl, pyrazolopyrimidinyl, phthalimidyl, phthalimidinyl, pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl, cϊnnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolϊnyl, phthalazinyl, benzodioxyl, benzisothiazoline- 1 , 1 ,3-trionyl, dihydroquinolinyl, tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl, benzoazepinyl, benzodiazepinyl, benzoxapinyl, and benzoxazepinyl;
Heterocyclyl refers to monocyclic rings containing carbon and heteroatoms taken from oxygen, nitrogen, or sulfur and wherein there is not delocalized π electrons (aromaticity) shared among the ring carbon or heteroatoms; heterocyclyl rings include, but are not limited to, oxetanyl, azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl, oxazolidinyl, thiazolinyl, thiazolidinyl, pyranyl, thiopyranyl, tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl, thiomorpholinyl, thiomorpholinyl S-oxide, thiomorpholinyl S-dioxide, piperazinyl, azepinyl, oxepinyl, diazepinyl, tropanyl, and homotropanyl;
Poly-aryϊ refers to two or more monocyclic or fused aryl bicyclic ring systems characterized by delocalized π electrons (aromaticity) shared among the ring carbon atoms of at least one carbocyclic ring wherein the rings contained therein are optionally linked together;
Poly-heteroaryl refers to two or more monocyclic or fused bicyclic systems characterized by delocalized π electrons (aromaticity) shared among the ring carbon or heteroatoms including nitrogen, oxygen, or sulfur of at least one carbocyclic or heterocyclic ring wherein the rings contained therein are optionally linked together, wherein at least one of the monocyclic or fused bicyclic rings of the poly-heteroaryl system is taken from heteroaryl as defined broadly above and the other rings are taken from either aryl, heteroaryl, or heterocyclyl as defined broadly above;
Poly-heterocyclyl refers to two or more monocyclic or fused bicyclic ring systems containing carbon and heteroatoms taken from oxygen, nitrogen, or sulfur and wherein there is not delocalized π electrons (aromaticity) shared among the ring carbon or heteroatoms wherein the rings contained therein are optionally linked, wherein at least one of the monocyclic or fused bicyclic rings of the poly-heteroaryl system is taken from heterocyclyl as defined broadly above and the other rings are taken from either aryl, heteroaryl, or heterocyclyl as defined broadly above;
Lower alkyl refers to straight or branched chain Cl-C6alkyls;
Substituted in connection with a moiety refers to the fact that a further substituent may be attached to the moiety to any acceptable location on the moiety.
The term salts embraces pharmaceutically acceptable salts commonly used to form alkali metal salts of free acids and to form addition salts of free bases. The nature of the salt is not critical, provided that it is pharmaceutically-acceptable. Suitable pharmaceutically- acceptable acid addition salts may be prepared from an inorganic acid or from an organic acid. Examples of such inorganic acids are hydrochloric, hydrobromic, hydroiodic, nitric, carbonic, sulfuric and phosphoric acid. Appropriate organic acids may be selected from aliphatic, cycloaliphatic, aromatic, aryl aliphatic, and heterocyclyl containing carboxylic acids and sulfonic acids, examples of which are formic, acetic, propionic, succinic, glycolic, gluconic, lactic, malic, tartaric, citric, ascorbic, glucuronic, maleic, fumaric, pyruvic, aspartic, glutamic, benzoic, anthranilic, mesylic, stearic, salicylic, p- hydroxybenzoic, phenylacetic, mandelic, embonic (pamoic), methanesulfonic, ethanesulfonic, 2-hydroxyethanesulfonic, benzenesulfomc, pantothenic, toluenesulfonic, 2-hydroxyethanesulfonic, sulfanilic, cyclohexylaminosulfonic, algenic, 3-hydroxybutyric, galactaric and galacturonic acid. Suitable pharmaceutically-acceptable salts of free acid-containing compounds of the invention include metallic salts and organic salts. More preferred metallic salts include, but are not limited to appropriate alkali metal (group Ia) salts, alkaline earth metal (group Ha) salts and other physiological acceptable metals. Such salts can be made from aluminum, calcium, lithium, magnesium, potassium, sodium and zinc. Preferred organic salts can be made from primary amines, secondary amines, tertiary amines and quaternary ammonium salts, including in part, tromethamine, diethyl amine, te/ra-N-methylammonium, N,N'-dibenzylethylenediamine, chloroprocaine, choline, diethanolamine, ethylenediamine, meglumine (N-methylglucamine) and procaine.
The term prodrug refers to derivatives of active compounds which revert in vivo into the active form. For example, a carboxylic acid form of an active drug may be esterified to create a prodrug, and the ester is subsequently converted in vivo to revert to the carboxylic acid form. See Ettmayer et. al, J. Med. Chem, 2004, 47(10), 2393-2404 and Lorenzi et. al, J. Pharm. Exp. Therpeutics, 2005, 883-8900 for reviews.
1. First aspect of the invention - Compounds, Methods, Preparations and Adducts The invention includes compounds of the formula Ia:
Figure imgf000008_0001
wherein Ql and Q2 are each individually and independently selected from the group consisting of N and C-Z6, provided that both Ql and Q2 are not simultaneously C-Z6;
El is selected from the group consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, pyrrolidinyl piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl and wherein the El ring is substituted with one or more Rl 6 moieties and wherein the El ring is substituted with one or more Rl 8 moieties;
wherein A is selected from the group consisting of phenyl, C3-C8carbocyclyl, pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl, pyrazinyl, pyridazinyl, triazinyl, pyridinyl, pyrimidinyl, and G4;
Gl is a heteroaryl taken from the group consisting of pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl, pyrazinyl, pyridazinyl, triazinyl, pyridinyl, and pyrimidinyl;
G2 is a fused bicyclic heteroaryl taken from the group consisting of indolyl, indolinyl, isoindolyl, isoindolinyl, indazolyl, benzofuranyl, benzothienyl, benzothiazolyl, benzothiazolonyl, benzoxazolyl, benzoxazolonyl, benzisoxazolyl, benzisothiazolyl, benzimidazolyl, benzimidazolonyl, benztriazolyl, imidazopyridinyl, pyrazolopyridinyl, imidazolonopyridinyl, thiazolopyridinyl, thiazolonopyridinyl, oxazolopyridinyl, oxazolonopyridinyl, isoxazolopyridinyl, isothiazolopyridinyl, triazolopyridinyl, imidazopyrimidinyl, pyrazolopyrimidinyl, imidazolonopyrimidinyl, thiazolopyridiminyl, thiazolonopyrimidinyl, oxazolopyridiminyl, oxazolonopyrimidinyl, isoxazolopyrimidinyl, isotliiazolopyrimidinyl, triazolopyrimidinyl, dihydropurinonyl, pyrrolopyrimidinyl, purinyl, pyrazolopyrimidinyl, phthaliniidyl, phthalimidinyl, pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl, cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl, phthalazinyl, benzodioxyl, benzisothiazoline-l,l,3-trionyl, dihydroquinolinyl, tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl, benzoazepinyl, benzodiazepinyl, benzoxapinyl, and benzoxazepinyl;
G3 is a non-fused bicyclic heteroaryl taken from the group consisting of pyridylpyridiminyl pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl, imidazolylpyrimidinyl, isoxazolylpyrimidinyl, isothiazolylpyrimidinyl, pyrazolylpyrimidinyl, triazolylpyrimidinyl, oxadiazoylpyrimidinyl, thiadiazoylpyrimidinyl, morpholinylpyrimidinyl, dioxothiomorpholinylpyrimidinyl, and thiomoφholinylpyrimidinyl ; G4 is a heterocyclyl taken from the group consisting of oxetanyl, azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl, oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl, tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl, thiomorpholinyl, tliiomoφholinyl S-oxide, thiomoφholinyl S-dioxide, piperazinyl, azepinyl, oxepinyl, diazepinyl, tropanyl, and homotropanyl;
The A ring is substituted at any substitutable position with one Al moiety, wherein Al is selected from the group consisting of A2, A3 and A4;
A2 is selected from the group consisting of
Figure imgf000010_0001
A3 is selected from the group consisting of
Figure imgf000011_0001
A4 is selected from the group consisting of
Figure imgf000012_0001
and wherein the symbol (**) is the point of attachment to the A ring of formula Ia;
and wherein — indicates either a saturated or unsaturated bond;
the A ring is optionally substituted with one or more R2 moieties;
X2 is selected from the group consisting of C1-C6 alkyl, C2-C6 branched alkyl, and a direct bond wherein El is directly linked to the NR3 group of foπnula Ia;
X3 is selected from the group consisting of -C(=O)-, -O-, ~O-(CH2)n-, -S-(CH2V, -NR3- (CH2)n-, -0-(CH2VO-, -O-(CH2)q-NR3-, -N(R3)-(CH2)q-N(R3)-, -(CH2)n-N(R4)-C(-O)-, -(CH2VN(R4)-C(=O)(CH2V, -(CH2)n-C(=O)N(R4)-, -(CH2)P-, C2-C5alkenyl, C2- CSalkynyl, and C3-C6cycloalkyl and wherein the carbon atoms of -(CH2V, -(CH2V, " (CH2)P-, C2-C5alkenyl, and C2-C5alkynyl moieties of X3 may be further substituted by one or more Cl-Cόalkyl;
V, Vl, and V2 are each independently and respectively selected from the group consisting of O and H2;
each Z2 is independently and individually selected from the group consisting of hydrogen, aryl, Cl-Cόalkyl, C3-C8carbocyclyl, hydroxyl, hydroxyCl-Cόalkyl-, cyano, (R3)2N-, (R4)2N-, (R4)2NC1-Cόalkyl-, (R4)2NC2-C6alkylN(R4)-(CH2)π-, (R4)2NC2- C6alkylO(CH2)n-, (R3)2NC(O)-, (R4)2NC(O)~, (R4)2NC(O)C1-C6alkyl-, carboxyl, carboxyCl-C6 alkyl-, Cl-Cόalkoxycarbonyl-, Cl-C6alkoxycarbonylCl-C6alkyI-, (R3)2NSO2-, (R4)2NSO2-, -SO2RS, -SO2R8, -(CH2)nN(R4)C(O)R8, -C(O)R8, =O, =NOH, =N(OR6), -(CH2)nGl, -(CH2)nG4, -(CH2)nO(CH2)nGl, -(CH2)nO(CH2)πG4, - (CH2)nNR3(CH2)n-aryl, -(CH2)nNR3(CH2)πGl , -(CH2)nNR3(CH2)nG4, (CH2)nNHC(O)NHS(O)2R8, -(CH2)πNHS(O)2NHC(O)R8, -C(O)NHS(O)2R8, (CH2)NHC(O)(CH2)nR5, -(CH2)nNHS(O)2R5, -(CH2)nC(O)NH(CH2)qR5, (CH2)nC(O)R5, -(CH2)nOC(O)R5, and -(CH2)nR5;
in the event that Z2 contains an alkyl or alkylene moiety, such moieties may be further substituted with one or more Cl-C6alkyls;
each Z3 is independently and individually selected from the group consisting of H, Cl- Cόalkyl, branched C3-C7alkyl, C3-C8carbocyclyl, halogen, fluoroCl-Cβalkyl wherein the alkyl moiety can be partially or fully fluorinated, cyano, hydroxyl, methoxy, oxo, (R3)2NC(O)-, (R4)2NC(O)-, -N(R4)C(O)R8, (R3)2NSO2-, (R4)2NSO2-, -N(R4)SO2R5, - N(R4)SO2R8, -(CH2)nN(R3)2, -(CH2)nN(R4)2, -O(CH2)qN(R4)2j -O(CH2)qO-Cl-C6alkyl, -N(R3)(CH2)qO-Cl-C6alkyl, ~N(R3)(CH2)qN(R4)2, -O(CH2)qR5, -NR3(CH2)qR5, - C(O)RS, -C(O)R8, -RS, and nitro;
in the event that Z3 contains an alkyl or alkylene moiety, such moieties may be further substituted with one or more Cl-C6alkyls; each Z4 is independently and individually selected from the group consisting of H, Cl- Cδalkyl, hydroxyC2-C6alkyl, Cl-C6alkoxyC2-C6alkyl-, (R4)2N-C2-C6alkyl-, (R4)2N- C2-C6alkylN(R4)-C2-C6alkyl-, (R4)2N-C2-C6alkyl-O-C2-C6alkyl- (R4)2NC(O)-C 1 - Cόalkyl-, carboxyCl-Cδalkyl-, Cl-C6alkoxycarbonylCl-C6alkyl-, -C2-
C6aIkyIN(R4)C(O)R8, R8-C(=NR3)-, -SO2R8, -COR8, -(CH2JnGl, -(CH2)nG4, -(CH2)q- O(CH2)nGl, -(CH2)qO(CH2)nG4, -(CH2)qNR3(CH2)nGl, -(CH2)qNR3(CH2)nG4, - (CH2)qNHC(O)(CH2)nR5, -(CH2)qC(O)NH(CH2)qR5, -(CH2)qC(O)R5, -(CH2)qOC(O)R5, -(CH2)qR5, -(CH2)qNR4(CH2)qR5, and -(CH2)qO(CH2)qR5;
in the event that Z4 contains an alkyl or alkylene moiety, such moieties may be further substituted with one or more Cl-C6alkyls;
each Z6 is independently and individually selected from the group consisting of H, Cl- Cόalkyl, branched C3-C7alkyl, hydroxyl, hydroxyCl -Cόalkyl, hydroxyC2-C6 branched alkyl-, Cl-C6alkoxy, C l-C6alkoxyCl -Cόalkyl-, Cl-C6alkoxyC2-C6 branched alkyl-, branched C2-C6alkoxy-, Cl-Cόalkylthio, (R3)2N-, -N(R3)COR8, (R4)2N-, -R5, - N(R4)C(O)R8, -N(R3)SO2R6, -C(O)N(R3)2, -C(O)N(R4)2, -C(O)RS, -SO2NHR4, halogen, fluoroCl -Cόalkyl wherein the alkyl is fully or partially fluorinated, cyano, fluoroCl -Cόalkoxy wherein the alkyl is fully or partially fluorinated, -O(CH2)qN(R4)2, - N(R3)(CH2)qN(R4)2, -O(CH2)qO~Cl -Cόalkyl, -O(CH2)qN(R4)2, -N(R3)(CH2)qO-DCl- Cόalkyl, -N(R3)(CH2)qN(R4)2? -O(CH2)qR5, and -N(R3)(CH2)qR5, -(NR3)rR17, - (O)rR17, -(S)1Rl 7, -(CH2)nR17, -(CHz)nGl, -(CH2)nG4, -(CH2)qO(CH2)nGl , - (CH2)qO(CH2)πG4, -(CH2)qN(R3)(CH2)πGl, and -(CH2)qNR3(CH2)nG4;
each R2 is selected from the group consisting of Z3-substituted aryl, Z3 -substituted Gl, Z3-substituted G4, Cl-C6alkyl, branched C3-C8alkyl, Rl 9 substituted C3- C8carbocyclyl, hydroxylCl-C6alky, hydroxyl branched C3-C6alkyl-, hydroxyl substituted C3-C8carbocyclyl-, cyanoCl -Cόalkyl-, cyano substituted branched C3- Cόalkyl-, cyano substituted C3-C8carbocyclyl-, (R4)2NC(O)C1 -Cόalkyl-, (R4)2NC(O) substituted branched C3-C6alkyl-, (R4)2NC(O) substituted C3-C8carbocyclyl-, fluoroCl - Cόalkyl wherein the alkyl is fully or partially fluorinated, halogen, cyano, Cl-C6alkoxy, and fluoroCl-Cόalkoxy wherein the alkyl group is fully or partially fluorinated;
each R3 is independently and individually selected from the group consisting of H, Cl- Cόalkyl, branched C3-C7alkyl, C3-C7cycloalkyl, and Z3-substituted phenyl-;
each R4 is independently and individually selected from the group consisting of H, Cl- Cόalkyl, hydroxyCl -Cόalkyl-, dihydroxyCl -Cόalkyl-, Cl -CόalkoxyCl -Cόalkyl-, branched C3-C7alkyl-, branched hydroxyCl -Cόalkyl-, branched C 1 -CόalkoxyCl - Cόalkyl-, branched dihydroxyC2-C6alkyl-, -(CH2)PN(R7)2, -{CH2)PR5, - (CH2)PC(O)N(R7)2, -(CH2)nC(O)R5, -(CH2)nC(O)OR3, C3-C8carbocyclyl, hydroxyl substituted C3-C8carbocyclyl-S alkoxy substituted C3-C8carbocyclyl-, dihydroxyl substituted C3-C8carbocyclyl-, and -(CH2)nR17;
each R5 is independently and individually selected from the group consisting of
Figure imgf000015_0001
and wherein the symbol (##) is the point of attachment of the R5 moiety;
each R6 is independently and individually selected from the group consisting of Cl- Cόalkyl, branched C3-C7alkyl, C3-C8carbocyclyl, phenyl, Gl , and G4;
each R7 is independently and individually selected from the group consisting of H, Cl- Cόalkyl, hydroxyC2-CόalkyI-, dihydroxyC2-C6alkyl-, C2-C6alkoxyC2-C6alkyl-, branched C3-C7alkyl-, branched hydroxyC2-Cό alkyl-, branched C2-C6alkoxyC2- Cόalkyl-, branched dihydroxyC2 -Cόalkyl-, -(CH2)qR5, -(CH2)nC(O)R5, - (CH2)nC(O)OR3, C3-C8carbocyclyl, hydroxyl substituted C3-C8carbocyclyl-, alkoxy substituted C3-C8carbocyclyl-, dihydroxy substituted C3-C8carbocyclyl, and - (CH2)nRl 7; each R8 is independently and individually selected from the group consisting of Cl- Cόalkyl, branched C3-C7alkyl, fluoroCl -Cόalkyl wherein the alkyl moiety is partially or fully fluorinated, C3-C8carbocyclyl, Z3 -substituted phenyl-, Z3 -substituted phenylCl- Cόalkyl-, Z3-substituted Gl-, Z3 -substituted Gl-Cl-C6alkyl-, Z2-substituted G4-, Z2- substituted G4-Cl-C6alkyl-, OH, Cl-C6alkoxy, N(R3)2, N(R4)2, and R5;
each R9 is independently and individually selected from the group consisting of H, F, Cl- Cόalkyl, branched C3-C7alkyl, C3-C7cycloalkyl, phenyl, phenyl-Cl-C6alkyl-, - (CH2)nGl, and -(CH2)nG4;
each RlO is independently and individually selected from the group consisting of CO2H, CO2Cl -Cόalkyl, -C(O)N(R4)2, OH, Cl-Cόalkoxy, and -N(R4) 2;
each Rl 3 is independently and individually selected from the group consisting of H, Cl- Cόalkyl, branched C3-C7alkyl, carbocyclyl, hydroxyC2-C7alkyl, Cl-C6alkoxyC2- C7alkyl-, (R4)2NC(O)-, (R4)2NC(O)C1-C6alkyl-, carboxyCl -Cόalkyl-, Cl- Cόalkoxycarbonyl-, C 1 -C6 alkoxycarbonylCl -Cόalkyl-, (R4)2N-C2-C6alkyl-, <R4)2N- C2-C6alkylN(R4)(CH2)q-, R5-C2-C6alkylN(R4)(CH2)q-, (R4)2N-C2-C6alkyl0(CH2)q-, R5-C2-C6alkylO(CH2)q-, -(CH2)qN(R4)C(O)R8, aryl, arylCl -Cόalkyl, aryloxyC2~ Cόalkyl-, arylaminoC2-C6alkyl-, Cl -CόalkoxycarbonylCl -Cόalkyl-, -C2- C6alkylN(R4)C(O)R8, R8C(=NR3)-, -SO2RS, -COR8, -(CH2)nGl, -(CH2)n-G4, - (CH2)nO(CH2)nGl, -(CH2)nO(CH2)nG4, -(CH2)nN(R3)(CH2)nGl, and (CHΞ)nN(R3)(CH2)nG4;
each R14 is independently and respectively selected from the group consisting of H, Cl- Cόalkyl, branched C3-C6alkyl, and C3-C7carbocyclyl;
each Rl 6 is independently and individually selected from the group consisting of Cl-
Cόalkyl, branched C3-C7alkyl, C3-C8 carbocyclyl, halogen, fluoro Cl-Cόalkyl wherein the alkyl moiety can be partially or fully fluorinated, cyano, hydroxyl, Cl-C6alkoxy, fluoroCl-Cόalkoxy wherein the alkyl moiety can be partially or fully fluorinated, - N(R3)2, -N(R4)2, and nitro;
each Rl 7 is taken from the group comprising phenyl, naphthyl, pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl, pyrazinyl, pyridazinyl, triazinyl, oxetanyl, azetadinyl, tetrahydrofuranyl, oxazolinyl, oxazolidinyl, pyranyl, thiopyranyl, tetrahydropyranyl, dioxalinyl, azepinyl, oxepinyl, diazepinyl, pyrrolidinyl, and piperidinyl;
wherein Rl 7 can be further substituted with one or more Z2, Z3 or Z4 moieties;
Rl 8 is independently and individually selected from the group consisting of hydrogen, Cl-C6alkyl, branched C3-C7alkyl, C3-C8carbocyclyl, halogen, fluoroCl-Cόalkyl wherein the alkyl moiety can be partially or fully fluorinated, cyano, hydroxyl, Cl- C6alkoxy, fluoroCl-Cόalkoxy wherein the alkyl moiety can be partially or fully fluorinated, -N(R3)2, -N(R4)2, C2-C3alkynyl, and nitro;
R19 is H or Cl-C6alkyl;
wherein two R3 or R4 moieties are independently and individually taken from the group consisting of Cl-C6alkyl and branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen atom, said moieties may cyclize to form a C3-C7 heterocyclyl ring;
and n is 0-6; p is 1-4; q is 2-6; r is 0 or 1; t is 1-3, v is 1 or 2;
with the proviso that compounds of formula Ia can not be
Figure imgf000018_0001
1.1 Compounds of Formula Ia which exemplify preferred A andX2-El Moieties In a preferred embodiment of compounds of formula Ia, said compounds have structures of formula I-lb:
Figure imgf000018_0002
wherein the A ring is pyrazolyl.
1.1.1 Compounds of Formula I~lb which exemplify preferred Al Moieties hi a preferred embodiment of compounds of formula I-lb, said compounds have structures of formula I- 1 c:
Figure imgf000018_0003
1.1.2 Compounds of Formula Ib which exemplify preferred Al Moieties
In a preferred embodiment of compounds of formula I-lb, said compounds have structures of formula I- 1 d
Figure imgf000018_0004
1.1.3 Compounds of Formula I-lb which exemplify preferred Al Moieties
In a preferred embodiment of compounds of formula I-lb, said compounds have structures of formula I- Ie
Figure imgf000019_0001
i.7.4 More preferred compounds of Section 1.1
In a preferred embodiment of compounds from Section 1.1, said compounds have structures of formula I- If:
Figure imgf000019_0002
1.1.5 Compounds of Section 1.1.4 with preferred Rl 6 moieties
In a preferred embodiment of compounds from Section 1.1.4, said compounds have structures of formula I- Ig:
Figure imgf000019_0003
1.1.6 Compounds of Section 1.1.5 with a more preferred Al moieties
In a more preferred embodiment of compounds from Section 1.1.5, said compounds have structures of formula I- Ih:
Figure imgf000019_0004
"Wherein Al is selected from the group consisting of
Figure imgf000019_0005
1.1.7 Compounds of Section 1.1.5 with a more preferred Z6 moieties
In a more preferred embodiment of compounds from Section 7.7.5, said compounds have structures of formula I- H:
Figure imgf000020_0001
wherein Z6 is -C(O)NHR4, -NHR4 or Rl 9 substituted pyrazole;
1.2 Compounds of Formula Ia which exemplify preferred A andX2-El Moieties
In a preferred embodiment of compounds of formula Ia, said compounds have structures of formula I-2a:
Figure imgf000020_0002
Where in the A ring is isoxazolyl.
1.2.1 Compounds of Formula I-2a wh ich exemplify preferred A 1 Moieties
In a preferred embodiment of compounds of formula I-2a, said compounds have structures of formula I-2b:
Figure imgf000020_0003
1.2.2 Compo unds of Formula 1-2 a which exemplify preferred A 1 Moieties
In a preferred embodiment of compounds of formula 1-2 a, said compounds have structures of formula I-2c:
Figure imgf000020_0004
1.2.3 Compounds of Formula I-2a which exemplify preferred A 1 Moieties
In a preferred embodiment of compounds of formula 1-2 a, said compounds have structures of formula I-2d;
Figure imgf000021_0001
1.2,4 More preferred compo unds of Section 1.2
In a preferred embodiment of compounds from Section 1.2, said compounds have structures of formula I-2e:
Figure imgf000021_0002
1.2.5 Compounds of Section 1.2.4 with preferred Rl 6 moieties
In a preferred embodiment of compounds from Section 1.2.4, said compounds have structures of formula I-2f:
Figure imgf000021_0003
1.2.6 Compounds of Section 1.2.5 with a more preferred Al moieties
In a more preferred embodiment of compounds from Section 1.2.5, said compounds have structures of formula I-2g:
Figure imgf000021_0004
Wherein Al is selected from the group consisting of
Figure imgf000021_0005
/.2.7 Compounds of Section 1.2.5 with a more preferred 26 moieties In a more preferred embodiment of compounds from Section 1.2.5, said compounds have structures of formula I-2h:
Figure imgf000022_0001
wherein Zό is -C(O)NHR4, -NHR4 or Rl 9 substituted pyrazole;
1.3 Compounds of Formula Ia which exemplify preferred A andX2-El Moieties
In a preferred embodiment of compounds of formula Ia, said compounds have structures of formula 1-3 a:
Figure imgf000022_0002
wherein the A ring is thienyl. 1.3.1 Compo unds of Formula 1-3 a wh ich exemplify preferred A 1 Moieties
In a preferred embodiment of compounds of formula I-3a, said compounds have structures of formula I-3b:
Figure imgf000022_0003
i .3.2 Compo unds of Formula Ix wh ich exemplify preferred A I Moieties In a preferred embodiment of compounds of formula I-3a, said compounds have structures of formula I-3c:
Figure imgf000022_0004
/.5.-? Compounds of Formula I- 3 a which exemplify preferred Al Moieties In a preferred embodiment of compounds of formula 1-3 a, said compounds have structures of formula 1-3 d:
Figure imgf000022_0005
1.3.4 More preferred compounds of Section 1.3
In a preferred embodiment of compounds from Section 1.3, said compounds have structures of formula I-3e:
Figure imgf000023_0001
1.3.5 Compounds of Section 1.3.4 with preferred Rl 6 moieties
In a preferred embodiment of compounds from Section 1.3.4, said compounds have structures of formula 1-3 f:
Figure imgf000023_0002
/.5.6 Compounds of Section 1.3.5 with a more preferred Al moieties In a more preferred embodiment of compounds from Section 7.3.5, said compounds have structures of formula I-3g:
Figure imgf000023_0003
Wherein Al is selected from the group consisting of
Figure imgf000023_0004
7.3.7 Compo unds of Section 1.3.5 with a more preferred Z6 moieties
In a more preferred embodiment of compounds from Section 7.3.5, said compounds have structures of formula I-3h:
Figure imgf000024_0001
wherein Z6 is -C(O)NHR4, -NHR4 or Rl 9 substituted pyrazole;
1.4 Compounds of Formula Ia which exemplify preferred A andX2-El Moieties
In a preferred embodiment of compounds of formula Ia, said compounds have structures of formula I-4a:
Figure imgf000024_0002
wherein the A ring is furyl.
1.4.1 Compounds of Form ula Iu wh ich exemplify preferred A 1 Moieties
In a preferred embodiment of compounds of formula I-4a, said compounds have structures of formula I-4b :
Figure imgf000024_0003
1.4.2 Compounds of Formula IU which exemplify preferred Al Moieties
In a preferred embodiment of compounds of formula I-4a, said compounds have structures of formula I-4c:
Figure imgf000024_0004
1.4.3 Compounds of Formula Im which exemplify preferred Al Moieties
In a preferred embodiment of compounds of formula I-4a, said compounds have structures of formula I-4d:
Figure imgf000024_0005
1.4.4 More preferred compounds of Section 1.4 In a preferred embodiment of compounds from Section 1.4, said compounds have structures of formula I-4e:
Figure imgf000025_0001
1,4.5 Compounds of Section 1.4.4 with preferred Rl 6 moieties
In a preferred embodiment of compounds from Section 1.4.4, said compounds have structures of formula I-4f:
Figure imgf000025_0002
1.4.6 Compounds of Section 1.4.5 with a more preferred Al moieties hi a more preferred embodiment of compounds from Section 1.4.5, said compounds have structures of formula I-4g:
Figure imgf000025_0003
Wherein Al is selected from the group consisting of
Figure imgf000025_0004
1.4.7 Compounds of Section 1.4.5 with a more preferred 26 moieties
In a more preferred embodiment of compounds from Section 1.4.5, said compounds have structures of formula I-4h:
Figure imgf000026_0001
wherein Z6 is -C(O)NHR4, -NHR4 or Rl 9 substituted pyrazole; 1.5 Compounds of Formula Ia which exemplify preferred A andX2-El Moieties In a preferred embodiment of compounds of formula Ia, said compounds have structures of formula 1-5 a:
Figure imgf000026_0002
wherein the A ring is pyrrolyl. i .5.1 Compo unds of Formula 1-5 a wh ich exemplify preferred A 1 Moieties In a preferred embodiment of compounds of formula I-5a, said compounds have structures of formula I-5b :
Figure imgf000026_0003
1.5.2 Compounds of Formula 1-5 a which exemplify preferred Al Moieties
In a preferred embodiment of compounds of formula 1-5 a, said compounds have structures of formula I-5c:
Figure imgf000026_0004
i.J.3 Compounds of Formula -5 a which exemplify preferred Al Moieties
In a preferred embodiment of compounds of formula 1-5 a, said compounds have structures of formula I-5d:
Figure imgf000026_0005
7.5.^ More preferred compounds of Section 1.5 In a preferred embodiment of compounds from Section 1.5, said compounds have structures of formula I-5e:
Figure imgf000027_0001
1.5.5 Compounds of Section 1.5.4 with preferred Rl 6 moieties
In a preferred embodiment of compounds from Section 1.5.4, said compounds have structures of formula 1-5 f:
Figure imgf000027_0002
1.5.6 Compounds of Section 1.5.5 with a more preferred Al moieties
In a more preferred embodiment of compounds from Section 7.5.5, said compounds have structures of formula I-5g:
Figure imgf000027_0003
Wherein Al is selected from the group consisting of
Figure imgf000027_0004
1.5.7 Compounds of Section 1.5.5 with a more preferred 26 moieties
In a more preferred embodiment of compounds from Section 1.5.5, said compounds have structures of formula I-5h:
Figure imgf000028_0001
wherein Z6 is -C(O)NHR4, -NHR4 or Rl 9 substituted pyrazole;
1.6 Compounds of Formula Ia wh ich exemplify preferred A and X2-E1 Moieties
In a preferred embodiment of compounds of formula Ia, said compounds have structures of formula 1-6 a:
Figure imgf000028_0002
wherein the A ring is imidazolyl,
1.6.1 Compounds of Formula I-6a which exemplify preferred Al Moieties
In a preferred embodiment of compounds of formula 1-6 a, said compounds have structures of formula I-6b :
Figure imgf000028_0003
1.6.2 Compounds of Formula I-6a which exemplify preferred Al Moieties
In a preferred embodiment of compounds of formula I-6a, said compounds have structures of formula I-6c:
Figure imgf000028_0004
1.6.3 Compounds of Formula I- 6a wh ich exemplify preferred A 1 Moieties
In a preferred embodiment of compounds of formula I-6a, said compounds have structures of formula I-6d:
Figure imgf000028_0005
1.6.4 More preferred compounds of Section 1.6 In a preferred embodiment of compounds from Section 1.6, said compounds have structures of formula I-6e:
Figure imgf000029_0001
7.6.5 Compounds of Section 1.6.4 with preferred Rl 6 moieties
In a preferred embodiment of compounds from Section 1.6.4, said compounds have structures of formula I-6f:
Figure imgf000029_0002
7.5.(5 Compounds of Section 1.6.5 with a more preferred Al moieties
In a more preferred embodiment of compounds from Section 1.6.5, said compounds have structures of formula I-6g:
Figure imgf000029_0003
Wherein Al is selected from the group consisting of
Figure imgf000029_0004
7.6.7 Compounds of Section 1.6.5 with a more preferred Z6 moieties
In a more preferred embodiment of compounds from Section 7.5,5, said compounds have structures of formula I-6h:
Figure imgf000030_0001
wherein Z6 is -C(O)NHR45 -NHR4 or Rl 9 substituted pyrazole;
1, 7 Compounds of Formula Ia which exemplify preferred A andX2-El Moieties
In a preferred embodiment of compounds of formula Ia, said compounds have structures of formula I-7a:
Figure imgf000030_0002
wherein the A ring is thiazolyl.
1.7,1 Compo unds of Formula J- 7a wh ich exemplify preferred A 1 Moieties
In a preferred embodiment of compounds of formula I-7a, said compounds have structures of formula I-7b :
Figure imgf000030_0003
1.7.2 Compounds of Formula I- 7a wh ich exemplify preferred A 1 Moieties
In a preferred embodiment of compounds of formula 1-7 a, said compounds have structures of formula I-7c:
Figure imgf000030_0004
/.7.3 Compounds of Formula I~7a which exemplify preferred Al Moieties hi a preferred embodiment of compounds of formula I-7a, said compounds have structures of formula I-7d:
Figure imgf000030_0005
1.7.4 More preferred compounds of Section 1.7 In a preferred embodiment of compounds from Section 1.7, said compounds have structures of formula I-7e:
Figure imgf000031_0001
1.7.5 Compounds of Section 1.7,4 with preferred Rl 6 moieties In a preferred embodiment of compounds from Section 1.7.4, said compounds have structures of formula I-7f:
Figure imgf000031_0002
1.7.6 Compounds of Section 1.7.5 with a more preferred Al moieties In a more preferred embodiment of compounds from Section 1.7.5, said compounds have structures of formula I-7g:
Figure imgf000031_0003
Wherein Al is selected from the group consisting of
Figure imgf000031_0004
7.7.7 Compounds of Section 1.7.5 with a more preferred Z6 moieties In a more preferred embodiment of compounds from Section 1.7.5, said compounds have structures of formula I-7h:
Figure imgf000032_0001
wherein Z6 is -C(O)NHR4, -NHR4 or Rl 9 substituted pyrazole;
1.8 Compounds of Formula Ia which exemplify preferred A andX2-El Moieties
In a preferred embodiment of compounds of formula Ia, said compounds have structures of formula I- 8 a:
Figure imgf000032_0002
wherein the A ring is oxazolyl.
1.8.1 Compounds of Formula I-8a which exemplify preferred A 1 Moieties hi a preferred embodiment of compounds of formula 1-8 a, said compounds have structures of formula I-8b:
Figure imgf000032_0003
7.5.2 Compounds of Formula I-8a which exemplify preferred Al Moieties
In a preferred embodiment of compounds of formula I-8a, said compounds have structures of formula I-8c:
Figure imgf000032_0004
7. S.3 Compounds of Formula I-8a which exemplify preferred A 1 Moieties
In a preferred embodiment of compounds of formula I-8a, said compounds have structures of formula I-8d:
Figure imgf000032_0005
7.5.4 More preferred compounds of Section 1.8 In a preferred embodiment of compounds from Section 1.8, said compounds have structures of formula I-8e:
Figure imgf000033_0001
1.8.5 Compounds of Section 1.8.4 with preferred Rl 6 moieties
In a preferred embodiment of compounds from Section 1.8.4, said compounds have structures of formula I-8f:
Figure imgf000033_0002
1.8.6 Compounds of Section 1.8.5 with a more preferred Al moieties
In a more preferred embodiment of compounds from Section 1.8.5, said compounds have structures of formula I-Sg:
Figure imgf000033_0003
Wherein Al is selected from the group consisting of
Figure imgf000033_0004
7.8.7 Compounds of Section 1.8.5 with a more preferred Z6 moieties
In a more preferred embodiment of compounds from Section 1.8.5, said compounds have structures of formula I-8h:
Figure imgf000034_0001
wherein Z6 is -C(O)NHR4, -NHR4 or Rl 9 substituted pyrazole;
1.9 Compounds of Formula Ia which exemplify preferred A andX2-El Moieties
In a preferred embodiment of compounds of formula Ia, said compounds have structures of formula I-9a:
Figure imgf000034_0002
wherein the A ring is isothiazolyl.
1.9.1 Compounds of Formula ϊ~9a which exemplify preferred Al Moieties In a preferred embodiment of compounds of formula I-9a, said compounds have structures of formula I-9b :
Figure imgf000034_0003
1.9.2 Compounds of Formula -9a which exemplify preferred Al Moieties
In a preferred embodiment of compounds of formula I-9a, said compounds have structures of formula I-9c:
Figure imgf000034_0004
1.9.3 Compounds of Formula I-9a which exemplify preferred A 1 Moieties
In a preferred embodiment of compounds of formula I~9a, said compounds have structures of formula I-9d:
Figure imgf000034_0005
7.9.4 More preferred compounds of Section 1.9 In a preferred embodiment of compounds from Section 1.9, said compounds have structures of formula I-9e:
Figure imgf000035_0001
/.P, J Compounds of Section 1.9.4 with preferred Rl 6 moieties
In a preferred embodiment of compounds from Section 1.9.4, said compounds have structures of formula 1-9 f:
Figure imgf000035_0002
1.9.6 Compounds of Section 1.9.5 with a more preferred Al moieties
In a more preferred embodiment of compounds from Section 1.9.5, said compounds have structures of formula I-9g:
Figure imgf000035_0003
Wherein Al is selected from the group consisting of
Figure imgf000035_0004
1.9.7 Compounds of Section 1.9.5 with a more preferred Z6 moieties
In a more preferred embodiment of compounds from Section 1.9.5, said compounds have structures of formula I-9h:
Figure imgf000036_0001
wherein Z6 is -C(O)NHR4, -NHR4 or Rl 9 substituted pyrazole;
1.10 Compounds of Formula Ia which exemplify preferred A and X2-E1 Moieties In a preferred embodiment of compounds of formula Ia, said compounds have structures of formula I- 10a:
Figure imgf000036_0002
wherein the A ring is phenyl.
1.10.1 Compounds of Formula I-10a which exemplify preferred Al Moieties In a preferred embodiment of compounds of formula I- 10a, said compounds have structures of formula I- 10b:
Figure imgf000036_0003
1.10.2 Compounds of Formula I-10a which exemplify preferred Al Moieties
In a preferred embodiment of compounds of formula I- 10a, said compounds have structures of formula I- 1 Oc:
Figure imgf000036_0004
1.10.3 Compounds of Formula I-10a which exemplify preferred Al Moieties hi a preferred embodiment of compounds of formula I-10a, said compounds have structures of formula I- 1Od:
Figure imgf000036_0005
1.10.4 More preferred compounds of Section 1.10 In a preferred embodiment of compounds from Section 1.10, said compounds have structures of formula I- 1 Oe:
Figure imgf000037_0001
1,10,5 Compounds of Section 1.10.4 with preferred Rl 6 moieties In a preferred embodiment of compounds from Section 1.10.4, said compounds have structures of formula I- 1Of:
Figure imgf000037_0002
1.10.6 Compounds of Section 1,10,5 with a more preferred Al moieties In a more preferred embodiment of compounds from Section 1,10.5, said compounds have structures of formula I- 1 Og:
Figure imgf000037_0003
Wherein Al is selected from the group consisting of
Figure imgf000037_0004
1,10.7 Compounds of Section 1.10.5 with a more preferred Z6 moieties In a more preferred embodiment of compounds from Section 1.10.5, said compounds have structures of formula I- 1Oh:
Figure imgf000038_0001
wherein Z6 is -C(O)NHR4, -NHR4 or Rl 9 substituted pyrazole; 1.11 Compounds of Formula Ia which exemplify preferred A andX2-El Moieties In a preferred embodiment of compounds of formula Ia, said compounds have structures of formula I- 11 a:
Figure imgf000038_0002
wherein the A ring is pyrimidinyl.
1.11.1 Compounds of Formula I-lla which exemplify preferred Al Moieties
In a preferred embodiment of compounds of formula I-l la, said compounds have structures of formula I- 11 b :
Figure imgf000038_0003
1.11.2 Compounds of Formula I-lla which exemplify preferred Al Moieties hi a preferred embodiment of compounds of formula I-l la, said compounds have structures of formula 1-1 Ic:
Figure imgf000038_0004
1.11.3 Compounds of Formula I-lla which exemplify preferred Al Moieties
In a preferred embodiment of compounds of formula I-l la, said compounds have structures of formula 1-1 Id:
Figure imgf000038_0005
1.11.4 More preferred compounds of Section 1.11 In a preferred embodiment of compounds from Section 1.11, said compounds have structures of formula ϊ-1 Ie:
Figure imgf000039_0001
1.11.5 Compounds of Section 1.11.4 with preferred Rl 6 moieties In a preferred embodiment of compounds from Section 1.11.4, said compounds have structures of formula I- 11 f:
Figure imgf000039_0002
1.11.6 Compounds of Section 1.11.5 with a more preferred Al moieties hi a more preferred embodiment of compounds from Section 1.11,5, said compounds have structures of formula I- 11 g:
Figure imgf000039_0003
Wherein Al is selected from the group consisting of
Figure imgf000039_0004
1.11.7 Compounds of Section 1.11.5 with a more preferred Z6 moieties In a more preferred embodiment of compounds from Section 1.11.5, said compounds have structures of formula 1-1 Ih:
Figure imgf000040_0001
wherein Z6 is -C(O)NHR4, -NHR4 or Rl 9 substituted pyrazole;
1.12 Compounds of Formula Ia which exemplify preferred A and X2-E1 Moieties
In a preferred embodiment of compounds of formula Ia, said compounds have structures of formula I- 12a:
Figure imgf000040_0002
wherein the A ring is pyridinyl.
1.12.1 Compounds of Formula I-12a which exemplify preferred Al Moieties
In a preferred embodiment of compounds of formula I-12a, said compounds have structures of formula I- 12b :
Figure imgf000040_0003
1.12.2 Compounds of Formula I- 12a which exemplify preferred Al Moieties
In a preferred embodiment of compounds of formula I- 12 a, said compounds have structures of formula I- 12c:
Figure imgf000040_0004
/.72J Compounds of Formula I- 12a which exemplify preferred Al Moieties
In a preferred embodiment of compounds of formula I- 12a, said compounds have structures of formula I-12d:
Figure imgf000040_0005
/./2.4 More preferred compounds of Section L12 In a preferred embodiment of compounds from Section 1.12, said compounds have structures of formula I-12e:
Figure imgf000041_0001
1.12.5 Compounds of Section 1.12.4 with preferred Rl 6 moieties In a preferred embodiment of compounds from Section 1.12.4, said compounds have structures of formula I-12f:
Figure imgf000041_0002
1.12.6 Compounds of Section 1.12.5 with a more preferred Al moieties In a more preferred embodiment of compounds from Section 1.12.5, said compounds have structures of formula I- 12g:
Figure imgf000041_0003
Wherein Al is selected from the group consisting of
Figure imgf000041_0004
/.72.7 Compounds of Section 1.12.5 with a more preferred Z6 moieties In a more preferred embodiment of compounds from Section 112.5, said compounds have structures of formula I-12h:
Figure imgf000042_0001
wherein Z6 is -C(O)NHR4, -NHR4 or Rl 9 substituted pyrazole;
1.13 Methods 1.13a Methods of Protein Modulation
The invention includes methods of modulating kinase activity of a variety of kinases, e.g. C-AbI kinase, bcr-Abl kinase, Flt-3, c-Kit, PDGFR, VEGFR, c-MET, the HER family of kinases and the Raf family of kinases. The kinases may be wildtype kinases, oncogenic forms thereof, aberrant fusion proteins thereof or polymorphs of any of the foregoing. The method comprises the step of contacting the kinase species with compounds of the invention and especially those set forth in sections 1.1-1.12. The kinase species may be activated or iraactivated, and the species may be modulated by phosphorylations, sulfation, fatty acid acylations glycosylations, nitrosylation, cystinylation (i.e. proximal cysteine residues in the kinase react with each other to form a disulfide bond) or oxidation. The kinase activity may be selected from the group consisting of catalysis of phospho transfer reactions, inhibition of phosphorylation, oxidation or nitrosylation of said kinase by another enzyme, enhancement of dephosphorylation, reduction or denitrosylation of said kinase by another enzyme, kinase cellular localization, and recruitment of- other proteins into signaling complexes through modulation of kinase conformation.
1.13b Treatment Methods
The methods of the invention also include treating individuals suffering from a condition selected from the group consisting of cancer and hyperproliferative diseases. These methods comprise administering to such individuals compounds of the invention, and especially those of sections 1.1-1.12, said diseases including, but not limited to, a disease caused by c-Abl kinase, oncogenic forms thereof, aberrant fusion proteins thereof and polymorphs thereof, chronic myelogenous leukemia, acute lymphocytic leukemia, other myeloproliferative disorders, gastrointestinal stromal tumors, age-related macular degeneration, liypereosinophilic syndrome, glioblastomas, ovarian cancer, pancreatic cancer, prostate cancer, lung cancers, breast cancers, kidney cancers, cervical carcinomas, metastasis of primary solid tumor secondary sites, ocular diseases characterized by hyperproliferation leading to blindness including various retinopathies, i.e. diabetic retinopathy and age-related macular degeneration, rheumatoid arthritis, melanomas, colon cancer, thyroid cancer, a disease caused by a mutation in the RAS-RAF-MEK- ERK-MAP kinase pathway, human inflammation, rheumatoid spondylitis, ostero- arthritis, asthma, gouty arthritis, sepsis, septic shock, endotoxic shock, Gram-negative sepsis, toxic shock syndrome, adult respiratory distress syndrome, stroke, reperfusion injury, neural trauma, neural ischemia, psoriasis, restenosis, chronic obstructive pulmonary disease, bone resorptive diseases, graft-versus-host reaction, Chron's disease, ulcerative colitis, inflammatory bowel disease, pyresis, and combinations thereof. The administration method is not critical, and may be from the group consisting of oral, parenteral, inhalation, and subcutaneous.
1.14 Pharmaceutical Prepara tions
The compounds of the invention, especially those of sections 1.1-1.12, may form a part of a pharmaceutical composition by combining one or more such compounds with a pharmaceutically acceptable carrier. Additionally, the compositions may include an additive selected from the group consisting of adjuvants, excipients, diluents, and stablilizers.
2, Syn thesis ofcompo unds of the present invention
The compounds of the invention are available by the procedures and teachings of WO 2006/071940, filed December 23, 2005, incorporated by reference, and by the general synthetic methods illustrated in the schemes below and the accompanying examples.
As indicated in Scheme 1, ureas of general formula I can be readily prepared by the union of amines of general formula 2 with isocyanates 3_ or isocyanate surrogates 4 (trichloroethyl carbamates) or 5 (isopropenyl carbamates). Preferred conditions for the preparation of compounds of general formula I involve heating a solution of 4 or 5 with 2 in the presence of a tertiary base such as diisopropylethylamine, trieihyl amine or N- methylpyrrolidine in a solvent such as dirnethylforraamide, dimethylsulfoxide, tetrahydrofuran or 1,4-dioxane at a temperature between 50 and 100 0C for a period of time ranging from 1 hour to 2 days.
Figure imgf000044_0001
Scheme 1
As shown in Scheme 2, isocyanates 3 can be prepared from amines A-NH2 6 with phosgene, or a phosgene equivalent such as diphosgene, triphosgene, or N,N- dicarbonylimidazole. Trichloroethyl carbamates 4 and isopropenyl carbamates 5 are readily prepared from amines A-NH2 (6) by acylation with trichloroethyl chloroformate or isopropenyl chloroformate by standard conditions familiar to those skilled in the art. Preferred conditions for the preparation of 4 and 5. include include treatment of compound 6 with the appropriate chloroformate in the presence of pyridine in an aprotic solvent such as dichloromethane or in the presence of aqueous hydroxide or carbonate in a biphasic aqueous/ethyl acetate solvent system.
Figure imgf000044_0002
Scheme 2
Additionally, compounds of formula I can also be prepared from carboxylic acids 7 by the intermediacy of in-situ generated acyl azides (Curtius rearrangement) as indicated in Scheme 3. Preferred conditions for Scheme 3 include the mixing of acid 7 with amine 2 and diphenylphosphoryl azide in a solvent such as 1,4-dioxane or dimethylformamide in the presence of base, such as triethylamine, and raising the temperature of the reaction to about 80-120 °C to affect the Curtius rearrangement.
Figure imgf000045_0001
Scheme 3
Many methods exist for the preparation of amines A-NH2 6 and acids A-CO2H 7, depending on the nature of the A-moiety. Many such methods have been described in detail in WO 2006/071940, and are incorporated by reference here. Preferred synthetic methods are outlined in the following schemes for the non-limiting examples wherein A is a 1-substituted-pyrazole (optionally substituted by R2) or A and Al are linked by C-C bond.
As illustrated in Scheme 4, Al -substituted, pyrazole amines K) (a preferred aspect of A-NH2 6, Scheme 2) are available by the condensation of hydrazines 8 and beta-keto nitriles 9. Preferred conditions for this transformation are by heating in ethanolic HCl.
Hydrazines 8 are in turn available by the diazotization of amines Jj. followed by reduction or, alternately from the hydrolysis of hydrazones ,13, obtained by the palladium mediated coupling of benzophenone hydrazone with compounds of formula Al-X 12, wherein X represents a halogen or triflate moiety.
NH2
Figure imgf000045_0002
Scheme 4
A non-limiting example of Scheme 4 is illustrated by the preparation of compound Jj? (Scheme 5 and the accompanying examples). Thus commercially available 6-hydroxyquinoline J4 can be converted to trifiuoromethanesulfonate J_5 by treatment with triflic anhydride and pyridine. Reaction of 15. with benzophenone hydrazone in the presence of a palladium catalyst, preferably a catalyst containing the bis(diphenylphosphino)ferrocene ligand, provides the hydrazone 16. Reaction of 16 with ethanolic HCl at reflux provides the hydrazine 1/7, which can be combined with keto nitriles of general formula 18 by further heating in ethanolic HCl to provide quinoline pyrazole amines of formula 19. In another aspect of this synthetic sequence, hydrazone 16 can be converted directly to pyrazole 19 by the direct reaction with keto nitrile 18 upon heating in ethanolic HCl.
Figure imgf000046_0001
11 12. Scheme s
Another preferred method for constructing Al -substituted pyrazoles is illustrated by the general preparation of pyrazole acid 22 (Scheme 6), an aspect of A-CO2H 7 (Scheme 3). As indicated in Scheme 6, the union of a pyrazole 5-carboxylic ester 20 with Al-X 12, wherein X reprepesents a halide, trifiate, or boronic acid suitable for direct transition metal-catalyzed couplings with pyrazoles 20, provides Al -substituted pyrazole esters 2L Preferred conditions for such transformations involve mixing a boronic acid H [X- B(OH)2] and esters 20 in dichloromethane with copper acetate and pyridine in the presence of crushed molecular sieves, with or without heating. Preferred esters for this transformation include ethyl, tert-butyl and benzyl esters. The esters 21 in turn can be converted to acids 22 by standard conditions familiar to those skilled in the art, such as saponification, acidic hydrolysis or hydrogenation.
Figure imgf000047_0001
m 21 22
Scheme 6
The synthesis of intermediates useful for the construction of compounds of formula i wherein A and Al are linked by a C-C bond is shown in Scheme 7. In this case, palladium catalyzed reactions (for example, Suzuki or Stille reactions) of Al-X 12 with a complementary component 23 or 24 provides compounds 25 or 26, examples of general intermediates A-NH2 6 or A-CO2H 7, respectively. In this synthetic sequence, the X- groups on the reactants 12 and 23 or 24 are moieties that undergo transition metal catalyzed cross coupling reactions, such as halides or triflates and boronic acids or esters, stannanes, silanes, organozincs or other organometallic moieties known by those skilled in the art to be suitable substrates for such processes. The X-groups in Scheme 7 are complementary moieties for cross coupling processes such that when Al-X Y2 is a halide or trifiate, A-X 23 or A-X 24 will be a complementary organometallic, such as a stannane or the like or a boronic acid or ester. Likewise, if Al -X 12 is an organometallic reagent or a boronic acid or ester, A-X will be a halide or trifiate.
Figure imgf000047_0002
Scheme 7
Within Scheme 7, it will be understood by those skilled in the art that there are additional synthetic equivalents for the Y-groups of 23. and 24 that can be used interchangeably with NH2 and CO2H with the addition of additional transforming steps. For example, the Y group of 23 might also be a protected amino group such as N-Boc or a surrogate amino group such as nitro that would give rise to compounds of formula 25 after acidic hydrolysis or reduction respectively. Similarly, it will be recognized that the Y group of 24 might also be an ester or nitrile which could be hydrolyzed to an acid of formula 26 by standard synthetic methods.
A non limiting example of Scheme 7 is illustrated by the preparation of compound 29, an example of general intermediate A-NH2 6, above. Thus, commercially available quinoline 6-boronic acid 27 can be combined with commercially available 5- fluoro-2-iodoaniline 28 in the presence of a palladium catalyst to provide compound 29, an example of general intermediate A-NH2 6, above.
Figure imgf000048_0001
12
Scheme 8 Amines 2 (Schemes 1 and 3, above) useful for the invention can be synthesized according to methods commonly known to those skilled in the art. Non-limiting examples are illustrated in the following schemes. A general preparation of aryl amine 32, an example of amine 2, above, is shown in Scheme 9. Thus, chloropyridines of formula 3J. are reacted with phenols of formula 30 in the presence of base such as potassium tert-butoxide. Reactions are generally conducted at temperatures between 0 0C and 150 0C in solvents such as dimethylacetamide, dimethylformamide or dimethylsulfoxide. Some non-limiting examples of general synthetic Scheme 9 are shown in Schemes 10-12, below.
Figure imgf000048_0002
30 M 32 Scheme 9
In Scheme 10, commercially available 3-fluoro-4-aminophenol is reacted with potassium tert-butoxide and chloropyridines 34 or 35 to provide amino ethers 36 and 37 respectively. Hie preferred solvent for this transformation is dimethyl acetamide at a temperature between 80 and 100 0C.
Figure imgf000049_0001
22 24 (R -CH3) 16 (R = CH3)
25 (R =H) IZ (R = H)
Scheme 10
In a similar manner, commercially available 2-methyl-4-aminophenol 38 is combined with chloropyridines 34 and 3_5 to provide amino ethers 39 and 40, respectively (Scheme 11).
Figure imgf000049_0002
as 34 (R =CH3) 32 (R - CH3) as (R =H) £U> (R - H)
Scheme 11 Scheme 12 illustrates the preparation of meta-substituted pyridyl ether amines 47 and 48, examples of general intermediate 2, above. As shown in Scheme 12, commercially available 2-chloro-4-fiuorophenol 4J. is treated with methyl chloroformate to provide carbonate 42. Nitration under standard conditions then provides adduct 43. Hydrolysis of the carbonate provides phenol 44. Concomitant reduction of both the nitro and chloro moieties provides aminophenol 45. Treatment of phenol 45 sequentially with potassium tert-butoxide and 3,5-dichloropyridine and heating in dimethylacetamide provides the compound 47. Removal of the chlorine atom of 47 by hydrogenation provides the amine of formula 48, an aspect of general amine 2.
Figure imgf000050_0001
Scheme 12
Amines of general formula 2 can also be prepared by the general route shown in Scheme 13. Thus, halo pyridine 49 (X is halogen) or halo pyrimidine 50 (X is halogen) can be converted to Z6-substituted pyridine 51 or Z6-substituted pyrimidine 52, respectively. There are several methods through which this can be accomplished, depending on the nature of the Z6. When the Z6 moiety is attached to the Q-containing ring through a Z6 nitrogen atom, preferred methods include heating compounds of formula 49 or 50 with an excess of the amine Z6-H either neat or in a solvent such as N- methylpyrrolidinone, DMF, DMSO or an alcoholic solvent at temperatures ranging from RT to 200 0C. For the case of aryl and heteroaryl amines Z6-H, additional preferred methods include the heating of compounds 49 or 50 with an excess of the amine Z6-H and an acid catalyst (for example, TsOH, HCl, HOAc or the like) in a suitable solvent such as DMF, DMSO or an alcoholic solvent. Additional preferred methods for aryl and heterσarylamines Z6-H include combining Z6-H with compounds 49 or .50 in the presence of a transition metal catalyst such as a palladium catalyst in a suitable solvent like 1 ,4-dioxane or DMF with heating if necessary. When the Z6 moiety is attached to the Q-containing ring through a Z6 oxygen or sulfur atom, preferred methods include heating 49-50 with alcohol or thiol Z6-H in the presence of a strong base (for example, NaH or potassium tert-butoxide) either neat using Z6-H as the solvent, or in a polar solvent such as DMF or DMSO at temperatures ranging from RT to 200 0C. When the Z6 moiety is attached to the Q-containing ring through a Z6 carbon atom, preferred methods include contacting compounds 49 or 50 with a species of formula Z6-M in the presence of a palladium catalyst, wherein M is a species that participates in transition- metal catalyzed cross-coupling reactions. Examples of suitable M groups include but are not limited to, boronic acids, boronic esters, zinc, trialkyltin, silicon, magnesium, lithium, and aluminum. Optionally, the transformations shown in Scheme 13 may be performed with microwave heating. It will be understood by those skilled in the art that the Z6 moieties introduced in Scheme 13 may contain optional protecting groups that will be removed in subsequent transformations (not shown). Some non-limiting examples of general Scheme 13 are shown in Schemes 14 and 15, below.
Figure imgf000051_0001
49 (Q = CH) Sl(Q - CH) 50.(Q = N) Sl(Q -N)
Scheme 13 In Scheme 14, phenol 33 and 2,4-dichloropyridine {51} are combined using general Scheme 9 to provide the chloropyridine 52. Further reaction of chloropyridine 52 with the N-methylpyrazole boronate 53 in the presence of palladium tetrakis(triphenylphosphine) provides 54, an example of general amine 2.
Figure imgf000051_0002
33 Sl 52
Figure imgf000051_0003
54
Scheme 14 Scheme 15, shows the preparation of amino pyridine 55 from chloropyridine 52 by the general route of Scheme 13. Preferred conditions for this transformation include the contacting of chloropyridine 52 with isopropyl amine in N-methylpyrrolidinone with microwave heating.
Figure imgf000052_0001
Scheme 15
Scheme 16 illustrates an alternative preparation of compounds of general formula
1, represented by the preparation of urea 6L In the instance when general amine 2 is primary (R3 = H), amine 2 can be converted to an isopropenyl carbamate 56, tricliloroethyl carbamate 57, or 4-nitrophenyl carbamate 58 by reaction with isopropenyl chloroformate, trichloroethyl chloroformate or 4-nitrophenyl chloroformate, respectively.
Alternatively, by analogy to Scheme 2, amine 2 (R3 = H) can be converted to a discrete isocyanate 59. By analogy to Scheme 1 , reaction of carbamates 56-5_8 or isocyanate 59 with R3-substituted amine 60 provides urea 6_I, an example of general formula 1..
Figure imgf000052_0002
1 (83 = H)
Figure imgf000052_0003
SL
Scheme 16
An additional subset of ureas of general formula I can be prepared as illustrated in Scheme 17. hi the instances when R3 is not H, the mono-substituted ureas I or 6J. can be optionally further transformed into bis-R3 -substituted ureas 62 (Formula I). Thus, in Scheme 17, exposure of X or 6χ to alkyl halides or cycloalkyl halides in the presence of a base, for example potassium carbonate, sodium hydride or potassium tert-butoxide in a suitable solvent such as DMF provides ureas 62 wherein the newly incorporated R3 group is alkyl or cycloalkyl. Alternatively, exposure of ureas i or 61 to copper(II) acetate and Z3-substituted phenylboronic acids [See: Chan et.al, Tetrahedron Lett. 2003, 44, 3863-3865; Chan et.al, Tetrahedron Lett. 1998, 39, 2933-2936; Chan, D. M. T. Tetrahedron Lett, 1996, 37, 9013-9016] provides the analogous bis-R3 -substituted ureas wherein the newly incorporated R3 is Z3 -substituted phenyl.
Figure imgf000053_0001
I(R3?* H) 62 6J.(R3≠ H)
Scheme 17 General amines A-NH2 (6) wherein the A-ring is isoxazole can be prepared by the methods described in Scheme 18. Many examples of R2-substituted aminoisoxazoles 64 and 65 are commercially available. They can also be prepared from common keto nitrile intemediates 63 by condensation with hydroxyl amine either under acidic or alkaline conditions as described in the literature (Takase, et al. Heterocycles, (1991), 12, pp 1153- 1158). Bromination of isoxazoles 64 or 65 using standard conditions (see: Sircar, et. al. J. Org. Chem (1985), 50_, pp 5723-7; Carr, et. al. J. Med. Chem. (1977), 20, pp 934- 9; Chan et al., US 5514691) provides bromo isoxazoles 66 and 67 respectively. By analogy to Schemes 7 and 8, 66 and 67 can be converted to Al -containing amino isoxazoles 68 and 69, examples of general amine 6 and 25, through palladium-mediated couplings with reagents of formula Al-M (70), wherein the "M" moiety of Al-M is a moiety that participates in transition metal catalyzed cross coupling reactions, such as a boronic acid or ester, stannane, silane, organozinc or other organometallic moiety known by those skilled in the art to be a suitable substrate for such processes. Using the general methods of Schemes 1 and 2, amines 68 and 69 can be converted to ureas of general formula 1. It will be understood by those skilled in the art that the Al -moiety of 68-70 may contain protecting groups that may be removed prior to or after conversion to ureas of formula 1 by appropriate de-protection conditions. It will be further understood that the amino group of 64-69 may be optionally protected with a suitable protecting group (such as a tert-butylcarbamate) if desired to facilitate the bromination or palladium coupling steps.
Figure imgf000054_0001
O
,CN
RZ
63
NHiOH
\
Al-M
Figure imgf000054_0002
67 69
Scheme 18 By analogy to Scheme 18, amines 73 and 74, examples of general amines A-NH2
(6) wherein the A-ring is isothiazole, can be prepared as shown in Scheme 19 by the reaction of bromo isothiazoles 71 and 72 and Al-M (70). The requisite isothiazoles 71 and 72 are accessible by methods described in the literature (See; Hegde, V., WO 94/21647 (1994); Hackler, et. al. J. Heterocyclic Chem. (1989), 26, PP 1575-8). Using the general methods of Schemes 1 and 2, amines 73 and 74 can be converted to ureas of general formula 1.
Figure imgf000054_0003
21 73
Al-M
Figure imgf000054_0004
72
74
Scheme 19
2.1 Examples
General Method A: To a stirring solution of carboxylic acid (0.50 mmol, 1.00 eq) and DPPA (0.75 mmol, 1.50 eq) in 1,.4-dioxane (5.0 ml) at RT was added Et3N (1.5 mmol, 3.00 eq). After stirring for 30 min at RT, the appropriate amine (0.76 mmol, 1.50 eq) in dioxane was added and the mixture was heated at 95-100 °C. After 2 h, the completed reaction was cooled to RT, diluted with brine and extracted with EtOAc (2x). The combined organics were washed with 3M HCl (Ix), satd. NaHCO3 (2x), and brine (Ix), dried (MgSO4), filtered and evaporated to give the crude product which was purified by 0ash column chromatography to afford the target urea.
Example Al: 4-Amino-2~fluorophenol (1.13 g, 8.9 mmol) and Example A22 (1.5 g, 8.9 mmol) were combined by the procedure of Example A2 to provide 4-(4-amino-2- fluorophenoxy)-N-methylpicolinamide (300 mg, 13% yield). 1H-NMR (DMSO-cfό) δ 8.78 (d, J= 4.8 Hz, 1 H), 8.47 (d, J = 5.4 Hz, 1 H), 7.32 (d, J - 2.4 Hz, 1 H), 7.11 (m, 1 H), 7.01 (t, J- 9.0 Hz, 1 H), 6.51 (dd, J= 13.2, 2.4 Hz, 1 H), 6.42 (dd, J= 8.4, 1.6 Hz, 1 H), 5.51 (br s, 2 H), 2.76 (d, J= 4.8 Hz, 3 H); MS (ESI) m/z: 262.1 (M + H+).
Example A2: A solution of 4-amino-3-fluorophenol (2.00 g, 15.7 mmol) in anhydrous DMA (32 mL) was degassed by evacuation of the head space and backfilling with argon (repeated 3x). The solution was treated with potassium tert-butoxide (2.12 g, 18.9 mmol) and the resultant mixture was sonicated briefly to bring all solids into the solvent volume and was stirred at RT for 30 min. Example A22 (2.68 g, 15.7 mmol) was added. The reaction mixture was degassed a second time and the reaction mixture was heated to 100 °C overnight under argon. The reaction mixture was poured into ethyl acetate (400 mL) and washed with water (3 x 100 mL) and saturated brine (2 x 100 mL). The combined aqueous was extracted with EtOAc (100 mL). The combined organics were dried (MgSO4), concentrated in vacuo to a brown oil and purified by silica gel chromatography to provide 4-(4-amino-3-fluorophenoxy)-N-methylpicolinamide (3.18 g, 77% yield). 1H NMR (400 MHz, DMSO-cfe) δ 8.76 (m, 1 H), 8.48 (d, J = 5.7 Hz, 1 H), 7.36 (d, J = 2.6 Hz, 1 H), 7.10 (dd, J = 5.7, 2.6 Hz, 1 H), 7.02 (dd, J= 11.8, 2.6 Hz, 1 H), 6.86 (t, J = 9.8 Hz, 1 H), 6.79 (dd, J = 8.9, 2.5 Hz, 1 H), 5.23 (s, 2 H), 2.79 (d, J = 4.9 Hz, 3 H); MS (ESI) m/z: 262.0 (M+H+). Example A3: In NMP (15 mL) was placed 3-amino-4-chϊorophenol (1.70 g, 11.8 mmol) and potassium t-butoxide (1.40 g, 12.4 mmol) and the mixture was stirred overnight at RT. The dark solution was treated with the 3,5-difluoropyridine (2.73 g, 23.7 mmol) and powdered potassium carbonate (818 mg, 5.92 mmol) and the mixture was then warmed to 80 0C and stirred for 24 h. The resulting black mixture was cooled to RT, diluted with brine (100 mL) and extracted with ethyl acetate (3 x 50 mL). The combined ethyl acetate extracts were washed with saturated sodium bicarbonate (50 mL), water (50 mL) and brine (50 mL), dried (Na2SO4), concentrated in vacuo and purified via column chromatography to yield 2-chloro-5-(5-fluoropyridin-3-yloxy)benzenamine as a thick oil which was used without further purification. 1H-NMR (DMS(W6): δ 5.57 (br s, 2H), 6.26-6.30 (dd, IH), 6.50 (s, IH), 7.19-7.22 (m, IH), 7.45-7.50 (m, IH), 8.26 (s, IH), 8.39 (s, IH). MS (ESI) m/z: 239.0 (M+H+).
Example A4: A mixture of Example AlO (4.6 g, 19.3 mmol) and 10% Pd(OH)2/C (0.5 g, 0.35 mmol) in EtOH (50 mL) was stirred under a H2 atmosphere at RT for 3h. The mixture was filtered through Celite and washed with EtOH. The filtrate was concentrated to give 2-fluoro-5-(pyridine-3-yloxy) aniline (3.5 g, 88 % yield). 1H NMR
(300 MHz, DMSO-J6) δ 8.53 (d, J= 2.4 Hz, 1 H), 8.48 (d, J = 3.9 Hz, 1 H), 7.80-7.69 (m,
2 H), 7.05 (dd, J - 11.1, 8.7 Hz, 1 H), 6.53 (dd, J = 7.5, 3.0 Hz, 1 H), 6.28 (dt, J = 8.7, 3.3 Hz, 1 H); MS (ESI) m/z: 205.3 (M+H+).
Example A5: To a solution of 2,4-difluorophenol (2 g, 15.4 mmol) in CH2Cl2 (20 mL) was added triethyl amine (3.21 ml, 23 mmol) and ethyl chloroformate (1.77 ml, 18.4 mmol) at 0 0C. After stirring the mixture for Ih at RT, sat. NaHCO3 solution (30 mL) was added, the organic layer was separated and the aqueous layer was extracted with CH2Cl2 (1x25 ml). The combined organic layers were washed with brine, dried (Na2SO4) and concentrated to afford 2,4-difluorophenyl ethyl carbonate (3.11 g, 100% yield) as a liquid.
To a solution of 2,4-difluorophenyl ethyl carbonate (3.1 g, 16 mmol) in sulphuric acid (10 mL) was added fuming HNO3 (0.78 ml, 19 mmol) slowly, keeping the internal temperature around 0 0C. After 15 min ice cold water (70 mL) was added, the product was extracted with ethyl acetate (2x50 mL), the combined organic layers were washed with brine, dried (Na2SO4) and concentrated to afford the nitro product as a thick syrup. This nitro product was dissolved in methanol (20 mL) and to this solution was added solid NaHCO3 (4.0 g, 47 mmol) and the resultant mixture was stirred for 16h at RT. The mixture was filtered and the filtrate was concentrated. The resulting solid was dissolved in water (20 ml) and acidified with 3M HCl solution to pH~5. The product was extracted with CH2Cl2 (3x25 mL), the combined organic layers were washed with brine, dried (Na2SO4) and concentrated to afford 2,4-difluoro-5-nitrophenol (2.34 g, 84% yield). 1H NMR (400 MHz, Acetone- J6) δ 9.59 (s, IH), 7.78 (t, J = 7.2 Hz, IH), 7.45 (t, J = 10.4 Hz, IH); MS (ESI) m/z: 176.0 (M+H+).
To a suspension of 2,4-difluoro-5-nitrophenol (1.01 g, 5.77 mmol) in EtOAc was added palladium hydroxide (0.08 g, 0.57 mmol) and the resulting slurry was stirred under a hydrogen atmosphere for 6h. The mixture was filtered through a Celite® pad, washing with EtOAc (2x10 mL) and the filtrate was concentrated to afford 5-amino-2,4- difluorophenol (0.8 g, 96% yield) as a solid. 1H NMR (400 MHz, DMSO-^6) δ 9.28 (s, IH), 6.91 (t, J = 7.2 Hz, IH), 6.35 (t, J = 8.8 Hz, IH), 4.84 (bis, 2H); MS (ESI) m/z: 146.0 (M+H+).
To a solution of 5-amino-2,4-difluorophenol (0.3 g, 2.07 mmol) in DMSO (2 mL) was added potassium t-butoxide (0.23 g, 2.07 mmol) at RT. After stirring for Ih, 3,5- dichloropyridine (0.37 g, 2.5 mmol) and potassium carbonate (0.14 g, 1 mmol) were added and the mixture was heated to 190 0C for Ih in microwave reactor. Water (30 mL) was added, and the product was extracted with EtOAc (2x35 mL) and the combined organic layers were washed with brine solution, dried (Na2SO4), concentrated in vacuo and purified by chromatography (EtOAc/hexane) to afford 5-(5-chloropyridin-3-yloxy)- 2,4-difluorobenzenamine (0.35 g, 66% yield) as a solid. 1H NMR (400 MHz, Acetone-^) 5 8.33 - 8.30 (m, 2H), 7.44 (t, J= 2.4 Hz, IH), 7.13 (t, J = 10.8 Hz, IH), 6.78 (t, J= 8.4 Hz, IH), 4.85 (bra, 2H); MS (ESI) m/z: 257.0 (M+H+).
To a solution of 5-(5-cliloropyridin-3-yloxy)-2,4-difluorobenzenamine (0.35 g, 1.4 mmol) in IM HCl solution (10 mL) was added Pd/C (0.015 g) and mixture was shaken on a Parr apparatus under a hydrogen atmosphere (40 psi) for 24h. The mixture was filtered through Celite® and the filter pad was washed with water (2 x 5 mL) and the filtrate was concentrated on the lyophilizer to afford the hydrochloride salt. This compound was neutralized with sat aq NaHCO3 solution, the free amine extracted into EtOAc (2 x 35 mL) and the combined organic layers were washed with brine, dried (Na2SO4) and concentrated to yield 2,4-difluoro-5-(pyridin-3-yloxy)benzenamine (0.19 g, 63% yield) as a solid. 1H NMR (400 MHz, Acetone-J6) δ 8.33 - 8.30 (m, 2H), 7.37 - 7.29 (m, 2H), 7.09 (t, J= 10.4 Hz5 IH), 6.70 (t, J- 8.4 Hz, IH), 4.78 (bra, 2H); MS (ESI) m/z: 223.0 (M+H+).
Example A6: A solution of 4-amino-o-cresol (0.301 g, 2.44 mmol) in anhydrous dimethylacetamide (6 mL) was de-gassed in vacuo and treated with potassium tert- butoxide (0.33 g, 2.93 mmol) under argon. The reaction mixture was sonicated briefly to suspend all solid matter in the liquid volume. The reaction was further stirred at RT for 30 min. Example A22 (0.417 g, 2.44 mmol) was added and the resultant mixture was heated to 100 0C overnight. The cooled reaction mixture was partitioned between ethyl acetate (50 mL) and water (20 mL). The organic layer was further washed with water (3 x 20 mL) and saturated brine (2 x 20 mL). The combined aqueous phases were extracted with ethyl acetate (2 x 20 mL). The combined organic phases were dried (MgSO4), concentrated in vacuo, and purified by silica gel chromatography (EtOAc/hexanes) to provide 4-(4-amino-2-methylphenoxy)-N-methylpicolinamide (530 mg, 84% yield) as a yellow foam. 1H NMR (400 MHz, DMSO-J6) δ 8.75 (m, 1 H), 8.45 (dd, J = 4.6, 0.5 Hz, 1 H), 7.27 (dd, J - 2.6, 0.4 Hz, 1 H), 7.04 (dd, J = 5.5, 2.6 Hz, 1 H), 6.78 (d, J = 8.5 Hz, 1 H), 6.53 (d, J = 2.3 Hz, 1 H), 6.48 (dd, J = 8.6, 2.5 Hz, 1 H), 5.10 (s, 2 H), 2.78 (d, J = 5.0 Hz, 3 H), 1.93 (s, 3 H); MS (ESI) m/z: 258.0 (M+H+).
Example A7: Using a procedure analogous to Example A2, 4-amino-3-fluorophenol (14 g, 0.11 mmol) and Example A25 (16 g, O.lOmmol) were combined to provide 4-(4- amino-3-fluorophenoxy)picolinamide (8.8 g, 36% yield). 1H NMR (300 MHz, DMSO- df) δ 8.46 (d, J - 5.7 Hz, 1 H), 8.09 (br s, 1 H), 7.68 (br s, 1 H), 7.34 (d, J = 2.4 Hz, 1 H), 7.10 (dd, J = 5.6, 2.6 Hz, 1 H), 7.01 (dd, J = 5.7, 2.4 Hz, 1 H), 6.84 (t, J = 9.0 Hz, 1 H), 6.77 (dd, J= 5.7, 2.4 Hz, 1 H), 5.22 (s, 2 H); MS (ESI) m/z: 248.1 (M + H+). Example A8: A solution of Example A23 (2.0 g, 8.4 mmol) in 2-amino-ethanol (6.0 mL) was heated to 150 0C for 3 h. The solvent was removed under reduced pressure and the residue was purified by silica gel column chromatography to provide 2-(4-(4-amino- 3-fIuorophenoxy)-ρyridin-2-yIamino)-ethanol (1.2 g, 54% yield). !H NMR (400 MHz, DMSO-4) δ 7.78 (d, J = 5.6 Hz, 1 H), 6.85 (dd, J = 12.0, 2.4 Hz, 1 H), 6.78 (t, J - 8.8 Hz, 1 H), 6.67 (dd, J = 8.8, 2.0 Hz, 1 H), 6.44 (t, J = 5.2 Hz5 1 H), 6.06 (dd, J = 6.0, 2.4 Hz, 1 H), 5.80 (d, J - 2.0 Hz, 1 H), 5.08 (s, 2 H), 4.68 (br s, 1 H), 3.43 (m, 2 H), 3.25- 3.20 (m, 2 H); MS (ESI) m/z: (M+H+)2ό4.1
Example A9: A solution of Example A23 (4.0 g, 16.8 mmol) and N5O- dimethylhydroxylamine HCl (3.3 g, 34 mmol) were combined in 1,4-dioxane (50 mL) and the reaction mixture was heated overnight at 110 0C. The reaction mixture was concentrated in vacuo, neutralized with 3M NaOH and extracted with EtOAc (3x). The combined organic phases were washed with brine, dried (MgSO4) and concentrated in vacuo to obtain 4-(4-amino-3-fluorophenoxy)-N-methoxy-N-metliylpyridin-2-aniine (4.4 g, 99% yield). 1H NMR (OMSO-d6) δ 8.06 (d, J = 5.2 Hz, 1 H), 6.95 (dd, J= 12.4, 2.8 Hz, 1 H), 6.83 (dd, J= 8.8, 8.4 Hz, 1 H), 6.75 (dd, J= 8.4, 2.4 Hz, 1 H), 6.43 (d, J- 2.4 Hz, 1 H), 6.37 (dd, J= 5.6, 2.4 Hz, 1 H), 5.16 (s, 2 H), 3.61 (s, 3 H), 3.14 (s, 3 H); MS (ESI) m/z: 264.2 (M+H+). A mixture of 2-fluoro-4-(2-(methoxy(methyl)amino)pyridine-4-yloxy)aniline (2.0 g,
7.6 mmol) and 10% Pd/C (200 nig, 0.18 mmol) in MeOH (15 mL) was stirred under a H2 atmosphere (50 psi) at RT for 48h. The mixture was filtered through Celite® and the cake was washed with MeOH. The filtrate was concentrated to afford 4-(4-amino-3- fluorophenoxy)-N-methylρyridin-2-amine (1.2 g, 68% yield). 1H NMR (OMSO-d6) δ 7.86 (d, J= 6.3 Hz, 1 H), 6.82-6.69 (m, 3 H), 6.18 (dd, J= 6.0, 2.1 Hz, 1 H)5 5.84 (d, J = 2.1 Hz, 1 H)5 5.41 (br s, 1 H), 3.62 (s, 2 H), 2.84 (d, J = 3.0 Hz, 3 H); MS (ESI) m/z: 234.2 (M+H+).
Example AlO: A solution of Example A24 (0.95 g, 7.47 mmol) and potassium tert- butoxide (0.92 g, 8.2 mmol) in dimethylacetamide (2.0 mL) was degassed under vacuum and backfilled with N2 (4x) and then stirred for 30 min. 3,5-Dichloropyridine was added and the resulting solution was heated to 80 0C overnight. The mixture was filtered and the filtrate was concentrated in vacuo and purified by silica gel chromatography to provide 5-(5-chloropyridin-3-yloxy)-2-fluoroaniline (0.5 g, 28% yield). 1H NMR (400 MHz, DMSO-t/d) δ 8.37 (s, 1 H), 8.29 (s, 1 H), 7.51 (s, 1 H), 7.00 (dd, J= 10.8, 8.8 Hz, 1 H), 6.46 (dd, J - 7.6, 2.8 Hz, 1 H), 6.22 (m, 1 H), 5.38 (s, 2 H); MS (ESI) m/z: 239.2 (M+H+).
Example All: A mixture of Example A8 (0.263 g, 1.0 mmol), imidazole (0.0749g, 1.1 mmol) and TBSCl (0.181 g, 1.2 mmol) in DMF (10 mL) was stirred at RT overnight. Solvent was removed under reduced pressure. The residue was quenched with H2O (10 mL) and the pH was adjusted to ~8 by using NaHCO3. The aqueous solution was extracted with EtOAc (3x20 mL) and the combined organic layers were dried (MgSO4), concentrated in vacuo and purified by chromatography to afford 4-(4-amino-3- fluorophenoxy)-N-(2-(tert-butyldimethylsilyloxy)ethyl)pyridin-2-amine (0.252 g, 67% yield) as a light yellow oil. MS (ESI) m/z: 378.3 (M+H+).
Example A12: To a solution of Example A17 (7.5 g, 32.5 mmol) in EtOH (60 mL) was added 1.0 M aqueous NaOH (10 mL, 100 mmol). The resultant mixture was heated at 85 °C overnight. The majority of ethanol was removed in vacuo and the concentrate was diluted with water (50 mL) and washed with ethyl acetate. The aqueous layer was acidified to pH 1-2 by the addition of 3 M HCl. The acidic solution was extracted with EtOAc (3 x 200 mL) and the extracts were washed with brine, dried (MgSO4) and concentrated in vacuo to give 5-(3-amino-4-fluorophenoxy)picolinic acid (6.2 g, 77%, yield). 1H-NMR (300 MHz, DMSO-J6) δ 8.40 (d, J= 2.7 Hz, 1 H), 8.01 (d, J= 8.4 Hz, 1 H), 7.38 (dd, J= 8.7, 2.7 Hz, 1 H), 7.03 (dd, J= 11.4, 8.7 Hz, 1 H), 6.50 (dd, J= 7.5, 3.0 Hz, 1 H), 6.26 (m, 1 H), 5.39 (br, s , 2 H); MS (ESI) m/z: 249.1 (M+H4).
5-(3-amino-4-fluorophenoxy)picolinic acid (0.14 g, 0.56 mmol) was dissolved in THF (3 mL) and stirred at 0 0C for 5 min. IM Borane (3.4 mL) solution was added drop wise to the reaction mixture at 0 DC over a period of 30 min. The ice bath was removed and stirring continued at RT for 7 hours. The reaction mixture was cooled in an ice bath and treated with 3M HCl (5 mL). The solution was heated for 1 h at 50 0C. The solution was washed with EtOAc (2x) and the aqueous layer was cooled in an ice bath and neutralized with 3M NaOH. The solution was extracted with EtOAc (3x), the combined organic layers were washed with brine, dried (Na2SO4) and concentrated in vacuo to obtain (5-(3-amino-4-fluorophenoxy)pyridin-2-yl)methanol (0.13 g, 98% yield). 1H NMR (400 MHz, DMSO-J6) δ 8.24 (d, J = 2.8 Hz, IH), 7.46 (d, J = 8.8 Hz, IH), 7.40 (dd, J= 2.8, 8.4 Hz, IH), 6.99 (dd, J= 8.8, 11.2 Hz, IH)5 6.40 (dd, J= 2.8, 7.6 Hz, IH), 6.15 (dt, J = 3.2, 8.8 Hz, IH), 5.40 (t, J= 5.6 Hz, IH), 5.33 (s, 2H), 4.54 (d, J = 6.0 Hz, 2H); MS (ESI) m/z: 235.0 (M+H +).
Example A13: NaH (100 mg, 3.3 mmol) was slowly added to a solution of Example A12 (0.5Og, 2.1 mmol) in dry THF (50 mL) at 0 °C. After 30 min, CS2 (0.49 g, 6.4 mmol) was added and the reaction mixture was stirred at 0 0C for 1 hour. Methyl iodide (2.4 g, 17 mmol) was added at 0 0C and the reaction mixture was allowed to warm to RT overnight. The solvent was removed under reduced pressure to obtain the crude product. The crude, C-(5-(3-amino-4-fluorophenoxy)pyridin-2-yl)methyl iS-raethyl carbonodithioate (0.69 g, 2.1 mmol) was dissolved in toluene (5 mL) and tributyltin hydride (1 mL) and AIBN (50 mg) were added. The reaction mixture was heated under reflux for 3 hours. The solvent was removed under reduced pressure and the residue was filtered and washed with CH2Cl2. The filtrate was evaporated and the residue was purified by silica gel column chromatography to obtain 2-fluoro-5-(6-methylpyridin-3- yloxy)benzenamine (0.26 g, 56% yield). 1H NMR (400 MHz, DMSO-J6) δ 8.20 (d, J = 2.8 Hz, IH ), 7.30 (dd, J = 2.8, and 8.4 Hz, IH), 7.25 (d, J= 8.4 Hz, IH), 6.97 (dd, J = 8.8, 11.6 Hz, IH), 6.38 (dd, J= 3.2, 7.6 Hz, IH), 6.13 (dt, J= 3.2, 8.8 Hz, IH), 5.31 (s, IH), 2.44 (s, 3H); MS (ESI) m/z: 219.0 (M+H+).
Example A14: A solution of 4-amino-3-fluorophenol (0.20 g, 1.6 mmol) in 4 mL of anhydrous DMA was treated with potassium tert-butoxide (0.24 g, 1.9 mmol). The resultant dark-red solution was stirred at RT for 1 hour in a capped vial. 4-Chloro-2- methoxypyridine (0.26 g, 1.6 mmol) was added and the reaction mixture was heated overnight at 100 0C. Water (50 mL) was added and the solution was extracted with ethyl acetate (3 x 50 mL). The combined organic layers were washed with brine, dried (Na2SO4), concentrated in vacuo and purified by silica gel column chromatography to obtain 2-fiuoro~4~(2-methoxypyridin-4-yloxy)benzenaniine (0.20 g, 58% yield). 1H NMR (400 MHz, DMSO-J6) δ 8.02 (d, J= 6.0 Hz, IH ), 6.95 (dd, J = 2.8, 12.0 Hz, IH), 6.82 (dd, J = 8.4, 8.8 Hz, IH), 6.73 (dd, J = 2.0, 8.4 Hz, IH), 6.54 (dd, J- 2.4, 6.0 Hz, IH), 6.10 (d, J= 2.4 Hz, IH), 5.17 (s, IH), 3.81 (s, 3H); MS (ESI) m/z: 235.0 (M+H+).
Example A15: A teflon capped vial was charged with 4-amino-3-fluorophenol (0.291 g, 2.29 mmol) and anhydrous DMF (2.3 mL). The resultant solution was de-gassed in vacuo and backfilled with argon (3x). The vial was treated with sodium tert-butoxide (0.27 g, 2.41 mmol) under argon and quickly capped. The reaction mixture was stirred at RT for Ih. After addition of 4-chloropicolinonitrile (0.317 g, 2.29 mmol) and K2CO3 (0.174 g, 1.26 mmol), the vial was de-gassed again and heated in a 90 0C oil bath overnight. The reaction mixture was diluted with EtOAc (60 mL) and washed with brine (25 mL). The aqueous phase was back-extracted with EtOAc (50 mL). The combined organic layers were washed with brine (25 mL), dried (MgSO4), concentrated in vacuo and purified by chromatography to afford 4-(4-amino-3-fluorophenoxy)picolinonitrile (0.162 g, 31% yield) as a colorless oil. 1H NMR (DMSO-^) δ 8.56 (d, J= 5.6 Hz, IH), 7.62 (d, J= 2.0 Hz, IH), 7.14 (dd, J= 6.0 , 2.8 Hz, IH), 7.03 (dd, J= 11.6, 2.4 Hz, IH), 6.88-6.77 (m, 2H), 5.25 (s, 2H); MS (ESI) rn/z: 230.0 (M+H+).
Example A16: A solution of 5-amino-2-chIoro-4-fluorophenol (100 mg, 0.619 mmol) in degassed dimethylacetamide (2 mL) was treated with potassium t-butoxide (83 mg, 0.743 mmol) and 5-chloro-2-cyanopyridine (86 mg, 0.619 mmol). The resultant mixture was heated to 80 0C overnight, then cooled to RT and diluted with water (10 mL). The mixture was extracted with EtOAc (30 mL). The organic phase was washed with water (3 x 30 mL) and brine (30 mL) dried (Na2SO4) and concentrated in vacuo to provide 5-(5- amino-2-chloro-4-fluorophenoxy)picolinonitrile as a dark oil which was used without further purification. MS (ESI) m/z; 264.0 (M+H+).
Example A17: A solution of 3~amino-4-fluoro-pheriol (5.6 g, 44 mmol) in dimethylacetamide (60 mL) was degassed in vacuo and was treated with potassium tert- butoxide (5.3 g, 47 mmol). The resulting solution was stirred for 30 min. 5-Bromo- pyridine-2-carbonitrile (6.6 g, 36 mmol) was added in one-portion and the mixture was heated at 80 0C overnight. The solvent was removed in vacuo and the residue was purified by silica gel chromatography to provide 5-(3~amino~4- fluorophenoxy)picolinonitrile (3.5 g, 44 % yield). !H-NMR (300 MHz, DMSO-afe) δ 8.47 (d, J= 3.0 Hz, 1 H), 7.98 (d, J= 8.4 Hz, 1 H), 7.44 (dd, J= 8.8, 2.7 Hz, 1 H), 7.06 (t, J= 9.2 Hz, 1 H), 6.52 (d, J = 7.6 Hz, 1 H), 6.28 (m, 1 H), 5.44 (br s , 2 H); MS (ESI) m/z: 230.0 (M-S-H+).
Example A18: In DMA (10 mL) was placed 3-amino-4-fluorophenol (500 mg, 3.93 mmol), potassium t-butoxide (441 mg, 3.93 mmol) and 4-chloro-2- (methylthio)pyrimidine (632 mg, 3.93 mmol). The mixture was wanned to 50 0C and stirred overnight. The mixture was cooled to RT and diluted with water (30 mL), extracted with ethyl acetate (2 x 25 mL) and the combined organic phases washed with brine, dried (Na2SO4) and concentrated to yield a dark oil. The oil was purified by column chromatography to yield 2-fluoro-5-(2-(methylthio)pyrimidin-4- yloxy)benzenamine (841 mg, 85% yield) as an oil which was used without further purification. MS (ESI) m/z: 252.0 (M+H+).
Example A19: A solution of pyridine-3-boronic acid (0.68 g, 5.5 mmol) and 2-methyl-5- nitro phenol (0.85 g, 5.5 mmol) in DCM (10 mL) was treated with pyridine (1.00 mL, 12.4 mmol), copper acetate (1.5 g, 8.3 mmol) and powdered 4A molecular sieves (330 mg). The reaction mixture was stirred for 7 days at RT open to air. The mixture was poured into water (50 mL) and extracted with DCM (2 x 50 mL). The combined organic phases were washed with saturated aq NaHCO3 (25 mL), water (25 mL), satd NH4Cl (2 x 25 mL) and brine (25 mL), dried (Na2SO4), concentrated in vacuo and purified via chromatography on silica gel to provide 3-(2-methyl-5-mtroρhenoxy)pyridine (81 mg, 6% yield). 1H NMR (400 MHz, CDCl3) δ 8.48 (dd, J = 4.6, 1.0 Hz, 1 H), 8.43 (d, J = 2.4 Hz, 1 H), 7.99 (dd, J= 8.0, 2.0 Hz, 1 H), 7.70 (d, J = 2.4 Hz, 1 H), 7.46 (d, J - 8.4 Hz, 1 H), 7.39-7.30 (m, 2 H), 2.42 (s, 3 H); MS (ESI) m/z: 231.0 (M+H+). A solution of 3-(2-methyl-5-nitrophenoxy)pyridine (80 mg, 0.35 mmol) and 10%
Pd/C (50% wet, 165 mg, 0.08 mmol) in methanol (4 mL) was treated with formic acid
(89%, 1 mL, 35 mmol) and the resultant solution was stirred at RT. After 1 h, the reaction mixture was filtered through Celite®, and the filter cake was washed with methanol. The filtrates were concentrated in vacuo, diluted with 40 mL of a pH 12 aqueous solution and extracted with ethyl acetate (3 x 25 mL). The extracts were dried
(Na2SC^) and concentrated in vacuo to provide 4-methyl-3-(pyridin-3- yloxy)benzenamine (58 mg, 83% yield). 1H NMR (400 MHz, CDCl3) δ 8.36 (m, 2 H),
8.32 (dd, J = 4.6, 1.4 Hz, 1 H), 7.26-7.18 (m, 3 H), 7.05 (d, J - 8.0 Hz, 1 H), 6.49 (dd, J= 8.8, 2.4 Hz, 1 H), 6.29 (d, J = 2.4 Hz, 1 H), 2.1 1 (s, 3 H); MS (ESI) rn/z: 201.0 (M+H+).
Example A20: hi DMA (8 mL) was placed 3-amino-4-fluorophenol (281 mg, 2.21 mmol), potassium t-butoxide (248 mg, 2.21 mmol) and 5-bromo-2- (trifluoromethyl)pyridine (500 mg, 2.21 mmol). The mixture was warmed to 75 0C overnight , then cooled to RT and diluted with water (75 mL). The mixture was extracted with ethyl acetate (2 x 40 mL) and the combined organic phases washed with brine (40 mL), dried (Na2SO4), concentrated in vacuo and purified by column chromatography to yield 2-fluoro-5-(6-(trifluoromethyl)pyridin-3-yloxy)benzenamine (161 mg, 26% yield) as an oil which was used without further purification. MS (ESI) m/z: 273.0 (M+H+).
Example A21: In DMF (5 mL) was placed 5-(3-amino-4-fluorophenoxy)picolinic acid from Example A12 (500 mg, 2.01 mmol), 2.0 M methylamine solution/THF (10 mL, 20.1 mmol) and HOBt (324 mg, 2.12 mmol). To this was added Nl- ((etliylimino)methylene)-N3,N3-dimethylpropane-l,3-diamine hydrochloride (772 mg, 4.03 rnmol) and the solution stirred overnight at RT. The solution was treated with an additional equiv of Nl-((etliylimino)methylene)-N3,N3-dimethylpropane-l,3-diamine hydrochloride (775 mg) and warmed to 40 0C, then cooled to RT and stirred overnight. The solution was diluted with ethyl acetate (30 mL) and washed with water (30 mL), brine (30 mL), dried (Na2SO4) and concentrated in vacuo to yield 5-(3-amino-4- fluorophenoxy)-N-methylpicolinamide (530 mg, 101% yield) as a thick oil, which was used without further purification. MS (ESI) m/z: 262,0 (M+H*). Example A22: To stirring anhydrous DMF (25 mL) was slowly added SOCl2 (125 mL) at such a rate that the reaction temperature was maintained at 40-50 0C. Pyridine-2- carboxylic acid (25 g, 0.2 mol) was added in portions over 30 min and the resulting mixture was heated at reflux for 16h during which time a yellow solid precipitated. After cooling to RT, the mixture was diluted with toluene (80 mL) and concentrated. This process was repeated three times. The resulting dry residue was washed with toluene and dried under reduced pressure to yield 4-chloro-pyridine-2-carbonyl chloride (27.6 g, 79% yield), which was used in the next step without purification. To a solution of 4-chloro-pyridine-2-carbonyl chloride (27.6 g, 0.16 mol) in anhydrous THF (100 mL) at 0 0C was added dropwise a solution of MeNH2 in EtOH. The resulting mixture was stirred at 3 0C for 4h. The reaction mixture was concentrated under reduced pressure to yield a solid, which was suspended in EtOAc and filtered. The filtrate was washed with brine (2 x 100 mL), dried and concentrated to yield 4-chloro-N- methylpicolinamide (16.4 g, 60% yield) as a yellow solid. 1H NMR (400 MHz, DMSO- d6) δ 8.78 (br s, IH), 8.55 (d, J - 5.2 Hz, IH), 7.97 (d, J = 2.0 Hz, IH), 7. 66 (m, IH), 2.82 (d, J= 4.8 Hz, 3H); MS (ESI) m/z: 171.0 (M+H÷).
Example A23: Using a procedure analogous to Example A2, 2,4-dichloropyridine (8.0 g, 54 mmol) and 3-fluoro-4-arninophenol (8.0 g, 62.9 mmol) were combined to provide
4-(2-chloro-ρyridin-4-yloxy)-2-fluoroρhenylamine (H g, 86% yield). 1H NMR (300
MHz, DMSO-J6) δ 8.24 (d, J = 5.7 Hz, 1 H), 7.00 (dd, J = 9.0, 2.7 Hz, 1 H), 6.89-6.73
(m, 4 H), 5.21 (br s, 2 H); MS (ESI) m/z: 239.2 (M+H+).
Example A24: Methyl chloroformate (77.3 g, 0.82 mol) was added dropwise to a -10 0C solution of 2-chloro-4-fluorophenol (10Og, 0.68 mol) and sodium hydroxide (32.8 g, 0.82 mol) in water (550 mL). After complete addition, the precipitated solid was collected by filtration and washed with water to give 2-chloro-4-fluorophenyl methyl carbonate (1 10 g, 79 % yield). 1H NMR (300 MHz, DMSO-J6) δ 7.62 (dd, J- 8.1, 2.7 Hz, 1 H), 7.50 (dd, J - 9.0, 5.4 Hz, 1 H), 7.30 (td, J = 8.1, 3.0 Hz, 1 H), 3.86 (s, 3 H); MS (ESI) m/z: 205.2 (M+H+). To a suspension of 2-chloro-4-fluorophenyl methyl carbonate (110 g, 0.54 mol) in cone. H2SO4 (50 mL) was slowly added a mixture comprised of cone. H2SO4 (40 mL) and fuming HNO3 (40.8 mL, 0.89 mol). The resultant mixture was stirred for 30 min at 0 0C. The reaction mixture was poured into ice water and the precipitated solid was collected by filtation and washed with water to give 2-chloro-4-fiuoro-5-nitrophenyl methyl carbonate (120 g, 90% yield). 1H NMR (400 MHz, DMSCW6): δ 8.45 (d, J- 7.2 Hz, 1 H), 8.12 (d, J= 10.8 Hz, 1 H), 3.89 (s, 3 H); MS (ESI) m/z: 250.1 (M+H÷).
A mixture of 2-chloro-4-fluoro-5-nitrophenyl methyl carbonate (12Og 0.48 mol) and sodium hydroxide (22.7 g, 0.57 mol) in water (300 mL) was refluxed for 4h. The insoluble solids were removed by filtration and the filtrate was acidified with dilute HCl.
The precipitated solid was collected by filtration and washed with water to give 2-chloro-
4-fiuoro-5-nitrophenol (90 g, 98% yield). 1H NMR (400 MHz, DMSO-flfe) δ 1 1.18 (s, 1
H), 8.10 (d, J= 10.4 Hz, 1 H), 7.62 (d, J =7.2 Hz, 1 H); MS (ESI) m/z: 192.1 (M+H+)
2-Cliloro-4-fluoro-5-nitrophenol (85 g, 0.45 mol) and 10% Pd/C (25g, 0.023 mol) were combined in EtOH and hydrogenated (50 psi) for 12h. The reaction mixture was filtered, concentrated in vacuo and purified by silica gel chromatography to provide 3- ammo-4-fluorophenol (40 g 70% yield). 1H NMR (400 MHz, DMSO-t/6) δ 8.87 (s, 1 H), 6.70 (dd, J= 1 1.2, 8.8 Hz, 1 H), 6.14 (dd, J= 7.8, 2.4 Hz, 1 H), 5.84 (m, 1 H), 4.92 (s, 2 H); MS (ESI) m/z: 128.2 (M+H+).
Example A25: 4-Chloropicolinamide was prepared using a procedure analogous to Example A22 by substituting NH3 for MeNH2. 1H NMR (300 MHz, DMSO-^n) δ 8.59 (d, J = 5.2 Hz, 1 H), 8.18 (br s, 1 H), 8.00 (d, J = 2.0 Hz, 1 H), 7.79 (br s, 1 H), 7.72 (dd, J= 5.2, 2.0 Hz, 1 H); MS (ESI) m/z: 157.0 (M+H+).
Example A26: Using a procedure analogous to Example A2, 2-fluoro-4-aminophenol (2.6 g, 24 mmol) and 2,4-dichloropyridine (2.88 g, 20 mol) were combined to provide 4- (2-chloropyridin-4-yIoxy)-3-fluoro-phenylamine (3.2 g, 67% yield). 1H NMR (400 MHz, DMSO-fi6) δ 8.25 (d, J= 5.6Hz, 1 H), 6.99 (m, 1 H), 6.90 (m, 2 H), 6.50 (d, J= 1.6 Hz, 1 H), 6.41 (d, J= 10.4Hz, 1 H), 5.51 (s, 2 H); MS (ESI) m/z: 239.1 (M+H+). A mixture of 4-(2-chloro-pyridin-4-yloxy)-3-fluoro-phenylamine (2.0 g, 8.4 mmol) and benzylmethylamine (20 mL) was heated to 200 0C overnight in a steel bomb. The reaction mixture was concentrated in vacuo and purified by silica gel chromatography to give 4-(4-amino-2-fluorophenoxy)-N-benzyl-N-metliylpyridin-2-amine (1.0 g, 37% yield). MS (ESI) m/z: 324.2 (M+H+).
To a solution of 4-(4-amino-2-fluorophenoxy)-N-benzyl-N-methylpyridin-2"amine (1.0 g, 3.1 mmol) in MeOH (10 mL) was added 10% Pd/C (0.25 g, 0.23 mmol). The reaction was stirred under a H2 atmosphere (50 psi) at 75 0C for 12h. The reaction mixture was filtered, concentrated under reduced pressure and purified by reverse phase prep-HPLC to provide 4-(4-amino-2-fluorophenoxy)-N-methylpyridin-2-amine (560mg, 78% yield). 1H NMR (400 MHz, DMSO-J6) δ 7.80 (d, J= 5.6 Hz, 1 H), 6.90 (t, J= 9.0 Hz, 1 H), 6.40-6.45 (m, 3 H), 6.06 (dd, J= 8.0, 2.8 Hz, 1 H), 5.73 (d, J = 2.8 Hz, 1 H), 5.37 (s, 2 H), 2.68 (d, J= 4.8 Hz, 3 H); MS (ESI) m/z: (M+H+): 234.2.
Example A27: Example A23 (0.597 g, 2.5 mmol), 4-(4,4,5,5-tetramethyI-l,3,2- dioxahorolan-2-yl)-lH-pyrazole (0.728g, 3.75 mmol), Cs2CO3 (3.10 g, 9.5 mmol) and Pd(PPh3)4 (0.289 g, 0.25 mmol) were combined in DMFYH2O (20 mL). The reaction mixture was degassed, blanketed with N2 and heated at 90 0C overnight. The completed reaction was diluted with H2O (5 mL) and extracted with EtOAc (3 x 50 mL). The combined organics were washed with brine (20 mL), dried (MgSO4), concentrated in vacuo and purified by chromatography to afford 4-(2-(lH-pyrazol-4-yl)pyridin-4-yloxy)- 2-fluorobenzenamine (0.56 g, 83%) as a light yellow solid. 1H NMR (400 Hz, DMSO-J6) δ 13.01 (s, 1 H), 8.38 (d, J= 5.6 Hz, 1 H), 8.35 (s, 1 H), 8.06 (s, 1 H), 7.29 (d, J =2.4 Hz, 1 H), 7.03 (dd, J = 11.6, 2.4 Hz, 1 H), 6.89 (t, J = 8.8 Hz, 1 H), 6.84 (m, J= 8.4 Hz, 1 H), 6.60 (m, 1 H), 5.20 (s, 2 H); MS (ESI) m/z: 271.0 (M+H+).
Example A28: A solution of Example A23 (3 g, 12.6 mmol), l-methyl-3-(4,4,5,5- tetrameώyl-[l,3,2]dioxaborolan-2-yl)-lH-pyrazole (5.2 g, 25.2 mmol), and Na2CO3 (2.7 g, 25.2 mmol) in DME (18 mL) and water (6 mL) was sparged with nitrogen for 20 min. Pd(PPh3)4 (729 mg, 0.63 mmol) was added and die resulting mixture was heated to 100 0C for 16 h. The solvent was removed under reduced pressure and the crude product was suspended in water and extracted with EtOAc. The organic layer was washed with brine, dried (Na2SO4), concentrated in vacuo and purified by silica gel chromatography to give 2-fluoro-4-(2-(l -methyl- lH-pyrazol-4-yl)pyridin-4-yloxy) aniline (2 g, 56% yield). !H NMR (300 MHz, DMSO-J6) δ 8.31 (d ,J- 5.7 Hz, 1 H), 8.21 (s, 1 H), 7.92 (s, 1 H), 7.12 (s, J= 2.4 Hz, 1 H), 6.96 (m, 1 H), 6.85-6.72 (m, 2 H), 6.56 (m, 1 H), 5.15 (s, 2 H), 3.84 (s, 3H); MS (ESI) m/z: 285.0 (M+H+)
Example A29: By analogy to Example A2, 4-amino-3-fluorophenol (0.12 g, 0.53 mmol), potassium tert-butoxide (0.080 g, 0.71 mmol) and tert-butyl 4-chloropicolinate (159 rag, 0.53 mmol) were combined to provide tert-butyl 4-(4-amino-3- fluorophenoxy)picolinate (151 mg, 67% yield). MS (ESI) m/z: 305.0 (M+H+).
To a solution Of LiAlH4 (699 mg, 18.4 mmol) in THF (15 mL) was added tert-butyl 4-(4-amino-3-fluorophenoxy)picolinate (1.4 g, 4.6 mmol) at 0 0C under N2. The mixture was stirred at 0 0C for 2 h. The reaction mixture was quenched with 10% aq NaOH solution (4 mL), the resultant suspension was filtered and the filtrate was extracted with EtOAc (3 x 30 mL) to give (4-(4-amino-3-fluorophenoxy)pyridin-2-yl)methanol (700 mg, 70% yield). MS (ESI) m/z: 235.1 (M+H+).
A solution of (4-(4-amino-3-fluorophenoxy)pyridin-2-yl)methanol (750 mg, 3.2 mmol) and Et3N (821 mg, 8 mmol) in DMF (10 ml) at 0 0C was treated with tert- butyldimethylsilyl chloride (624 mg, 4.16 mmol). The resulting solution was stirred at RT for 4 hours. The solvent was removed in vacuo and the residue was purified by silica gel column chromatography to provide 4-(2-((tert-butyldimetliylsilyloxy)methyI)pyridin- 4-yloxy)-2-fiuorobenzenamine (370 mg, 33% yield). 1H NMR (400 MHz, DMSO-^6) δ 8.32 (d, J = 5.6 Hz, 1 H), 7.02 (s, 1 H), 6.67-6.82 (m, 4 H), 4.76 (s, 2 H), 3.71 (s, 2 H), 0.89 (s, 9 H), 0.07 (s, 6 H); MS (ESI) m/z: 349.2 (M+H +).
Example A30: Example A23 (1 g, 4.2 mmol) and ethyl(4-methoxy-benzyl)amine (10 mL) were combined and heated to 200 0C for 30 hours. The reaction solution was poured into HO Ac/water (20%, V/V) and extracted with EtOAc (3 x 100 mL). The combined organics were washed with brine (3 x 5OmL) and saturated NaHCO3 solution (2 x 100 mL), dried (NaSO4), concentrated in vacuo and purified by silica gel chromatography to give [4-(4-amino-3-fluoro-phenoxy)-pyridin-2-yl]-ethyl-(4-methoxybenzyl)amine (1.2 g, 78% yield). 1H NMR (400MHz, DMSO-</6) 57.90 (d, J = 5.6 Hz, 1 H), 7.07 (d, J =8.4 Hz, 2 H), 6.82 (d, J= 8.0 Hz, 2 H), 6.74 (m, 2 H), 6.63 (d, J = 7.2 Hz,l H), 6.02 (d, J = 4.0 Hz, IH), 5.90 (s, IH), 5.09 (s, 2H), 4.53 (s, 2H), 3.67 (s, 3H), 3.44 (m, 2 H), 1.00 (t, J = 6.8, 3 H); MS (ESI) m/z: 368.2 (M+H+).
Trifluoroacetic acid (10 mL) was added to a solution of [4-(4-amino-3-fluoro- phenoxy)-pyridin-2-yl]-ethyl-(4-methoxybenzyl)amine (1.2 g, 3.27 mmol) in CH2Cl2 (50 mL) and the resulting solution was heated to 40 0C overnight. The reaction mixture was concentrated under reduced pressure and the residue was treated with HCl (5 mL, 12M, 60 mmol) and water (50 mL). The solution was washed with EtOAc (4 x 50 mL). The aqueous layer was treated with NaHCO3 until pH = 8 and then extracted with EtOAc (3 x 50 mL). The combined extracts were washed with brine (3 x 50 mL), dried (NaSO4) and concentrated in vacuo to give 4~(4-amino-3-fϊuorophenoxy)-N-ethylpyridin-2-amine (0.45 g, 67% yield). 1H NMR (300 MHz, DMSO-^6) 67.79 (d, J= 5.7, 1 H), 6.85 (dd, J= 11.7, 2.4 Hz, 1 H), 6.78 (t, J= 8.7 Hz, 1 H), 6.67 (dd, J= 8.7, 2.4 Hz, 1 H), 6.39 (m, 1 H), 6.05 (dd, J= 5.7, 2.1 Hz, IH), 5.72 (d, J =2.1 Hz, IH), 5.09 (s, 2H), 3.15 (m, 2H), 1.03 (U J =7.2, 3H); MS (ESI) m/z: 248.2 (M+H+).
Example A31: To a solution of Example A23 (0.30 g, 1.3 mmol) in NMP (5 mL) was added isopropylamine (0.54 mL, 6.3 mmol) and it was heated under microwave at 200 °C for 6 hours. Water was added and the solution was extracted with ethyl acetate. The organic layer was washed with brine, dried (MgSO4), concentrated in vacuo and purified by silica gel column chromatography (EtOAc/hexane: EtOAc: MeOHZCH2Cl2) to obtain
4-(4-amino-3-fluorophenoxy)-N-isopropylpyridin-2-amine (0.16 g, 49% yield). MS (ESI) m/z: 262.2 (M+H+).
Example A32: A solution of 3,5-dinitro-benzomtrile (5 g, 25.9 mol), 5-chloro-pyridin-3- ol (3.35 g, 25.9 mol) and K2CO3 (7.2 g, 52 mol) in DMF (150 mL) was heated at 100 0C overnight. The mixture was concentrated in vacuo and the residue was poured into water. The aqueous layer was extracted with ethyl acetate (3 x 150 mL) and the combined organics were washed with brine, dried (Na2SO4), concentrated in vacuo and purified by silica gel chromatography to afford 3-(5-chloro-pyridin-3-yloxy)-5-nitro-benzonitrile (3.1 g, 44 % yield). 1H NMR (400 MHz, DMSO-J6) δ 8.56 (s, 1 H), 8.51 (s, 1 H), 8.47 (s, 1 H), 8.22 (s, 1 H), 8.19 (s, 1 H), 7.87 (s, 1 H).
Iron powder (6.3 g, 112 mmol) was added to a mixture of 3-(5-chloro-pyridin-3- yloxy)-5-nitro-benzonitrile (3.1 g, 11.2 mol) in acetic acid (100 mL) and the reaction was stirred at RT for 6 h. Water (200 mL) was added and the mixture was neutralized to pH 7 with saturated Na2CO3 solution and was extracted with EtOAc (3 x 150 mL). The combined organics were washed with brine, dried (Na2SO4), concentrated in vacuo and purified on silica gel to give 3-amino-5-(5-chloropyridin-3-yloxy)benzonitrile (1.92 g, 71 % yield). 1H NMR (400 MHz, DMSO-J6) δ 8.53 (d, J = 1.6 Hz, 1 H), 8.44 (d, J = 2.4 Hz,
1 H), 7.80 (t, J = 2.4 Hz, 1 H), 6.77 (s, 1 H), 6.72 (d, J = 1.6 Hz, 1 H), 6.56 (d, J = 2.0 Hz,
1 H), 5.92 (s, 2 H); MS (ESI) m/z: 246.2 [M + H]+.
Example A33: 3,5-dinitro-benzonitrile (3 g, 16 mmol), 6-methylpyridin-3-ol (1.7 g, 16 mmol), and K2CO3 (4.3 g, 31 mmol) were dissolved in DMF and heated to 110 0C overnight. The reaction mixture was poured into water and the mixture was extracted with EtOAc. The combined organics were washed with brine, dried (Na2SO^, concentrated in vacuo and purified by silica gel chromatography to provide 3-(6- metliylpyridin-3-yloxy)-5-nitrobenzonitrile (3 g, 76% yield ). 1H NMR (400 MHz, DMSO) δ 8.50 (s, 1 H), 8.38 (s, 1 H), 8.08 (s, 1 H), 8.01 (s, 1 H), 7.59-7.56 (d, J = 10 Hz, 1 H), 7.38-7.36 (d, J - 8.4 Hz, 1 H), 1.98 (s, 3 H); MS (ESI) m/z: 256.3 [M+H]+.
A mixture of 3-(6-methylpyridin-3-yloxy)-5-nitrobenzonitrile (3 g, 0.012 mol) and iron powder in acetic acid (200 mL) was stirred at RT for 6 h. H2O was added and the mixture was adjusted to pH 7 with saturated Na2CO3 solution. The aqueous layer was extracted with EtOAc, and the combined organics were washed with brine, dried (MgSO4), concentrated in vacuo and purified by silica gel chromatography to afford 3- amino-5-(6-methylpyridin-3yloxy)benzonitrile (2 g, 76% yield). 1H NMR (400 MHz, DMSO) δ 8.25 (s, 1 H), 7.42 (d, J = 10 Hz, 1 H), 7.30 (d, J = 8.4 Hz, 1 H), 6.62 (s, 1 H), 6.51 (s, 1 H)5 6.38 (s, 1 H), 5.78 (s, 2 H), 2.49 (s, 3 H); MS (ESI) m/z: 226.2 [M+H]+. Example A34: 3,5-Dinitrobenzonitrile(1.50 g, 7.77 mmol) was added to a slurry of pyridin-3-ol (739 mg, 7.77 mmol) and potassium carbonate (10.7 g, 77.7 mmol) in DMF (15 mL), the mixture was warmed to 60 0C and stirred overnight. After cooling to RT the reaction was diluted with ethyl acetate (50 mL) and water (100 mL). The organic phase was separated, washed with saturated sodium bicarbonate (50 mL) and brine (50 mL), dried (Na2SO4), concentrated in vacuo and purified by chromatography (Si-40 column, ethyl acetate/hexanes) to give a light yellow solid identified as 3-nitro-5-(pyridin~3~ yloxy)benzonitrile (1.31 g , 69% yield). MS (ESI) m/z: 242.0 (M+H+).
A solution of 3-nitro-5-(pyridin-3-yloxy)berizonitrile (1.31 g, 9.42 mmol) and tin(II)chloride dehydrate (6.13 g, 27.2 mmol) in ethanol (20 mL) was warmed to 70 0C for 2 hrs. After cooling to RT, the reaction was poured onto ice/water (100 mL). The aqueous mixture was made basic (pH~=8) with sodium hydroxide, diluted with ethyl acetate (50 mL) and filtered through paper to remove most salts. This solution was extracted with ethyl acetate (2 x 75 mL) and the combined organics washed with brine, dried (Na2SO4) and concentrated in vacuo to give a light yellow solid identified as 3- ammo-5-(pyridin-3-yloxy)benzonitriIe (660 mg, 57% yield). MS (ESI) m/z: 212.0 (M+H+).
Example A3S: Using a procedure analogous to Example A3, 3-amino-4-fluorophenol (491 mg, 3.86 mmol) and 4-chioropyrimidin-2-amine (500 mg, 3.86 mmol) were combined to give 4-(3-amino-4-fluorophenoxy)pyrimidin-2-amine (509 mg, 59% yield). MS (ESI) m/z: 221.0 (M+H+).
Example A36: A solution of l,3-difluoro-2-methylbenzene (15 g, 0.12 mol) in H2SO4 (100 mL) was treated dropwise with HNO3 (65 %, 11.4 g, 0.12 mol) at -10 0C. The resultant mixture was stirred for about 30 min. The mixture was poured into ice- water and extracted with EtOAc (3 x 200 mL). The combined organics were washed with brine, dried (NaSO4) and concentrated in vacuo to give l,3-difluoro~2-methyl-4-nitrobenzene
(16 g, 78% yield). 1H NMR (400MHz, CDCl3) S 7.80 (m, 1 H), 6.8-7.1 (m, 1 H), 2.30 (s, 3 H). l,3-difmoro-2-methyl-4-nitrobenzene (16 g, 0.092 mol), benzyl alcohol (1O g, 0.092 mol) and K2CO3 (25.3 g, 0.18 mol) were combined in DMF (250 mL) and heated to 100 0C overnight. The mixture was poured into water and extracted with EtOAc (3 x 200 mL). The combined organics were washed with brine, dried (Na2SO4), concentrated in vacuo and purified by column chromatography on silica gel to give l-benzyloxy-3- fluoro-2-methyl-4-nitrobenzene (8 g, 33 % yield). 1H NMR (400 MHz, DMSO-Jn) δ 8.04 (t, J= 8.8 Hz, 1 H), 7.30-7.46 (m, 5 H), 7.08 (d, J= 9.2 Hz, 1 H), 5.28 (s, 2 H), 2.13 (s, 3 H). l-Benzyloxy-3-fluoro-2-methyl-4~nitrobenzene (8 g, 0.031 mol) and 10 % Pd-C (Ig) were combined in methanol (100 mL) and the mixture was stirred under an H2 atmosphere (1 ami) overnight. The reaction mixture was filtered and the filtrate was concentrated in vacuo to give 4-amino-3-fluoro-2-methylphenol (4.2 g, 96 % yield). 1H NMR (300 MHz, DMS(Wfi) δ 8.61 (s, 1 H), 6.42 (t, J= 8.4 Hz, 1 H), 7.11 (d, J= 8.4 Hz, 1 H), 4.28 (s, 2 H), 1.96 (s, 3 H); MS (ESI) m/z: 142.1 [M+H]+. Potassium tert-butoxide (3.5 g, 0.031 mol) was added to a solution of 4-amino-3- fluoro-2-methylphenol (4.2 g, 0.03 mol) in DMAc and the resultant mixture was stirred for 30 min at RT. To this mixture was added a solution of 2,4-dichloropyridine (4.38 g, 0.03 mol) in DMAc and the mixture was heated at 100 0C overnight. The reaction mixture was concentrated in vacuo and the residue was dissolved in ethyl acetate (200 mL) and filtered through silica gel, washing forward with EtOAc. The filtrate was concentrated and purified by silica gel chromatography to give 4-(2-chloropyridin-4- yloxy)-2-fluoro-3-methylbenzenamine (3.2 g, 42% yield). 1H NMR (300 MHz, DMSO- d6) δ 8.21 (d, J= 6.0 Hz, 1 H), 6.84 (s, 1 H), 6.81 (dd, J= 5.6, 2.4 Hz, 1 H), 6.67 (m, 2 H), 5.12 (s, 2 H), 1.91 (s, 3 H); MS (ESI) m/z 253.1 [M+H]+. 4-(2-Chloropyridin-4-yloxy)-2-fluoro-3-methylbenzenamine (1.0 g, 3.3 mmol), 1- me-hyl-4-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2-yI)-lH-pyrazole (1 g, 4.8 mmol), Na2CO3 (0.84 g, 6.6 mmol) and Pd(PPh3)4 (0.25 g, 0.2 mmol) were combined in DME (75 mL) and water (25 mL). The mixture was sparged with nitrogen for 15 min and was heated to reflux overnight. The reaction mixture was extracted with EtOAc (3 x 100 mL) and the combined organics were washed with brine, concentrated in vacuo and purified by silica gel chromatography to give 2-fluoro-3-methyl-4-(2-(l -methyl- lH-pyrazol-4- yl)pyridin-4-yloxy)aniline (0.74 g, 75% yield). 1H NMR (300 MHz, DMSO-J6) δ 8.27 (d, J = 6.0 Hz, 1 H), 8.18 (s, 1 H), 7.90 (s, 1 H), 7.07 (s, 1 H), 6.63 (m, 2 H), 6.45 (dd, J= 5.6, 2.4 Hz, 1 H), 5.06 (s, 2H), 3.82 (s, 3 H), 1.95 (s, 3H); MS (ESI) m/z: 299.2 [M+H]÷.
Example A37: A solution of 1,2,3 -trifluoro-4-nitro-benzene (30 g, 0.17 mol) and benzyl alcohol (18.4 g, 0.17 mol) in DMF (300 mL) was treated with K2CO3 (35 g, 0.25 mol) and the resulting mixture was stirred at RT for 8 h. Water (300 mL) was added, and the mixture was extracted with EtOAc (3 x 500 mL). The combined organics were washed with brine, dried (MgSO4), concentrated in vacuo and chromatographed on silica gel to give l-benzyloxy-2,3-difluoro-4-nitrobenzene (16 g, 36% yield). 1H NMR (400 MHz, DMSO-J6): δ 8.06 (m, 1 H), 7.49-7.30 (m, 6 H), 5.37 (s, 2 H).
A mixture of l-benzyloxy-2,3-difluoro-4-nitrobenzene (14 g, 52.8 mmol) and Pd/C (10%, 1.4 g) in MeOH (200 mL) was stirred under a hydrogen atmosphere (30 psi) for 2 h. The catalyst was removed by filtration and the filtrate was concentrated in vacuo to afford 4-amino-2,3difluoro-phenol (7 g, 92% yield). 1H NMR (400 MHz, DMSO-J6) δ 9.05 (s, 1 H), 6.45 (t, J= 8.8 Hz, 1 H), 6.34 (t, J= 9.2 Hz, 1 H), 4.67 (s, 2 H).
Using a procedure analogous to Example A2, 4~amino-2,3-difluorophenol (6 g, 41.4 mmol), potassium tert-butoxide (4.9 g, 43.5 mmol) and 2,4-dichoropyridine (6.1 g, 41.4 mmol) were combined to afford 4-(2-chloro-pyridin-4-yloxy)-2,3-difluorophenylamine (7 g, 66% yield). 1H NMR (400 MHz, DMSO-J6) δ 8.27 (d, J= 6.0 Hz, 1 H), 7.05 (s, 1 H), 6.95 (m, 1 H), 6.92 (d, J= 8.8 Hz, 1 H), 6.62 (d, J= 8.8 Hz, 1 H), 5.60 (s, 2 H).
Example A38: A solution of Example A37 (2 g, 7.8 mmol), l-methyl-4-(4,4,5,5- tetramethyl-[l,3,2]dioxaborolan-2-yl)-lH-pyrazole (1.6 g, 7.8 mmol) and Na2CO3 (1.65 mg, 15.6 mmol) in DME (12 mL) and H2O (4 mL) was sparged with nitrogen for 20 min. Pd(PPh3 )4 (450 mg, 0.4 mmol) was added and the resulting mixture was heated to 70 0C under nitrogen for 16 h. The solvent was removed under reduced pressure and the crude product was suspended in water and extracted with EtOAc (3 x 10 mL). The organic layer was washed with brine, dried (MgSO4), concentrated in vacuo and purified by column chromatography on silica gel to give 2,3-difluoro-4-[2-(l-methyl-lH-pyrazol-4- yl)~pyridin-4-yloxy]phenylamine (1.3 g, 55% yield). 1H NMR (400 MHz, DMSO-J6) S 8.40 (d, J= 6.0 Hz, 1 H), 8.32 (s, 1 H), 8.02 (s, 1 H), 7.26 (s, 1 H), 6.96 (t, J= 8.8 Hz, 1 H), 6.70-6.67 (m, 2 H), 5.62 (s, 2 H), 3.92 (s, 3 H); MS (ESI) m/z: 303.2[M+H]+.
Example A39: Example A23 (2.0 g, 8.4 mmol) and 4-methoxybenzyl amine (50 mL) were combined in a steel bomb and heated to 160 C for 3h. The reaction mixture was concentrated under reduced pressure and purified by reverse prep-HPLC to give N-(4- rnethoxybenzyl)-4-(4-amino~3- fluorophenoxy)pyridin-2-amine (1.0 g, 35% yield).
A solution of N-(4-methoxybenzyl)-4-(4-amino-3-fluorophenoxy)pyridin-2~amine
(500 mg, 1.47 mmol) in CH2Cb (10 mL) was treated with ammonium cerium(IV) nitrate (1.64 g, 2.99 mmol) and the resultant mixture was stirred at RT overnight. The reaction mixture was washed with water, concentrated in vacuo and purified by silica gel chromatography to yield 4-(4~amino-3~fluorophenoxy)pyridm-2-amine (250 mg, 77%
■ yield). 1H NMR (300 MHz, DMSO-^5) δ 7.73 (d, J= 6.0 Hz, 1 H), 6.88 (dd, J= 9.0, 2.0
Hz, 1 H), 6.80 (t, J= 8.7 Hz, 1 H), 6.68 (m, 1 H), 6.06 (dd, J= 4.5, 1.8 Hz, 1 H), 5.84 (s, 2 H), 5.75 (d, J = 1.5 Hz, 1 H), 5.08 (s, 2 H); MS (ESI) m/z: 220.3 (M+H+).
Example A40: A solution of 4-amino-2-methyl-phenol (4.25 g, 34.5 mmol) in dimethylacetamide (50 mL) was degassed in vacuo and blanketed with argon. Potassium tert-butoxide (5.0 g, 44.6 mmol) was added and the reaction mixture was de-gassed a second time and stirred at RT under argon for 30 min. 2,4-Dichloro-pyridine (4.6 g, 31.3 mmol) was added and the mixture was heated to 100 0C overnight. The solvent was removed under reduced pressure and the residue was purified by silica gel chromatography to give 4-(2-chloropyridin-4-yloxy)-3-methylbenzenamine (4.5 g, 56% yield). 1H NMR (400 MHz, DMSO-Jn) δ 8.21 (d, J= 5.2 Hz, 1 H), 6.75-6.80 (m, 3 H), 6.45-6.50 (m, 2 H), 5.15 (s, 2 H), 1.92 (s, 3 H); MS (ESI) m/z: 235.1 (M+H+).
A solution of 4-(2-chloropyridin-4-yloxy)-3-methylbenzenamme (595 mg, 2.54 mmol), l-methyl-4-(4,4,5,5-tetramethyl)-[l,3,2] dioxaborolan-2-yl)-4H-pyrazoIe (790 mg, 3.80 mmol) and Cs2CO3 (2.53 g, 7.77 mmol) in 10 mL of DMF (10 mL) and water (3 mL) was de-gassed under vacuum and blanketed with nitrogen. Pd(PPh3J4 (295 mg, 0.26 mmol) was added and the reaction mixture was heated to 90 °C overnight. The reaction mixture was diluted with EtOAc (30 mL) and washed with water (2 x 10 mL) and brine (2 x 10 mL). The aqueous portion was extracted with EtOAc (2 x 15 mL) and the combined organics were washed with brine (10 mL), concentrated in vacuo and purified on silica gel to provide 3 -methyl-4-(2-(l -methyl- lH-pyrazol-4-yl)pyridin-4- yloxy)benzenamine as a pale yellow colored foam (627 mg, 88% yield). 1H NMR (400 MHz, DMSCWtf): δ 8.27 (d, J - 6.0 Hz, 1 H), 8.18 (s, 1 H), 7.90 (d, J - 0.7 Hz, 1 H), 7.07 (d, J = 2.2 Hz, 1 H), 6.74 (d, J = 8.6 Hz, 1 H), 6.49 (d, J = 2.5 Hz, 1 H), 6.46-6.40 (m, 2 H), 5.02 (s, 2 H), 3.84 (s, 3 H), 1.94 (s, 3 H); MS (ESI) m/z: 281.2 (M+H+).
Example A41: 4-Chloro-2-methylsulfanyl-pyrimidine (1.4 g, 8.8 mmol), 4-(4,4,5,5- tetramethyl-[l,3,2]dioxaborolan-2-yl)-lH-pyrazole (2.0 g, 10.3 mmol), Na2CO3 (2.8 g, 26.4) and Pd(PPh3J4 (500 mg, 0.43 mmol) were combined in a solvent comprised of toluene/EtOH/H2O (4/4/1, 20 mL). The mixture was degassed by applying a vacuum and backfilling the headspace with argon. The reaction mixture was heated overnight at 100 0C. The insoluble portion was filtered and the filtrate was concentrated and purified by silica gel chromatography to provide 2-(methylthio)-4-(lH-pyrazol-4-yl)pyrimidine (1.2 g, 71% yield). !H NMR (400 MHz, CDCl3) δ 8.45 (d, J = 6.4 Hz5 1 H), 8.24 (s, 1 H), 7.23 (s, 1 H), 7.05 (d, J= 6.4 Hz, 1 H), 2.51 (s, 3 H).
To a solution of 2-(methylthio)-4-(lH-pyrazol-4-yl)pyrimidine (200 mg, 1 mmol) in dichloromethane (3 mL) and H2O (1 mL) was added 4-methoxybenzyl chloride (200 mg, 1.28 mmol) at 00C. The mixture was stirred at RT overnight. The organic layer was separated, washed with brine and concentrated in vacuo to give crude 4-(l-(4- metlioxybenzyl)-lH-pyrazol-4-yl)-2-(methylthio)pyrimidine. 1H NMR (300 MHz, DMSO-rfβ) δ 8.58 (s, 1 H), 8.50, (d, J- 5.4 Hz, 1 H), 8.16 (s, 1 H), 7.40 (d, J- 5.4 Hz, 1 H), 7.27 (d, J= 8.4 Hz, 2 H), 7.22 (d, J= 8.4 Hz, 2 H), 5.30 (s, 2 H), 3.72 (s, 3 H), 2.51 (s, 3 H); MS (ESI) m/z: 313 (M+H÷).
To a solution of 4-(l-(4-methoxybenzyI)-lH-pyrazol-4-yl)-2- (methylthio)pyrimidine (200 mg, 0.64 mmol) in dichloromethane was added m-CPBA (220 mg, 1.28 mmol). The reaction was stirred for 2 hour at RT. Water was added, the organic layer was separated and the aqueous layer was extracted with dichloromethane. The combined organics were washed with brine and concentrated in vacuo. The residue was combined with 3-amino-4-fluorophenol (165 mg, 1.28 mmol) and K2CO3 (176 mg, 1.28 mmol) in DMF (5 mL) and the resultant mixture was heated at 90 0C overnight. After filtration and concentration, the residue was purified by silica gel column chromatography to give 5-(4-(l-(4~methoxybeiizyl)-lH-pyrazol-4-yl)pyrimidm-2-yloxy)-
2-fluorobenzenamine (210 mg, 84% yield). 1H NMR (300 MHz, DMSO-^) δ 8.50 (s, 1
H), 8.44, (d, J= 5.4 Hz, 1 H), 8.10 (s, 1 H), 7.42 (d, J= 5.4 Hz, 1 H)3 7.25 (d, J= 8.4 Hz, 2 H), 6.98 (t, J= 9.6 Hz, 1 H), 6.91 (d, J- 8.4 Hz, 2 H), 6.52 (dd, J= 2.7, 8.7 Hz5 1 H),
6.28 (m, 1 H), 5.30 (br s, 2 H), 5.26 (s, 2 H), 3.72 (s, 3 H); MS (ESI) m/z: 392.2 (M+H+).
To a solution of 5-(4-(l-(4-methoxybenzyl)-lH-pyrazol-4-yl)pyrimidin-2-yloxy)-
2-fluorobenzenamine (50 mg, 0.13 mrnol) in dichloromethane (3 mL) was added TFA
(0.3 mL) at 0 0C and the reaction stirred at RT for 12h. The solvent was removed in vacuo, the residue was washed with ether and treated with saturated ammonia solution. The solid was collected via filtration and dried under vacuum to give 5-(4-(lH-pyrazol-4- yl)pyrimidin-2-yloxy)-2-fluorobenzenamine (15 mg, 43% yield). 1H NMR (300 MHz, MeOD) δ 8.44 (d, J= 5.1 Hz, 1 H), 8.23 (br s, 2 H), 7.40 (d, J= 5.4, 1 H), 7.02 (dd, J = 10.8, 8.7 Hz, 1 H), 6.73 (dd, J = 2.7, 7.2 Hz, 1 H), 6.50 (m, 1 H); MS (ESI) m/z: 272.2 (M+H+).
Example A42; Using a procedure analogous to Example A3, 3-amino-4-fluorophenol (0.127 g, 1.0 mrnol) and 5-bromo-2-nitropyridine (0.203 g, 1.0 mmol) were combined to afford 2-fluoro-5-(6-nitropyridin-3-yloxy)benzenarnine (0.098 g, 39% yield) as a yellow solid. 1H NMR (400 MHz, DMSO-d6) δ 8.36 (d, J = 2.8 Hz, IH), 8.30 (d, J = 8.8 Hz, IH), 7.56 (dd, J= 8.8, 2.8 Hz, IH), 7.07 (m, IH), 6.53 (dd, J= 7.6, 3.2 Hz, IH), 6.31 (s, IH), 5.48 (s, 2H); MS (ESI) m/z: 250.0 (M+H+).
Example Bl: To a stirring solution of benzyl 6-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan~ 2-yl)-3,4-dihydroisoquinoline-2(lH)-carboxylate (0.991 g, 2.52 mmol, 1.00 eq) in THF
(10 ml) and H2O (2.5 ml) was added NaIO4 (1.62 g, 7.56 mmol, 3.00 eq). The resulting suspension was stirred at 25 0C for 30 min and then treated with 3M HCl (1.68 ml, 5.04 mmol, 2.0 eq). The mixture was stirred for 2.5 h. The supernatant was decanted away from the solids, rinsing forward with THF. The combined organic phases were washed with brine (2x), dried (MgSO4) and concentrated in vacuo to give crude 2-
(benzyloxycarbonyl)-l,2,3,4-tetrahydroisoquinolin-6-ylboronic acid (0.640 g, 82% yield) as a foam which was used as is in the next reaction. 1H NMR (400 MHz, OMSO-d6) δ 7.68-7.58 (m, 2H), 7.45-7.29 (m, 6H), 7.17 (m, IH), 5.13 (s, 2H), 4.62-4.56 (brm, 2H)5 3.65 (brs, 2H), 2.86 (t, 2H, J = 5.60 Hz); MS (ESI) m/z: 312.0 (M+H+).
To a stirring suspension of 2-(benzyloxycarbonyl)-l,2,3,4-tetrahydroisoquinolin- 6-ylboronic acid (0.640 g, 2.06 mmol, 1.00 eq) and 4A MS (0.64 g) in CH2Cl2 (20 ml) was added pyridine (0.168 ml, 2.06 mmol, 1.00 eq) followed by ethyl 3-t-butyl-lH- pyrazole-5-carboxylate (0.404 g, 2.06 mmol, 1.00 eq) and Cu(OAc)2 (0.374 g, 2.06 mmol, 1.00 eq). The resulting blue-green mixture was stirred at 25 0C. After 40 h, the mixture was diluted with H2O and decanted away from the molecular sieves. The layers were separated and the organic phase was washed with H2O (2x). The combined aqueous phases were extracted with CH2Cl2 (Ix). The combined organic phases were dried (MgSO4), concentrated in vacuo and purified by flash chromatography (EtOAc/hexanes) to afford benzyl 6-(3-t-butyl-5-(ethoxycarbonyI)-lH-pyrazol-l-yl)-3,4- dihydroisoquinoline-2(lH)-carboxylate (0.46 g, 48% yield). 1H NMR (400 MHz, δ 7.41-7.28 (m, 5H), 7.24-7.20 (m, 3H), 6.96 (s, IH), 5.15 (s, 2H), 4.67 (brm, 2H), 4.17 (q, 2H, J = 7.2 Hz), 3.66 (brs, 2H), 2.86 (t, 2H, J = 6.0 Hz), 1.29 (s, 9H), 1.18 (t, 3H, J = 7.2 Hz); MS (ESI) m/z: 462.3 (M+H+).
To a stirring solution of benzyl 6-(3-t-butyl-5-(ethoxycarbonyl)-lH-pyrazol-l-yl)- 3,4-dihydroisoquinoline-2(lH)-carboxylate (0.160 g, 0.347 mmol) in 1:1 :1 THF/EtOH/H2O (3 ml) at 22 0C was added LiOH-H2O (0.0727 g, 1.73 mmol). After 3 h, the completed reaction was acidified (pH 2-3) with IM HCI and extracted with EtOAc (3x). The combined organic phases were washed with brine (2x), dried (MgSO4), filtered and evaporated to afford l-(2-(benzyloxycarbonyl)- 1,2,3 , 4-tetrahydroisoquinolin-6~yl)~3 - t-butyl-lH-pyrazole-5-carboxyIic acid (0.16 g, 106% yield) as an oil which was used without further purification. 1H NMR (400 MHz, DMSO- ά6) δ 7.41-7.31 (m, 5H), 7.328- 7.20 (m, 3H), 6.91 (s, IH), 5.15 (s, 2H), 4.65 (brm, 2H), 3.66 (brs, 2H), 2.86 (t, 2H, J = 6.0 Hz), 1.29 (s, 9H); MS (ESI) m/z: 434.2 (M+H+).
Example B2: Ethyl 3-t-butyl-l-(2-(trifluoromethylsulfonyloxy)quinolin-6-yl)-ii/- pyrazole-5-carboxylate (see WO 2006/071940A2, 0.380 g, 0.806 mmol), MeNH2-HCl
(0.109 g, 1.61 mmol) and Et3N (0.449 ml, 3.22 mmol) were combined DMF (8 mL) and stirred at RT overnight. Additional portions Of MeNH2-HCl (0.109 g, 1.61 mmol) and Et3N (0.449 ml, 3.22 mmol) were added and the reaction was stirred an additional 4 h at RT and 3 h at 60 0C. The completed reaction was diluted with brine and extracted with EtOAc. The extracts were washed with brine, dried (Na2SO4), concentrated in vacuo and purified by silica gel chromatography to provide ethyl 3-tert-butyl-l-(2- (methylamino)quinolin-6-yl)-lH-pyrazole-5-carboxylate (240 mg, 85% yield). 1H NMR (400 MHz, DMSO-de) δ 7.90 (d, J = 92 Hz, IH), 7.68 (d, J = 2.8 Hz, IH), 7.53 (d, J - 9.2 Hz, IH), 7.46 (dd, J- 8.8, 2.0 Hz, IH), 7.17 (q, J= 4.8 Hz, IH), 6.98 (s, IH), 6.80 (d, J= 8.8 Hz, IH), 4.16 (q, J - 7.2 Hz, 2 H), 2.92 (d, J= 4.8 Hz, 3H), 1.32 (s, 9H), 1.13 (t, J = 7.2 Hz, 3 H); MS (ESI) m/z: 353.2 (M+H+).
LiOH-H2O (0.143 g, 3.40 mmol ) was added to a solution of ethyl 3-tert-butyl-l- (2-(methylamino)quinolin-6-yl)-lH-pyrazole-5-carboxylate (0.240 g,0.68 mmol) in a mixture of water/THF/EtOH (1 :1 :1, 9 mL). The reaction mixture was stirred overnight at RT, diluted with 3 M HCl and extracted with EtOAc and THF. The combined organics were washed with brine, dried (MgSO4) and concentrated under vacuum to obtain 3-tert- butyl~l-(2-(methylamino)quinolin-6-yl)-lH-pyrazole-5-carboxylic acid (0.22 g, 100% yield). 1H-NMR (DMSO-J6) δ 7.90 (d, J= 9.2 Hz, IH), 7.66 (d, J= 2.4 Hz, IH), 7.52 (d, J- 8.8 Hz, IH), 7.46 (dd, J= 9.2, 2.8 Hz, IH), 7.14 (m, IH), 6.88 (brs, IH), 6.79 (d, J = 9.2 Hz, IH), 2.92 (d, J= 4.8 Hz, 3H), 1.31 (s, 9H); MS (ESI) m/z: 325.2 (M + H+).
Example B3: A solution of triflic anhydride (42.8 g, 0.15 mol) in CH2Cl2 (10OmL) was added dropwise to a 0 °C solution of 6-hydroxyquinoline (20.00 g, 0.138 mol) and pyridine (23 g, 0.277 mol) in CH2Cl2 (500 mL). The cooling bath was removed and the resulting solution was stirred at RT for 4 h. The reaction mixture was washed with water (3 x 300 mL) and the organic phase was dried (MgSO4) and concentrated under vacuum to afford crude quinolin-6-yl trifluoromethanesulfonate (4Og, >100% yield) as an oil. 1H- NMR (400 MHz, DMSO-4) δ 9.00 (d, 1 H, J= 2.8 Hz), 8.50 (d, IH, J= 8.0 Hz), 8.21 (d, J = 2.8 Hz, IH), 8.18 (d, J - 9.2 Hz, IH), 7.80 (m, 1 H), 7.64 (m, 1 H); MS (ESI) m/z: 277.9 (M+H+). To a suspension of quinolin-6-yl trifluoromethanesulfonate (40 g, 0.14 mol), benzophenone hydrazone (35.6 g, 0.18 mol), cesium carbonate (74 g, 0.23 mol) and 1,F- bis(diphenylphosphino)ferrocene (2.5 g, 4.5 mmol) in degassed toluene (1 L) was added palladium acetate (0.013 g, 0.058 ramol). The resultant mixture was heated to 90 0C under a nitrogen atmosphere. After 16 h, the mixture was concentrated in vacuo and the residue was purified via silica gel column chromatography (EtO Ac/pet ether) to provide l-(diρhenylmethylene)-2-(quinolin-6-yl)hydrazine (32 g, 68.6% yield). 1H-NlVIR (300 MHz, OMSO-d6) δ 9.22 (s, 1 H), 8.58 (t, J= 1.8 Hz, 1 H), 8.13 (d, J= 3.6 Hz, 1 H), 7.80 (U1 J= 3.6 Hz, 1 H), 7.61 (d, J- 3.9 Hz, 1 H), 7.59-7.51 (m, 4 H), 7.50 (d, J = 3.6 Hz, 2 H), 7.33-7.39 (m, 6 H); MS (ESI) m/z: 324 (M+H+).
A solution of l-(diphenylmethylene)-2-(quinolin-6-yl)hydrazine (32 g, 99 mmol) and 4,4-dimethyl-3-oxo-pentanenitrile (26 g, 0.15 mol) in ethanol (500 mL) was treated with cone HCl (80 ml, 12 N, 0.96 mol) and the mixture was heated to reflux overnight. The cooled reaction mixture was concentrated under vacuum and the residue was washed with Et2O to remove the diphenylketone. The crude product was dissolved in EtOAc and neutralized (pH 8) with saturated Na2CO3 solution. The organic layer was dried (Na2SO4), concentrated in vacuo and purified by silica gel chromatography to give 5-tert- butyl-2-quinolin-6-yl-2H-pyrazol-3-ylamine (23 g, 87% yield). 1H-NMR (300 MHz, DMSO-^ύ) δ 8.86 (m, 1 H), 8.39 (d, J= 5.7 Hz, 1 H), 8.11-8.02 (m, 3 H), 7.54 (m, 1 H), 5.46 (s, 1 H), 5.42 (br s, 2 H), 1.23 (s, 9 H); MS (ESI) m/z: 267.2 (M+H+).
To a cold solution (-10 0C) of 5-fer/»butyl-2-quinolin-6-yl-2H-pyrazol-3-ylamine (8.00 g, 30 mmol) in 100 ml of CH2Cl2 was added pyridine (8.0 ml, 99 mmol) and DMAP (100 mg), followed by a solution of trichloroethyl chloroformate (8.9 ml, 42 mmol) in 30 ml of CH2Cl2 over a period of 20 minutes. After stirring for 1 hour, water (100 ml) was added, stirring continued for 10 more minutes and the organic layer separated. The organic layer was washed with brine, dried and the dark brown residue obtained after removal of the solvent crystallized from acetonitrile to furnish 2,2,2- trichloroethyl 3-tert-butyl-l-(quinolin-6-yl)-lH-pyrazol-5-ylcarbamate as a white solid (8.23 g, 62% yield). 1H NMR (DMSO-d6) δ 10.15 (br s, IH) 8.93 (m, IH), 8.41 (d, J = 8Hz, IH), 8.1 l(m, 2H), 7.90 (dd, J = 8, 2 Hz, IH), 7.60 (dd, J = 6.4, 4.2 Hz, IH), 6.39 (s, IH), 4.85 (s, 2H), 1.32 (s, 9H); MS (ESI) m/z: 442 (M+H +). Example B4: Quinolin-6-ylboronic acid (0.34 g, 2.0 mrnol) was dissolved in CH2Cl2 (30 mL) and pyridine (1 mL) with MS (activated 4A) and stirred at RT for 6 hours. Ethyl 3- tert-butyl-lH-pyrazole-5-carboxylate (0.39 g, 2.0 mmol) and copper(II) acetate (0.36 g, 2.0 mmol) were added and the reaction was stirred at RT for 3 days open to air. The reaction mixture was filtered through a pad of Celite®, the filtrate was concentrated in vacuo and purified by silica gel chromatography to obtain ethyl 3-tert-butyl-l-(quinolin- 6-yl)-lH-pyrazole-5-carboxylate (0.21 g, 33% yield). MS (ESI) m/z: 324.0 (M+H÷).
Lithium hydroxide (62 mg, 2.6 mmol) was added to a solution of ethyl 3-tert- butyl-l-(quinolin-6-yl)-lH-pyrazole-5-carboxylate (0.21 g, 0.65 mmol) in dioxane-H2O- EtOH (1 :1 :1, 6 mL). The reaction mixture was stirred overnight at RT. The solution was concentrated and the residue was dissolved in H2O (2 mL). 3M HCl was added and the precipitate was collected by filtration and washed with water. The solid was dried under vacuum to obtain 3-tert-butyl-l-(quinolin-6-yl)-lH-pyrazole-5-carboxylic acid (0.18 g, 94% yield) as a white solid. 1H NMR (400 MHz, DMSO-^6) δ 8.96 (dd, J= 2.0, 4.0 Hz3 IH), 8.47 (dd, J= 1.2, 8.4 Hz, IH), 8.09 (rn, IH), 8.06 (s, IH), 7.82 (dd, J- 2.8, 9.2 Hz, IH), 7.61 (dd, J = 4.8, 8.8 Hz, IH), 7.01 (s, IH), 1.33 (s, 9H); MS (ESI) m/z: 296.0 (M+H+).
Example B5: [3-(5-amino-3-t-butyl-pyrazol-l-yl)naphthalen-l-yl]acetic acid ethyl ester hydrochloride (see WO 2006/071940, 1.60 g, 4.55 mmol) was treated with ammonia in methanol (7 M, 13 mL, 91 mmol) and the reaction mixture was heated in a sealed tube for 6 days. The solvent was removed in vacuo and the residue was chromatographed to provide 2-(3-(5-amino-3-tert-butyl-lH-pyrazoI-l-yl)naphthalen-l-yl)acetamide (610 mg, 41 % yield). MS (ESI) m/z: 323.3 (M+H+). To a mixture of saturated sodium bicarbonate (20 mL), ethyl acetate (20 mL) and 2-
(3-(5-amino-3-tert-butyl-lH-pyrazol-l-yl)naphtlialen-l-yl)acetamide (300 mg, 0.931 mmol) was added Troc-Cl (296 mg, 1.40 mmol). The mixture was stirred vigorously overnight. The mixture was diluted with ethyl acetate (30 mL) and the organic phase was separated, washed with 5% citric acid (30 mL) and brine (30 mL), dried (Na2SO4) and concentrated in vacuo to give a solid which was triturated with ethyl acetate and filtered to provide 2,2,2-trichloroethyl l-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-tert-butyl- lH-pyrazol-5-ylcarbamate (241 mg, 52% yield). MS (ESI) m/z: 499.0 (M+H+).
Example B6: To a stirring suspension of tert-butyl 5-(5-amino-3-tert-butyl-lH-pyrazoI- l-yl)-lH-indazole-l-carboxylate (see WO 2006/071940 A2, 0.250 g, 0.70 mmol) and Troc-Cl (0.10 ml, 0.74 mmol) in EtOAc (7 ml) at RT was added sat'd. NaHCO3 (2.9 ml, 2.1 mmol). After 3h, the completed reaction was diluted with hexanes (35 ml) and filtered. The solid was rinsed well with hexanes and dried to afford tert-butyl 5-(3-tert- butyl-5-((2,2,2-trichloroethoxy)carbonyl)- 1 H-pyrazol- 1 -yl)~ 1 H-indazole- 1 -carboxylate (0.3ό g, 97% yield). MS (ESI) m/z: 532.0 (M+H+).
Example B7: To a stirring solution of t-butyl 6-(5-amino-3 -t-butyl-1 H-pyrazol- 1 -yl)- 3,4-dihydroisoquinoline-2(lH)-carboxylate (see WO 2006/071940A2, 0.075 g, 0.20 mmol) and Troc-Cl (0.028 ml, 0.21 mmol) in EtOAc (2 ml) was added sat'd. NaHCO3 (0.82 ml, 0.61 mmol). The resulting biphasic solution was stirred at RT overnight. The layers were separated and the aqueous phase was extracted with EtOAc (2x). The combined organic phases were washed with brine (Ix), dried (MgSO4) and concentrated in vacuo to give crude t-butyl 6-(3-t-butyl-5-((2,2,2-trichIoroethoxy)carbonyl)-lH- pyrazol-l-yl)-3,4-dihydroisoquinoline-2(lH)-carboxylate (0.110 g, 100% yield). 1H NMR (DMSO-^6) δ 9.93 (brs, IH), 7.29-7.24 (m, 2H), 6.83-6.80 (m, IH), 6.27 (s, IH), 4.85 (s, 2H), 4.52 (brs, 2H), 3.57-3.53 (m, 2H), 2.82-2.79 (m, 2H), 1.44 (s, 9H), 1.27 (s, 9H); MS (ESI) m/z: 545.0 (M+H÷).
Example B8: A solution of tert-butyl 5-(5-amino-3-tert-butyl~lH-pyrazol-l-yl)-lH- indazole-1 -carboxylate (see WO 2006/071940 A2, 0.64 g, 1.80 mmol) in EtOAc (6 mL) was treated with IM aq NaOH (2.7 mL). To the stirring biphasic reaction mixture at 0 0C was added isopropenyl chlorofoπnate (0.26 mL) dropwise over 1 min. The reaction mixture was stirred for 4 h at RT. The reaction was diluted with EtOAc (20 ml). The organic layer was washed with H2O (2x10 ml), brine (10 ml) dried (MgSO4) and concentrated to afford tert-butyl 5-(3-tert-butyl-5-((prop-l-en-2-yloxy)carbonylamino)-
1 H-pyrazol- l-yl)-l H-indazole- 1 -carboxylate (0.69 g, 87% yield) as a light yellow foam.
1H NMR (DMSO~d6) δ 9.77 (s, IH), 8.52 (s, IH), 8.17 (d, J = 9Hz, IH), 7.97 (d, J - 2 Hz, IH), 7.74 (dd, J- 9, 2 Hz IH), 6.34 (s, IH), 4.7 (m, 2H), 1.80 (s, 3H), 1.67 (s, 9H), 1.30 (s, 9H); MS (ESI) m/z: 440.2 (M-I-H+).
Example B9: Using a procedure analogous to Example B3, 6-(2- (diphenylmethylene)hydrazinyl)quinoline (4.0 g, 12.3 mmol) and 4-methyl-3-oxo- pentanenitrile (1.5 g, 13.5 mmol) were combined to provide to 3~isopropyl-l-(quinolin-6- yl)-lH-pyrazol-5-amine. (1.1 g, 36% yield). 1H NMR (400 MHz, CDCl3) δ 8.93 (dd, J =
4.4, 1.6 Hz, 1 H), 8.21-8.18 (m, 2 H), 8.05-8.02 (m, 2 H), 7.44 (dd, J = 8.4, 4.4 Hz, 1 H),
5.56 (s, 1 H), 3.85 (br s, 2 H), 2.97 (m, 1 H), 1.31 (d, J = 6.8 Hz, 6 H); MS (ESI) m/z: 253.2 (M+H+).
Using a procedure analogous to Example B3 3-isopropyl-l-(quinolin-6-yl)-lH- pyrazol-5-amine (0.378 g, 1.5 mmol) was converted to 2,2,2-trichloroethyl 3-isopropyl-l- (quinolin-6-yl)-lH-pyrazol-5-ylcarbamate (0.391 g, 61% yield). MS (ESI) m/z: 427.0 (MH-H+).
Example BlO: Using a procedure analogous to Example B3, 6-(2-
(diphenylmethylene)hydrazinyl)qumoline (4.0 g, 12.3 mmol) and 3-oxo-pentanenitriIe
(1.3 g, 1.1 eq) were combined to yield 5-etliyl-2-quinolin-6-yl-2H-pyrazol-3-ylamine (2.5 g, 85% yield). 1H NMR (300 MHz, OMSO-d6) δ 8.87 (dd, J = 7.8, 1.8 Hz, 1 H), 8.39 (dd, J= 8.4, 1.5 Hz, 1 H), 8.12 (s, 1 H), 8.06-8.03 (m, 2 H), 7.54 (dd, J - 8.4, 1.2 Hz, 1
H), 5.46 (br s, 2 H), 5.40 (s, 1 H), 2.49 (q, J= 7.5 Hz, 2 H), 1.16 (t, J = 7.5 Hz, 3 H); MS
(ESI) m/z: 239.2 (M+H+).
Using a procedure analogous to Example B3, 5-ethyl-2-quinolin-6-yl-2H- pyrazol-3-ylamine (0.378 g, 1.5 mmol) was converted to 2,2,2-trichloroethyl 3-ethyl-l- (quinolm-6-yl)-lH-pyrazol-5-ylcarbamate (0.287 g, 41% yield) as a white foam. MS
(ESI) m/z: 413.0 (MH-H+).
Example BIl: Using a procedure analogous to a procedure analogous to Example B3, ό-(2-(diphenylmethylene)hydrazinyϊ)quinoline (5.0 g, 15.5 mmol) and 4,4,4-trifluoro-3- oxo-butyronitrile (2.3 g, 16.8 mmol) were combined to yield 2-quinolin-6-yl-5- trifluoromethyl-2H-pyrazol-3-ylamine (2.3 g, 53% yield). 1H NMR (300 MHz5 DMSO- d6) δ 8.95 (dd, J= 1.5, 4.2 Hz, 1 H), 8.47 (d, J- 7.2 Hz, 1 H), 8.22 (d, J = 2.4 Hz, 1 H), 8.14 (d, J = 9.3 Hz, 1 H), 7.97 (dd, J= 2.4, 9.0 Hz, 1 H), 7.60 (dd, J= 7.2, 4.2 Hz, 1 H), 5.96 (br s, 2 H), 5.85 (s, 1 H); MS (ESI) m/z: 279.2 (M+H+).
Using a procedure analogous to Example B3, 2-qumolin-ό-yl-5-trifluoromethyl- 2H-pyrazol-3-ylamine (0.47 g, 1.7 mmol) was converted to 2,2,2-trichloroethyl 1- (quinolin-6-yl)-3-(trifluoromethyl)-lH-pyrazol"5-ylcarbamate (0.333 g, 43% yield). MS (ESI) m/z: 453.0 (M+H+).
Example B12: Using a procedure analogous to Example B3, 6-(2- (diphenylmethylene)hydrazinyl)quinoline (5.0 g, 15.5 mmol) and 3-cyclopentyl-3- oxopropanenitrile (3.0 g, 1.1 eq) were combined to yield 3-cyclopentyl-l-(quinolin-6-yl)- lH-pyrazol-5-amine (2.3 g, 53% yield). 1H NMR (300 MHz, DMSO-J6) 5 8.87 (m, 1 H), 8.38 (dd, J= 1.5, 8.4 Hz, 1 H), 8.10 (s, 1 H), 8.04-8.02 (m, 2 H), 7.55 (dd, J = 4.2, 8.1 Hz, 1 H), 5.41 (br s, 2 H)5 5.38 (s, 1 H)5 2.90 (m, 1 H), 1.85-1.96 (m, 2 H), 1.53-1.70 (m, 6 H); MS (ESI) m/z: 279.3 (M+H+). Using a procedure analogous to Example B3, 3-cyclopentyl-l-(quinolm~6-yl)- lH-pyrazol-5-amine (0.418 g, 1.5 mmol) was converted to 2,2,2-trichloroethyl 3- cyclopentyl-l-tquinolin-β-yO-lH-pyrazol-S-ylcarbamate (0.394 g, 58% yield). MS (ESI) m/z: 453.0 (M+H+).
Example B13: Using a procedure analogous to Example B3, 6-(2- (diphenylmethylene)hydrazinyl)quinoline (4.0 g, 12.3 mmol) and 3-cyclobutyl-3-oxo- propionitrile (1.7 g, 1.1 eq) were combined to provide 5-cyclobutyl-2-qumolm-6-yl-2H- pyrazol-3-ylamine (1.3 g, 40% yield). 1H NMR (300 MHz, CDCl3) δ 8.92 (dd, J = 4.5, 1.2 Hz, 1 H), 8.16-8.20 (m, 2 H), 8.00-8.04 (m, 2 H), 7.43 (dd, J= 8.4, 1.2 Hz, 1 H), 5.64 (s, 1 H), 3.83 (br s, 2 H), 3.53 (m, 1 H), 2.40-2.20 (m, 4 H), 2.08-1.92 (m, 2 H); MS (ESI) m/z: 265.1 (M+H+).
Using a procedure analogous to Example B3, 5-cyclobutyl-2-quinolin-6-yl-2H- pyrazol-3-ylamine (0.396 g, 1.5 mmol) was converted to 2,2,2-trichloroethyl 3- cyclobutyl-l-(qumolin-6-yl)-lH-pyrazol-5-ylcarbamate (0.412g, 63% yield). MS (ESI) m/z: 439.0 (M+H+). Example B14: A degassed mixture of ethyl 5-chloro-2-iodobenzoate (0.621 g, 2.00 mmol), Pd(PPh3)4 (0.116 rag, 0.1 mmol), quinolin-6-ylboronic acid (0.381 g, 2.2 mmol), K2CO3 (0.553 g, 4.0 mmol), dimethoxyethane (20 mL), and water (5 mL) was heated under reflux overnight. Solvents were removed under reduced pressure. The residue was diluted with sat'd NH4Cl (15 mL) and extracted with EtOAc (3 x 30 mL). The combined organic layers were dried (MgSO4), concentrated in vacuo and purified by chromatography to afford ethyl 5-chloro-2-(quinolin-6-yl)benzoate (0.244 g, 39% yield) as a colorless oil. MS (ESI) m/z: 312.0 (M+H+).
To a stirring solution of ethyl 5-chloro-2-(quinolin-6-yl)benzoate (0.244 g, 0.78 mmol) in 1:1 :1 THF/EtOH/H2O (21 ml) at RT was added LiOH-H2O (0.164 g, 3.91 mmol). The resulting reaction mixture was stirred at RT overnight. Solvent was removed under reduced pressure and the residue was diluted with H2O (10 mL). The aqueous solution was acidified to pH~4 with 3M HCl and extracted with EtOAc (3x30 mL). The combined organic layers were washed with brine (20 mL), dried (MgSO4) and concentrated to afford 5-chIoro-2-(quinolin-6-yl)benzoic acid (0.201 g, 91% yield) as a white solid. MS (ESI) m/z: 284.0 (M+H+).
To a stirring solution of 5-chloro-2-(quinolin-6-yl)benzoic acid (0.201 g, 0.708 mmol) and TEA (0.148 ml, 1.06 mmol) in 1,4-dioxane (10 ml) at RT, was added DPPA (0.191 ml, 0.244 mmol). After stirring for 30 min at RT, 2,2,2-trichloroethanol (0.680 ml, 7.08 mmol) was added and the reaction was stirred with heating at 100 0C for 2 h. The completed reaction was diluted with brine (10 ml) and extracted with EtOAc (3x25 ml). The combined organics were washed with 5% citric acid (10 ml), sat'd. NaHCO3 (10 ml) and brine (10 ml), dried (MgSO4), concentrated in vacuo and purified by chromatography to afford 2,2,2-trichloroethyl 5-chloro-2-(quinolin-6-yl)phenylcarbamate (0.25 g, 82% yield) as a white solid. MS (ESI) m/z; 431.0 (M+H+).
Example B15: 2,2,2-Trichloroethyl 4-chloro-2-(quinolin-6-yl)phenylcarbamate was prepared from ethyl 4-chloro-2-iodobenzoate using a procedure analogous to Example B14. MS (ESI) m/z: 431.0 (M+H+). Example B16: A mixture of 5-ratro-lH-indazole (50 g, 0.31 mol) and 10 % Pd/C (5.0 g) in MeOH (400 mL) was heated under H2 (30 psi) atmosphere overnight. After the mixture was filtered, the filtrate was concentrated to give lH-indazol-5-ylamine as a yellow solid (40 g, 97% yield). 1H NMR (300 MHz, DMSO-J6) δ 12.50 (br s, 1 H), 7.70 (s, 1 H), 7.22 (d, J= 6.6 Hz, 1 H), 6.77 (d, J = 6.6 Hz, 1 H), 6.74 (s, 1 H), 4.72 (br s, 1 H); MS (ESI) m/z: 134.2 (M+H+).
To a solution of lH-indazol-5-ylamine (8.0 g, 60.1 mmol) in concentrated HCl (20 mL, 240 mmol) was added an aqueous solution (50 mL) of NaNO2 (4.2 g, 60.1 mmol) at 0 0C and the resulting mixture was stirred for 1 h. A solution of SnCl2'2H2O (27 g, 120 mmol) in cone HCl (30 mL) was then added at 0 0C. The reaction was stirred for an additional 2 h at RT. A solution of 4-methyl-3-oxo-pentanenitrile (8.0 g, 1.1 eq) in ethanol (50 mL) was added and the resultant mixture was heated to reflux overnight. The reaction mixture was concentrated under reduced pressure and was purified by silica gel chromatography to provide 2-(lH-indazol-5-yl)-5-isopropyl-2H-pyrazol-3-ylamine (8.5 g, 59% yield, two steps). 1H NMR (300 MHz, DMSO-J6) 8.09 (s, 1 H), 7.82 (s, 1 H), 7.57 (d, J = 6.6 Hz, 1 H), 7.51 (d, J= 6.6 Hz, 1 H), 5.31 (s, 1 H), 5.12 (s, 2 H), 2.74 (m, 1 H), 1.15 (d, J= 5.1 Hz, 6 H); MS (ESI) m/z: 242.3 (M+H+).
A stirring solution of 2-(lH-indazol-5-yl)-5-isopropyl-2H-pyrazol-3-ylamine (8.0 g, 33 mmol) in dioxane (80 mL)/10 % NaOH (30 mL) was treated with (Boc)2O (8.6 g, 39.4 mmol). The resultant mixture was stirred for 3 h and was then extracted with DCM (3 x 100 mL). The organic layer was concentrated in vacuo and the residue was purified by silica gel chromatography to give 5-(5-amino-3-isopropyl-pyrazol-l-yl)-indazole-l- carboxylic acid tert-butyl ester (6.8 g, 47%) as a white solid. 1H NMR (300 MHz, DMSO-J6) δ 8.43 (s, 1 H), 8.10 (d, J= 9.3 Hz, 1 H), 8.00 (br s, 1 H), 7.82 (d, J= 9.3 Hz, 1 H), 5.36 (s, 1 H), 5.29 (br s, 2 H), 2.76 (m, 1 H), 1.64 (s, 9 H), 1.16 (d, J= 7.2 Hz, 6 H). MS (ESI) m/z: 442.2 (M+H*).
A solution of tert-butyl 5-(5-amino-3-isopropyl~lH~pyrazol-l-yl)-lH-indazole-l- carboxylate (1.50 g) in EtOAc (15 mL) was treated with IM aq NaOH (6.8 mL). To the stirred biphasic reaction mixture at 0 0C was added isopropenyl chloroformate (0.64 mL) drop- wise over 1 min. The reaction mixture was stirred at RT overnight. The reaction mixture was diluted with EtOAc (100 mL), washed with H2O (2x30 mL), brine (30 mL), dried (MgSO4) and concentrated to afford tert-butyl 5-(3-isopropyl-5-((prop-l-en-2- yloxy)carbonylamino)-lH-pvrazol-l-yl)-l H-indazole-1 -carboxylate (1.90 g, 99% yield) as a white foam. MS (ESI) m/z: 425.8 (M+H+).
Example B17: Using a procedure analogous to Example B16, lH-indazol-5-ylamine (5.0 g, 37.5 mmol) and 3-oxo-pentanenitrile (4.0 g, 1.1 eq) were combined and purified by silica gel chromatography to give 5-ethyl-2-(lH-indazol-5-yl)-2H-pyrazol-3-ylamine (5.2 g, 61% yield, two steps). 1H NMR (300 MHz, DMSCW6) δ 8.04 (s, 1 H), 7.58 (s, 1 H), 7.57 (d, J= 6.6 Hz, 1 H), 7.50 (d, J = 6.6 Hz, 1 H), 5.30 (s, 1 H), 5.13 (br s, 2 H), 2.47 (q, J= 6.9 Hz, 2 H), 1.14 (t, J- 6.9 Hz, 3 H); MS (ESI) m/z: 228.3 (M+H+).
Using a procedure analogous to Example B16, 5-ethyl-2-(lH-indazol-5-yl)-2H- pyrazol-3-ylamine (5.0 g, 22 mmol) was converted to 5-(5-amino-3-ethyl-pyrazol-l-yl)- indazole-1-carboxylic acid tert-butyl ester (3.0 g, 42% yield) as a white solid. 1H NMR (300 MHz, DMSCW6): δ 8.42 (s, 1 H), 8.09 (d, J= 6.6 Hz, 1 H), 7.98 (s, 1 H), 7.81 (d, J = 6.6 Hz, 1 H), 5.35 (s, 1 H), 5.29 (br s, 2 H), 2.44 tert-Buty\ 5-(5-amino-3-ethyl-l H-pyrazol- 1 -yl)- 1 H-indazole-1 -carboxylate (0.50 g) was converted to tert-butyl 5-(3-ethyl-5-((prop-l~en-2-yloxy)carbonylamino)-lH- pyrazol-l-yl)-l H-indazole-1 -carboxylate (0.55 g, 88% yield) using a procedure analogous to Example 16. MS (ESI) m/z: 412.3 (M+H+).
Example B18: A solution of N-benzhydrylidene-N'-quinolin-ό-yl-hydrazine (32 g, 0.099 mol) in EtOH (500 mL) was treated with cone. HCl (80 ml, 0.96 mmol). After stirring for 10 min, 5,5-dimethyl-2,4-dioxo-hexanoic acid ethyl ester (26 g, 0.15 mol) was added, and the mixture was heated to 80°C overnight. The reaction was concentrated in vacuo to give a residue which was washed with Et2O to afford ethyl 5-tert-butyl-l-(quinolin-6-yl)- lH-pyrazole-3-carboxylate hydrochloride (40 g, 0.11 mol, 1 12 % yield). MS (ESI) m/z: 324.1 (M+H+).
A suspension of ethyl 5-tert-butyl-l-(quinolin-6-yl)-lH-pyrazole-3-carboxylate hydrochloride (32 g, 0.089 mol) in THF (300 mL) was treated with aqueous LiOH (2 N, 100 mL, 0.20 mmol) and the resultant mixture was heated to 40 0C for 3 hours. The reaction was concentrated under reduced pressure and the remaining aqueous layer was washed with EtOAc. The aqueous phase was acidified to pH 3 and the resultant precipitate was collected by filtration, washed with cold ether and dried in vacuo to provide 5-tert-butyl-l-(quinolin-6-yl)-lH-pyrazole-3-carboxylic acid (21 g, 71% yield). 1H-NMR (400 MHz, DMSO-J6) δ 9.03 (m, 1 H), 8.50 (d, J = 8.7 Hz, 1 H), 8.20 (d, J = 2.4 Hz, 1 H), 8.15 (d, J= 8.8 Hz, 1 H), 7.79 (dd, J = 8.7 Hz, 2.4 Hz, 1 H), 7.67 (dd, J = 8.4, 4.4 Hz, 1 H), 6.68 (s, 1 H), 1.17 (s, 9H); MS (ESI) m/z: 296.3 (M+H+).
Example B19: A solution of sodium nitrite (502 mg, 7.27 rnmol) in H2O (8 ml) was added dropwise to a well-stirred 0 0C mixture of 2-methylquinolin-6-arnine (1.00 g, 6.32 mmol) in cone. HCl (10 ml). The resulting mixture was stirred at 0 0C for 1 h. Tin(II) chloride dihydrate (6.13 g, 27.2 mmol) in cone. HCl (8 ml) was added and stirring was continued at 0 0C for 1 h and then RT for 2h. Ethanol (60 ml) and 4,4-dimethyl-3- oxopentanenitrile (1.03 g, 8.22 mmol) were added and the mixture was heated at reflux overnight. The completed reaction mixture was concentrated in vacuo and diluted with ethyl acetate (100 mL). The mixture was cooled in an ice/water bath and made basic (pH~8) with solid sodium hydroxide. The solution was filtered through Celite, and the filter cake was washed with water (50 mL) and ethyl acetate (100 mL). The organic phase was separated, washed with brine, dried (Na2SO4), and concentrated to yield a foam. The foam was stirred in ether (50 mL) and allowed to stand for several hours. The resultant solid was collected by filtration and dried in vacuo to yield 3-tert-butyl-l-(2- methylquinolin-6-yl)-lH-pyrazol-5-amme (428 mg, 24% yield). MS (ESI) m/z: 281.2 (M+H+).
A solution of 3-tert-butyl-l-(2-methylquinolin-6-yl)-lH"pyrazol-5-amine (420 mg, 1.50 mmol) in CH2Cl2 (15 mL) was treated with pyridine (592 mg, 7.49 mmol) and TROC-Cl (333 mg, 1.57 mmol). The mixture was stirred at RT for 16 h, then washed with 5% citric acid (2 x 20 mL), saturated aq NaHCO3 (20 mL) and brine (20 mL). The organic phase was dried (Na2SO4) and concentrated to provide a mixture of 2,2,2- trichloroethyl 3 -tert-butyl- 1 -(2-methylquinolin-6-yl)- 1 H-pyrazol-5 -ylcarbamate (73 % yield) contaminated with 16% of the bis-Troc aduct. The mixture was used without further purification. MS (ESI) m/z: 456.5 (M+H+). Example B20: Using a procedure analogous to Example B4, imidazo[l,2-a]pyridin-6- ylboronic acid (0.200 g, 1.23 mmol) and ethyl 3-tert-butyl-lH-pyrazole-5-carboxylate (0.267 g, 1.36 mmol) were combined to afford ethyl 3-tert-butyl-l~(H-imidazo[l,2- a]pyridin-6-yl)-lH-pyrazole-5-carboxylate (0.0355g, 9% yield) as a colorless oil. MS (ESI) IΉ/Z: 313.2 (MH-H+).
Using a procedure analogous to Example B4, ethyl 3-tert-butyl-l-(H- imidazo[l,2-a]pyridin-6-yl)-lH-pyrazole~5-carboxylate (0.071 g, 0.23 mmol) was converted to 3-tert-butyl- 1 -(H-imidazo[ 1 ,2-a]pyridin-6-yl)- 1 H-pyrazole-5-carboxylic acid (0.0643 g, 99% yield) as a white solid. MS (ESl) m/z: 285.0 (M+H+).
Example B21: Using a procedure analogous to Example B4, imidazo[l,2-a]pyridin-6- ylboronic acid (0.500 g, 3.09 mmol) and ethyl 3-isoproρyl-lH-pyrazole~5-carboxylate (0.619 g, 3.40 mmol) were combined to afford ethyl 3-isopropyl-l-(H-imidazo[l,2- a]pyridin-6-yl)-lH-pyrazole-5-carboxylate (0.098 g, 11% yield) as a colorless oil. MS (ESI) m/z: 299.3 (M+H+).
Using a procedure analogous to Example B4, ethyl 3~isopropyl-l-(H- imidazo[l,2-a]pyridin-6-yl)-lH-pyrazole-5~carboxyIate (0.098 g, 0.33 mmol) was converted to 3-isopropyl-l-(H-imidazo[l,2-a]pyridin-6-yl)-lH-pyrazoIe-5-carboxylic acid (0.087 g, 98% yield) as a white solid. MS (ESI) m/z: 271.0 (M+H+).
Example B22: To a stirring suspension of 6-aminobenzothiazole (0.500 g, 3.33 mmol) in cone. HCl (5 ml) at 0-5 0C was added a solution Of NaNO2 (0.276 g, 3.99 mmol) in H2O (5 ml). The mixture was stirred at 0-5 0C for 75 min until a clear yellow solution was obtained. To this was then added a solution of SnCl2-2H2O (2.76 g, 13.3 mmol) in cone. HCl (5 ml). After completing the addition, the suspension was stirred at RT for 2h. 4-Methyl-3-oxopentanenitrile (0.444 g, 3.99 mmol) and EtOH (50 ml) were added and the reaction was stirred with heating at 75 0C. After 18 h, the completed reaction was cooled to RT and concentrated to an aqueous residue. This was chilled thoroughly in ice and made strongly basic (pH 12-13) by the addition of 6M NaOH. While still cold the mixture was extracted with EtOAc (2x). The combined organics were washed with H2O (2x), brine (Ix), dried (MgSO4), filtered and evaporated to afford crude 1- (benzo[d]thiazol-6-yl)-3-isopropyHH-pyrazol-5-amine (0.8 g, 93% yield) as an oil which was used as is in the next reaction. 1H NMR (400 MHz, OMSO-d6) δ 9.36 (s, IH), 8.30 (d, J = 2.4 Hz, IH); 8.10 (d, J = 8.8 Hz, IH), 7.74 (dd, J = 2.4 and 8.8 Hz, IH), 5.36 (s, IH), 5.33 (brs, 2H), 2.76 (septet, J = 6.8 Hz, IH), 1.17 (d, J- 6.8 Hz, 6H); MS (ESI) m/z: 259.0 (M+H+).
To a stirring solution of l-(benzo[d]thiazol-6-yl)-3-isopropyl-lH-pyrazol-5-amine (0.80 g, 3.1 mmol) and pyridine (0.51 ml, 6.2 mmol) in CH2Cl2 (30 ml) at RT was added Troc-Cl (0.51 ml, 3.7 mmol). After 2 h, the completed reaction was washed with 10% CuSO4 (2x), H2O (Ix), brine (Ix), dried (MgSO4), evaporated and purified by flash column chromatography (EtOAc/hexanes) to afford 2,2,2-trichloroethyl 1- (benzo[d]thiazol-6-yl)-3-isopropyl-lH-pyrazol-5-ylcarbamat (0.31 g, 23% yield) as an oil. MS (ESI) m/z: 433.0 (M+H*), 435.0 (M+2+H+).
Example B23: l-Methyl~5~nitro-lH-benzo[d]imidazole (prepared as described in WO 2005/092899; 1.14 g, 6.43 mmol) in EtOH (50 ml) was stirred under H2 (1 atm) at RT in the presence of 10% Pd/C (50 wt% H2O, 1.37 g, 0.643 mmol). After 18 h, the completed reaction was filtered on Celite, rinsing forward with EtOH. The combined filtrates were concentrated to afford crude l-methyl-lH-benzo[d]imidazol-5-amine (1.02 g, 108% yield) as a dark orange oil which was used as is in the next reaction. 1H NMR (400 MHz, DMSO-J5) δ 7.87 (s, IH), 7.17 (d, J = 8.4 Hz, IH), 6.75 (d, J = 2.0 Hz, IH), 6.59 (dd, J = 2.0 and 8.4 Hz5 IH), 4.73 (brs, 2H), 3.69 (s, 3H); MS (ESI) m/z: 148.0 (M+H+).
Using a procedure analogous to Example B22, 1 -methyl- lH-benzo[d]imidazol-5- amine (0.50 g, 3.4 mmol), NaNO2 (0.28 g, 4.1 mmol), SnCl2-2H2O (2.8 g, 14 mmol) and 4-methyl-3-oxopentanenitrile (0.45 g, 4.1 mmol) were combined to afford crude 3- isopropyl-l-(l-methyl-lH-benzo[d]imidazol-5-yl)-lH-pyrazol-5-amine (0.63 g, 73% yield) as a foam which was used as is in the next reaction. 1H NMR (400 MHz, DMSO- d6): δ 8.22 (s, IH), 7.72 (dd, J = 0.40 andl.2 Hz, IH), 7.60 (dd, J = 0.40 and 8.4 Hz, IH), 7.42 (dd, J = 2.0 and 8.4 Hz, IH), 5.32 (s, IH), 5.08 (brs, 2H), 3.85 (s, 3H), 2.75 (septet, J = 6.8 Hz, IH), 1.16 (d, J = 6.8 Hz, 6H); MS (ESI) m/z: 250.0 (M+H+). Using a procedure analogous to Example B22, 3-isopropyl-l -(I -methyl- IH- benzo[d]imidazol-5-yl)-lH-pyrazol-5-amine (0.63 g, 2.5 mmol) was converted to 2,2,2- trichϊoroethyl 3-isopropyl-l-(l-memyl-lH-beiizo[d]imidazol-5-yl)-lH-pyrazol-5- ylcarbamate (0.5 g, 47% yield) and isolated as an oil. 1H NMR (400 MHz, OMS0-d6) δ 9.86 (brs, IH), 8.24 (s, IH), 7.67 (brs, IH), 7.62 (d, J = 8.4 Hz, IH), 7.36 (dd, J - 2.0 and 8.4 Hz, IH), 6.23 (s, IH), 4.81 (s, 2H), 3.85 (s, 3H), 2.90 (septet, J = 6.8 Hz, IH), 1.22 (d, J = 6.8 Hz, 6H); MS (ESI) m/z: 430.0 (M+H+), 432.0 (M+2+H+).
Example B24: To a stirring solution of l-(2-(benzyloxycarbonyl)-l, 2,3,4- tetrahydroisoquinolin-6-yl)-3-tert-butyl-lH-pyrazole-5-carboxylic acid from Example Bl (0.320 g, 0.738 mmol, 1.0 eq) and TEA ( 0.118 ml, 0.849 mmol, 1.15 eq) in 1,4- dioxane (7.5 ml) at 20 0C was added DPPA (0.183 ml, 0.849 mmol, 1.15 eq). After 30 min, 2,2,2-trichloroethanol (1.0 ml, 10.4 mmol, 14 eq) was added and the reaction was stirred with heating at 100 0C. After 4 h, the completed reaction was diluted with brine and extracted with EtOAc (2x). The combined organics were washed with 5% citric acid (Ix), satd. NaHCO3 (Ix) and brine (Ix), dried (MgSO4), concentrated in vacuo and purified by silica gel chromatography to afford benzyl 6-(3-tert-butyl~5-((2,2,2~ trichloroethoxy)carbonyl)amino- 1 H-pyrazol- 1 -yl)-3 ,4-dihydroisoquinoline-2( 1 H)- carboxylate (0.260 g, 61% yield) as an oil. MS (ESI) m/z: 579.0 (M+H+), 581.0 (M+2+H+).
Example B25: Using the procedure of Example B26, 3-isopropyl-l-(quinolin-6-yl)-lH- pyrazol-5 -amine from Example B9 (1.0Og, 4.0 mmol), lithium bis(trimethylsilyl)amide (1.0 M in THF, 7.9 mL, 7.9 mmol) and isopropenyl chloroformate (0.48 mL, 4.4 mmol) were combined to provide prop-l-en-2-yl 3-isopropyl-l-(quinolin-6-yl)-lH-pyrazol~5- ylcarbamate (0.85 g, 65% yield). MS (ESI) m/z: 337.2 (MfH+).
Example B26: A solution of 5-ter^butyl-2-quinolin-6-yl-2H-pyrazol-3-ylaraine from
Example B3 (1.00 g, 3.8 mmol) in THF (20 mL) was cooled to -78 0C and treated with lithium bis(trimethylsilyl)amide (1.0 M in THF, 7.5 mL, 7.5 mmol). The resultant mixture was stirred at -78 0C for 30 min. Isopropenyl chloroformate (0.45 mL, 0.41 mmol) was added and stirring was continued at -78 0C for 30 min. The reaction mixture was quenched at -78 0C with aq HCl (2 N, 4 mL, 8 mmol), was warmed to RT and partitioned between water (200 mL) and EtOAc (20OmL). The organic layer was separated, washed with brine, dried (MgSO4), concentrated in vacuo and purified by silica gel chromatography to provide prop-l-en-2-yl 3~tert-butyi-l-(quinolin-6-yl)-lH- pyrazol-5-ylcarbamate (0.5 g, 38% yield). MS (ESI) m/z: 351.2 (M+H+).
Example B27: 4-Fluoro-3-nitrophenylboronic acid (0.9 g, 4.9 mmol) was dissolved in CH2Cl2 (10 mL) and pyridine (1 mL) with MS (activated 4A) and dried for 6 hours. A mixture of 4-fluoro-3-nitrophenylboronic acid, tert-butyl 3-isopropyl-lH-pyrazole-5- carboxylate (1.0 g, 4.9 mmol), copper(II) acetate (0.88 g, 4.9 mmol) and molecular sieves (4A activated, powder) was stirred at RT for 7 days open to the air. The reaction mixture was filtered through a pad of Celite. The filtrate was concentrated in vacuo and purified by silica gel column chromatography (EtOAc/hexane) to obtain tert-butyl l-(4-fluoro-3- nitroρhenyl)-3-isopropyl-lH-pyrazole-5~carboxylate (0.74 g, 44% yield). MS (ESI) m/z: 350.3 (M+H+).
To a solution of tert-butyl l-(4-fluoro-3-nitrophenyl)-3-isopropyl-lH-pyrazole-5- carboxylate (0.74 g, 2.1 mmol) in THF/water (12 mL) was added LiOH (300 mg, 13 mmol) and H2O2 (30%wt, 0.96 mL). The reaction mixture was heated overnight at 60 0C. Na2S2O3 solution was added until the peroxide test (starch-iodide paper) was negative. Acetic acid was added until the pH was 4-5. The solution was extracted with EtOAc and the organic layer was washed with brine, dried (MgSO4), concentrated in vacuo and purified by silica gel column chromatography (EtOAc/hexanes) to obtain tert- butyl l-(4-hydroxy-3-nitrophenyl)-3-isopropyl-lH-pyrazole-5-carboxylate (0.27 g, 37% yield). MS (ESI) m/z: 348.3 (M+H+).
To a solution of tert-butyl l-(4-hydroxy-3-nitrophenyl)-3-isopropyl-lH-pyrazole- 5-carboxylate (0.27 g, 0.78 mmol) in ethyl acetate/methanol (1 :1, 10 mL) was added palladium on carbon (30 mg) and the mixture was hydrogenated (50 psi) overnight under Parr. The solution was filtered and washed with methanol. The combined filtrate was concentrated to afford tert-butyl l-(3-amino-4-hydroxyphenyl)-3-isopropyl-lH-pyrazole- 5 -carboxylate. The crude tert-butyl l-(3-amino-4-hydroxyphenyl)-3-isopropyl-lH- pyrazole-5-carboxylate was treated with 25% TFA in CH2Cl2 (2 mL) and stirred overnight at RT. The solvent was evaporated to obtain l-(benzo[d]oxazol-5-yl)-34ert- butyl-lH-pyrazole-5-carboxylic acid. To a solution of l-(benzo[d]oxazol~5-yl)-3-tert- butyl- lH-pyrazole-S-carboxylic acid in xylenes (3 mL) was added triethyl orthoformate (0.16 mL, 0.96 mmol) and a catalytic amount of PPTS. The reaction mixture was heated at 140 0C for 4 hours. The solvent was evaporated and the residue was treated with methylene chloride with stirring for 1 hour. The resulting solid was filtered and washed with methylene chloride to obtain l-(benzo[d3oxazol-5-yl)-3-isoρropyl-lH-pyrazole-5- carboxylic acid (0.1 g, 45% yield: for three steps). MS (ESI) m/z: 272.0 (M+H+).
Example B28: In toluene (8 mL) was placed l-(diphenylmethylene)hydrazine (1.00 g, 5.10 mmol), palladium acetate (10.4 mg, 0.0464 mmol) and 2-(diphenylphosphino)-l-(2- (diphenylphosphino)naphthalen~l~yl)naphthalene (44 mg, 0.0696 mmol) and the reaction was stirred at 100 0C under Ar for 5 min and then cooled to RT. To this dark purple solution was added 6-bromoquinoxaline (970 mg, 4.64 mmol), sodium t-butoxide (624 mg, 6.50 mmol) and toluene (2 mL). The reaction was placed under Ar and warmed to 100 0C for 5 hrs, cooled to RT and stirred overnight. The reaction was diluted with ether (50 mL) and water (30 mL) and filtered through a Celite pad. The pad was washed with ether (20 mL) and water (20 mL). The combined organic layers were washed with brine (50 mL), dried (Na2SO4), concentrated in vacuo and purified by chromatography (ethyl acetate/hexanes) to give l-(diphenylmethylene)-2-(quinoxalin-6-yl)hydrazine (305 mg, 20% yield) as a bright yellow foam. 1H NMR (300 MHz, DMSO-4) δ 7.35-7.41 (m, 5 H), 7.51-7.53 (m, 2 H), 7.58-7.65 (m, 3 H), 7.75 (s, 1 H), 7.89 (s, 2 H), 8.61 (s, 1 H), 8.74 (s, 1 H), 9.60 (s, 1 H); MS (ESI) m/z: 325.0 (M+H+).
In ethanol (10 mL) was placed l-(diphenylmethylene)-2-(quinoxalin-6- yl)hydrazine (300 mg, 0.925 mmol), pivaloylacetonϊtrile (156 mg, 1.25 mmol) and p- toluenesulfonic acid hydrate (704 mg, 3.70 mmol). The reaction was brought to reflux and stirred overnight. The reaction was cooled to RT, diluted with ethyl acetate (50 mL) and saturated sodium bicarbonate (50 mL). The organic phase was separated, washed with IN NaOH (30 mL) and brine (30 mL), dried (Na2SO4), concentrated in vacuo and purified by chromatography (Si-25 column, ethyl acetate /hexanes) to give a tan foam, identified as 3-tert-butyl-l-(quinoxalin-6-yl)-lH-pyrazol-5-amine (57 mg, 23% yield). MS (ESI) m/z: 268.2 (M+H+). Example B29: To a solution of phenethyl amine (60.5 g, 0.5 mol) and Na2CO3
(63.6 g, 0.6 mol) in EtOAc/H O {800 mL, 4:1) was added ethyl chloroformate, dropwise, (65.1 g, 0.6 mol) at 0 0C during a period of Ih. The mixture was warmed to RT and stirred for an additional Ih. The organic phase was separated and the aqueous layer was extracted with EtOAc. The combined organic phases were washed with H2O and brine, dried (Na2SO4), concentrated in vacuo and purified by flash chromatography to afford ethyl phenethylcarbamate (90.2 g). 1H NMR (400 MHz, CDCl3) δ 7.32-7.18 (m, 5 H), 4.73 (brs, IH), 4.14-4.08 (q, J= 6.8 Hz, 2H), 3.44-3.43 (m, 2H), 2.83-2.79 (t, J -6.8 Hz, 2H), 1.26-1.21 (t, J=6.8 Hz, 3H). A suspension of ethyl phenethylcarbamate (77.2 g, 40 mmol) in polyphosphoric acid (300 mL) was heated to 140-160 0C and stirred for 2.5h. The reaction mixture was cooled to RT, carefully poured into ice-H2O and stirred for Ih. The aqueous solution was extracted with EtOAc (3x300 mL). The combined organic phases were washed with H2O, 5% K2CO3 and brine, dried (Na2SO4), concentrated in vacuo and purified by flash chromatography to afford 3,4-dihydro-2H-isoquinolin-l-one (24 g). 1H NMR (400 MHz, DMSO-^6) δ 7.91 (brs, IH), 7.83 (d, J= 7.5 Hz, IH,), 7.43 (t, J= 7.5 Hz, IH)5 7.33-7.25 (m, 2H), 3.37-3.32 (m, 2H), 2.87 (t, J= 6.6 Hz, 2H).
To an ice-salt bath cooled mixture of cone. HNO3 and cone. H24 (200 mL, 1:1) was added 4-dihydro-2H-isoquinolin-l-one (15 g, 0.102 mol) dropwise over 15 min. After stirring for 2h, the resulting mixture was poured into ice~Η2O and stirred for 30 min. The precipitate was filtered, washed with H2O, and dried in air to afford 7-nitro- 3,4-dihydro-2H-isoquinolin-l-one (13 g). 1H NMR (300 MHz, DMSO-J6) δ 8.53 (d, J = 2.4 Hz, IH,), 8.31 (d, J =2.4 Hz, IH)3 8.29 (d, J=2.4 Hz, IH), 7.62 (d, J =8.4 Hz, IH), 3.44-3.39 (m, 2H), 3.04 (t, J= 6.6 Hz, 2H). A suspension of 7-riitro-3,4-dihydro-2H-isoqumolm-l-one (11.6 g, 60 mmol) and
10% Pd/C (1.2 g,) in MeOH was stirred overnight at RT under H2 (40 psi). The mixture was filtered through Celite® and washed with MeOH. The filtrate was evaporated under vacuum to afford 8.2 g of 7-amino-3,4-dihydro-2/f-isoquinolin-l-one, which was used without further purification. To a suspension of 7-amino-3,4-dihydro-2H-isoqumolin-l-one (8.1 g, 50 mmol) in cone. HCl (100 mL) in an ice-Η2O bath was added a solution Of NaNO2 (3.45 g, 50 minol) in H2O drop wise at such a rate that the reaction mixture never rose above 5 0C. A solution of SnCl2-2H2O(22.5 g, 0.1 mol) in cone. HCl (150 mL) was added dropwise after 30 min. The resulting mixture was stirred for another 2h at 0 0C. The precipitate was collected by suction, washed with ether to afford 7-hydrazino-3,4-dihydro-2H- isoquinolin-1-one (8.3 g), which was used for the next reaction without further purification.
A mixture of 7-hydrazino-3,4-dihydro-2H-isoquinolin-l-one (8.0 g, 37.6 mmol) and 4,4-dimethyl-3-oxo-pentanenitrile (5.64 g, 45 mmol) in EtOH (100 mL) and cone. HCl (10 mL) was heated at reflux overnight. After removal of the solvent, the residue was washed with ether to afford 7-(5-amino-3-t-butyl-ρyrazol-l-yl)-3,4-dihydro-2//- isoquinolin-1-one hydrochloride as a yellow solid (11.5 g, 96% yield), which was used without further purification.
To a solution of 7-(5-amino-3-t-butyl~pyrazol-l-yl)-3,4-dihydro-2H-isoquinoIin- 1-one hydrochloride (0.5 g, 1.76 mmol) in CH2Cl2 (25 mL) were added pyridine (0.22 mL) and trichloroethyl chloroformate (0.27 mL) at 0 0C and the mixture was stirred overnight at RT. LCMS showed the reaction was incomplete. Pyridine (0.25 mL) and TROC-Cl (0.25 mL) were added and then the mixture stirred at RT for 2 hours. The reaction mixture was diluted with CH2Cl2, the organic layer was washed with 3M HCl and brine, dried (Na2SO4) and concentrated in vacuo. The residue was dissolved in EtOAc and hexane was added. The solid was filtered to obtain 2,2,2-trichloroethyl 3-tert- butyl-l-(l-oxo-l,2,3,4-tetrahydroisoquinolin-7-yl)-lH-pyrazol-5-ylcarbamate (0.46 g, 57% yield). MS (ESI) m/z: 458.0 (M+H+).
Example B30: To a solution of 7-(5-amino-3-t-butyl~pyrazol-l-yl)-3,4-dihydro-2H- isoquinolin-1-one hydrochloride from Example B29 (20 g, 0.070 mol) in THF (400 mL) was added LAH (15 g, 0.395 mol) in portions at 0-5 0C. The resulting mixture was heated at reflux overnight, followed by the addition of 10% NaOH solution. After stirring for Ih at RT, BoC2O (23g, 0.106 mol) was added and the solution stirred overnight. After filtration, the filtrate was concentrated to afford the crude product, which was purified by reverse phase chromatography to give 7-(5-amino-3-t-butyl- pyrazol-l-yl)-3,4-dihydro-iH-isoquinoline-2-carboxylic acid t-butyl ester (12 g, 75% yield). 1H NMR (300 MHz, DMSO-^6) δ 7.32 (s, IH), 7.29 (d, J= 2.7 Hz, IH), 7.18 (d, J- 8.4 Hz, IH), 5.32 (s, IH), 5.15 (s, IH), 4.51 (s, 2H), 3.52 (t, J= 5.6 Hz, 2H), 2.75 (t, J = 5.6 Hz, 2H), 1.40 (s, 9H), 1.17 (s, 9H); MS (ESI) m/z: 371(M+H+).
To a stirring solution of tert-butyl 7-(5-ammo-3-tert-butyl-lH-pyrazol-l-yl)-3,4- dihydroisoquinoline-2(lH)-carboxylate (0.50 g, 1.35 mmol) and Troc-Cl (0.19 ml, 1.38 mmol) in EtOAc (15 mL) was added satd. NaHCO3 (2.75 ml, 2.02 mmol). The resulting triphasic mixture was stirred at RT for 5 h. The layers were separated and the organic washed with sat'd. NaHCO3 (Ix) and brine (Ix), dried (Na2SO4) and concentrated in vacuo to obtain tert-butyl 7-(3-tert-butyl-5-((2,2,2-trichloroethoxy)carbonyl)-lH-ρyrazol- l-yl)-3,4-dihydroisoquinoline-2(lH)-carboxylate (0.69 g, 94% yield). MS (ESI) m/z:
545.0 (MH-H+).
Example 1: A solution of Example B3 ( 7.0 g, 15.8 mmol ), Example A2 ( 4.14 g, 15.8 mmol ) and DIEA ( 4.5 g, 34.9 mmol ) in DMSO ( 70 ml) was heated in an oil-bath at 70 0C for 8 hrs. The reaction mixture was poured into water (500 ml), stirred overnight and the solids were separated by filtration. Successive crystallization of the crude product from toluene and acetone provided 1 -(3 -tert-butyl- l-(quinolin-6-yl)-lH-pyrazol-5-yl)-3- (2-fluoro-4-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea as a white crystalline solid (4.06 g, 46% yield). 1H NMR (DMSO-d6) δ 8.90 (m, 2H), 8.79 (m, IH), 8.52 (m, 2H), 8.2 (m, 3H), 7.96 (dd, J = 9, 2Hz, IH), 7.63 (dd, J - 8, 4Hz, IH), 7.40 (br s, IH), 7.30(dd, J - 3, 12Hz, IH), 7.17 (m, IH), 7.05 (d, J = 9Hz, IH), 6.50 (s, IH), 2.80(d, J = 5 Hz), 1.32(s, 9H); MS (ESI) m/z: 554 (M+H+). The free base was treated with 0.1 M HCl to provide 1 -(3-tert-butyl- 1 -(quinolm-6-yl)-l H-pyrazol-5~yl)-3-(2-fluoro-4-(2-
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea bis hydrochloride salt as a pale yellow fluffy solid (2.40 g). 1H NMR (DMSO-d6) δ 9.56 (s, IH), 9.26 (m, 2H), 9.10 (d, J = 8Hz, IH), 8.85 (m, IH), 8.55 (m,2H), 8.46 (d, J = 9Hz, IH), 8.33 (dd, J = 9, 2Hz, IH), 8.1 l(t, J = 9Hz, IH), 8.03 (dd, dd, J = 9, 2Hz, IH), 7.46 (d, J - 3Hz, IH), 7.30 (dd, J = 3, 12Hz, IH), 7.20 (dd, J = 3, 6Hz, IH), 7.04 (brd, J = 7 Hz, IH), 6.49 (s, IH), 2.80 (d, J - 4.5 Hz), 1.33 (s, 9H). Example2: Example Bl (142 mg, 0.33 mmol) and Et3N (0.15 mL, 0.72 mmol) were combined in dioxane (3 mL). DPPA (0.13 mL, 0.59 mmol) was added and the reaction mixture was stirred at RT for 90 min. Example A2 (94 mg, 0.36 mmol) was added and the resultant mixture was heated to 95 0C for 4 h. The reaction mixture was concentrated in vacuo and purified by silica gel chromatography to provide benzyl 6-(3-tert-butyl-5- (3-(2-fluoro-4-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)ureido)-lH-pyrazol-l-yl)- 3,4-dihydroisoquinoline-2(lH)-carboxylate (95 mg, 42% yield). 1H NMR (400 MHz, DMSOd6) δ 9.00 (br s, 1 H), 8.84 (s, 1 H), 8.79 (q, J = 4.8 Hz, 1 H), 8.52 (d, J = 5.6 Hz, 1 H), 8.20 (t, J = 9.2 Hz, 1 H), 7.40-7.28 (m, 10 H), 7.17 (dd, J= 5.6, 2.8 Hz, 1 H), 7.05 (m, 1 H), 6.40 (s, 1 H), 5.14 (s, 2 H), 4.66 (m, 2 H), 3.68 (m, 2 H), 2.91 (t, J = 5.6 Hz, 2 H), 2.79 (d, J - 4.8 Hz, 3 H), 1.27 (s, 9H); MS (ESI) rn/z: 692.2 (M+H+).
A solution of benzyl 6-(3-tert-butyl-5-(3-(2-fluoro-4-(2-
(methylcarbamoyl)pyridin-4-yloxy)phenyl)ureido)- 1 H-pyrazol- 1 -yl)-3 ,A- dihydroisoquinoline-2(lH)-carboxylate (93 mg, 0.13 mmol) in methanol (3 mL) was treated with 10% Pd/C (50% wet, 74 mg, 0.03 mmol) and formic acid (88%, 0.60 mL, 14 mmol). The resultant reaction mixture was stirred for 90 min and filtered through Celite, washing forward with methanol. The filtrate was concentrated in vacuo and purified on silica gel to provide l-(3-tert-butyl-l-(l,2,3,4-tetrahydroisoquinolin-6-yl)-lH~pyrazol-5- yl)-3-(2-fluoro-4-(2-(metliylcarbamoyl)pyridin-4-yloxy)phenyl)urea (42 mg, 56% yield). The product was treated with aqueous HCl (0.1 M, 0.75 mL) to provide l-(3-tert-butyl-l- (l ,2,3,4-tetraliydroisoquinolin-6-yl)-lH-pyrazol-5-yl)-3-(2-fluoro-4-(2- (methylcarbamoyl)ρyridin-4-yloxy)phenyl)urea hydro chloride, 1H NMR (400 MHz, DMSO-d6) δ 9.38 (br s, 2 H), 9.10 (d, J - 1.8 Hz, 1 H), 9.05 (s, 1 H), 8.80 (m, 1 H), 8.53 (d, J = 5.4 Hz, 1 H), 8.15 (t, J = 9.1 Hz, 1 H)5 7.46-7.34 (m, 4 H), 7.32 (dd, J - 11.6, 2.8 Hz, 1 H)5 7.18 (m, 1 H), 7.05 (m, 1 H), 6.39 (s, 1 H), 4.33 (br s, 2 H), 3.40 (2 H obscured by H2O), 3.09 (t, J = 6.0 Hz, 2 H), 2.79 (d, J = 5.0 Hz, 3 H), 1.28 (s, 9 H); MS (ESI) m/z: 558.3 (M+H+).
Example 3: Using general method A, Example B4 (80 mg, 0.27 mmol), Example Al (0.18 g, 0.68 mmol), Methyl amine (30 mg, 0.30 mmol), and DPPA (82 mg, 0.30 mmol) were combined to yield l-(3-tert-butyl-l-(quinoIin-6-yl)-lH-pyrazol-5-yl)-3-(3-fluoro-4- (2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea which was treated with 3M HCl/EtOAc to obtain its HCl salt (125 mg, 78% yield). 1H NMR (400 MHz, DMSCW6): δ 9.79 (brm, IH), 9.16 (brm, IH), 9.05 (brm, IH), 8.93 (brm, IH), 8.79 (brm, IH), 8.53 (d, J - 5.6 Hz, IH), 8.42 (brm, IH), 8.33 (brm, IH), 8.22 (brm, IH), 7.91 (brm, IH), 7.68 (dd, J = 2.4, and 14.4 Hz, IH), 7.37 (d, J - 2.4 Hz, IH), 7.34 (t, J = 9.2 Hz, IH), 7.19 (brm, IH), 6.49 (s, IH), 2.79 (d, J = 5.2 Hz, 3H), 1.31 (s, 9H); MS (ESI) m/z: 554.2 (M+H4).
Example 4: To a solution of Example B8 (0.132 g, 0.30 mmol) in THF (1.0 ml) were added Example A2 (0.083 g, 0.315 mmol) and 1 -methyl pyrrolidine (2.6 mg, 0.03 mmol). The mixture was heated at 55 °C overnight. Solvent was removed and the residue was dissolved in MeOH (4.5 ml), to which 3M HCl/EtOAc (1.3 ml, 3.8 mmol) was added. The resulting mixture was stirred at RT overnight, followed by heating at 55 0C for 3 h. The reaction mixture was concentrated to dryness, diluted with sat'd. NaHCO3 (7 ml) and extracted with EtOAc (3x20 ml). The combined organic layers was washed with sat'd. NaHCO3 (7 ml), H2O (7 ml) and brine (7ml), dried (MgSO4), concentrated in vacuo and purified by chromatography to afford l-(3-tert-butyl-l-(lH-indazol-5-yl)-lH-pyrazol-5- yl)-3-(2-fluoro-4-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea (80 mg, 49% yield) as a white solid. This was converted to corresponding HCl salt by reacting with HCl (4.0 M in dioxane, 1.0 eq.). !H NMR (DMSO-J6) δ 9.17 (s, IH), 9.13 (s, IH), 8.99 (m, IH), 8.56 (d, J = 5.6 Hz, IH), 8.23-8.18 (m, 2H), 7.96 (d, J= 2.0 Hz, IH), 7.72 (d, J= 8.8 Hz, IH), 7.58 (d, J= 2.4 Hz, IH ), 7.49 (dd, J= 8.8, 1.6 Hz, IH), 7.32 (dd, J = 11.6, 2.8 Hz, IH), 7.24 (dd, J= 6.0, 3.0 Hz, IH), 7.07 (dd, J= 8.8, 1.6 Hz, IH), 6.47(s, IH), 2.81 (d, J = 4.8 Hz, 3H), 1.30 (s, 9H); MS (ESI) m/z: 543.2 (M+H+).
Example S: Using general method A, Example B4 (80 mg, 0.27 mmol) and Example A6 (99 mg, 0.38 mmol) were combined to provide l-(3-tert-butyl-l-(quinolin-6-yl)-lH- pyrazol-5-yl)-3-(3-methyl-4-(2-(metliylcarbamoyl)pyridin-4-yloxy)phenyl)urea (149 mg, 99% yield). 1H NMR (400 MHz, DMSO-J6) δ 9.08 (s, 1 H), 8.97 (dd, J = 4.1, 1.2 Hz, 1 H), 8.77 (q, J = 4.6 Hz, 1 H), 8.62 (s, 1 H), 8.51-8.48 (m, 2 H), 8.20 -8.16 (m, 2 H), 7.97 (d, J = 8.9, 2.0 Hz, 1 H), 7.63 (dd, J = 8.5, 4.2 Hz, 1 H), 7.46 (d, J = 2.4 Hz, 1 H), 7.32 (dd, J = 8.7, 2.5 Hz, 1 H), 7.27 (d, J - 2.6 Hz, 1 H), 7.08 (m, 1 H), 7.06 (d, J= 8.7 Hz, 1 H), 6.47 (s, 1 H), 2.78 (d, J = 4.6 Hz, 3 H), 2.04 (s, 3 H), 1.33 (s, 9 H); MS (ESI) m/z:
550.2 (M+H+).
Example 6: Using a procedure analogous to Example 1, Example B3 (0.19 g, 0.43 mmol) and Example A7 (0.11 g, 0.43 mmol) were combined to provide l-(3-tert-butyl-l- (quinolin-6-yl)-lH-pyrazol-5-yl)-3-(4-(2-carbainoylpyridin-4-yloxy)-2-fluorophenyl)urea hydrochloride (0.160 g, 64% yield). 1H NMR (DMSO-^6) δ 9.55 (s, IH), 9.27-9.24 (m, 2H), 9.10 (d, J = 8.8 Hz, IH), 8.56-8.54 (m, 2 H), 8.46 (d, J- 9.2 Hz, IH), 8.32 (dd, J = 9.6, 2.4 Hz, IH), 8.27 (s, IH), 8.13 (t, J = 9.2 Hz, IH), 8.04 (dd, J - 8.4, 5.2 Hz, IH), 7.85 (s, IH), 7.52 (d, J= 2.4 Hz, IH), 7.32 (dd, J= 11.6, 2.4 Hz, IH), 7.24 (dd, J= 6.0, 2.8 Hz, IH), 7.05 (dq, J = 8.8, 1.2 Hz, IH), 6.50 (s, IH), 1.33 (s, 9H); MS (ESI) m/z:
540.3 (M+H+).
Example 7: Example B3 (0.12 g, 0.27 mmol), Example A9 (63 mg, 0.27 mmol) and DIEA (77 mg, 0.60 mmol) were combined in DMSO (1 mL) and heated overnight at 50- 55 0C. Water was added (50 mL) and the mixture was extracted with EtOAc (3 x 100 mL), dried (MgSO4), concentrated in vacuo and purified by silica gel column chromatography (EtOAc/hexane) to obtain l-(3-tert-butyl-l-(quinolin-6-yl)-lH-pyrazol- 5-yl)-3-(2-fluoro-4-(2-(memylamino)pyridin-4-yloxy)phenyl)urea. The solid was treated with 0.10OM HCl (2 equiv.) to obtain and l~(3-tert-butyl-l-(quinolin-6-yl)-lH-pyrazol-5- yl)-3-(2-fluoro-4-(2-(methylamino)pyridin-4-yloxy)phenyl)urea hydrochloride (52 mg, 32% yield). 1H NMR (400 MHz, DMSO-J6) δ 9.23 (brs, IH), 9.17 (brs, IH), 9.06 (brm, IH), 8.66 (brm, IH), 8.53 (brs, IH), 8.0 - 8.3 (m, 4H), 7.92 (d, J= 6.8 Hz, IH), 7.74 (m, IH), 7.35 (dd, J= 2.8, and 11.6 Hz, IH), 7.07 (m, IH), 6.62 (d, J= 6.4 Hz, IH), 6.48 (s, IH), 6.18 (brs, IH), 2.88 (d, J = 4.8 Hz, 2H), 1.32 (s, 9H); LC-MS (EI) m/z: 526.2 (M+H÷).
Example 8: Using a procedure analogous to Example 1, Example B6 (0.178 g, 0.335 mmol), Example AlO (0.0840 g, 0.352 mmol) and DIEA (0.0701 ml, 0.402 mmol) were combined, purified by flash column chromatography (EtOAc/hexanes) and purified a second time by flash column chromatography (EtOAc/CH2Cl2) to afford t-butyl 5-(3-t- butyl-5-(3-(5-(5-chloropyridin-3-yloxy)-2-fluorophenyl)ureido)-lH-pyrazol-l-yl)-lH- indazole-1-carboxylate (0.0486 g, 23% yield) as a solid. 1H NMR (400 MHz, acetone-^) 6 8.52 (brd, IH, J = 2.8 Hz), 8.46 (s, IH), 8.37 (d, IH, J = 2.0 Hz), 8.35-8.32 (m, 2H), 8.24 (dt, IH, J - 0.8 and 8.8 Hz), 8.818 (dd, IH, J - 2.8 and 6.8 Hz), 7.22 (dd, IH, J = 8.8 and 10.8 Hz), 6.81 (ddd, IH, J = 3.2, 4.0 and 8.8 Hz), 1.73 (s, 9H), 1.34 (s, 9H); MS (ESI) m/z: 620.2 (M+H+).
The material from the previous step (0.0486 g, 0.078 mmol) and 4M HCl in dioxane (5.0 ml) were combined at RT. A little MeOH was added to give a homogeneous solution. The mixture was heated overnight at 40 0C. The completed reaction was concentrated in vacuo, dissolved in MeCNZH2O, frozen and lyophilized to afford l-(3-t-butyl-l-(lH-indazol-5-yl)-lH-ρyrazol-5-yl)-3-(5-(5-chloroρyridin-3-yloxy)- 2-fluorophenyl)urea (0.0475 g, 103% yield) as the bis-HCl salt. 1H NMR (400 MHz, DMSO-^n) δ 9.14 (s, IH), 8.95 (s, IH), 8.43-8.42 (m, IH), 8.34-8.33 (m, IH), 8.20 (s, IH), 8.00-7.97 (m, IH), 7.88-7.87 (m, IH), 7.70-7.67 (m, IH), 7.60-7.59 (m, IH), 7.45- 7.42 (m, IH), 7.32-7.27 (m, IH), 6.81-6.77 (m, IH), 6.38 (s, IH), 1.27 (s, 9H); MS (ESI) m/z: 520.2 (M+H÷).
Example 9: Using a procedure analogous to Example 1, Example B7 (0.300 g, 0.550 mmol), Example AlO (0.138 g, 0.577 mmol) and DIEA (0.115 ml, 0.659 mmol) were combined and purified by flash column chromatography (EtOAc/hexanes) to afford tert- butyl 6-(3-tert-butyl-5-(3-(5-(5-chloropyridin-3-yloxy)-2-fluorophenyl)ureido)-lH- pyrazol-l-yl)-3,4-dihydroisoquinoline-2(lH)-carboxylate (0.090 g, 26% yield) as a film.
1H NMR (400 MHz, acetone-J,;) δ 8.50 (brs, IH), 8.36 (s, IH), 8.35-8.32 (m, 2H)5 8.19- 8.16 (m, IH), 7.47-7.46 (m, IH), 7.38-7.36 (m, 2H), 7.31-7.29 (m, IH), 7.27-7.22 (m,
IH), 6.83-6.79 (m, IH), 6.46 (s, IH), 4.63 (brs, 2H), 3.68-3.65 (m, 2H), 2.89-2.86
(m,2H), 1.50 (s, 9H), 1.32 (s, 9H); MS (ESI) m/z: 635.2 (M+H+).
The material from the previous reaction (0.090 g, 0.14 mmol, 1.00 eq) and 4M
HCl in dioxane (5.00 ml) were combined at 22 0C. A little MeOH was added to make the mixture homogeneous. After 2.5 h, the completed reaction was concentrated in vacuo, dissolved in MeCN/H2O, frozen and lyophilized to afford l-(3-tert-butyl-l-(l,2,3,4- tetraliydroisoquinolin-6-yl)-lH-pyrazol-5-yl)-3-(5-(5-chloropyridin-3-yloxy)-2- fluorophenyl)urea (76 mg, 89% yield) as the bis-HCl salt. 1H NMR (400 MHz, DMSO- d6) δ 9.51 (brs, 2H), 9.26 (brs, IH), 9.22 (s, IH), 8.42-8.41 (m, IH), 8.33-8.32 (m, IH), 7.95-7.92 (m, IH), 7.60-7.59 (m, IH), 7.42-7.29 (m, 4H), 6.82-6.78 (m, IH), 6.34 (s, IH), 4.32-4.30 (m, 2H), 3.39-3.35 (m, 2H), 3.10-3.06 (m, 2H), 1.26 (s, 9H); MS (ESI) m/z: 535.2 (M+H+).
Example 10: Using a procedure analogous to Example 1, Example B9 (0.150 g, 0.351 mmol) and Example A2 (0.101 g, 0.386 mmol) were combined to provide 1 -(2-fluoro-4- (2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)-3-(3-isoproρyl-l -(quinolin-6-yl)-l H- pyrazol-5-yl)urea hydrochloride (0.126 g, 62% yield). 1H NMR (OMSO-d6) δ 9.36 (s, IH), 9.18-9.15 (m, 2H), 8.92 (d, J= 8.4 Hz, IH), 8.85-8.80 (m, IH), 8.53 (d, J = 5.6 Hz, IH), 8.44 (d, J - 2.4 Hz, IH), 8.36 (d, J = 9.2 Hz, IH), 8.22 (dd, J= 9.2, 2.4 Hz, IH), 8.14 (t, J= 9.2 Hz, IH), 7.92 (dd, J= 8.4, 4.8 Hz, IH), 7.42 (d, J= 2.4 Hz, IH), 7.31 (dd, J= 11.6, 2.8 Hz, IH), 7.19 (dd, J= 5.6, 2.8 Hz, IH), 7.04 (dd, J= 8.8, 2.0 Hz, IH), 6.45 (s, IH), 2.96 (m, IH), 2.79 (d, J= 4.8 Hz, 3H), 1.28 (d, J = 6.8 Hz, 6H); MS (ESI) m/z: 540.3 (M+H+).
Example 11: Using a procedure analogous to Example 1, Example BlO (0.15 g, 0.363 mmol) and Example A2 (0.100 g, 0.38 mmol) were combined to provide l-(3-ethyl-l- (quinolin-6-yl)-lH-pyrazol-5-yl)-3-(2-fluoro-4-(2-(methylcarbamoyl)pyridin-4- yloxy)phenyl)urea hydrochloride (0.120 g, 58% yield). 1H NMR (OMSO-d6) δ 9.42 (s, IH), 9.21-9.18 (m, 2H), 8.96 (d, J= 8.4 Hz, IH), 8.87-8.82 (m, IH), 8.53 (d, J= 5.6 Hz, IH), 8.48 (d, J = 1.6 Hz, IH), 8.38 (d, J = 9.2 Hz, IH), 8.25 (dd, J - 9.2, 1.6 Hz, IH), 8.14 (t, J= 8.8 Hz, IH), 7.95 (dd, J= 8.0, 4.8 Hz, IH), 7.43 (d, J= 2.0 Hz, IH), 7.31 (dd, J= 12.0, 2.4 Hz, IH), 7.19 (dd, J= 5.2, 2.0 Hz, IH), 7.05 (dt, J= 8.8, 1.6 Hz, IH), 6.44 (s, IH), 2.79 (d, J = 4.8 Hz, 3H), 2.64 (q, J - 7.6 Hz, 2H), 1.25 (t, J = 7.6 Hz, 3H); MS (ESI) m/z: 526.2 (M+H+).
Example 12: Using a procedure analogous to Example 1, Example B3 (0.195 g, 0.441 mmol), Example AlO (0.1 11 g, 0.464 mmol) and DIEA (0.0923 ml, 0.530 mmol) were combined and purified first by flash column chromatography (EtOAc/hexanes) and then by reverse phase chromatography (MeCN (w/ 0.1% TFA)/ H2O (w/0.1% TFA)) to provide an aqueous solution of the TFA salt of the desired product. The aqueous residue was treated with satd. NaHCO3 (pH 8) and extracted with EtOAc (3x). The combined organics were washed with brine (Ix), dried (MgSO4), and evaporated to afford product (0.0258 g, 11% yield) as the free base. The free base was treated with certified 0.1N HCl (0.97 ml, 2.0 eq) to afford l-(3-t-butyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)-3-(5-(5- chloropyridin-3-yloxy)-2-fluorophenyl)urea (0.0262 g, 10% yield) as the bis-HCl salt. !H NMR (400 MHz, OMSO-d6) δ 9.33 (s, IH), 9.22-9.21 (m, IH), 9.14-9.13 (m, IH), 8.83-8.81 (m, IH), 8.42-8.41 (m, IH), 8.36 (brs, IH), 8.33-8.29 (m, 2H), 8.15-8.12 (m, IH), 7.94-7.91 (m, IH), 7.88-7.84 (m, IH), 7.59-7.57 (m, IH), 7.34-7.28 (m, IH), 6.82- 6.78 (m, IH), 6.46 (s, IH), 1.30 (s, 9H); MS (ESI) m/z: 531.0 (M+H+).
Example 13: Using a procedure analogous to Example 1, Example B3 (100 mg, 0.226 mmol), DIEA (73 mg, 0.566 mmol) and Example A18 (63 mg, 0.25 mmol) were combined to yield l-(3-tert-butyl-l-(quinolin-6-yl)-lH-pyrazoI-5-yl)-3-(2-fluoro-5-(2-
(methylthio)pyrimidin-4-yloxy)phenyl)urea hydrochloride (61 mg, 50% yield). 1H-NMR
(DMSO-^) δ 1.30 (s, 9H), 2.50 (s, 3H), 6.47 (s, IH), 6.76 (d, IH), 6.86-6.90 (m, IH),
7.29-7.34 (m, IH), 7.92-7.98 (m, 2H), 8.20-8.23 (m, IH), 8.37 (d, IH), 8.44 (s, IH), 8.50 (d, IH), 8.95 (d, IH), 9.19-9.20 (m, IH), 9.28 (s, IH), 9.46 (s, IH); MS (ESI) m/z: 544.2
(M+H+).
Example 14: Using a procedure analogous to Example 1, Example B3 (0.10 g, 0.23 mmol), Example Al 2 (53 mg, 0.23 mmol) and DIEA (64 mg, 0.50 mmol) were combined and purified by reverse phase column chromatography to obtain l-(3-tert- butyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)-3-(2-fluoro-5-(6-(hydroxymethyl)pyridin-3- yloxy)phenyl)urea TFA salt. The residue was dissolved in 3M HCl and co-evaporated with isopropyl alcohol (3x). EtOAc was added to the residue and the solid was filtered, washed with EtOAc, and dried under vacuum to obtain l-(3-tert-butyl-l-(quinolin-6-yl)- lH-pyrazol-5-yl)-3-(2~fluoro-5-(6-(hydroxymethyl)pyridm-3-yloxy)phenyl)urea HCl salt (40 mg, 34% yield). 1H NMR (400 MHz, DMSO-J6) δ 9.15 (brm, IH), 9.05 (bπri, IH), 8.63 (brm, IH), 8.32 (bim, IH), 8.23 (brm, 2H), 8.03 (m, IH), 7.90 (m, IH), 7.73 (brm, IH), 7.56 (m, 2H), 7.28 (dd, J = 9.2,12.4 Hz, IH), 6.74 (m, IH), 6.44 (s, IH), 4.60 (m, 2H), 1.30 (s, 9H); MS (ESI) m/z: 527.2 (M+H+).
Example 15: Using a procedure analogous to Example 1, Example B9 (0.120 g, 0.281 mmol) and Example A7 (0.0763 g, 0.309 mrαol) were combined to provide l-(4-(2- carbamoylpyridin-4-yloxy)-2-iluoroprienyl)-3-(3-isopropyl- 1 -(quinolin-6-yl)-l H-pyrazol- 5-yl)urea hydrochloride (0.101 g, 65% yield). 1H NMR (DMSO-J6) δ 9.23 (s, IH), 9.11- 9.08 (m, 2H), 8.77 (d, J = 4.8 Hz, IH), 8.53 (d, J= 6.0 Hz, IH), 8.35 (d, J= 2.0 Hz, IH), 8.29 (d, 7= 8.8 Hz, IH), 8.18-8.11 (m, 3H), 7.84-7.80 (m, IH), 7.75 (s, IH), 7.43 (d, J = 2.4 Hz, IH), 7.31 (dd, J =11.6, 2.4 Hz, IH), 7.20 (dd, J= 6.0, 2.4 Hz, IH), 7.05 (dd, J = 9.6, 2.8 Hz, IH), 6.45 (s, IH); MS (ESI) m/z: 526.2 (M+H+).
Example 16: Using a procedure analogous to Example 1, Example B3 (85 mg, 0.19 mmol), Example A13 (42 mg, 0.19 mmol) and DIEA (55 mg, 0.42 mmol) were combined in DMSO (1 mL) and heated overnight at 50-55 0C. Water was added (50 mL) and the mixture was extracted with EtOAc (3 x 100 mL), dried (MgSO4), concentrated in vacuo and purified by silica gel column chromatography to obtain l-(3-tert-butyl-l-
(quinolin-6-yl)-lH-pyrazol-5-yl)-3-(2-fluoro-5-(6-methylpyridin-3-yloxy)phenyl)urea. The product treated withh 0.1 OM aq HCl solution to obtain l-(3-tert-butyl-l-(quinolin-6- yl)-lH-pyrazol-5-yl)-3-(2-fluoro~5-(6-methylpyridin-3-yloxy)phenyl)urea salt HCl salt
(56 mg, 52% yield). 1H NMR (400 MHz, DMSCW6) δ 9.38 (brs, IH), 9.27 (d, J = 2.4
Hz, IH), 9.11 (dd, J= 1.6, and 4.8 Hz, IH), 8.77 (d, J= 8.0 Hz, IH), 8.50 (d, J= 3.2 Hz,
IH), 8.34 (d, J= 2.4 Hz, IH), 8.29 (d, J= 9.2 Hz, IH), 8.11 (dd, J= 2.4, and 9.2 Hz, IH), 7.94 (dd, J= 3.2, and 6.8 Hz, IH), 7.83 (m, 2H), 7.68 (d, J= 8.8 Hz, IH), 7.32 (dd, J =
9.2, 10.8 Hz, IH), 6.79 (m, IH), 6.44 (s, IH), 2.61 (s, 3H), 1.30 (s, 9H); MS (ESI) m/z:
511.2 (M+H+).
Example 17: Using a procedure analogous to Example 1, Example B9 (213 mg, 0.50 mmol), Example A6 (145 mg, 0.56 mmol) and DIEA (0.09 mL, 0.517 mmol) were combined in DMF (2 mL) to provide l-(3-isopropyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)- 3-(3-methyl~4~(2-(methyIcaτbamoyl)pyridin-4-yloxy)phenyl)urea (194 mg, 73% yield). 1H NMR (400 MHz, DMSCW6): δ 9.07 (s, 1 H), 8.97 (dd, J = 4.2, 1.8 Hz, 1 H), 8.76 (q, J = 4.9 Hz, 1 H), 8.64 (s, 1 H), 8.51-8.48 (m, 2 H), 8.19-8.16 (m, 2 H), 7.97 (dd, J = 9.0, 2.4 Hz, 1 H), 7.63 (dd, J = 8.3, 4.2 Hz, 1 H), 7.45 (d, J = 2.4 Hz, 1 H), 7.33 (dd, J - 8.9, 2.6 Hz, 1 H), 7.28 (d, J= 2.6 Hz, 1 H), 7.10-7.04 (m, 2 H), 6.43 (s, 1 H), 2.95 (m, 1 H), 2.78 (d, J- 4.9 Hz, 3 H), 2.04 (s, 3 H), 1.28 (d, J= 6.7 Hz, 6 H); MS (ESI) m/z: 536.2 (M+H+).
Example 18: mCPBA (1.07 g of -70%, 4.34 mmol) was added to a solution of Example A18 (545 mg, 2.17 mmol) in CH2Cl2 (15 niL) and the solution was stirred at RT. The mixture was washed with saturated sodium bicarbonate (3 x 20 mL) and brine (30 mL), dried (Na2SO4) and concentrated in vacuo to yield 0.65 g of a tan foam, which proved to be a mixture of the sulfoxide and sulfone, and which was used as is. In 2.0N methylamine/THF (22 mL) was placed the crude sulfoxide/sulfone mixture (0.61 g, 2.2 mmol) with stirring overnight at 40 0C. The mixture was cooled to RT, diluted with ethyl acetate (25 mL), washed with 5% citric acid (25 mL), saturated sodium bicarbonate (25 mL) and brine (25 mL), dried (Na2SO4), concentrated in vacuo and purified by reverse phase chromatography to yield 4~(3-amino-4-fluorophenoxy)-N-methylpyrimidin~2- amine trifluoroacetic acid salt (301 mg, 60% yield). MS (ESI) m/z: 235.0 (M+H+). In DMSO (2 mL) was placed Example B3 (159 mg, 0.359 mmol), DIEA (139 mg, 1.08 mmol) and 4-(3-arnino-4-fluorophenoxy)-N-methylpyrimidin-2-amine trifluoroacetic acid salt (150 mg, 0.431 mmol). The mixture was warmed to 50 0C overnight, then diluted with ethyl acetate (25 mL), washed with 5% citric acid (50 mL), saturated sodium bicarbonate (50 mL) and brine (50 mL), dried (Na2SO4), concentrated in vacuo and purified by column chromatography to yield l-(3-tert-butyl-l-(quinolin-6- yl)-lH-pyrazol-5-yl)-3-(2-fluoro-5-(2-(methylamino)pyrimidin-4-yloxy)phenyl)urea (93 mg, 49% yield). 1H-NMR
Figure imgf000103_0001
1.31 (s, 9H), 2.54-2.86 (br d, 3H), 6.46 (s, IH), 6.57-6.61 (br m, IH), 6.91-6.93 (br m, IH), 7.32-7.37 (m, IH), 7.94-8.05 (m, 2H), 8.23- 8.33 (m, 2H), 8.40 (d, IH), 8.48 <s, IH), 8.98 (d, IH), 9.19-9.21 (m. IH), 9.43-9.47 (br m, IH), 9.68-9.73 (br m, IH); MS (ESI) m/z: 527.2 (M+H+). Example 19: Using a procedure analogous to Example 1, Example B9 (85 mg, 0.20 mmol), Example A9 (46 mg, 0.20 mmol) and DIEA (57 mg, 0.44 mmol) were combined in DMSO (1 mL) to obtain l~(2-fluoro-4-(2-(methylamino)pyridin-4-yloxy)phenyl)-3-(3- isopropyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)urea. The product was treated with 0.10OM aq HCl solution to obtain l-(2-tluoro-4-(2-(methylamino)pyridin-4-yloxy)phenyl)-3-(3- isopropyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)urea HCl salt (52 mg, 48% yield). 1H NMR (400 MHz, DMS(W6) δ 9.17 (s, IH), 9.14 (brs, IH), 8.98 (dd, J= 1.2, and 4.0 Hz , IH), 8.50 (d, J = 8.4 Hz, IH), 8.42 (brs, IH), 8.20 (d, J = 2.8 Hz, IH), 8.17 (d, J = 9.2 Hz, IH), 7.97 (dd, J = 2.4, and 9.2 Hz, IH), 7.91 (d, J- 7.2 Hz, IH), 7.64 (dd, J = 4.0, and 8.4 Hz, IH), 7.34 (dd, J - 2.4, and 11.6 Hz , IH), 7.07 (dd, J = 1.2, and 8.8 Hz , IH), 6.60 (d, J = 6.4 Hz, IH), 6.43 (s, IH), 6.17 (brs, IH), 2.95 (m, IH)5 2.87 (d, J= 4.4 Hz, 3H), 1.27 (d, J= 6.8 Hz , 6H); MS (ESI) m/z: 512.3 (M+H+).
Example 20: Using a procedure analogous to Example 1, Example BlO (0.13 g, 0.314 rranol), Example A7 (0.086 g, 0.346 mmol) and DIEA (0.12 mL, 0.69 mmol) were dissolved in DMSO (1.5 mL) and the mixture was heated at 55 °C overnight to afford 1- (4-(2-carbamoylpyridin-4-yloxy)-2-fluorophenyl)-3-(3-ethyl-l-(quinolin-6-yl)-lH- pyrazol-5-yl)urea (0.088 g, 55% yield). This was converted to corresponding HCl salt by reacting with HCl (4.0 M HCl/dioxane, 1.0 eq.). 1H NMR (DMSO^6) δ 9.37 (s, IH), 9.18-9.15 (m, 2H), 8.90 (d, J= 8.0 Hz, IH), 8.54 (d, J = 5.6 Hz, IH), 8.43 (s, IH), 8.21 (d, J= 8.8 Hz, IH), 8.22-8.12 (m, 3 H), 7.91 (m, IH), 7.78 (s, IH), 7.45 (d, J= 1.6 Hz, IH), 7.31 (dd, J = 12, 2.0 Hz, IH), 7.21 (dd, J = 5.2, 1.4 Hz, IH), 7.05 (d, J = 9.2 Hz, IH), 6.44 (s, IH), 2.64 (q, J= 7.6 Hz, 2H), 1.25 (t, J= 7.2 Hz, 3H); MS (ESI) m/z: 512.3 (M+H*).
Example 21: Using a procedure analogous to Example 1, Example B3 (198 mg, 373 mmol), DIEA (121 mg, 0.933 mmol) and Example A21 (117 mg, 0.448 mmol) were combined to yield l-(3-tert-butyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)-3-(2-fluoro-5-(6~ (methylcarbamoyl)pyridin-3-yloxy)phenyI)urea (140 mg, 67% yield) as the hydrochloride salt. 1H-NMR (DMSO-c/u) 6 1.30 (s, 9H)5 2.81 (d, 3H), 6.45 (s, IH), 6.81- 6.83 (m, IH), 7.30-7.35 (m, IH), 7.43-7.46 (m, IH), 7.91-8.02 (m, 3H), 8.19-8.21 (m, IH), 8.34-8.43 (m, 3H), 8.65-8.66 (m, IH), 8.91 (d, IH), 9.17-9.19 (m, IH), 9.28 (br s, IH), 9.44 (s, IH); MS (ESI) m/z: 554.2 (M+H+).
Example 22: Using a procedure analogous to Example 1, Example B14 (0.125 g, 0.291 mmol) and Example A7 (0.079 g, 0.320 mmol) were combined to provide l-(4-(2- carbaraoylpyridm-4-yloxy)-2-fluorophenyl)-3-(5-chloro-2-(quinolin-6-yl)phenyl)urea hydrochloride (0.070 g, 43% yield). 1H NMR (OMSO-d6) δ 9.20 (d, J- 3.6 Hz, IH), 9.04 (d, J= 1.6 Hz, IH), 8.92 (d, J= 8.0 Hz, IH), 8.54-8.52 (m, 2H), 8.36 (d, J = 9.2 Hz, IH), 8.32 (d, J= 1.6 Hz, IH), 8.23 (t, J= 8.8 Hz, IH), 8.18-8.17 (m, 2H), 8.02 (dd, J= 8.4, 1.6 Hz, IH), 7.93-7.90 (m, IH), 7.76 (s, IH), 7.43-7.39 (m, 2H), 7.31-7.26 (m, 2H), 7.20 (dd, J- 5.6, 2.4 Hz, IH), 7.06 (dd, J- 8.8, 1.2 Hz, IH); MS (ESI) m/z: 528.0 (M+H+).
Example 23: Using a procedure analogous to Example 1, Example B9 (35 mg, 0.02 mmol), Example A14 (47 mg, 0.20 mmol) and DIEA were combined in DMSO and heated overnight at 60 0C to obtain l-(2-fluoro-4-(2-methoxypyridin-4~yloxy)phenyl)-3- (3-isopropyl-l-(quinolin-6-yI)-lH-pyrazol-5-yl)urea HCl salt (54 mg, 49% yield). 1H NMR (400 MHz, DMSO-J6) δ 9.35 (brs, IH), 9.13 (brs, IH), 8.85 (d, J = 2.0 Hz, IH), 8.74 (s, IH), 8.35 (dd, J= 1.6, and 8.4 Hz, IH), 8.25 (m , IH), 7.90 (s, IH), 7.74 (d, J = 8.4 Hz, IH), 7.71 (brs, IH), 7.29 (m, 2H), 6.46 (s, IH), 4.31 (q, J= 7.2 Hz, 2H), 2.66 (s, 3H), 1.29 (s, 9H), 1.22 (t, J= 7.2 Hz5 3H); MS (ESI) m/z: 556.3 (M+H+).
Example 24: Using a procedure analogous to Example 1, Example B19 (150 mg, 0.329 mmol) and Example A2 (94 mg, 0.362 mmol) were combined to provide 1 -(3-tert-butyl- l-(2-methylquinolin-6-yl)-lH-pyrazol-5-yl)-3-(2-fluoro-4-(2-(methylcarbamoyl)pyridin- 4-yloxy)phenyl)urea hydrochloride (113 mg, 60% yield). 1H-NMR (DMSO-J6) δ 1.33 (s, 9 H), 2.79 (d, 3 H), 3.00 (s, 3 H), 6.49 (s, 1 H), 7.02-7.04 (m, 1 H), 7.19-7.20 (m, 1 H), 7.30 (d, 1 H), 7.45 (s, IH), 8.01 (d, 1 H), 8.07-8.09 (m, 1 H), 8.34-8.37 (m, 1 H), 8.50- 8.57 (m, 3 H), 8.85-8.87 (m, 1 H), 9.10 (d, 1 H), 9.29 (s, 1 H), 9.61 (s, 1 H); MS (ESI) m/z: 568.2 (M+H+). Example 25: Using a procedure analogous to Example 1, Example B9 (120 mg, 0.28 mmol), Example A20 (80 mg, 0.29 mπiol), and DIEA (110 mg, 0.84 mmol) were combined to yield l-(2-fluoro-5-(6-(trifluoromethyI)pyridin-3-yloxy)phenyl)-3-(3- isopropyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)urea hydrochloride (62 mg, 40% yield). 1H- NMR (DMSO-Jg) δ 1.25 (d, 6H), 2.93 (pen, IH), 6.41 (s, IH), 6.85-6.88 (m, IH), 7.32- 7.37 (m, IH), 7.51-7.54 (m, IH), 7.87-7.90 (m, 2H), 7.96-7.98 (m, IH), 8.16-8.18 (m, IH), 8.33 (d, IH), 8.40 (s, IH), 8.52 (s, IH), 8.87 (d, IH)5 9.15-9.16 (m, IH), 9.28 (s, IH), 9.42 (s, IH); MS (ESI) m/z: 551.2 (M+H+).
Example 26: Using a procedure analogous to Example 1, Example B9 (0.200 g, 0.468 mmol) and Example A15 (0.1 13 g, 0.491 mmol) were combined to provide l-(4-(2- cyanopyridin-4-yloxy)-2-fluorophenyl)-3-(3-isopropyl-l~(quinolin-6-yI)-lH-pyrazol-5- yl)urea (0.238 g, 100%). MS (ESI) m/z: 508.3 (M+H+) l-(4-(2-Cyanopyridin-4~yloxy)-2-fluorophenyl)-3-(3-isopropyl-l-(quinolin-6-yl)- lH-pyrazol-5-yl)urea (0.108 g, 0.221 mmol) and N-acetyl cysteine (0.072 g, 0.441 mmol) were dissolved in MeOH (0.3 mL). Ammonium acetate (0.041 g, 0.0.529 mmol) was added and the reaction mixture was heated at 60 QC under N2 overnight. The completed reaction was diluted with H2O (10 ml), basified by K2CO3, extracted with EtOAc (2x30 mL) and THF (20 mL). The combined organic layers were washed with brine (20 mL), dried (MgSO4), concentrated in vacuo and purified by chromatography to afford l-(4-(2- carbamimidoylpyridin-4-yloxy)-2-fluorophenyl)-3-(3-isopropyl-l-(quinolin-6-yl)-lH- pyrazol-5-yl)urea (0.019 g, 17% yield) as a white solid. This was converted to corresponding HCl salt by reacting with HCl (4.0 M HCl/dioxane, 1.0 eq.). 1H NMR (DMSO-J6) δ 9.57 (s, 2H), 9.36-9.34 (m, 2H), 9.20 (d, J= 1.2 Hz, IH), 9.09 (dd, J= 4.4, 1.2 Hz, IH), 8.74 (d, J= 8.0 Hz, IH), 8.68 (d, J= 5.2 Hz, IH), 8.35 (d, J= 2.0 Hz, IH), 8.28 (d, J = 9.2 Hz, IH), 8.18-8.10 (m, 2H), 7.92 (d, J = 2.4 Hz, IH), 7.80 (dd, J= 8.4, 4.8 Hz, IH), 7.32-7.26 (m, 2H), 7.05 (dd, J = 8.8, 1.2 Hz, IH), 6.44 (s, IH), 2.97-2.93 (m, IH), 1.28 (d, J= 6.8 Hz, 6H); MS (ESI) m/z: 525.3 (M+H÷).
Example 27: Using a procedure analogous to Example 1, Example B7 (159 mg, 0.291 mmol), DIEA (45 mg, 0.35 mmol) and Example A34 (74 mg, 0.35 mmol) were combined to give tert-butyl 6-(3-tert-butyl-5-(3-(3-cyano-5-(pyridin-3- yloxy)phenyl)ureido)-lH-pyrazol-l-yl)-3,4-dihydroisoquinoIine-2(lH)-carboxylate (83 mg, 47% yield). MS (ESI) m/z: 608.3 (M+H+).
In CH2Cl2 (8 mL) was placed tert-butyl 6-(3-tert-butyl-5-(3-(3-cyano-5-(ρyridin- 3-yloxy)phenyl)ureido)-lH-pyrazol-l-yI)-3,4-dihydroisoquinoline-2(lH)-carboxylate (83 mg, 0.14 mmol). HCl (g) was bubbled into reaction mixture until the solution was saturated and the solution was then stirred at RT for 4 hrs. Concentration in vacuo gave a solid which was triturated with ether (10 rnL). The solid was collected by filtration, washed with ether (2 mL) and dried to afford 1 -(3 -tert-butyl- 1-( 1,2, 3,4- tetrahydroisoquinolin-6-yl)-lH-pyra2ol-5-yl)-3-(3-cyano-5-(pyridin-3-yloxy)phenyl)urea hydrochloric acid salt (69 mg, 93% yield). 1H NMR (300 MHz, DMSO-J6) 5 1.26 (s, 9 H), 3.06-3.09 (m, 2 H), 3.35-3.40 (m, 2 H), 4.28-4.30 (m, 2 H), 6.33 (s, 1 H), 7.23-7.24 (m, 1 H), 7.31-7.34 (m, 1 H), 7.39-7.47 (m, 4 H), 7.63-7.67 (m, 2 H), 7.77-7.78 (m, 1 H), 8.52-8.54 Cm, 1 H), 8.59 (m, 1 H), 8.93 (s, 1 H), 9.42-9.43 (m, 2 H), 10.16 (s, 1 H); MS (ESI) m/z: 527.2 (M+H+).
Example 28: Using a procedure analogous to Example 1, Example A35 (95 mg, 0.428 mmol), DIEA (158 mg, 1.22 mmol) and Example B3 (180 mg, 0.407 mmol) were combined to give l-(5-(2-aminopyrimidin-4-yloxy)-2-fluorophenyl)-3-(3-tert-butyl-l- (quinolin-6-yl)-lH-ρyrazol-5-yl)urea hydrochloride salt (102 mg, 48% yield). 1H NMR (300 MHz, DMSO-J6) δ 1.31 (s, 9 H), 6.46 (s, 1 H), 6.65 (d, J= 6.8 Hz, 1 H), 6.91-6.94 (m, 1 H), 7.32-7.37 (m, 1 H), 7.91-7.94 (m, 1 H), 7.97-8.00 (m, 1 H), 8.20-8.23 (m, 1 H), 8.31-8.33 (m, 1 H), 8.36-8.39 (m, 1 H), 8.45-8.46 (m, 1 H), 8.92-8.94 (m, 1 H), 9.18 (m, 1 H), 9.45 (m, 1 H), 9.66 (s, 1 H), NH2 missing; MS (ESI) m/z: 513.3 (M+H+).
Example 29: Using a procedure analogous to Example 1, Example B9 (0.200 g, 0.468 mmol) and Example A15 (0.113 g, 0.491 mmol) in presence of DIEA (0.179 mL, 0.1.03 mmol) were combined to afford l-(4-(2~cyanopyridin-4-yloxy)-2-fluorophenyl)-3-(3- isopropyI-l-(quinolin-6-yl)-lH-pyrazol-5-yl)urea (0.238 g, 100%) as a colorless oil. It was converted to corresponding HCl salt by reacting with HCl (4.0 M in dioxane, 1.0 eq.). !H NMR (400 MHz, DMSOd6) δ 9.19 (s, IH), 9.09-9.08 (m, 2H), 8.73 (d, J= 8.0 Hz, IH), 8.60 (d, J- 6.0 Hz, IH), 8.32 (d, J = 2.4 Hz, IH), 8.27 (d, J= 8.8 Hz, IH), 8.16 (t, J= 9.2 Hz, IH), 8.10 (dd, J= 9.2, 2.4 Hz, IH), 7.80 (dd, J= 8.0, 4.4 Hz, IH), 7.72 (d, J= 2.8 Hz, IH), 7.31 (dd, J= 11.6, 2.8 Hz, IH), 7.23 (dd, J= 5.6, 2.8 Hz3 IH), 7.05 (dd, J= 9.2, 2.8 Hz, IH), 6.45 (s, IH), 2.95 (m, IH), 1.27 (d, J= 7.2 Hz, 6H); MS (ESI) m/z: 508.3 (M-HH+).
Example 30: Using a procedure analogous to Example 1, Example B3 ( 0.2 g, 0.453 mmol ) and Example A29 (0.158 g, 0.453 mmol ) were combined in DMSO ( 4 mL) at
70 0C in presence of DIEA ( 0.176 g, 1.36 mmol ) to provide l-(3-tert-butyl-l-(quinolin- 6-yl)-l H-pyrazol-5-yl)-3-(4-(2-((tert-butyldimethylsilyloxy)methyl)pyridin-4-yloxy)-2- fluorophenyl)urea (0.12g, 43% yield). 1H NMR (400 MHz, CDCl3) δ 9.02 (bra, IH), 8.86 (d, J = 8.5 Hz, IH), 7.65 (m, 3H), 7.27 (dd, J = 8, 4.4 Hz, IH), 6.99 (s, IH), 6.89 (brd, J = 9.0Hz, IH), 6.73 (dd, J = 12, 2.5 Hz, IH), 6.65 (s, IH), 6.60 ( m, IH), 4.71 (s, 2H), 1.36 (s, 9H), 0.85 (s, 9H), 0.05 (s, 6H); MS (ESI) m/z: 641.3 (M+H+). A solution of l-(3-tert-butyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)-3-(4-(2-((tert- butyldimethylsilyloxy)methyl)pyridin-4-yloxy)-2-fluoropheiiyl)urea (0.12 g, 0.19 mmol) in THF (2 ml) was treated with TBAF (1.0 ml, 1.0 M solution in THF) at RT for 1 hour. Water (10 ml) was added and the separated solid was filtered, washed with water and dried to give desilylated product l-(3-tert-butyl-l-(quinolin-6-yl)-lH-pyrazol~5-yl)-3-(2- fluoro-4-(2-(liydroxymethyl)pyridin-4-yloxy)phenyl)urea as a white solid (0.09Og, 91% yield). 1H NMR (400 MHz, DMSOd6) δ 9.01 (brs, IH), 8.97 (dd, J = 4.2, 1.6 Hz, 2H),
8.50 (brd, J = 8.3 Hz, IH), 8.36 (d, J = 5.5Hz, 2H), 8.18 (m, 2H), 7.97 (dd, J = 9, 2 Hz,
IH), 7.63 (dd, J = 9, 4.4 Hz, IH), 7.22 (dd, J = 12, 2.5 Hz, IH), 6.99 (m, IH), 6.93 (d, J
- 2.5 Hz, IH), 6.82 (dd, J = 5.7, 2.5 Hz, IH), 6.48 (s, IH), 5.40 (t, J = 6 Hz, IH), 4.50 (d, J = 8 Hz, 2H), 1.32 (s, 9H); MS (ESI) m/z: 527.2 (M+H +). The free base was converted to hydrochloride salt. 1H NMR (400 MHz, DMSOd6) δ 9.31 (brs, IH), 9.23 (m, IH),
9.07 (dd, J = 4.2, 1.6 Hz3IH), 8.70 (brd, J = 8.3 Hz, IH), 8.65 (d, J = 6.8Hz, 2H), 8.32 (d, J - 2Hz, IH), 8.27 (d, J = 9Hz, IH), 8.22 (d, J = 9 Hz, IH)3 8.09 (dd, J = 9, 2.3 Hz, IH), 7.75 (dd, J - 8, 4.5 Hz, IH), 7.43-7.37 (m, 2H), 7.34 (d, 2.8 Hz, IH), 7.12 (m, IH), 6.48 (s, 1 H), 4,77 (s, 2H), 1.32 (s, 9H); MS (ESI) m/z: 527.2 (M+H +). Example 31: Using a procedure analogous to Example 4, Example B25 (0.30 g, 0.89 mmol) and Example A31 (0.26 g, 0.98 mmol) in presence of N-methyl pyrrolidine (catalytic amount) were combined to afford l-(2-fluoro-4-(2-(isoρroρylamino)ρyridin-4- yloxy)phenyl)-3-(3-isopropyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)urea (0.26 g, 54% yield). The product was treated with methanesulfonic acid to afford 1 -(2-fluoro-4~(2- (isopropylamino)pyridin-4-yloxy)phenyl)-3-(3-isopropyl-l-(quinolin-6-yl)-lH-pyrazol-5- yl)urea mesylate salt (260 mg, 88% yield). 1H NMR (400 MHz, DMSCW6) δ 9.03 (m, IH), 9.01 (s, IH), 8.96 (dd, J = 1.6, and 4.0 Hz, IH), 8.49 (bid, J = 8.4 Hz, IH), 8.33 (brm, IH), 8.17 (rn, 2H), 7.95 (dd, J= 2.8, and 9.2 Hz, IH), 7.87 (d, J= 7.6 Hz, IH), 7.63 (d, J= 4.4, and 8.4 Hz, IH), 7.33 (dd, J= 2.8, and 11.6 Hz, IH), 7.06 (m, IH), 6.61 (dd, J = 2.4, and 7.2 Hz, IH), 6.41 (s, IH), 6.09 (bis, IH), 3.81 (m, IH), 2.91 (m, IH), 2.30 (s, 3H), 1.25 (d, J- 6.8 Hz, 6H), 1.13 (d, J= 6.0 Hz, 6H); MS (ESI) rn/z: 540.3 (M+H+).
Example 32: Using general method A, Example B20 (0.0643 g, 0.226 mmol) and Example A7 (0.168 g, 0.678 mmol) were combined to afford l-(3-tert-butyl-l-(H- imidazo[l,2-a]pyridin-6-yl)-lH-pyrazol-5-yI)-3-(4-(2-carbamoylpyridin-4-yloxy)-2- fluorophenyl)urea (0.071 g, 59%) as a white solid. It was converted to corresponding HCl salt by reacting with HCl (4.0 M in dioxane, 1.0 eq.). 1H NMR (400 MHz, DMSOd6) δ 9.48 (s, IH), 9.33 (d, J = 0.8 Hz, IH), 9.13 (d, J = 1.6 Hz, IH), 8.53 (d, J= 5.2 Hz, IH), 8.41 (d, J = 2.4 Hz, IH), 8.26 (d, J= 2.0 Hz, IH), 8.17-8.09 (m, 4H), 7.72 (s, IH), 7.39 (d, J= 2.4 Hz, IH), 7.32 (dd, J= 12.0, 2.8 Hz, IH), 7.20 (dd, J= 5.6, 2.8 Hz, IH), 7.05 (dd, J= 9.2, 1.6 Hz, IH), 6.49 (s, IH), 1.32 (s, 9H); MS (ESI) m/z: 529.3 (M+H+).
Example 33: Using a procedure analogous to Example 1, Example B9 (100 mg, 0.23 mmol) and Example A12 (55 mg, 0.23 mmol) in presence of DIEA (90 μL, 0.51 mmol) were combined to afford l-(2-fluoro-5-(6-(hydroxymethyl)pyridin-3-yloxy)phenyl)-3-(3- isopropyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)urea (30 mg, 25% yield). The product was treated with methanesulfonic acid to afford l-(2-fluoro-5-(6-(hydroxymethyl)pyridin-3- yloxy)phenyl)-3-(3-isopropyl-l-(qumolin-6~yl)~lH-pyrazol-5-yl)urea mesylate salt (23 mg, 65% yield). 1H NMR (400 MHz, DMSO-(Z6) δ 9.11 (brs, IH), 9.10 (m, IH), 9.06 (m, IH), 8.65 (d, J= 8.4 Hz, IH), 8.34 (s, IH), 8.25 (d, J= 1.6 Hz, IH), 8.21 (d, J= 9.2 Hz, IH), 8.03 (dd, J= 2.4, and 9.2 Hz, IH), 7.91 (dd, J= 2.8, and 6.4 Hz, IH), 7.75 (dd, J= 4.8, and 8.4 Hz, IH), 7.58 (s, IH), 7.30 (m, IH), 6.75 (m, IH), 6.40 (s, IH), 4.61 (s, 2H), 2.92 (m, IH), 2.32 (s, 3H), 1.25 (d, J- 6.8 Hz, 6H); MS (ESI) m/z: 513.3(M+!!4).
Example 34: Using a procedure analogous to Example B19 step 2, Example A2 (1.00 g, 3.83 mmol) and 2,2,2-trichloroethyl carbonochloridate (1.30 g, 6.12 mmol) were combined to give 2,2,2-trichloroethyl 2-fluoro-4-(2-(methylcarbamoyl)pyridin-4- yloxy)ρhenylcarbamate. MS (ESI) m/z: 436.0, 438.0 (M+H).
A solution of Example B28 (57 mg, 0.213 mmol), 2,2,2-trichloroethyl 2-fluoro-4- (2-(methylcarbamoyl)pyridin-4-yloxy)phenylcarbamate (102 mg, 0.235 mmol) and DIEA (110 mg, 0.853 mmol) in DMSO (1.5 mL) was placed was warmed to 60 0C overnight. It was then treated with additional 2,2,2-trichloroethyl 2-fluoro-4-(2- (methylcarbamoyl)pyridin-4-yloxy)phenylcarbamate (-200 mg), warmed to 60 0C overnight. The reaction was diluted with ethyl acetate (25 mL) and 5% citric acid (20 mL). The organic phase was separated, washed with saturated sodium bicarbonate (20 mL) and brine (20 mL), dried (Na2SO4), concentrated in vacuo and purified by chromatography (Si-25 column, MeOH/EtOAc) to afford impure product. Repurifϊcation via reverse phase chromatography (Cl 8-25 column, CH3CN/H2O) gave a residue which was treated with IN sodium hydroxide (3 mL) and extracted with ethyl acetate ( 2 x 20 mL). The combined organic phases were dried (Na2SO4), concentrated in vacuo and treated with 4N HCl/dioxane (0.1 mL) to afford l-(3-tert-butyl-l- (quinoxalin-6-yl)~lH-pyrazol-5-yl)-3-(2-fluoro-4-(2-(methylcarbamoyl)pyridin-4- yloxy)ρhenyl)urea hydrochloric acid salt (14 mg, 12% yield). 1H NMR (300 MHz, DMSO-Uf6) δ 1.31 (s, 9 H), 2.77 (d, 3 H), 6.47 (s, 1 H), 7.00-7.05 (m, 1 H)5 7.15-7.18 (m, IH), 7.26-7.28 (m, 1 H), 7.39 (m, 1 H), 7.65 (m, 1 H), 8.08-8.13 (m, 2 H), 8.21-8.25 (m, 2 H), 8.50 (m, IH), 8.78 (m, 1 H), 8.97-9.03 (m, 3 H), 9.13 (s, 1 H); MS (ESI) m/z: 555.2 (M+H+).
Example 35: Using a procedure analogous to Example 1, Example B9 (0.145 g, 0.339 mmol) and Example A27 (0.087 g, 0.323 mmol) in presence of DIEA (0.124 mL, 0.710 mmol) were combined to afford l-(4-(2-(lH-pyrazol-4-yl)pyridin-4-yloxy)~2- fiuorophenyl)-3-(3-isopropyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)urea (0.1 12 g, 63%) as a white foam. It was converted to corresponding mesylate salt by reacting with MsOH (1.0 eq.). 1H NMR (400 MHz, DMSO-d6) δ 9.10-9.03 (m, 3H), 8.63-8.52 (m, 4H), 8.26-8.20 <m, 2H), 8.03 (d, J- 3.6 Hz, IH), 7.78-7.70 (m, 2H), 7.40 (d, J= 10.8 Hz, IH), 7.14-7.09 (m, 2H), 6.44 {s, IH), 2.95 (m, IH), 2.33 (s, 3H), 1.27 (d, J= 7.2 Hz, 6H); MS (ESI) m/z; 549.3 (MH-H+).
Example 36: Example B22 (0.310 g, 0.715 mmol), Example A2 (0.187 g, 0.715 mmol) and DIEA (0.274 ml, 1.57 mmol) were combined in DMSO (3 ml) and stirred at 70 0C. After 18 h, the completed reaction was cooled to RT, diluted with brine and extracted with EtOAc (3x). The combined organics were washed with brine (2x), dried (MgSO4), evaporated and purified by flash column chromatography (EtOAc/hexanes) to afford the free base (84.1 mg, 22% yield). The free base thus obtained was treated with certified 0.1N HCl (3.1 ml, 2.0 eq) to afford l-(l-(benzo[d]thiazol-6-yl)-3-isoρroρyl-lH-ρyrazol- 5-yl)-3-(2-fluoro-4-(2-(methylcarbamoyl)ρyridin-4-yloxy)phenyl)urea (45 mg) as the bis- HCl salt. !H NMR (400 MHz, DMSO-rfβ) δ 9.49 (s, IH), 9.00 (s, 2H), 8.81 (q, J = 4.8 Hz, IH), 8.52 (d, J = 5.6 Hz, IH), 8.39 (d, J = 1.6 Hz, IH), 8.24 (d, J = 8.80 Hz, IH), 8.19 (t, J = 9.2 Hz, IH), 7.70 (dd, J = 2.4 and 8.8 Hz, IH), 7.42 (d, J = 2.4 Hz), 7.31 (dd, J = 3.2 and 12.0 Hz, IH), 7.18 (dd, J = 2.8 and 6.0 Hz, IH), 7.06 (ddd, J = 1.2, 2.8 and 8.8 Hz, IH), 6.42 (s, IH), 2.92 (septet, J = 7.2 Hz, IH), 2.79 (d, J - 4.8 Hz, 3H), 1.26 (d, J - 7.2 Hz, 6H); MS (ESI) m/z: 546.3 (MH-H+).
Example 37: Example B23 (0.200 g, 0.464 mmol), Example A2 (0.121 g, 0.464 mmol) and 1-Pr2NEt (0.178 ml, 1.02 mmol) were combined in DMSO (2 ml) and stirred with heating at 70 0C. After 18 h, the completed reaction was cooled to RT, diluted with brine and extracted with EtOAc (3x). The combined organics were washed with brine (2x), dried (MgSO4), concentrated in vacuo and purified by flash column chromatography (EtOAc/hexanes to EtOAc to THF) to afford impure product. This was purified a second time by reverse phase chromatography (MeCN (w/ 0.1% TFA)/ H2O (w/ 0.1% TFA)) to afford desired product (1 10 mg, 36% yield) as the TFA salt following lyophilization. The TFA salt thus obtained was dissolved in THF and shaken orbitally with MP-carbonate resin (110 mg) for 2 h. The supernatant was decanted away and the beads washed with THF (2x). The combined decants were concentrated, diluted with MeCNYH2O and then treated with certified 0.1N HCl (3.3 ml, 2.0 eq) to afford l-(2-fluoro-4-(2- (methylcarbamoyl)pyridin-4-yloxy)phenyl)-3-(3-isopropyl-l-(l-methyl-lH- benzo[d]imidazol-5-yl)-lH-pyrazol-5-yl)urea (31 mg) as the bis-HCl salt. !H NMR (400 MHz, DMSO-rfβ) δ 9.46 (bra, IH), 9.11 (s, IH), 9.07 (s, IH), 8.76 (brq, J = 4.8 Hz, IH), 8.50 (d, J = 5.6 Hz, IH), 8.11 (t, J - 9.2 Hz, IH), 8.06 (d, J - 8.8 Hz), 7.98 (d, J = 2.0 Hz, IH), 7.78 (m, IH), 7.37 (d, J = 2.8 Hz, IH), 7.28 (dd, J = 2.4 and 11.2 Hz5 IH), 7.16 (dd, J = 2.4 and 5.6 Hz, IH), 7.02 (ddd, J = 1.2. 2.8 and 8.8 Hz, IH), 6.38 (s, IH), 4.08 (s, 3H), 2.92 (septet, J = 6.8 Hz, IH), 2.76 (d, J - 4.8 Hz, 3H), 1.24 (d, J - 6.8 Hz, 6H); MS (ESI) m/z: 543.2 (M+H+).
Example 38: Using general method A, Example B21 (0.0.054 g, 0.20 mmol) and Example A2 (0.16 g, 0.60 mrnol) were combined to afford l-(l-(H-imidazo[l,2- a]pyridin-6-yl)-3-isopropyl-lH-pyrazol-5-yl)-3-(2-fluoro-4-(2- (methylcarbamoyl)pyridin-4-yloxy)phenyl)urea (0.045g, 43% yield) as a white solid. It was converted to corresponding mesylate salt by reacting with MsOH (1.0 eq.). 1H NMR (400 MHz, DMSO-d6) δ 9.19 (m, IH), 8.49 (d, J = 6.0 Hz, IH), 8.33 (d, J = 2.0 Hz, IH), 8.24 (dd, J- 9.6, 3.0 Hz, IH), 7.15 (d, J= 2.0 Hz, IH), 8.08 (d, J- 10.0 Hz, IH), 8.01 (t, J = 8.8 Hz, IH), 7.53 (d, J = 3.5 Hz, IH), 7.12 (dd, J = 6.0, 3.0 Hz, IH), 7.06 (dd, J = 11.6, 2.8 Hz, IH), 6.96 (rn, IH), 6.45 (s, IH), 3.01 (m, IH), 2.94 (s, 3H), 2.70 (s, 3H), 1.33 (d, J= 6.4 Hz, 6H); MS (ESI) m/z: 529.3 (M+H÷).
Example 39: Using general method A, Example B21 (0.030 g, 0.11 mmol) and Example A7 (0.082 g, 0.33 mmol) were combined to afford l-(l~(H-imidazo[l,2- a]pyridin-6-yl)-3-isopropyl-lH-pyrazol-5-yl)-3-(4-(2-carbamoylpyridin-4-yloxy)-2- fluorophenyl)urea (0.0245g, 43% yield) as a white solid. It was converted to corresponding HCl salt by reacting with HCl (4.0 M in dioxane, 1.0 eq.). 1H NMR (400 MHz, DMSO-d6) δ 9.26 (d, J= 0.8 Hz, IH), 8.69 (d, J= 6.4 Hz, IH), 8.38 (d, J= 1.6 Hz, IH), 8.26 (dd, J= 9.6, 1.2 Hz, IH), 8.20-8.11 (m, 3H), 7.96 (s, IH), 7.48 (d, J= 5.6 Hz, IH), 7.23 (dd, J= 11.6, 2.8 Hz, IH), 7.10 (d, J= 9.2 Hz, IH), 6.51 (s, IH), 3.03 (m, IH), 1.37 (d, J= 6.8 Hz, 6H); MS (ESI) m/z: 515.2 (M+H+).
I l l Example 40: Using a procedure analogous to Example 1, Example A39 (63 mg, 0.29 mmol) and Example B9 (122 mg, 0.29 mmol) were combined to provide l-(4-(2- aminopyridm-4-yloxy)-2-fluorophenyl)-3-(3-isopropyl-l-(quinolin-6-yl)-lH-pyrazol-5- yl)urea contaminated with 2,2,2-trichloroethanol (56 mg, 28% yield). 1H NMR (400 MHz, DMSO-J6) δ 8.99-8.96 (m, 2 H), 8.93 (d, J = 1.5 Hz, 1 H), 8.49 (m, 1 H), 8.19-8.16 (m, 2 H), 8.10 (t, J = 9.2 Hz, 1 H), 7.95 (dd, J - 9.1, 2.3 Hz, 1 H), 7.80 (d, J = 5.8 Hz, 1 H), 7.63 (dd, J = 8.3, 4.0 Hz, 1 H), 7.15 (dd, J = 11.8, 2.8 Hz, 1 H), 6.95 (m, 1 H), 6.44 (s, 1 H), 6.13 (dd, J - 5.9, 2.2 Hz, 1 H), 5.94 (s, 2 H), 5.82 (d, J = 2.0 Hz, 1 H), 2.94 (m, 1 H), 1.27 (d, J = 6.8 Hz, 6 H); MS (ESI) m/z: 498.2 (M+H*). A solution of the above l-(4-(2-aminopyridin-4-yloxy)-2-fluorophenyl)-3-(3- isopropyI-l-(quinolin-6-yl)-lH-pyrazol-5-yl)urea (44 mg, 0.061 mmol theory) and pyridine (0.30 niL, 3.7 mmol) in CH2Cl2 (1 niL) was treated with acetic anhydride (0.040 mL, 0.39 mmol). The reaction was stirred for 60 h and then partitioned between EtOAc and 2 M aq Na2CO3. The organic layer was washed with water and brine. The aqueous phases were back extracted with EtOAc. The combined organic phases were dried (Na2SO4), concentrated in vacuo and purified by reverse-phase chromatography to provide l-(4-(2-acetamidopyridin-4-yloxy)-2-flxioroρhenyl)-3-(3-isopropyl-l-(quinolm- 6-yl)-lH-pyrazol-5-yl)urea (25 mg, 76% yield). 1H NMR (400 MHz, DMSO-Jn) δ 10.53 (s, 1 H), 9.01 (s, 1 H), 8.96-8.94 (m, 2 H), 8.49 (m ,1 H), 8.18-8.11 (m, 4 H), 7.95 (dd, J - 8.8, 2.4 Hz, 1 H), 7.64-7.59 (m, 2 H), 7.21 (dd, J = 11.8, 2.7 Hz, 1 H), 6.98 (m, 1 H), 6.65 (dd, J = 5.8, 2.4 Hz, 1 H), 6.43 (s, 1 H), 2.93 (m, 1 H), 2.03 (s, 3 H), 1.26 (d, J = 6.8 Hz, 6 H); MS (ESI) m/z: 540.3 (M+H+).
Example 41: Using as procedure analogous to Example 4, Example B25 (100 mg, 0.30 mmol) and Example A30 (74 mg, 0.30 mmol) in presence of N-methyl pyrrolidine (catalytic amount) were combined to afford l-(4-(2-(ethylamino)pyridin-4-yloxy)-2- fJuorophenyl)-3-(3-isopropyl-l-(quinolm-6-yl)-lH-pyrazol-5-yl)urea (70 mg, 45% yield). The product was treated with methanesulfonic acid to afford 1 -(4-(2-(ethylamino)pyridin- 4-yloxy)-2-fluoroρhenyl)-3-(3-isopropyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)urea mesylate salt (71 mg, 87% yield). 1H NMR (400 MHz, DMSO-J6) δ 9.02 (m, IH), 9.01 (s, IH), 8.97 (dd, J = 1.6, and 4.0 Hz, IH), 8.49 (brd, J = 8.4 Hz, IH), 8.37 (bra, IH), 8.17 (m, 2H), 7.95 (dd, J = 2.4, and 8.8 Hz, IH), 7.88 (d, J = 12 Hz, IH), 7.63 (d, J = 4.4, and 8.4 Hz, IH), 7.33 (dd, J- 2.8, and 1 1.6 Hz, IH), 7.06 (m, IH), 6.61 (dd, J = 2.0, and 7.2 Hz, IH), 6.41 (s, IH), 6.13 (bra, IH), 3.23 (m, 2H), 2.92 (m, IH), 2.28 (s, 3H), 1.25 (d, J= 6.8 Hz, 6H), 1.13 (t, J= 7.2 Hz, 3H); MS (ESI) m/z: 526.2 (M+H+).
Example 42: Using a procedure analogous to Example 1, Example B9 (295 mg, 0.69 mmol) and Example A40 (214 mg, 0.763 mmol) were combined in DMF (3 rnL) to provide l-(3-isopropyI-l-(quinolin-6-yl)-lH-pyrazol-5-yl)-3-(3-metriyl-4-(2-(l-methyl- lH-ρyrazol-4-yl)ρyridin-4-yloxy)ρhenyl)urea (278 mg, 72% yield). 1H NMR (400 MHz, DMSO-J6) δ 9.00 (s, 1 H), 8.94 (dd, J - 4.2, 1.6 Hz, 1 H), 8.59 (s, 1 H), 8.45 (dd, J - 8.6, 1.0 Hz, 1 H), 8.29 (d, J= 6.0 Hz, 1 H), 8.20 (s, 1 H), 8.15-8.13 (m, 2 H), 7.94 (dd, J - 9.1, 2.4 Hz, 1 H), 7.91 (s, 1 H), 7.60 (dd, J = 8.5, 4.1 Hz, 1 H), 7.40 (d, J = 2.3 Hz, IH), 7.27 (dd, J = 8.6, 2.4 Hz, 1 H), 7.11 (d, J = 2.2 Hz, 1 H), 6.99 (d, J - 8.8 Hz, 1 H), 6.45 (dd, J = 5.7, 2.4 Hz, 1 H), 6.39 (s, 1 H), 3.83 (s, 3 H), 2.92 (m ,1 H), 2.05 (s, 3 H), 1.25 (d, J - 6.9 Hz, 6 H); MS (ESI) m/z: 559.2 (M+H+).
Example 43: Using a procedure analogous to Example 1, Example B3 (0.71 1 g, 1.66 mmol) and Example A28 ( 0.450 g, 1.58 mmol) in presence of DIEA (0.61 mL, 3.48 mmol) were combined to afford 1 -(2-fluoro-4-(2-(l -methyl- 1 H-pyrazol-4-yl)pyri din-4- yloxy)phenyl)-3-(3-isopropyl-l-(quinolin-6-yl)~l H-pyrazol-5-yl)urea (0.431 g, 48% yield) as a white solid. It was converted to corresponding mesylate salt by reacting with MsOH (1.0 eq.). 1H NMR (400 MHz, DMSO-d6) δ 9.08-9.04 (m, 3H), 8.66 (d, J = 8.8 Hz, IH), 8.57-8.54 (m, 2H), 8.26-8.16 (m, 4H), 8.05 (dd, J = 9.2, 2.4 Hz, IH), 7.75 (q, J = 4.4 Hz, IH), 7.64 (s, IH), 7.37 (dd, J - 11.6, 2.0 Hz, IH), 7.12-7.08 (m, 2H), 6.41 (s, IH), 3.90 (s, 3H), 2.92 (m, IH), 2.33 (s, 3H), 1.24 (d, J = 7.2 Hz, 6H); MS (ESI) m/z: 563.3 (M+H+).
Example 44: Using a procedure analogous to Example 4, Example B26 (100 mg, 0.29 mmol) and Example A31 (75 mg, 0.29 mmol) in presence of N-methyl pyrrolidine (catalytic amount) were combined to afford l-(3-tert-butyl-l-(quinolin-6-yl)-lH-pyrazol- 5-yl)-3-(2-fluoro-4-(2-(isopropylamino)pyridin-4-yloxy)phenyl)urea (59 mg, 32% yield). The product was treated with methanesulfonic acid to afford l-(3-tert-butyl-l-(quinolin- 6-yl)-lH-pyra2θl-5-yl)-3-(2-fluoro-4-(2-(isopropylamino)pyridin-4-yloxy)ρhenyl)urea mesylate salt (63 mg, 93% yield). 1H NMR (400 MHz, DMSO-^6) δ 9.03 (m, IH), 9.00 (s, IH), 8.98 (m, IH), 8.54 (bid, J= 8.4 Hz, IH), 8.35 (brm, IH), 8.17 (m, 2H), 7.97 (dd, J= 2.4, and 9.2 Hz5 IH), 7.86 (d, J= 7.2 Hz, IH), 7.66 (d, J= 4.4, and 8.4 Hz, IH), 7.33 (dd, J= 2.8, and 11.6 Hz, IH), 7.05 (m, IH), 6.61 (dd, J- 2.4, and 6.8 Hz, IH), 6.45 (s, IH), 6.08 (bra, IH), 3.81 (m, IH), 2.29 (s, 3H), 1.29 (s, 9H), 1.13 (d, J= 6.0 Hz, 6H); MS (ESI) m/z: 554.2 (M+H+).
Example 45: Using a procedure analogous to Example 1, Example BlO (0.060 g, 0.15 mraol) and Example A28 (0.041 g, 0.15 mmol) in presence of DIEA (0.056 rnL, 0.32 mmol) were combined to afford l-(3-ethyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)-3-(2- fluoro-4-(2-(l -methyl- lH-pyrazol-4-yl)pyridin-4-yloxy)phenyl)urea (47.6 mg, 60% yield) as a white foam. It was converted to corresponding mesylate salt by reacting with MsOH (1.0 eq.). 1H NMR (400 MHz, DMSOd6) δ 9.03-8.95 (m, 3H), 8.55-8.48 (m, 3H), 8.19-8.13 (m, 3H), 7.95 (dd, J= 9.2, 2.4 Hz, IH), 7.64 (dd, J = 8.4, 4.4 Hz, IH), 7.55 (s, IH), 7.32 (dd, J = 12.0, 2.8 Hz, IH), 7.07-7.01 (m, 2H), 6.36 (s, IH), 3.86 (s, 3H), 2.56 (q, J= 7.2 Hz, 2H), 2.25 (s, 3H), 1.18 (t, J= 7.6 Hz, 3H); MS (ESI) m/z: 549.3 (M+H+).
Example 46: Using general method A, Example B27 (77 mg, 0.28 mmol) and Example A2 (150 mg, 0.57 mmol) in presence of DPPA (67 μL, 0.31 mmol) and Et3N (44 μL, 0.31 mmol) were combined to afford l-(l-(benzo[d]oxazol-5-yl)-3-isopropyl-lH- pyrazol-5-yl)-3-(2-fiuoro-4-(2-(methyIcarbamoyl)pyridin-4-yloxy)phenyl)urea (105 mg, 70% yield). 1H NMR (400 MHz, DMSO-^6) δ 8.96 (d, J= 2.0 Hz, IH), 8.88 (s, IH), 8.86 (s, IH), 8.77 (q, J = 4.8 Hz, IH), 8.49 (d, J = 6.0 Hz, IH), 8.16 (t, J= 9.2 Hz, IH), 7.94 (dd, J= 3.2 and 5.2 Hz, IH), 7.57 (dd, J= 2., and 8.8 Hz, IH), 7.38 (d, J= 2.8 Hz, IH), 7.28 (dd, J= 2.4 and 11.6 Hz, IH), 7.14 (dd, J= 2.8 and 5.6 Hz, IH), 7.03 (m, IH), 6.37 (s, IH), 2.76 (d, J= 4.8 Hz, 3H), 1.23 (d, J= 6.8 Hz, 6H); MS (ESI) m/z: 530.2 (M+H+).
Example 47: To a suspension of 5-amino-2-fluorobenzonitrile (1.00 g, 7.38 mmol) in cone HCl (15 mL) at 0 0C was added a solution Of NaNO2 (0.64 g, 9.28 mmol) in water (15 mL) slowly over 15 min. The resultant mixture was stirred for 90 min at 0 0C. A solution comprised of SnCl2.2H2O (3.37 g, 14.9 mmol), cone HCl (5 mL) and water (5 mL) was added drop wise over 20 min. The mixture was stirred for 2 h at 0 0C, and was extracted with EtOAc (4 x 25 mL). The aqueous portion was cooled with an ice bath and cautiously treated with 70 mL of 3 M NaOH (70 mL) to a final pH of 5. The aqueous was extracted with EtOAc (2 x 50 mL). All organics were combined and concentrated in vacuo to afford a brown oil (2.58 g), which was combined with pivaloylacetonitrile (1.00 g, 8.0 mmol) in isopropanol (15 mL). The resultant solution was heated to reflux for 28 h. The reaction mixture was concentrated in vacuo, diluted with EtOAc (30 mL) and washed with water (20 mL), satd aq NaHCO3 (20 mL), water (20 mL) and brine (20 mL). The aqueous was further extracted with EtOAc (2 x 20 mL). The combined organics were dried (MgSO4), concentrated in vacuo and purified by chromatography on silica gel to provide 5-(5-amino-3-tert-butyl~lH-pyrazol-l-yl)-2-fluorobeii2θiutrile (1.24 g, 65% yield). 1H NMR (400 MHz, OMSO-d6) δ 8.05 (m, 1 H), 7.97 (m, 1 H), 7.61 (t, J - 9.0 Hz, 1 H), 5.43 (s, 1 H), 5.42 (s, 2 H); MS (ESI) m/z: 259.3 (M+H+).
A solution 5-(5-amino-3-tert-butyl-lH-pyrazol-l-yl)-2-fluorobenzonitrile (86 mg, 0.33 mmol) and acetone oxime (37 mg, 0.50 mmol) in DMAc (1 mL) was treated with potassium tert-butoxide (56 mg, 0.50 mmol). The reaction mixture was stirred 45 min at RT. The mixture was diluted with EtOAc (30 mL), washed with water (10 mL) and brine (2 x 10 mL), dried (Na2SO4), concentrated in vacuo and purified via silica gel chromatography to provide propan-2-one O-2-cyano-4-(5-amino-3-tert-butyl-lH-pyra2:ol- l-yl)phenyl oxime (47 mg, 45% yield). 1H NMR (400 MHz, Acetone-Jή) δ 7.93-7.89 (m, 2 H), 7.63 (dd, J = 8.8, 0.8 Hz, 1 H), 5.52 (s, 1 H), 4.87 (s, 2 H), 2.17 (s, 3 H), 2.08 )s, 3 H), 1.26 (s, 9 H); MS (ESI) m/z: 312.3 (M+H+). A solution of propan-2-one 0-2-cyano-4-(5-amino-3-tert-butyI-lH-pyrazol-l- yl)phenyl oxime (47 mg, 0.15 mmol) in ethyl acetate (5 mL) was treated with 2 M aq Na2CO3 (0.67 mL) and isopropenyl chloroformate (0.050 mL, 0.46 mmol). The reaction was stirred at RT. After 2 h, additional isopropenyl chloroformate (0.1 mL, 0.92 mmol) was added. Afterl h, additional isopropenyl chloroformate (0.1 mL, 0.92 mmol) and 2 M aq Na2CO3 (0.5 mL, 1 mmol) were added. After another hour, the reaction was diluted with EtOAc (10 mL), washed with water (10 mL) and brine (10 mL), dried (MgSO4) and concentrated in vacuo to provide the isopropenyl carbamate of propan-2-one O-2-cyano- 4-(5-amino-3-tert-butyl-lH-pyrazol-l-yl)phenyl oxime (62 mg, 58 % yield) that was used without further purification. MS (ESI) m/z: 396.2 (M+H+).
The isopropenyl carbamate from the previous step (60 mg, 0.15 mmol), Example A2 (40 mg, 0.15 mmol) and N-methylpyrrolidine (1 mg, 0.015 mmol) were combined in
THF (1 mL) and heated to 55 °C overnight. The reaction was concentrated and chromatographed to provide the corresponding urea (97 mg, > 100% yield) as a dark foam. MS (ESI) m/z: 599.2 (M+H+).
The above urea was dissolved in ethanol and treated with 3 M aq HCl (0.5 mL). After 24 h, another 0.5 mL of 3 M aq HCL was added and the stirring was continued for 3 days. The reaction mixture was partitioned aqueous 2 M Na2CO3 and EtOAc. The organic layer was washed with sat aq NaHCO3, water, and brine, dried (Na2SO4), concentrated in vacuo and purified by silica gel chromatography and recrystallization from acetone to provide l-(l-(3-aminobenzo[d]isoxazol-5-yl)-3-tert-butyl-lH-pyrazol-5- yl)-3-(2-fluoro-4-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea (33 mg, 39 % yield over 2 steps). 1H NMR (400 MHz, DMSO-d6) δ 8.93 (d, J = 2.2 Hz, 1 H), 8.86 (s, 1 H), 7.77 (q, J = 4.8 Hz, 1 H), 8.50 (d, J = 5.4 Hz, 1 H), 8.20 (t, J = 9.3 Hz, 1 H), 7.99 (d, J = 1.2 Hz, 1 H), 7.64-7.59 (m, 2 H), 7.37 (d, J - 2.4 Hz, 1 H), 7.29 (dd, J = 11.9, 2.6 Hz, 1 H), 7.15 (dd, J - 5.6, 2.6 Hz, 1 H), 7.03 (m, 1 H), 6.55 (s, 2 H), 6.41 (s, 1 H), 2.77 (d, J = 4.7 Hz, 3 H), 1.27 (s, 9 H); MS (ESI) rn/z: 559.2 (M+H+).
Example 48: Using a procedure analogous to Example 1, Example B9 (0.175 g, 0.41 mmol) and Example A42 (0.097 g, 0.389 mmol) were combined to afford 1 -(2-fluoro~5- (6-nitropyridin-3-yloxy)phenyl)~3-(3-isopropyl- 1 -(quinolin-6-yl)- 1 H-pyrazol-5-yl)urea (0.129g, 63% yield) as a light yellow oil. 1H NMR (400 MHz, DMSO»d6) δ 8.94 (dd, J = 4.4, 2.0 Hz, IH), 8.48 (d, J= 8.4 Hz, IH), 8.31 (d, J- 8.8 Hz, IH), 8.26 (d, J= 2.8 Hz, IH), 8.20 (d, J - 8.8 Hz, IH), 8.11 (d, J= 2.4 Hz, IH), 8.00 (m, IH), 7.91 (dd, J = 9.2, 2.4 Hz, IH), 7.63 (m, IH), 7.58 (dd, J = 8.8, 2.8 Hz, IH), 7.22 (m, IH), 6.84 (m, IH), 6.46 (s, IH), 2.98 (m, IH), 1.30 (d,J= 7.2 Hz, 6H); MS (ESI) m/z: 528.3 (M+H+). 1 -(2~fluoro-5-(6-nitropyridin-3-yloxy)phenyl)-3-(3-isopropyl-l -(quinolin-6-yl)- lH-pyrazol-5-yl)urea (0.129 g, 0.245 mmol) was dissolved in MeOH (2.0 mL), to which NH4Cl (0.131 g, 2.45 mmol) and zinc power (0.16Og, 2.45 mmol) were added and the reaction mixture was stirred at RT for 4 h. The reaction mixture was filtered through Celite and washed with methanol (30 mL) and EtOAc (50 mL). The filtrate was concentrated in vacuum, partitioned between EtOAc (30 mL) and water (20 mL). The separated organic phase was washed with brine (10 mL), dried (MgSO4) and concentrated to afford l-(5-(6~aminopyridin-3-yloxy)-2-fluoroρhenyl)-3-(3-isoρropyl-l- (quinolin-6-yl)-lH-pyrazol-5-yl)urea (0.0495 g, 41% yield) as a white foam. MS (ESI) m/z: 498.2 (M+H+). l-(5-(6-aminopyridin-3-yloxy)-2-fluorophenyl)-3-(3-isopropyl-l-(quinolin-6-yl)- lH-pyrazol-5-yl)urea (0.0495 g, 0.099 mmol) was dissolved in DCM (1.0 mL), to which pyridine (0.49 mL, 6.0 mmol) and acetic anhydride (0.066 mL, 0.65 mmol) were added. The reaction mixture was stirred at RT for 12 h. The completed reaction was quenched with 2M NaHCO3 (12 mL) and extracted with EtOAc (25 mL). The organic layer was washed with H2O (15 mL) and brine (10 mL), dried (MgSO4), concentrated in vacuo and purified by chromatography to afford l-(5-(6-acetamidopyridin-3-yIoxy)-2- fluorophenyl)-3-(3-isoproρyl-l-(qxiinolin-6-yl)-lH-pyrazol-5-yl)urea (0.0234 g, 44% yield) as a yellow foam. It was converted to corresponding mesylate salt by reacting with MsOH (1.0 eq.). 1H NMR (400 MHz, DMSO-d6) 5 10.54 (s, IH), 9.09 (s, IH), 9.07-9.04 (m, 2H), 8.65 (d, J= 8.0 Hz, IH), 8.25 (d, J= 2.0 Hz, IH), 8.21 (d, J= 8.8 Hz, IH), 8.11- 8.07 (m, 2H), 8.02 (dd, J - 8.8, 2.4 Hz, IH), 7.85 (m, IH), 7.75 (m, IH), 4.48 (dd, J = 8.8, 3.2 Hz, IH), 7.24 (m, IH), 6.67 (m, IH), 6.40 (s, IH), 2.92 (m, IH), 2.31 (s, 3H), 2.08 (s, 3H), 1.24 (d, J= 7.2 Hz, 6H); MS (ESI) m/z: 540.0 (M+H+).
Example 49: Using a procedure analogous to Example 1, Example B24 (150 mg, 0.26 mmol) and Example A28 (74 mg, 0.26 mmol) in presence of DIEA (90 μL, 0.52 mmol) were combined to afford benzyl 6-(3-tert-butyl-5-(3-(2-fluoro-4-(2-(l -methyl- IH- pyrazol-4-yl)pyridin-4-yloxy)phenyl)ureido)- 1 H-pyrazol- 1 -yl)-3 ,4-dihydroisoquinoline-
2(lH)-carbσxylate (100 mg, 56% yield).
To a solution of benzyl 6-(3-tert-butyl-5-(3-(2-fluoro-4-(2-(l-metliyl-lH-pyrazol- 4-yl)pyridin-4-yloxy)phenyl)ureido)- 1 H-pyrazol- 1 -yI)-3 ,4-dihydroisoquinoIine-2( 1 H)- carboxylate (100 mg, 0.14 mmol) in methanol/EtOAc (1 :1, 10 mL) was added 10% Pd/C. The solution was stirred overnight under H2 (1 atm) at RT. The solution was filtered and concentrated in vacuo to obtain l-(3-tert-butyl-l-(l, 2,3,4- tetrahydroisoquinolm-6-yl)- 1 H-pyrazol-5-yl)-3-(2-fluoro-4-(2-(l -methyl- 1 H-pyrazol-4- yl)pyridin-4-yloxy)phenyl)urea (73 mg, 90% yield) 1H NMR (400 MHz, DMSO-^6) δ 9.00 (brs, IH), 8.02 (m, IH), 8.35 (d, J= 5.6 Hz, IH), 8.25 (s, IH), 8.15 (dt, J= 2.4, and 8.8, IH), 7.95 (s, IH), 7.1 - 7.3 (m, 3H), 7.99 (m, IH), 6.65 (m, IH), 6.36 (d, J- 2.8 Hz, IH), 3.95 (m, IH), 3.84 (s, 3H), 3.53 (m, IH), 3.01 (m, IH), 2.88 (m, IH), 2.79 (m, IH), 2.60 (m, IH), 1.25 (s, 9H); MS (ESI) m/z: 581.3 (M+H+).
Example 50: Using a procedure analogous to Example 1, Example B29 (0.20 g, 0.43 mmol) and Example A27 (118 mg, 0.43mmol) were combined to afford 1-(4-(2-(1H- pyrazol-4-yl)pyridin-4-yloxy)-2-fluorophenyl)-3-(3-tert-butyl-l -(I -oxo-1 ,2,3,4- tetrahydroisoquinolin-7-yl)-lH-pyrazol~5-yl)urea (123 mg, 47% yield). 1H NMR (400 MHz, DMSO-4) δ 8.88 (brs, IH), 8.83 (s, IH), 8.33 (d, J= 5.6 Hz, IH), 8.10 (d, J= 8.8 Hz, IH), 8.07 (m, 2H), 7.85 (d, J= 2.0 Hz, IH), 7.57 (dd, J= 2.4, and 8.0 Hz, IH), 7.42 (d, J - 8.0 Hz, IH), 7.31 (brs, IH), 7.18 (dd, J = 2.4, and 12.0 Hz, IH), 6.95 (m, IH), 6.65 (m, IH), 6.33 (s, IH), 3.35 (m, 2H), 2.91 (m, 2H), 1.22 (s, 9H); MS (ESI) m/z: 581.3 (M+H+).
Example 51: Using a procedure analogous to Example 1, Example B30 (0.20 g, 0.37 rnmol) and Example A27 (100 mg, 0.37 mmol) were combined to afford tert-butyl 7-(5- (3~(4-(2-(lH-pyrazol-4-yl)pyridin-4-yloxy)-2-fluorophenyl)ureido)-3-tert-butyl-lH- pvrazol-1-yI)-3,4-dihydroisoqumoline-2(lH)-carboxylate (130 mg, 53% yield) which was treated with 4.0 M HCl/dioxane (2 mL) and it was stirred at RT for 4 hours. The solid was filtered, washed with ethyl acetate, and dried under vacuum to obtain 1-(4-(2-(1H- pyrazol~4-yl)pyridin-4-yloxy)-2-fluorophenyl)-3 -(3 -tert-butyl- 1-( 1,2, 3 ,4- tetrahydroisoquinolin-7-yl)-lH-pyrazol-5-yl)urea HCl salt (120 mg, 96% yield). 1H NMR (400 MHz, DMSCW6) δ 9.51 (brs, 2H), 9.27 (brs, IH), 9.21 (brs, IH), 8.69 (brs, 2H), 8.54 (d, J = 7.2 Hz, IH), 8.22 (t, J = 9.2 Hz, IH), 7.84 (m, IH), 7.3-7.5 (m, 4H), 7.13 (m IH), 7.10 (dd, J= 2.4, and 6.4 Hz, IH), 6.37 (s, IH), 4.38 (m, 2H), 3.38 (m, 2H), 3.05 (m, 2H), 1.28 (s, 9H); MS (ESI) m/z: 567.3 (M+H). Example 52: Using a procedure analogous to Example 1, Example A36 (110 mg, 0.363 mmol) and Example BlO (150 ing, 0.363 mmol) were combined and purified by chromatography (Si-25 column, methanol/ethyl acetate) to give l-(2,3-difluoro-4-(2-(l- methyl-lH-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-3-(3-ethyl-l-(quinoIin-6-yl)-lH- pyrazol-5-yl)urea as a white foam (66 mg, 32% yield). 1H NMR (400 MHz, dimethylsulfoxide-J6) δ 1.27 (t, 3 H), 2.65 (q, 2 H), 3.89 (s, 3 H), 6.46 (s, 1 H), 6.74-6.76 (m, 1 H), 7.22 (t, 1 H), 7.29 (s, 1 H), 7.65-7.68 (s, 1 H), 7.97-8.02 (m, 3 H), 8.20-8.22 (m, 2 H), 8.31 (s, 1 H), 8.40-8.42 (m, 1 H), 8.50-8.53 (m, 1 H), 9.00-9.01 (m, 1 H), 9.11 (s, 1 H), 9.19 (s, 1 H); MS (ESI) m/z: 567.0 (M+H+).
Example 53: Using a procedure analogous to Example 1, Example A38 (108 mg, 0.363 mmol) and Example BlO (150 mg, 0.363 mmol) were combined and purified by chromatography (Si-25 column, methanol/ethyl acetate) to give l-(3-ethyl-l-(quinolin-6- yl)-lH-pyra2ol-5-yl)-3-(2-fluoro-3-meihyl-4-(2-(l-methyl4H-pyrazol-4-yl)pyridin-4- yloxy)phenyl)urea as a white foam (78 mg, 38% yield). 1H NMR (400 MHz, dimetliylsulfoxide-J6) δ 1.29 (t, 3 H), 2.09 (s, 3 H), 2.67 (q, 2 H), 3.91 (s, 3 H), 6.47 (s, 1 H), 6.59-6.61 (m, 1 H), 7.00-7.02 (m, 1 H), 7.22 (s, 1 H), 7.67-7.70 (m, 1 H), 7.99-8.10 (m, 3 H), 8.22-8.24 (m, 2 H), 8.30 (s, 1 H), 8.39 (d, 1 H), 8.53-8.55 (m, 1 H), 9.00-9.03 (m, 2 H), 9.10 (s, 1 H); MS (ESI) m/z: 563.3 (M+H÷).
Example 54: Using a procedure analogous to Example 1, Example B3 (0.10 g, 0.23 mmol) and Example A32 (56 mg, 0.23 mmol) in the presence of DIEA (68 μL) were combined to afford l-(3-tert-butyl-l-(quinolin-6-yl)-lH-pyrazol~5-yl)-3~(3-(5- chloropyridin-3-yloxy)-5-cyanophenyl)urea (39 mg, 32% yield). 1H NMR (400 MHz, DMSO-CZ6) δ 9.47 (s, IH), 8.98 (dd, J= 2.0 and 4.4 Hz, IH), 8.82 (s, IH), 8.53 (d, J = 2.0 Hz, IH), 8.49 (m, IH), 8.45 (d, J= 2.4 Hz, IH), 8.17 (m, 2H), 7.97 (dd, J= 2.8 and 9.2 Hz, IH), 7.84 (t, J= 2.0 Hz, IH), 7.70 (t, J= 1.6 Hz, IH), 7.65 (dd, J= 4.0 and 8.0 Hz, IH), 7.45 (t, J = 2.0 Hz, IH), 7.31 (m, IH), 6.48 (s, IH), 2.50 (s, 3H), 1.34 (s, 9H); MS (ESI) m/z: 538.0 (M+H+). Example 55: Using a procedure analogous to Example 1, Example B3 (0.10 g, 0.23 mmol) and Example A33 (51 mg, 0.23 mmol) in presence of DIEA (68 μL) were combined to afford l-(3-tert-butyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)-3-(3-cyano-5-(6- methylpyridin-3-yloxy)phenyl)urea (31 mg, 27% yield). 1H NMR (400 MHz, DMSO-J6) δ 9.43 (s, IH), 8.98 (dd, J= 2.0 and 4.4 Hz, IH), 8.74 (s, IH), 8.48 (m, IH), 8.33 (d, J= 2.8 Hz, IH), 8.16 (m, 2H), 7.96 (dd, J= 2.8 and 9.2 Hz, IH), 7.63 (m, 2H), 7.50 (dd, J =
2.8 and 8.0 Hz, IH), 7.34 (d, J= 8.4 Hz, IH), 7.29 (t, J= 2.0 Hz, IH), 7.17 (ra, IH), 6.46 (s, IH), 2.50 (s, 3H), 1.33 (s, 9H); MS (ESI) m/z: 518.0 (M+H*).
Example 56: Using a procedure analogous to Example 1, Example A41 (15 mg, 0.055 mrnol) and Example B9 (24 mg, 0.056 mmol) were combined to provide 1-(5-(4-(1H- pyrazol-4-yl)pyrimidin-2-yloxy)-2-fluorophenyl)-3-(3-isopropyl- 1 -(quinolin-6-yl)-l H- pyrazol-5-yl)urea (9 mg, 29% yield) 1H NMR (400 MHz, DMSO-^6) δ 13.36 (s, 1 H),
9.09 (s, 1 H), 9.07 (s, 1 H), 8.95 (m, 1 H), 8.50-8.45 (m, 2 H), 8.17-8.12 (m, 2 H), 8.01 (dd, J = 6.8, 2.9 Hz, 1 H), 7.92 (dd, J = 9.0, 2.1 Hz5 1 H), 7.61 (dd, J = 8.2, 4.1 Hz, 1 H),
7.51 (d, J = 5.0 Hz, 1 H), 7.27 (dd, J = 11.0, 8.9 Hz, 1 H), 6.85 (m, 1 H), 6.40 (s, 1 H), 2.89 (m, 1 H), 1.22 (d, J= 6.8 Hz, 6H); MS (ESI) m/z: 550.2 (M+H+).
The following examples were prepared by the methods described in Schemes 1-17, General Method A, the above Examples and the methods described in WO 2006/071940, filed December 23, 2005, incorporated by reference :1 -(3 -tert~butyl-l-( 1,2, 3,4- tetrahydroisoquinolin-6-yl)-lH-pyrazol-5-yl)-3-(3-fluoro-4-(2-
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea, 1 -(3-tert-butyl- 1 -(2-
(methylamino)quinolin-ό-yl)- 1 H-pyrazol-5-yl)-3-(2-fluoro-4-(2- (methylcarbamoyl)ρyridin-4-yloxy)phenyl)urea, l-(l-(4-(2~amino-2- oxoethyl)naphthalen-2-yl)-3-tert-butyl-lH-pyrazol-5-yl)-3-(2-chloro-5-(5-fluoropyridin-
3 -yloxy)phenyl)urea, 1 -(3-tert-butyl- 1 -(quinolin-6-yl)- 1 H-pyrazol-5-yl)-3 -(2-fluoro-5-
(pyridin-3-yloxy)phenyl)urea, l-(3-tert-butyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)-3-(2,4- difluoro-5-(pyridin-3-yloxy)phenyl)urea, 1 -(3-tert-butyl- 1-( 1,2,3 ,4-tetrahydroisoquinolin- 6-yl)-lH-pyrazol-5-yl)-3-(2,4-difluoro-5-(pyridin-3-yloxy)phenyl)urea, 1 -(3-tert-butyl-l -
( 1 H-indazol-5-yl)- 1 H-pyrazol-5-yl)-3-(2-fIuoro-5-(pyridin-3-yloxy)phenyl)urea, 1 -(5- tert-butyl- 1 -(quinolin-ό-yl)-l H-pyrazol-3-yl)-3-(2-fluoro-4-(2-(methylcarbarnoyl)pyridin- 4-yloxy)phenyl)urea, l~(3-tert-butyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)-3-(2-fluoro-4-(2- (2-hydroxyethylamino)pyridin-4-yloxy)phenyl)urea, 1 -(3 -tert-butyl- 1 -(quinolin-6-yl) - 1 H- pyra2ol-5-yl)-3-(4-chloro-5-(6-cyanopyridin-3-yloxy)-2-fluorophenyl)urea, l-(2-fluoro- 4-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)-3-(l-(quinolin-6-yl)-3-(trifluoromethyl)- 1 H-pyrazol-5-yl)urea, 1 -(3-cyclopentyl- 1 -(quinolin-6-yl)- 1 H-pyrazol-5-yl)-3-(2-fluoro-4- (2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea, 1 -(3-cyclobutyl- 1 -(quinolin-6-yl)- 1 H- pyrazol~5-yl)-3-(2-fluoro-4-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea, l-(3-tert- butyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)-3-(5-(6-cyanopyridin-3-yloxy)-2- fluorophenyl)urea, 1 -(3-tert-butyl-l -(quinolin-6-yl)- 1 H-pyrazol-5-yl)-3-(3~fluoro-4-(2- (methylamino)pyridin-4-yloxy)phenyl)urea, 1 -(3-tert-butyl-l -(1 ,2,3,4- tetrahydroisoqumolhi-ό-yl)- 1 H-pyrazol-5-yl)-3-(4-raethyl-3-(pyridin-3- yloxy)phenyl)urea, 1 -(2-fluoro-5-(6-methylpyridin-3-yloxy)phenyl)-3-(3-isopropyl- 1 - (quinolin-6-yl)- 1 H-pyrazol-5-yl)urea, 1 -(3-ethyl- 1 -(quinolin-6-yl)- 1 H-pyrazoI-5-yl)-3-(2- fluoro-4-(2-(methylamino)pyridin-4-yIoxy)phenyl)urea, 1 -(3-tert-butyl- 1 -( 1 H-indazol-5- yl)- 1 H-pyrazol-5-yl)-3-(2-fluoro-5-(2-(methylamino)pyrimidin-4-yloxy)phenyl)urea, 1 - (4-(2-carbamoylpyridin-4-yloxy)-2-fluorophenyl)-3-(4-chloro-2-(quinolin-6- yl)phenyl)urea, l-(l-(lH-indazol-5-yl)-3-isopropyl-lH-pyrazol-5~yl)-3-(4-(2- carbamoylpyridin-4-yloxy)-2-fluorophenyl)urea, 1 -(3-tert-butyl-l -(2-methylquinolin-6- yl)-lH-pyrazol-5-yl)-3-(4-(2-carbamoylpyridin-4-yloxy)-2-fluorophenyl)urea, l-(4-(2- carbamoylpyridin-4-yloxy)-3-methylphenyl)-3-(3-isopropyl- 1 -(quinolin-6-yl)- 1 H- pyrazol-5-yl)urea, l-(2-fluoro-4-(2-(metliylcarbaπioyl)pyridin-4-yloxy)phenyl)-3-(3- isopropyl-1 -(2-methyIquinolin-6-yl)- 1 H-pyrazol-5-yl)urea, 1 -(3-isopropyl- 1 -(quinolin-6- yl)- 1 H-pyrazol-5 -yl)-3 -(3 -methyl-4-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea, 1 -(4-(2-carbamoylpyridin-4-yloxy)-2-fluorophenyl)-3-(3-isopropyl~l -(2-niethylquinolin- 6-yl)-lH-pyrazol-5-yl)urea, l-(4-(2-(dirnethylamino)pyridin-4-yloxy)-2-fluorophenyl)-3- (3-isopropyl- 1 -(quinolin~6~yl)- 1 H-pyrazol-5-yl)urea, 1 -(3-isopropyl- 1 -(quinolin-6-yl)- 1 H-pyrazol-5-yl)-3-(3-methyl-4-(2-(methylamino)pyridin-4-yloxy)phenyl)urea, 1 -(3-tert- butyl-l -(quinolin-6-yl)- 1 H-pyrazol-5-yl)-3 -(4-(2-carbamoylpyridin-4-yloxy)-3 - methylphenyl)urea, 1 -(5-(2-aminopyriraidin-4-yloxy)-2-fluorophenyl)-3-(3-isopropyl-l- (2-methylquinolin-6-yl)-lH-pyrazol-5-yl)urea, l-(2-fluoro-4-(2-(methylamino)pyrimidin- 4-yloxy)phenyI)-3-(3-isoρropyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)urea, l-(2-fluoro-5-(6- (methylcarbamoyl)pyridin-3-yloxy)phenyl)-3-(3-isopropyl- 1 -(quinolin-6-yl)- 1 H-pyrazol- 5-yl)urea, 1 ~(3-isopropyl-l -(quinolin~6-yl)-l H-pyrazol-5-yI)-3-(2-methyl-4-(2-
(niethylcarbamoyl)ρyridin-4-yloxy)phenyl)urea, 1 -(3-tert-butyl- 1 -(2-methylquinolin-6- yl)-l H-pyrazol-5-yl)-3-(2-fluoro-4-(2-(methylamino)pyridin-4~yloxy)phenyI)urea, 1 -(4- (2-( 1 H~pyrazol-4-yl)pyridin-4-yloxy)-2-fluorophenyl)-3 -(3-methyl- 1 -(quinolin-6-yl)- 1 H- pyrazol-5-yl)urea, l-(2-fluoro-4-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)-3-(3- isopropyl- 1 -(quinoxalin-6-yl)- 1 H-pyrazol-5-yl)urea, 1 -(4-(2-carbamoylpyridin-4-yloxy)- 2-fluorophenyl)-3-(3-isopropyl- 1 -(quinoxalin-6-yl)- lH-pyrazol-5-yl)urea, 1 -( 1 - (benzo[d]oxazol-5-yl)-3-tert-butyl-l H-pyrazol-5-yl)-3-(2-fluoro-4-(2-
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea, 1 -(4-(2-( 1 H-pyra2;ol-4-yl)pyridin-4- yloxy)-3-methylphenyl)-3-(3-isopropyl-l-(quinolin-6-yl)-l H-pyrazol-5-yl)urea, 1 -(4-(2- (1 H-pyrazol-4-yl)pyridin-4-yloxy)-2-fluorophenyl)-3-(3-tert-butyl- 1 -(1 ,2,3,4- tetrahydroisoquinolin-6-yl)-l H-pyrazol-5-yl)urea, 1 -(3-fluoro-4-(2- (isopropylamino)pyridin-4-yloxy)phenyl)-3-(3-isopropyl-l -(quinolin-6-yl)- lH-pyrazol-5- yl)urea, 1 -(3 -isopropyl-1 -(quinolin-6-yl)- lH-pyrazol-5 -yl)-3-(4-(2-
(isopropylamino)pyridin-4-yloxy)-3-methylphenyl)urea, 1 -(4-(2-
(cyclopentylamino)pyridin-4-yloxy)-2-fluorophenyl)-3 -(3-isopropyl- 1 -(quinolin-6-yl)- 1 H-pyrazol-5-yl)urea and 1 -(2-fluoro-4-(2-( 1 -methyl- 1 H-pyrazol-4-yl)pyridin-4- yloxy)phenyl)-3-(3-rnethyl- 1 -(quinolin-6-yl )-l H-pyrazol-5-yl)urea.
The following examples are prepared by the methods described in Schemes 1-17, General Method A, the above Examples and the methods described in WO 2006/071940, filed December 23, 2005, incorporated by reference; 1 -(3-tert-butyl- 1-( 1,2, 3,4- tetrahydroisoquinolin-6-yl)-lH-pyrazol-5-yl)-3-(4-methyl-3-(4-(pyridin-3-yl)pyrimidin- 2-yloxy)phenyl)urea, l-(5-(4-(lH-pyrazol-4--yl)pyrimidin-2~yloxy)-2-fluorophenyl)~3-(3- isopropyl- 1 -(quinolin-6-yl)- 1 H-pyrazol- 5 -yl)urea, 1 -(2-fluoro-4-methyl-5-(4-( 1 -methyl- lH-pyrazol-4-yl)pyrimidin-2-yloxy)phenyl)-3-(3-isopropyl-l-(quinolin-6-yl)-lH- pyrazol-5-yl)urea, 1 -(2-fluoro-5-(4-(ϊ -methyl- 1 H-pyrazol-4-yl)pyrimidin-2- yloxy)phenyl)-3-(3-isopropyl- 1 -(quinolin-6-yl )- 1 H-pyrazol-5-yl)urea, 1 -(2-fluoro-4-(2- ( 1 -methyl- 1 H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-3 -(I -isopropyl-3 -(quinolin-6-yl)- IH- pyrazol-4-yl)urea, 1 -(2-fluoro-4-(2-( 1 -methyl- 1 H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)- 3-(l-isopropyl-4-(quinolin-6-yl)-lH-pyrrol-3-yl)urea, l-(2-fluoro-4-(2-(l -methyl- IH- pyrazol-4-yl)pyridin-4-yloxy)phenyl)-3 -(I -isopropyl-5-methyl-3 -(quinolin-6-yl)- IH- pyrazol-4-yl)urea, 1 -(2-fluoro-4-(2-( 1 -methyl- 1 H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)- 3~(2-isopropyl-5-(quinolin-6-yl)oxazol-4-yl)urea, l-(2-fluoro-4-(2-(l -methyl- lH-pyrazol- 4-yl)pyridin-4-yloxy)phenyl)-3-(2-isopropyl-5-(quinolin-6-yl)ihiazol-4-yl)urea, l-(2- fluoro-4-(2-( 1 -methyl- 1 H-pyrazol-4-yl)pyridin-4-yloxy)ρhenyl)-3-(5-isopropyl-2- (qumolin-6-yl)furan-3-yl)urea, l-(2-fluoro-4-(2-(l -methyl- lH-pyrazol-4-yl)pyridin-4- yloxy)phenyl)-3-(5-isopropyl-2-(quinolin-6-yl)ttøophen-3-yl)urea, l-(2-fluoro-4-(2-(l- methyl- 1 H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-3 -(4-isopropyl- 1 -(quinolin-6-yl)- IH- imidazol-2-yl)urea, 1 -(2-fhioro-4-(2-( 1 -methyl- 1 H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)- 3-(5-isopropyl-2-(quinolin-6-yl)- 1 H-pyrτol"3-yl)urea, 1 -(2-fluoro-4-(2-( 1 -methyl- 1 H- pyrazol-4-yl)pyridin-4-yloxy)phenyl)-3-(4-isoproρyl- 1 -(quinolin-6~yl)- 1 H-pyrrol-2- yl)urea, l-(2-fluoro-4-(2-(l-methyl-lH-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-3-(5- methyl-2-(quinolin-6-yl)pyridin-3~yl)urea, 1 -(2-fluoro-4-(2-(l -methyl- 1 H-pyrazol-4- yl)pyridin-4-yloxy)phenyl)-3-(l-isopropyl-3-(l,2,3,4-tetrahydroisoquinolin-6-yl)-lH- pyrazol~4-yl)urea, l-(2-fluoro-4-(2 -(I -methyl- 1 H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)- 3-(l-isopropyl-4-(l ,2,3,4-tetrahydroisoquinolin-6-yl)-lH-pyrrol-3-yI)urea, l-(2-fluoro-4- (2-(l -methyl-1 H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)--3-(2-isopropyl-5-(l ,2,3,4- tetrahydroisoquinolin-6-yl)oxazol-4-yl)urea, l-(2-fluoro-4-(2-(l -methyl- 1 H-pyrazol-4- yl)pyridin-4-yloxy)phenyl)-3-(2-isopropyl-5-(l,2,3,4-tetraliydroisoquinolin-6-yl)thiazol- 4-yl)urea, l-(2-fluoro-4-(2-(l-methyl-lH-pyrazol-4-yl)pyridin-4-yloxy)phenyl)~3-(5- isopropyl-2-(l,2,3,4-te-rahydroisoquinolin-6-yI)fiiran-3-yl)urea, l-(2-fluoro-4-(2-(l- methyl-lH-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-3-(5-isopropyl-2-(l,2,3,4- tetrahydroisoquinolin-6-yl)thiopheri-3 -yl)urea, 1 -(2-fluoro-4-(2-( 1 -methyl- 1 H-pyrazoI-4- yl)pyridin-4-yloxy)phenyl)-3 -(4-i sopropyl- 1 -( 1 ,2 ,3 ,4-tetrahydroisoquinolin-6-yl)- IH- imidazol-2-yl)urea, 1 -(2-fluoro-4-(2-( 1 -methyl- 1 H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)- 3-(5-isopropyl-2-(l,2,3,4-tetrahydroisoquinolin-6-yl)-lH-pyrrol-3-yl)urea, l-(2-fluoro-4- (2-( 1 -methyl- 1 H-pyrazol-4-yl)pyridm-4-yloxy)phenyl)-3-(4-isopropyl- 1 -( 1 ,2 ,3 ,4- tetraliydroisoquinolin-6-yl)- 1 H-pyrrol-2-yl)urea, 1 -(2-fluoro-4-(2-( 1 -methyl- 1 H-pyrazol- 4-yl)pyridin-4-yloxy)phenyl)-3-(5-methyl-2-(l,2,3,4-tetrahydroisoquinolin-6-yl)pyridin- 3-yI)urea, 4-(3-fluoro-4-(3-(l-isopropyl-3-(quinolin-6-yl)-lH-pyrazol-4- yl)ureido)phenoxy)-N-methylpicolinamide, 4-(3-fluoro-4-(3-(l-isopropyl-4-(quinolin-6- yl)-lH-pyrrol-3-yl)ureido)phenoxy)-N-methylpicoHnamide, 4-(3-fluoro-4-(3-{2- isopropyl-5-(quinolin-6-yl)oxazol-4-yl)ureido)phenoxy)-N-methylpicolinamide, 4-(3- fluoro-4-(3-(2-isopropyl-5-(quinoIin-6-yl)thiazol-4-yl)ureido)phenoxy)-N- methylpicolinamide, 4-(3-fluoro-4-(3-(5-isopropyl-2-(quinolm-ό-yl)thiophen-3- yl)ureido)phenoxy)-N-methylpicolinamide, 4~(3-fluoro-4-(3-(4-isopropyl-l-(quinolm~6~ yl)-lH-imidazol-2-yl)ureido)phenoxy)-N-meihylρicolinamide, 4-(3-fluoro-4-(3-(5- isopropyl-2-(quinolin-6-yl)-lH-pyrrol-3-yl)ureido)phenoxy)-N-methylpicolinamide, 4- (3-fluoro-4-(3-(4-isopropyl-l~(quinolin-6-yl)-lH-pyrrol-2-yl)ureido)phenoxy)-N- methylpicolinamide, 4-(3-fluoro-4-(3-(5-methyl-2"(quinolm-6-yl)pyridin-3- yl)ureido)phenoxy)-N-methylpicolinamide, 4-(3-fluoro-4-(3-(5-isopropyl-2-(quinolin-6- yl)furan-3-yl)ureido)phenoxy)-N-methylpicolinamide, l-(5-(4-(lH-pyrazol-4- yl)pyrimidin-2-yloxy)-2-fluoro-4-methylphertyl)-3-(3-isopropyl- 1 -(quinolin-6-yl)- 1 H- pyrazol-5-yl)urea, 1 -(2-fluoro-5-(4-(l -methyl- lH-pyrazol-4-yl)pyrimidin-2- yloxy)phenyl)-3-(3-isopropyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)urea, 1-(5-(4-(1H- pyrazol-4-yl)pyrimidin-2-yloxy)-2-fluoro-4-methylphenyl)-3-(l-(benzo[d]oxazol-5-yl)-3- isopropyl- 1 H-pyrazol-5-yl)urea, 1 -(2-fhioro-4-methyI-5-(4-( 1 -methyl- 1 H-pyrazol-4- yl)pyrimidin-2-yloxy)phenyl)-3-(3-isopropyl-l-(quinolin-6-yl)-lH-pyrazol-5-yl)urea, 1- (l-(benzo[d]oxazol-5-yl)-3-isopropyl-lH-pyrazol-5-yl)-3-(2-fluoro-5-(4-(l-methyl-lH- pyrazol-4-yl)pyrimidin-2-yloxy)phenyl)urea, 1 -( 5-(4- ( 1 H-pyrazol»4-yl)pyrimidin-2- yloxy)-2-fluoro-4-metliylphenyI)-3-(l-(imidazo[l,2-a]pyridin-6-yl)-3-isopropyl-lH- pyrazol-5-yl)urea, 1 -(2-fluoro-5 -(4-(I -methyl- 1 H-pyrazol-4-yl)pyrimidin-2- yloxy)phenyl)-3-(l-(imidazo[l,2-a]pyridin-6-yl)-3-isopropyl-lH-pyrazol-5-yl)urea.
Section 3
AbI kinase (SEQ ID NO: 1) assay
Activity of AbI kinase (SEQ ID NO: 1) was determined by following the production of
ADP from the kinase reaction through coupling with the pyruvate kinase/lactate dehydrogenase system (e.g., Schindler, et al. Science (2000) 259, 1938-1942). In this assay, the oxidation of NADH (thus the decrease at A34Omn) was continuously monitored spectrophometrically. The reaction mixture (100 μl) contained AbI kinase (1 nM. AbI from deCode Genetics), peptide substrate (EAIYAAPFAKKK (SEQ ID NO: 3), 0.2 mM), MgCl2 (10 niM), pyruvate kinase (4 units), lactate dehydrogenase (0.7 units), phosphoenol pyruvate (1 mM), and NADH (0.28 mM) in 90 mM Tris buffer containing 0.2 % octyl-glucoside and 3.5 % DMSO, pH 7.5. Test compounds were incubated with AbI (SEQ ID NO: 1) and other reaction reagents at 30 C for 2 h before ATP (500 μM) was added to start the reaction. The absorption at 340 nrn was monitored continuously for 2 hours at 30 0C on Polarstar Optima plate reader (BMG). The reaction rate was calculated using the 1.0 to 2.0 h time frame. Percent inhibition was obtained by comparison of reaction rate with that of a control (i.e. with no test compound). IC50 values were calculated from a series of percent inhibition values determined at a range of inhibitor concentrations using software routines as implemented in the GraphPad Prism software package.
p AbI kinase assay
Activity of pAbl kinase (SEQ ID NO: 1) was determined by following the production of ADP from the kinase reaction through coupling with the pyruvate kinase/lactate dehydrogenase system (e.g., Schindler, et al. Science (2000) 289, 1938-1942). In this assay, the oxidation of NADH (thus the decrease at A340nm) was continuously monitored spectrophometrically. The reaction mixture (100 μl) contained pAbl kinase (2 nM. pAbl from deCode Genetics), peptide substrate (EAIYAAPFAKKK (SEQ ID NO: 3), 0.2 mM), MgCl2 (10 mM), pyruvate kinase (4 units), lactate dehydrogenase (0.7 units), phosphoenol pyruvate (1 mM), and NADH (0.28 mM) in 90 mM Tris buffer containing 0.2 % octyl-glucoside and 3.5 % DMSO, pH 7.5. Test compounds were incubated with pAbl (SEQ ID NO: 1) and other reaction reagents at 30 C for 2 h before ATP (500 μM) was added to start the reaction. The absorption at 340 nm was monitored continuously for 2 hours at 30 0C on Polarstar Optima plate reader (BMG). The reaction rate was calculated using the 1.0 to 2.0 h time frame. Percent inhibition was obtained by comparison of reaction rate with that of a control (i.e. with no test compound). IC50 values were calculated from a series of percent inhibition values determined at a range of inhibitor concentrations using software routines as implemented in the GraphPad Prism software package. pAbl was obtained as a phosphorylated form of the enzyme used in the AbI assay (see above).
Abl(T315I) (SEQ ID NO: 2) kinase assay Activity of Abl(T315I) (SEQ ID NO: 2) kinase was determined by following the production of ADP from the kinase reaction through coupling with the pyruvate kinase/lactate dehydrogenase system (e.g., Schindler, et at. Science (2000) 289, 1938- 1942). In this assay, the oxidation of NADH (thus the decrease at A340Hm) was continuously monitored spectrophometrically. The reaction mixture (100 μl) contained Abl(T315I) kinase (SEQ ID NO: 2) (6 πM. AbI(TSl 51) from decode Genetics), peptide substrate (EAIYAAPF AKKK (SEQ ID NO: 3), 0.2 mM), MgCl2 (10 mM), pyruvate kinase (4 units), lactate dehydrogenase (0.7 units), phosphoenol pyruvate (1 mM), and NADH (0.28 mM) in 90 mM Tris buffer containing 0.2 % octyl-glucoside and 3.5 % DMSO, pH 7.5. Test compounds were incubated with Abl(T315I) and other reaction reagents at 30 C for 2 Ii before ATP (500 μM) was added to start the reaction. The absorption at 340 ran was monitored continuously for 2 hours at 30 0C on Polarstar Optima plate reader (BMG). The reaction rate was calculated using the 1.0 to 2.0 h time frame. Percent inhibition was obtained by comparison of reaction rate with that of a control (i.e. with no test compound). IC50 values were calculated from a series of percent inhibition values determined at a range of inhibitor concentrations using software routines as implemented in the GraphPad Prism software package.
AbI kinase (SEQ ID NO: !)
MSYY-fflHIfflHD YDIPTTENL YFQGAMDPSSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVW KKYΞLTVAWTLKEDTMBVEEFLKEAAVMKEIKHPI^VQLLGVCTREPPFYIITEFMTYGNLLDYLRECN
RQE WAWLL YMATQ I S S AMEYLEKKNFI HRDLAARNCLVGENHL VKVADFGL SRLMTGDTYTAHAGAKF
PIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMΞPYPGIDLSQVYELLEKDYRMERPEGCPEKVYΞL
MRACWQWNPSDRP S FAE IHQ AFETMFQES S I SDEVEKELGKRGT
Abl(T315I) kinase (SEQ ID NO: 2)
MSYYHHHHHHDYDIPTTENLYFQGAMDPΞSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVW
KKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIIIEFMTYGNLLDYLRECN
RQEVMAWLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF PIKWTAPESLAYNKFSIKΞDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYEL
MRACWQWNPSDRPSFAEIHQAFETMRGT CeU Culture
BaF3 cells (parental or transfected with the following: wild type bcr-Abl or bcr- AbI point mutants T315I, E255K, Y253F, M351T) were obtained from Professor Richard Van Etten (New England Medical Center, Boston, MA). Briefly, cells were grown in RPMl 1640 supplemented with 10% characterized fetal bovine serum (HyClone, Logan, UT) at 37 degrees Celsius, 5% CO2, 95% humidity. Cells were allowed to expand until reaching 80% saturation at which point they were subcultured or harvested for assay use.
Cell Proliferation Assay A serial dilution of test compound was dispensed into a 96 well black clear bottom plate (Corning, Corning, NY). For each cell line, three thousand cells were added per well in complete growth medium. Plates were incubated for 72 hours at 37 degrees Celsius, 5% CO2, 95% humidity. At the end of the incubation period Cell Titer Blue (Promega, Madison, WI) was added to each well and an additional 4.5 hour incubation at 37 degrees Celsius, 5% CO2, 95% humidity was performed. Plates were then read on a BMG Fluostar Optima (BMG, Durham, NC) using an excitation of 544 nM and an emission of 612 nM. Data was analyzed using Prism software (Graphpad, San Diego, CA) to calculate IC50's.
Biological Data Summary. Biochemical IC50 values of compounds of Formula Ia.
In general, compounds 1-56 disclosed herein exhibited >50% inhibition activity at 0.1-2 uM concentration against AbI kinase and T315I AbI kinase.
Biological Data Summary. Whole cell IC 50 values of compounds of Formula Ia. In general, compounds 1-56 disclosed herein exhibited >50% inhibition of proliferation at 1-10 uM concentration against BaF/3 cells harboring wt bcr-Abl and or bcr-Abl point mutants including T315I, E255K, Y253F, and M351T. Section 4 - Important Structural Comparisons vs. Biological Activity
WO 2006/071940 A2 describes inhibitors of kinases, including C-AbI kinase, B- Raf kinase, c-MET, VEGF kinase, and the HER family wherein a central phenyl ring is unsubstituted. An example of these inhibitors is shown below, wherein the central phenyl ring is unsubstituted (R 16 and Rl 8 = H). Compounds A, B and C, discussed below, are taken from from WO 2006/071940A2.
Representative Key Structures
Example 1 (R16=2-F, Rl S=H), Example 15 (Rlό=2-F, R18=H) Example 5 (R16=3-Me, R18=H) Compound B (R16=H, R18=H) Compound A (R16=H, R18=H)
Figure imgf000129_0001
It has unexpectedly been found that inhibitors that contain Rl 6 substituents other than H have superior potency as measured by in vitro kinase inhibition and also as measured by in vivo whole cell anti-proliferation potencies in cancer cells. By way of illustration in Table 1, Example 1 of the present invention containing a 2-F moiety as the Rl 6 substituent is 5.5 -times more potent vs. phosphorylated-Abl kinase (p-Abl) than the unsubstituted Compound A containing Rl 6 = H. Example 1 is 6.3 times more potent than Compound A vs. the T315I mutant AbI kinase, a clinical isolate of oncogenic AbI kinase found in patients with chronic myelogenous leukemia and in whom treatment is resistant to currently available therapies including Gleevec® (M. E. Gorre et al, Science
(2001) 293: 876; S. Branford et al, Blood (2002) 99: 3472; N. von Bubnoff et al, Lancet
(2002) 359: 487) and dasatinib (N. P. Shah et al, Science (2004) 305: 399). Example 5 containing a 3-methyl moiety as the Rl 6 substituent is 4 times more potent vs. p-Abl kinase than the unsubstituted (R 16 = H) Compound A. Example 15 containing a 2-F moiety as the Rl 6 substituent is 8 -times more potent vs. unphosphorylated-Abl kinase (u- AbI) than the unsubstituted (Rl 6 = H) Compound B (from WO 2006/071940A2). Example 15 is > 14-times more potent than Compound B vs. p-Abl kinase, and 18 times more potent than Compound B vs. the T315I mutant AbI kinase.
Table 1
Figure imgf000130_0002
Structures of Example 4 (R16=2~F, RlS=H)
Figure imgf000130_0001
This trend is also evident in other analogs related to those mentioned above. As shown in Table 1, the indazolyl-containing compound Example 4 containing a 2-F moiety as the Rl 6 substituent is 2.2 times more potent than the unsubstituted (Rl 6 = H) Compound C vs. u-Abl kinase, 18 times more potent than Compound C vs. p-Abl kinase, and 13 times more potent than Compound C vs. T315I mutant AbI kinase.
This unexpected increase in potency vs. these kinases is also revealed in whole cell assays which measure the effectiveness of these AbI kinase inhibitors to block proliferation of cells containing oncogenic forms of AbI kinase: the fusion protein bcr- AbI kinases (C. L. Sawyers, New England Journal of Medicine (1999) 340: 1330; S. Faderl et al, New England Journal of Medicine (1999) 341: 164; J.B. Konopka et at, Proceeding of the National Academy of Sciences USA (1985) 82: 1810). Table 2 illustrates the increased potency of substituted R16-containing compounds of Examples 1, 5, and 15 vs. their unsubstituted analogs Compounds A and B. The R16-substituted analogs are 2.6-4.5 times more potent than the unsubstituted analogs in BaF3 cells expressing oncogenic bcr-abl kinase, 1.5-3.5 times more potent in BaF3 cells expressing the T315I mutant oncogenic form of bcr-abl kinase, 3.5-7.2 times more potent in BaF3 cells expressing the Y253F mutant oncogenic form of bcr-abl kinase, 4.4-6 times more potent in BaF3 cells expressing the E255K mutant oncogenic form of bcr-abl kinase, and 3.2-4.2 times more potent in BaF3 cells expressing the M351T mutant oncogenic form of bcr-abl kinase. These five forms of bcr-abl kinase are oncogenic and are causative of human chronic myelogenous leukemia. Moreover, the four mutant forms of bcr-abl kinase are resistant to the currently available bcr-abl inhibitor Gleevec ®.
Table 2
Figure imgf000131_0001

Claims

Claims
1. Compounds of the formula Ia
Figure imgf000132_0001
wherein Ql and Q2 are each individually and independently selected from the group consisting of N and C-Z6, provided that both Ql and Q2 are not simultaneously C-Z6;
wherein El is selected from the group consisting of cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, pyrrolidinyl piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl, and wherein the El ring is substituted with one or more Rl 6 moieties and wherein the El ring is substituted with one or more Rl 8 moieties;
wherein A is selected from the group consisting of phenyl, C3-C8carbocyclyl, pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl, pyrazinyl, pyridazinyl, triazinyl, pyridinyl, pyrimidinyl, and G4;
Gl is a heteroaryl taken from the group consisting of pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl, pyrazinyl, pyridazinyl, triazinyl, pyridinyl, and pyrimidinyl;
G2 is a fused bicyclic heteroaryl taken from the group consisting of indolyl, indolinyl, isoindolyl, isoindolinyl, indazolyl, benzofuranyl, benzothienyl, benzothiazolyl, benzothiazolonyl, benzoxazolyl, benzoxazolonyl, benzisoxazolyl, benzisothiazolyl, benzimidazolyl, benzimidazolonyl, benztriazolyl, imidazopyridinyl, pyrazolopyridinyl, imidazolonopyridinyl, thiazolopyridinyl, thiazolonopyridinyl, oxazolopyridinyl, oxazolonopyridinyl, isoxazolopyridinyl, isothiazolopyridinyl, triazolopyridinyl, imidazopyrimidinyl, pyrazolopyrimidinyl, imidazolonopyrimidinyl, thiazolopyridiminyl, thiazolonopyrimidinyl, oxazolopyridiminyl, oxazolonopyrimidinyl, isoxazolopyrimidinyl, isothiazolopyrimidinyl, triazolopyrimidinyl, dihydropurinonyl, pyrrolopyrimidinyl, purinyl, pyrazolopyrimidinyl, phthalimidyl, phthalimidinyl, pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl, cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl, phthalazinyl, benzodioxyl, benzisothiazoline-1 ,1 ,3-trionyl, dihydroquinolinyl, tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl, benzoazepinyl, benzodiazepinyl, benzoxapinyl, and benzoxazepinyl;
G3 is a non-fused bicyclic heteroaryl taken from the group consisting of pyridylpyridiminyl pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl, imidazolylpyrimidinyl, isoxazolylpyrimidinyl, isothiazolylpyrimidinyl, pyrazolylpyrimidinyl, triazolylpyrimidinyl, oxadiazoylpyrimidinyl, thiadiazoylpyrimidinyl, morpholinylpyrimidinyl, dioxothiomorpholinylpyrimidinyl, and thiomorpholinylpyrimidinyl;
G4 is a heterocyclyl taken from the group consisting of oxetanyl, azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl, oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl, tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl, thiomorpholinyl, thiomorpholinyl S-oxide, thiomorpholinyl S-dioxide, piperazinyl, azepinyl, oxepinyl, diazepinyl, tropanyl, and homotropanyl;
The A ring is substituted at any substitutable position with one Al moiety, wherein Al is selected from the group consisting of A2, A3 and A4;
A2 is selected from the group consisting of:
Figure imgf000134_0001
A3 is selected from the group consisting of:
Figure imgf000135_0001
A4 is selected from the group consisting of:
Figure imgf000136_0001
and wherein the symbol (**) is the point of attachment to the A ring of formula Ia;
and wherein — indicates either a saturated or unsaturated bond;
the A ring is optionally substituted with one or more R2 moieties;
X2 is selected from the group consisting of C1-C6 alkyl, C2-C6 branched alkyl, and a direct bond wherein El is directly linked to the NR3 group of formula Ia;
X3 is selected from the group consisting of -C(O)-, -O-, -O-(CH2)n-, -S-(CH2V, -NR3- (CH2)π-, -O(CH2)qO-, -O(CH2)qN(R3)-, -N(R3)(CH2)qN(R3)-, -(CH2)nN(R4)C(O)-, - (CH2)nN(R4)C(O)(CH2)n-, -(CH2)nC(O)N(R4)-, -(CH2V. -C2-C5alkenyl, -C2-C5alkynyl, and -CS-Cόcycloalkyl and wherein the carbon atoms of -(CH2V, -(CH2)q-, -(CH2)P-, C2- C5alkenyl, and C2-C5alkynyl moieties of X3 may be further substituted by one or more Cl-C6alkyl;
V, Vl, and V2 are each independently and respectively selected from the group consisting of O and H2;
each Z2 is independently and individually selected from the group consisting of hydrogen, aryl, Cl-C6alkyl, C3-C8carbocyclyl, hydroxyl, hydroxyCl-Cόalkyl-, cyano, (RS)2N-, (R4)2N-, (R4)2NC1-C6alkyl-, (R4)2NC2-C6alkylN(R4)(CH2)n-, (R4)2NC2- C6alkylO(CH2)n-, (R3)2NC(O)~, (R4)2NC(O)-, (R4)2NC(O)C1-C6alkyl-, carboxyl, carboxyC 1 -Cόalkyl , C 1 -Cόalkoxycarbonyl-, C 1 -CόalkoxycarbonylC 1 -Cόalkyl-, (R3)2NSO2-, (R4)2NSO2-, -SO2RS, -SO2R8, -(CH2)nN(R4)C(O)R8, -C(O)R8, =O, =N0H, -N(ORO), -(CH2)nGl, -(CH2)nG4, -(CH2)nO(CH2)nGl, -(CH2)nO(CH2)nG4, - (CH2)πN(R3)(CH2)n-aryl, -(CH2)nN(R3)(CH2)πGl, -(CH2)nN(R3)(CH2)nG4, (CH2)nNHC(O)NHS(O)2R8, -(CH2)nNHS(O)2NHC(O)R8, -C(O)NHS(O)2R8, - (CH2)NHC(O)(CH2)nR5, -(CH2)nNHS(O)2R5, -(CH2)nC(O)NH(CH2)qR5, (CH2)πC(O)R5, -(CH2)nOC(O)R5, and ~(CH2)nR5;
in the event that Z2 contains an alkyl or alkylene moiety, such moieties may be further substituted with one or more Cl-C6alkyls;
each Z3 is independently and individually selected from the group consisting of H, Cl- Cόalkyl, branched C3-C7alkyl, C3-C8carbocyclyl, halogen, fluoroCl-Cόalkyl wherein the alkyl moiety can be partially or fully fluorinated, cyano, hydroxyl, methoxy, oxo, (R3)2NC(O)-, (R4)2NC(O)-, -N(R4)C(O)R8, (R3)2NSO2-, (R4)2NSO2-, -N(R4)SO2R5, - N(R4)SO2R8, -(CH2)N(RS)2, -(CH2)nN(R4)2, -O(CH2)qN(R4)2, -O(CH2)qO-Cl-C6alkyl, - N(R3)(CH2)qO-Cl-C6aIkyl, -N(R3)(CH2)qN(R4)2, -O(CH2)qR5, -N(R3)(CH2)qR5, - C(O)R5, -C(O)RS, -R5, and nitro; in the event that Z3 contains an alkyl or alkylene moiety, such moieties may be further substituted with one or more Cl-C6alkyls;
each Z4 is independently and individually selected from the group consisting of H, Cl- Cόalkyl, hydroxyC2-C6alkyl, Cl-C6alkoxyC2-C6alkyl, (R4)2N-C2-C6alkyl, (R4)2N-C2- C6alkylN(R4)-C2-C6alkyl, (R4)2N-C2-C6alkyl-O-C2-C6alkyl, (R4)2NC(O)-C 1 -C6alkyl, carboxyCl-Cβalkyl-, Cl-C6alkoxycarbonylCl-C6alkyl-, -C2-C6alkylN(R4)C(O)R8, R8- C(=NR3)-, -SO2R8, -C(O)R8, -(CH2)nGl, -(CH2)nG4, -(CH2)qO(CH2)nGl, - (CH2)qO(CH2)nG4, -(CH2)qN(R3)(CH2)nGl, -(CH2)qN(R3)(CH2)nG4,
(CH2)qNHC(O)(CH2)nR5, -(CH2)qC(O)NH(CH2)qR5, -(CH2)qC(O)R5, -(CH2)qOC(O)R5, -(CH2)qR5, -(CH2)qNR4(CH2)qR5, and -(CH2)qO(CH2)qR5;
in the event that Z4 contains an alkyl or alkylene moiety, such moieties may be further substituted with one or more Cl-C6alkyls;
each Z6 is independently and individually selected from the group consisting of H, Cl- Cόalkyl, branched C3-C7alkyl, hydroxyl, hydroxyCl-Cόalkyl, hydroxyC2~C6 branched alkyl, Cl-C6alkoxy, Cl-C6alkoxyCl-C6alkyl-, Cl-C6alkoxyC2-C6 branched alkyl-, C2- C6 branched alkoxy-, Cl-COalkylthio-, (R3)2N-, -N(R3)C(O)R8, (R4)2N-, -R5, - N(R4)C(O)R8, -N(R3)SO2R6, -C(O)N(R3)2, -C(O)N(R4)2, -C(O)RS, -SO2N(R4)2, - SO2N(RS)2, halogen, fluoroCl-Cόalkyl wherein the alkyl is fully or partially fluorinated, cyano, fluoroCl-Cόalkoxy wherein the alkyl is fully or partially fluorinated, - O(CH2)qN(R4)2, -N(R3)(CH2)qN(R4)2, -O(CH2)qO-Cl-C6 Alkyl, -O(CH2)qN(R4)2, - N(R3)(CH2)qO-Cl-C6Alkyl, -N(R3)(CH2)qN(R4)2, -O(CH2)qR5, and -N(R3)(CH2)qR5, - (NR3)rR17, -(O)rR17, -(S)rR17, -(CH2)nR17; -R17, -(CH2)nGl, -(CH2)πG4, - (CH2)nO(CH2)nGl, -(CH2)nO(CH2)nG4, -(CH2)nN(R3)(CH2)nGl, and (CH2)nN(R3)(CH2)nG4;
each R2 is selected from the group consisting of Z3-substituted aryOl, Z3 -substituted Gl-, Z3-substituted G4-, C1-C6 alkyl, branched C3-C8alkyl, Rl 9 substituted C3- Cδcarbocyclyl, hydroxylCl-Cόalkyl-, hydroxyl branched C3~C6alkyl-, hydroxyl substituted C3-C8carbocyclyl-, cyanoCl-Cόalkyl-, cyano substituted branched C3- Cόalkyl, cyano substituted C3-C8carbocyclyl, (R4)2NC(O)C1-C6alkyl-, (R4)2NC(O) substituted branched C3-C6alkyl-, (R4)2NC(O) substituted C3-C8carbocyclyl-, fluoroCl- Cόalkyl wherein the alkyl is fully or partially fluorinated, halogen, cyano, Cl-C6alkoxy, and fluoroCl-Cόalkoxy wherein the alkyl group is fully or partially fluorinated;
wherein each R3 is independently and individually selected from the group consisting of H, Cl-C6alkyl, branched C3-C7alkyl, C3-C8carbocyclyl, and Z3 -substituted phenyl;
each R4 is independently and individually selected from the group consisting of H, Cl- Cδaikyl, hydroxyCl-Cόalkyl-, dihydroxyCl-Cόalkyl-, Cl-C6alkoxyCl-C6alkyl-, branched C3-C7alkyl-, branched hydroxyCl-Cδalkyl-, branched Cl-C6alkoxyCl- Cόalkyl-, branched dihydroxyC2-C6alkyl-, -(CH2)PN(R7)2, -(CH2)PR5, - (CH2)pC(O)N{R7)2, -(CH2)nC(O)R5, -(CH2)nC(O)OR3, C3-C8carbocyclyl, hydroxyl substituted C3-C8carbocyclyl-, alkoxy substituted C3-C8carbocyclyl~, dihydroxyl substituted C3-C8carbocyclyl-, and -(CH2)nR17;
each R5 is independently and individually selected from the group consisting of
Figure imgf000139_0001
and wherein the symbol (##) is the point of attachment of the R5 moiety;
each R6 is independently and individually selected from the group consisting of Cl- Cβalkyl, branched C3-C7alkyl} C3-C8carbocyclyl, phenyl, Gl, and G4;
each R7 is independently and individually selected from the group consisting of H, Cl- Cόalkyl, hydroxyC2-C6alkyl-, dihydroxyC2-C6alkyl-, C2-C6alkoxyC2-C6alkyl-, branched C3-C7alkyl-, branched hydroxyC2-C6 alkyl-, branched C2-C6alkoxyC2- Cβalkyl-, branched dihydroxyC2-Cόalkyl-, -(CH2)qR5, -(CH2)nC(O)R5, - (CH2)nC(O)OR3, C3-C8carbocyclyl, hydroxyl substituted C3-C8carbocyclyl-, alkoxy substituted C3-C8carbocyclyl~, dihydroxy substituted C3-C8carbocyclyl, and - (CH2)nR17;
each R8 is independently and individually selected from the group consisting of Cl- Cβalkyl, branched C3-C7alkyl, fluoroCl-Cόalkyl wherein the alkyl moiety is partially or fully fluorinated, C3-C8carbocyclyl, Z3 -substituted phenyl-, Z3 -substituted phenylCl- Cόalkyl-, Z3-substituted Gl, Z3-substituted Gl-Cl-C6alkyl-S Z2-substituted G4, Z2- substituted G4-Cl-C6alkyl-, OH, Cl-C6alkoxy, N(R3)2, N(R4)2, and R5;
each R9 is independently and individually selected from the group consisting of H, F, Cl- Cόalkyl, branched C3-C7alkyl, C3-C7carbocyclyl, phenyl, phenyl-Cl-C6alkyl-; - (CH2)nGl, and -(CH2)nG4;
each RlO is independently and individually selected from the group consisting OfCO2H, CO2Cl-C6alkyl, -C(O)N(R4)2, OH, Cl-Cόalkoxy, and -N(R4)2;
each Rl 3 is independently and individually selected from the group consisting of H, Cl- Cόalkyl, branched C3-C7alkyl, C3-C8carbocyclyl, hydroxyC2-C7 alkyl, Cl-C6alkoxyC2- C7alkyl, (R4)2NC(O)-, (R4)2NC(O)-Cl-C6alkyl, carboxyCl-C6 alkyl, Cl- C6alkoxycarbonyl-, Cl-C6alkoxycarbonylCl-C6alkyl-, (R4)2N-C2-C6alkyl-, (R4)2N- C2-C6alkylN(R4)(CH2)q-, R5-C2-C6alkylN(R4)(CH2)q-, (R4)2N-C2-Cόalkyl0(CH2)q-, R5-C2-C6alkyl-O(CH2)q, -(CH2)qN(R4)C(O)R8, aryl, arylCl-Cόalkyl-, aryloxyC2- C6alkyl-, arylaminoC2-C6alkyl-, Cl-CβalkoxycarbonylCl-Cόalkyl-, -C2- C6alkylN(R4)C(O)R8, R8-C(=NR3)-, -SO2R8, -C(O)R8, -(CH2)nGl, -{CH2)nG4, - (CH2)n0(CH2)πGl , -(CH2)nO(CH2)nG4, -(CH2)nN(R3)(CH2)nGl, and (CH2)nN(R3)(CH2)nG4;
each Rl 4 is independently and respectively selected from the group consisting of H, Cl- Cόalkyl, branched C3-C6alkyl, and C3-C8carbocyclyl; Rl 6 is independently and individually selected from the group consisting of Cl-C6alkyl, branched C3-C7alkyl, C3-C8carbocyclyl, halogen, fluoroCl-Cόalkyl wherein the alkyl moiety can be partially or fully fluorinated, cyano, hydroxyl, Cl-C6alkoxy, fluoro Cl- Cόalkoxy wherein the alkyl moiety can be partially or fully fluorinated, -N(R3)2, - N(R4)2, C2-C3alkynyl, and nitro;
each Rl 7 is taken from the group comprising phenyl, naphthyl, pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl, pyrazinyl, pyridazinyl, triazinyl, oxetanyl, azetadinyl, tetrahydrofuranyl, oxazolinyl, oxazolidinyl, pyranyl, thiopyranyl, tetrahydropyranyl, dioxalinyl, azepinyl, oxepinyl, diazepinyl, pyrrolidinyl, and piperidinyl;
wherein Rl 7 can be further substituted with one or more Z2, Z3 or Z4 moieties;
Rl 8 is independently and individually selected from the group consisting of hydrogen, Cl-C6alkyl, branched C3-C7alkyl, C3-C8carbocyclyl, halogen, fiuoroCl-Cόalkyl wherein the alkyl moiety can be partially or fully fluorinated, cyano, hydroxyl, Cl- Cόalkoxy, fluoroCl-Cόalkoxy wherein the alkyl moiety can be partially or fully fluorinated, -N(R3)2, -N(R4)2, C2-C3alkynyl, and nitro;
R19 is H or Cl-C6 alkyl;
wherein two R3 or R4 moieties are independently and individually taken from the group consisting of Cl~C6alkyl and branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen atom, said moieties may cyclize to form a C3-C7 heterocyclyl ring;
and n is 0-6; p is 1-4; q is 2-6; r is 0 or 1; t is 1-3, v is 1 or 2;
with the proviso that compounds of formula Ia cannot be
Figure imgf000142_0001
2. Compounds of claim 1 having the formula Ib
Figure imgf000142_0002
wherein A is pyrazolyl.
3. A compound of claim 2 having the formula Ic
Figure imgf000142_0003
4. A compound of claim 2 having the formula Id:
Figure imgf000142_0004
5. A compound of claim 2 having the formula Ie:
Figure imgf000142_0005
6, A compound of claim 1 having the formula If:
Figure imgf000142_0006
wherein A is isoxazolyl.
7. A compound of claim 6 having the formula Ig:
Figure imgf000143_0001
8. A compound of claim 6 having the formula Ih:
Figure imgf000143_0002
9. A compound of claim 6 having the formula Ii:
Figure imgf000143_0003
10. A compound of claim 1 having the formula Ij :
Figure imgf000143_0004
wherein A is thienyl.
11. A compound of claim 10 having the formula Ik:
Figure imgf000143_0005
12. A compound of claim 10 having the formula II:
Figure imgf000143_0006
13. A compound of claim 10 having the formula Im:
Figure imgf000143_0007
14. A compound of claim 1 having the formula In:
(RRJJBB))11 (Zβ),
A1
(RJ BJ,
H H wherein A is furyl.
15. A compound of claim 14 having the formula Io:
Figure imgf000144_0001
16. A compound of claim 14 having the formula Ip:
Figure imgf000144_0002
17. A compound of claim 14 having the formula Iq:
Figure imgf000144_0003
18. A compound of claim 1 having the formula Ir:
Figure imgf000144_0004
wherein A is pyrrolyl.
19. A compound of claim 18 having the formula Is:
Figure imgf000144_0005
20. A compound of claim 18 having the formula It:
Figure imgf000144_0006
21. A compound of claim 18 having the formula Iu:
Figure imgf000144_0007
22. A compound of claim 1 having the formula Iv:
Figure imgf000145_0001
wherein A is imidazolyl.
23. A compound of claim 22 having the formula Iw:
Figure imgf000145_0002
24. A compound of claim 22 having the formula Ix:
Figure imgf000145_0003
25. A compound of claim 22 having the formula Iy:
Figure imgf000145_0004
26. A compound of claim ϊ having the formula Iz:
Figure imgf000145_0005
wherein A is thiazolyl.
27. A compound of claim 26 having the formula Iaa: lilil
Figure imgf000145_0006
28. A compound of claim 26 having tlie formula Ibb:
Figure imgf000145_0007
29. A compound of claim 26 having the formula Ice:
Figure imgf000146_0001
30. A compound of claim 1 having the formula Idd:
Figure imgf000146_0002
wherein A is oxazolyl.
31. A compound of claim 30 having the formula lee:
Figure imgf000146_0003
32. A compound of claim 30 having the formula Iff:
Figure imgf000146_0004
33. A compound of claim 30 having the formula Igg:
Figure imgf000146_0005
34. A compound of claim 1 having the formula Ihh:
Figure imgf000146_0006
wherein A is isothiazolyl.
35. A compound of claim 34 having the formula Iik
Figure imgf000146_0007
36. A compound of claim 34 having the formula Ijj:
Figure imgf000147_0001
37. A compound of claim 34 having the formula Dck:
Figure imgf000147_0002
38. A compound of claim 1 having the formula 111:
Figure imgf000147_0003
wherein A is phenyl.
39. A compound of claim 38 having the formula hnm:
Figure imgf000147_0004
40. A compound of claim 38 having the formula Inn:
Figure imgf000147_0005
41. A compound of claim 38 having the formula loo:
Figure imgf000147_0006
42. A compound of claim 1 having the formula Ipp:
Figure imgf000147_0007
wherein A is pyrimidinyl.
43. A compound of claim 42 having the formula Iqq:
Figure imgf000148_0001
44. A compound of claim 42 having the formula Irr:
Figure imgf000148_0002
45. A compound of claim 42 having the formula Iss:
Figure imgf000148_0003
46. A compound of claim 1 having the formula Itt:
Figure imgf000148_0004
wherein A is pyridinyl.
47. A compound of claim 46 having the formula Iuu:
Figure imgf000148_0005
48. A compound of claim 46 having the formula Iw:
Figure imgf000148_0006
49. A compound of claim 46 having the formula Iww:
Figure imgf000148_0007
50. A method of modulating a kinase activity of a wild-type kinase species, oncogenic forms thereof, aberrant fusion proteins thereof and polymorphs of any of the foregoing, comprising the step of contacting said species with a compound of claim 1.
51. A pharmaceutical composition comprising a compound of claim 1 and salts thereof, together with a pharmaceutically acceptable carrier, said carrier including an additive selected from the group including adjuvants, excipients, diluents, and stablilizers.
52. A method of treating an individual suffering from a condition selected from the group consisting of cancer, hyperproliferative diseases, secondary cancer growth arising from metastasis, diseases characterized by hyper-vascularization, inflammation, osteoarthritis, respiratory diseases, stroke, systemic shock, immunological diseases, cardiovascular disease and diseases characterized by angiogenesis, comprising the step of administering to such individual a compound of claim 1.
53. A method of treating an individual suffering from a disease caused by c-Abl kinase, oncogenic forms thereof, aberrant fusion proteins thereof and polymorphs thereof, chronic myelogenous leukemia, acute lymphocytic leukemia, other myeloproliferative disorders, gastrointestinal stromal tumors, hypereosinophilic syndrome, glioblastomas, ovarian cancer, pancreatic cancer, prostate cancer, lung cancers, breast cancers, kidney cancers, cervical carcinomas, metastasis of primary solid tumor secondary sites, ocular diseases characterized by hyperproliferation leading to blindness including various retinopathies i.e. diabetic retinopathy and age-related macular degeneration, rheumatoid arthritis, melanomas, colon cancer, thyroid cancer, a disease caused by a mutation in the RAS-RAF-MEK-ERK-MAP kinase pathway, human inflammation, rheumatoid spondylitis, ostero-arthritis, asthma, gouty arthritis, sepsis, septic shock, endotoxic shock, Gram-negative sepsis, toxic shock syndrome, adult respiratory distress syndrome, stroke, reperfusion injury, neural trauma, neural ischemia, psoriasis, restenosis, chronic obstructive pulmonary disease, bone resorptive diseases, graft- versus-host reaction, Chron's disease, ulcerative colitis, inflammatory bowel disease, pyresis, and combinations thereof, comprising the step of administering to such individual a compound of claim 1.
54. A method of administering to a mammal a compound of claim 1 , said method of administration selected from the group consisting of oral, parenteral, inhalation, and subcutaneous.
PCT/US2007/081098 2006-10-11 2007-10-11 Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases WO2008046003A2 (en)

Priority Applications (14)

Application Number Priority Date Filing Date Title
BRPI0719195A BRPI0719195B8 (en) 2006-10-11 2007-10-11 kinase inhibitors, their uses, and pharmaceutical composition
BR122020010667A BR122020010667B8 (en) 2006-10-11 2007-10-11 kinase inhibitors, their uses, and pharmaceutical composition
CA2666563A CA2666563C (en) 2006-10-11 2007-10-11 Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases
RU2009117615/04A RU2482112C2 (en) 2006-10-11 2007-10-11 Kinase inhibitors applicable for treating myeloproliferative diseases and other proliferative diseases
DK07844173.0T DK2073811T3 (en) 2006-10-11 2007-10-11 Kinase inhibitors useful for the treatment of myeloproliferative diseases and other proliferative diseases
MX2009003704A MX2009003704A (en) 2006-10-11 2007-10-11 Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases.
AU2007307679A AU2007307679B9 (en) 2006-10-11 2007-10-11 Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases
JP2009532577A JP5042314B2 (en) 2006-10-11 2007-10-11 Kinase inhibitors useful for the treatment of chronic myeloproliferative disorders and other proliferative disorders
EP07844173.0A EP2073811B1 (en) 2006-10-11 2007-10-11 Kinase inhibitors useful for the treatment of myeloproliferative diseases and other proliferative diseases
CN2007800455912A CN101553233B (en) 2006-10-11 2007-10-11 Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases
KR1020097009667A KR101439823B1 (en) 2006-10-11 2007-10-11 Kinase inhibitors useful for the treatment of myeloproliferative diseases and other proliferative diseases
ES07844173.0T ES2538215T3 (en) 2006-10-11 2007-10-11 Kinase inhibitors useful for the treatment of myeloproliferative diseases and other proliferative diseases
IL197933A IL197933A (en) 2006-10-11 2009-04-05 Kinase inhibitors, pharmaceutical compositions comprising such compounds and uses thereof
HK10103426.6A HK1139036A1 (en) 2006-10-11 2010-04-07 Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US85083406P 2006-10-11 2006-10-11
US60/850,834 2006-10-11
US11/870,388 2007-10-10
US11/870,388 US7790756B2 (en) 2006-10-11 2007-10-10 Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases

Publications (2)

Publication Number Publication Date
WO2008046003A2 true WO2008046003A2 (en) 2008-04-17
WO2008046003A3 WO2008046003A3 (en) 2008-08-21

Family

ID=39283624

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2007/081098 WO2008046003A2 (en) 2006-10-11 2007-10-11 Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases

Country Status (17)

Country Link
US (2) US7790756B2 (en)
EP (1) EP2073811B1 (en)
JP (2) JP5042314B2 (en)
KR (1) KR101439823B1 (en)
CN (1) CN101553233B (en)
AU (1) AU2007307679B9 (en)
BR (2) BR122020010667B8 (en)
CA (1) CA2666563C (en)
DK (1) DK2073811T3 (en)
ES (1) ES2538215T3 (en)
HK (1) HK1139036A1 (en)
IL (1) IL197933A (en)
MX (1) MX2009003704A (en)
PT (1) PT2073811E (en)
RU (1) RU2482112C2 (en)
SG (1) SG175640A1 (en)
WO (1) WO2008046003A2 (en)

Cited By (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2008131227A1 (en) * 2007-04-20 2008-10-30 Deciphera Pharmaceuticals, Llc Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases
WO2011028995A1 (en) * 2009-09-03 2011-03-10 Allergan, Inc. Compounds as tyrosine kinase modulators
WO2011137342A1 (en) 2010-04-29 2011-11-03 Deciphera Pharmaceuticals, Llc Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activites
WO2012098416A1 (en) 2011-01-21 2012-07-26 Sun Pharma Advanced Research Company Ltd Diarylacetylene hydrazide containing tyrosine kinase inhibitors
JP2013518089A (en) * 2010-02-01 2013-05-20 キャンサー・リサーチ・テクノロジー・リミテッド 1- (5-tert-butyl-2-phenyl-2H-pyrazol-3-yl) -3- [2-fluoro-4- (1-methyl-2-oxo-2,3-dihydro-1H-imidazo [ 4,5-B] pyridin-7-yloxy) -phenyl] -urea and related compounds and their use in therapy
EP2594566A1 (en) * 2010-07-16 2013-05-22 Kyowa Hakko Kirin Co., Ltd. Nitrogenated aromatic heterocyclic ring derivative
WO2015186137A1 (en) 2014-06-06 2015-12-10 Natco Pharma Limited 1h-1,8- naphthyridin-2ones as anti proliferative compounds
US9296722B2 (en) 2010-05-27 2016-03-29 Ambit Biosciences Corporation Azolyl urea compounds and methods of use thereof
US9546156B2 (en) 2012-11-13 2017-01-17 Array Biopharma Inc. N-bicyclic aryl,N'-pyrazolyl urea, thiourea, guanidine cyanoguanidine compounds as TrkA kinase inhibitors
US9562055B2 (en) 2011-05-13 2017-02-07 Array Biopharma Inc. Pyrrolidinyl urea, pyrrolidinyl thiourea and pyrrolidinyl guanidine compounds as TrkA kinase inhibitors
US9790178B2 (en) 2012-11-13 2017-10-17 Array Biopharma Inc. Pyrrolidinyl urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9790210B2 (en) 2012-11-13 2017-10-17 Array Biopharma Inc. N-(monocyclic aryl),N'-pyrazolyl-urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9809578B2 (en) 2012-11-13 2017-11-07 Array Biopharma Inc. Pyrazolyl urea, thiourea, guanidine and cyanoguanidine compounds as trkA kinase inhibitors
US9822118B2 (en) 2012-11-13 2017-11-21 Array Biopharma Inc. Bicyclic heteroaryl urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9828360B2 (en) 2012-11-13 2017-11-28 Array Biopharma Inc. Pyrrolidinyl urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9896435B2 (en) 2012-11-13 2018-02-20 Array Biopharma Inc. N-pyrrolidinyl,N′-pyrazolyl-urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9969694B2 (en) 2012-11-13 2018-05-15 Array Biopharma Inc. N-(arylalkyl)-N′-pyrazolyl-urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9981959B2 (en) 2012-11-13 2018-05-29 Array Biopharma Inc. Thiazolyl and oxazolyl urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US10221192B2 (en) 2009-09-03 2019-03-05 Allergan, Inc. Compounds as tyrosine kinase modulators
US10351575B2 (en) 2012-11-13 2019-07-16 Array Biopharma Inc. Bicyclic urea, thiourea, guanidine and cyanoguanidine compounds useful for the treatment of pain
US10835533B2 (en) 2014-05-15 2020-11-17 Array Biopharma Inc. 1 -((3S,4R)-4-(3-fluorophenyl)-1-(2-methoxyethyl)pyrrolidin-3-yl)-3-(4-methyl-3-(2-methylpyrimidin-5-yl)-1-phenyl-1H-pyrazol-5-yl)urea as a TrkA kinase inhibitor
WO2021013712A1 (en) 2019-07-19 2021-01-28 Anagenesis Biotechnologies S.A.S. Polyaromatic urea derivatives and their use in the treatment of muscle diseases
US10966966B2 (en) 2019-08-12 2021-04-06 Deciphera Pharmaceuticals, Llc Methods of treating gastrointestinal stromal tumors
USRE48731E1 (en) 2012-06-07 2021-09-14 Deciphera Pharmaceuticals, Llc Dihydronaphthyridines and related compounds useful as kinase inhibitors for the treatment of proliferative diseases
US11185535B2 (en) 2019-12-30 2021-11-30 Deciphera Pharmaceuticals, Llc Amorphous kinase inhibitor formulations and methods of use thereof
US11266635B2 (en) 2019-08-12 2022-03-08 Deciphera Pharmaceuticals, Llc Methods of treating gastrointestinal stromal tumors
EP4029501A1 (en) 2021-01-19 2022-07-20 Anagenesis Biotechnologies Combination of polyaromatic urea derivatives and glucocorticoid or hdac inhibitor for the treatment of diseases or conditions associated with muscle cells and/or satellite cells
US11395818B2 (en) 2019-12-30 2022-07-26 Deciphera Pharmaceuticals, Llc Compositions of 1-(4-bromo-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)-3-phenylurea
US11779572B1 (en) 2022-09-02 2023-10-10 Deciphera Pharmaceuticals, Llc Methods of treating gastrointestinal stromal tumors
US11986463B2 (en) 2018-01-31 2024-05-21 Deciphera Pharmaceuticals, Llc Combination therapy for the treatment of gastrointestinal stromal tumor
US12102620B2 (en) 2018-01-31 2024-10-01 Deciphera Pharmaceuticals, Llc Combination therapy for the treatment of mastocytosis

Families Citing this family (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP5197016B2 (en) 2004-12-23 2013-05-15 デシファラ ファーマスーティカルズ, エルエルシー Enzyme modulators and therapy
US8188113B2 (en) 2006-09-14 2012-05-29 Deciphera Pharmaceuticals, Inc. Dihydropyridopyrimidinyl, dihydronaphthyidinyl and related compounds useful as kinase inhibitors for the treatment of proliferative diseases
US7790756B2 (en) * 2006-10-11 2010-09-07 Deciphera Pharmaceuticals, Llc Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases
US20110189167A1 (en) * 2007-04-20 2011-08-04 Flynn Daniel L Methods and Compositions for the Treatment of Myeloproliferative Diseases and other Proliferative Diseases
CN102256493A (en) * 2008-10-29 2011-11-23 迪赛孚尔制药有限公司 Cyclopropane amides and analogs exhibiting anti-cancer and anti-proliferative activities
WO2013036232A2 (en) * 2011-09-08 2013-03-14 Deciphera Pharmaceuticals, Llc Methods and compositions for the treatment of myeloproliferative diseases and other proliferative diseases
US8841301B2 (en) 2011-09-26 2014-09-23 Bristol-Myers Squibb Company Selective NR2B antagonists
US8722670B2 (en) 2011-09-30 2014-05-13 Bristol-Myers Squibb Company Selective NR2B antagonists
UA112897C2 (en) 2012-05-09 2016-11-10 Байєр Фарма Акцієнгезелльшафт BICYCLIC SUBSTITUTED URATILES AND THEIR APPLICATIONS FOR THE TREATMENT AND / OR PREVENTION OF DISEASES
HUE042591T2 (en) * 2013-02-19 2019-07-29 Ono Pharmaceutical Co Trk-inhibiting compound
WO2014140582A1 (en) 2013-03-14 2014-09-18 Respivert Limited Kinase inhibitors
EA030483B1 (en) 2013-04-02 2018-08-31 Респайверт Лимитед Urea derivatives useful as kinase inhibitors
US9457019B2 (en) * 2013-11-07 2016-10-04 Deciphera Pharmaceuticals, Llc Methods for inhibiting tie-2 kinase useful in the treatment of cancer
WO2015067651A1 (en) 2013-11-08 2015-05-14 Bayer Pharma Aktiengesellschaft Substituted uracils as chymase inhibitors
US10231965B2 (en) 2014-02-20 2019-03-19 Ignyta, Inc. Molecules for administration to ROS1 mutant cancer cells
MA40775A (en) * 2014-10-01 2017-08-08 Respivert Ltd 4- (4- (4-PHENYLUREIDO-NAPHTALÉN -1-YL) OXY-PYRIDIN-2-YL) AMINO-BENZOIC ACID USED AS A KINASE P38 INHIBITOR
CA2969540C (en) 2014-12-02 2023-03-21 Ignyta, Inc. Combinations for the treatment of neuroblastoma
CN105777625B (en) 2014-12-24 2020-05-22 浙江海正药业股份有限公司 Method for preparing 4- (4-amino-3-fluorophenoxy) -N-methylpyridine-2-formamide
WO2017075367A1 (en) * 2015-10-28 2017-05-04 Northwestern University Substituted aromatic n-heterocyclic compounds as inhibitors of mitogen-activated protein kinase interacting kinase 1 (mnk1) and 2 (mnk2)
JP7061068B2 (en) 2015-12-18 2022-04-27 イグナイタ インコーポレイテッド Combination drug for cancer treatment
EP3440073B1 (en) 2016-04-06 2022-06-08 Oxular Acquisitions Limited Kinase inhibitors
BR112020000793A2 (en) 2017-07-19 2020-07-14 Ignyta, Inc. pharmaceutical compositions and dosage forms
CN111225662B (en) 2017-10-17 2022-11-22 伊尼塔公司 Pharmaceutical compositions and dosage forms
HUE065492T2 (en) 2018-12-28 2024-05-28 Deciphera Pharmaceuticals Llc Csf1r inhibitors for use in treating cancer
JP2022531932A (en) 2019-05-10 2022-07-12 デシフェラ・ファーマシューティカルズ,エルエルシー Heteroarylaminopyrimidineamide autophagy inhibitor and its usage
KR20220008873A (en) 2019-05-10 2022-01-21 데시페라 파마슈티칼스, 엘엘씨. Phenylaminopyrimidine amide autophagy inhibitors and methods of use thereof
JP2022536540A (en) 2019-06-17 2022-08-17 デシフェラ・ファーマシューティカルズ,エルエルシー Aminopyrimidine amide autophagy inhibitors and methods of use thereof
PE20231311A1 (en) 2020-11-18 2023-08-24 Deciphera Pharmaceuticals Llc GCN2 AND PERK KINASE INHIBITORS AND METHODS OF USE THEREOF

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1994021647A1 (en) 1993-03-18 1994-09-29 Smithkline Beecham Plc Diclavulanate salt with a diamine and process of preparation
WO2003000008A2 (en) 2001-06-22 2003-01-03 The Government Of The United States Of America As Represented By The Secretary Of The Navy High speed electro-optic clock recovery circuit
WO2006071940A2 (en) 2004-12-23 2006-07-06 Deciphera Pharmaceuticals, Llc Enzyme modulators and treatments
WO2013098244A1 (en) 2011-12-30 2013-07-04 Wageningen Universiteit Modified cascade ribonucleoproteins and uses thereof

Family Cites Families (86)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE1115350B (en) 1959-04-17 1961-10-19 Siemens Ag Circuit breaker, in particular line circuit breaker, with a drive mechanism consisting of a knee joint for the switching element
GB971307A (en) 1961-03-02 1964-09-30 Wellcome Found 5-anilinopyrimidines
GB1127875A (en) 1967-03-23 1968-09-18 Parke Davis & Co 4-(5-nitro-2-furyl) thiazolyl hydantoins and hydrouracils
US3949002A (en) 1970-11-13 1976-04-06 Imperial Chemical Industries Limited Process for producing sulfone containing thiophenols
US3818024A (en) 1972-02-16 1974-06-18 Velsicol Chemical Corp Benzothiazol substituted thiadiazolidines
CH565887A5 (en) 1972-08-22 1975-08-29 Ciba Geigy Ag
US3939122A (en) 1973-04-11 1976-02-17 Bayer Aktiengesellschaft Process for the preparation of compounds which contain hydantoin rings
FR2337554A1 (en) 1976-01-08 1977-08-05 Buzas Andre (1)-Substd. (2)-phenyl-(4)-butyl-pyrazolidine dione salts - analgesics and antiinflammatories with little ulcerogenic action
US4093624A (en) 1977-01-31 1978-06-06 Icn Pharmaceuticals, Inc. 1,2,4-Thiadiazolidine-3,5-dione
FR2396549A2 (en) 1977-07-06 1979-02-02 Buzas Andre Antiinflammatory pyrazolidine-di:one cpds. - with reduced ulcerogenic activity
US4256758A (en) 1979-06-11 1981-03-17 Merck & Co., Inc. 4-Substituted-3-hydroxy-3-pyrroline-2,5-dione inhibitors of glycolic acid oxidase
US4298743A (en) 1979-09-11 1981-11-03 Merck & Co., Inc. 4-(Substituted phenyl thiazolyl)-3-hydroxy-3-pyrroline-2,5-diones
US4296237A (en) 1979-09-11 1981-10-20 Merck & Co., Inc. 4-(Pyridyl, piperazinyl and thiazolyl substituted thiazolyl)-3-hydroxy-3-pyrroline-2,5-diones
US4432992A (en) 1979-11-05 1984-02-21 Merck & Co., Inc. 4-[5(and 4)-Substituted-2-thienyl]-3-hydroxy-3-pyrroline-2,5-dione inhibitors of glycolic acid oxidase
US4366189A (en) 1979-12-21 1982-12-28 Ciba-Geigy Corporation 4-Heterocyclyl-4'-vinylstilbenes
JPS5915247A (en) 1982-07-16 1984-01-26 Mitsubishi Paper Mills Ltd Formation of image
JPS59177557A (en) 1983-03-28 1984-10-08 Fuji Photo Film Co Ltd Silver halide color photosensitive material
DE3406329A1 (en) 1984-02-22 1985-08-22 Merck Patent Gmbh, 6100 Darmstadt PYRIDONE
US4816454A (en) 1984-09-21 1989-03-28 Cassella Aktiengesellschaft 4,5-dihydro-3(2H)-pyridazinones and their pharmacological use
US5514691A (en) 1993-05-20 1996-05-07 Immunopharmaceutics, Inc. N-(4-halo-isoxazolyl)-sulfonamides and derivatives thereof that modulate the activity of endothelin
US5103014A (en) 1987-09-30 1992-04-07 American Home Products Corporation Certain 3,3'-[[[(2-phenyl-4-thiazolyl)methoxy]phenyl]methylene]dithiobis-propanoic acid derivatives
AU606808B2 (en) 1988-06-29 1991-02-14 Otsuka Pharmaceutical Factory, Inc. Arylcarboxamide substituted by alkylphosphonates, process for preparing the same and a pharmaceutical composition containing the same
GB9012936D0 (en) 1990-06-11 1990-08-01 Fujisawa Pharmaceutical Co Thiophene derivatives,processes for preparation thereof and pharmaceutical composition comprising the same
US5254715A (en) 1990-11-07 1993-10-19 Warner-Lambert Company Aminosulfonyl carbamates
EP0525197B1 (en) 1991-01-21 1997-08-27 Shionogi Seiyaku Kabushiki Kaisha 3-benzylidene-1-carbamoyl-2-pyrrolidone analogs
US5162360A (en) 1991-06-24 1992-11-10 Warner-Lambert Company 2-heteroatom containing urea and thiourea ACAT inhibitors
DE4302702A1 (en) 1993-02-01 1994-08-04 Bayer Ag Arylaminosulfonylureas
AU6518694A (en) 1993-03-19 1994-10-11 Dowelanco A process for preparing halogenated isothiazoles
CA2159344A1 (en) 1993-03-30 1994-10-13 Minoru Moriwaki Cell adhesion inhibitor and thienotriazolodiazepine compound
WO1994024095A1 (en) 1993-04-16 1994-10-27 Abbott Laboratories Immunosuppressive agents
CA2123728A1 (en) 1993-05-21 1994-11-22 Noriyoshi Sueda Urea derivatives and their use as acat inhibitors
DE4337847A1 (en) 1993-11-05 1995-05-11 Bayer Ag Substituted phenylaminosulphonylureas
US5801170A (en) 1993-12-07 1998-09-01 Smithkline Beecham Plc Heterocyclic biphenylylamides useful as 5HT1D antagonists
DE4343831A1 (en) 1993-12-22 1995-06-29 Magyar Tudomanyos Akademia New N-substd. N-acyloxy:methyl-N'-sulphonyl-urea cpds
FR2715155B1 (en) 1994-01-19 1996-07-26 Mayoly Spindler Monoamine oxidase B inhibitors and methods of preparing them.
US5494925A (en) 1994-12-02 1996-02-27 Sterling Winthrop Inc. 2-heterocyclyloxymethyl and 2-heterocyclylthiomethyl-1,2,5-thiadiazolidin-3-one 1,1-dioxides and compositions and method of use thereof
US5716542A (en) 1995-04-24 1998-02-10 Takasago International Corporation Liquid crystal compound and liquid crystal composition containing the same
JPH09221476A (en) 1995-12-15 1997-08-26 Otsuka Pharmaceut Co Ltd Medicinal composition
JPH107804A (en) 1996-06-25 1998-01-13 Japan Synthetic Rubber Co Ltd Thermosetting resin composition
US6020357A (en) 1996-12-23 2000-02-01 Dupont Pharmaceuticals Company Nitrogen containing heteroaromatics as factor Xa inhibitors
DE69810527T2 (en) 1997-03-27 2004-11-04 Great Lakes Chemical (Europe) Gmbh 2- (2'-hydroxphenyl) benzotriazoles and their use as light stabilizers for organic polymers
TR199902593T2 (en) * 1997-04-22 2000-03-21 Neurosearch A/S Substituted phenyl derivatives, their preparation and use.
US6294573B1 (en) 1997-08-06 2001-09-25 Abbott Laboratories Reverse hydroxamate inhibitors of matrix metalloproteinases
US6235786B1 (en) 1997-08-06 2001-05-22 Abbott Laboratories Reverse hydroxamate inhibitors of matrix metalloproteinases
JP2001521934A (en) 1997-11-03 2001-11-13 ベーリンガー インゲルハイム ファーマシューティカルズ インコーポレイテッド Aromatic heterocyclic compounds as anti-inflammatory drugs
US7329670B1 (en) 1997-12-22 2008-02-12 Bayer Pharmaceuticals Corporation Inhibition of RAF kinase using aryl and heteroaryl substituted heterocyclic ureas
US20070244120A1 (en) 2000-08-18 2007-10-18 Jacques Dumas Inhibition of raf kinase using substituted heterocyclic ureas
US7517880B2 (en) 1997-12-22 2009-04-14 Bayer Pharmaceuticals Corporation Inhibition of p38 kinase using symmetrical and unsymmetrical diphenyl ureas
US6887893B1 (en) 1997-12-24 2005-05-03 Sankyo Company, Limited Methods and compositions for treatment and prevention of tumors, tumor-related disorders and cachexia
EP0928790B1 (en) 1998-01-02 2003-03-05 F. Hoffmann-La Roche Ag Thiazole derivatives
ATE234099T1 (en) 1998-04-24 2003-03-15 Leuven K U Res & Dev IMMUNE SUPPRESSIVE EFFECTS OF 8 SUBSTITUTED XANTHINE DERIVATIVES
US6197599B1 (en) 1998-07-30 2001-03-06 Guorong Chin Method to detect proteins
GB9823873D0 (en) 1998-10-30 1998-12-30 Pharmacia & Upjohn Spa 2-ureido-thiazole derivatives,process for their preparation,and their use as antitumour agents
US8124630B2 (en) 1999-01-13 2012-02-28 Bayer Healthcare Llc ω-carboxyaryl substituted diphenyl ureas as raf kinase inhibitors
US7928239B2 (en) 1999-01-13 2011-04-19 Bayer Healthcare Llc Inhibition of RAF kinase using quinolyl, isoquinolyl or pyridyl ureas
UA73492C2 (en) 1999-01-19 2005-08-15 Aromatic heterocyclic compounds as antiinflammatory agents
JP2000275886A (en) 1999-03-23 2000-10-06 Konica Corp Electrophotographic photoreceptor and process cartridge and image forming device using the same
US6410254B1 (en) 1999-05-18 2002-06-25 Cytokinetics Compositions and assays utilizing ADP or phosphate for detecting protein modulators
JP3972163B2 (en) 1999-06-18 2007-09-05 株式会社大塚製薬工場 Phosphonic acid diester derivatives
US6525046B1 (en) 2000-01-18 2003-02-25 Boehringer Ingelheim Pharmaceuticals, Inc. Aromatic heterocyclic compounds as antiinflammatory agents
US6500628B1 (en) 2000-05-25 2002-12-31 Millennium Pharmaceuticals, Inc. Nucleic acid molecules encoding human kinase and phosphatase homologues and uses therefor
US6645990B2 (en) 2000-08-15 2003-11-11 Amgen Inc. Thiazolyl urea compounds and methods of uses
US20020173507A1 (en) * 2000-08-15 2002-11-21 Vincent Santora Urea compounds and methods of uses
US7235576B1 (en) 2001-01-12 2007-06-26 Bayer Pharmaceuticals Corporation Omega-carboxyaryl substituted diphenyl ureas as raf kinase inhibitors
MXPA03006749A (en) 2001-02-15 2004-05-31 Boehringer Ingelheim Pharma Process for synthesis of heteroaryl-substituted urea compounds useful as antiinflammatory agents.
JP4343534B2 (en) 2001-03-02 2009-10-14 ゲーペーツェー バイオテック アクチェンゲゼルシャフト Three hybrid assay system
EP1281399A3 (en) 2001-08-01 2004-02-11 Warner-Lambert Company Dual inhibitors of wax ester and cholesteryl ester synthesis for inhibiting sebum production
CA2458029A1 (en) 2001-09-13 2003-03-20 Boehringer Ingelheim Pharmaceuticals, Inc. Methods of treating cytokine mediated diseases
US20040138216A1 (en) 2002-12-23 2004-07-15 Boehringer Ingelheim Pharma Gmbh & Co. Kg Process for the preparation of an essentially pure polymorph of an n-pyrazolyl-n'-naphthyl-urea
US7144911B2 (en) 2002-12-31 2006-12-05 Deciphera Pharmaceuticals Llc Anti-inflammatory medicaments
US7202257B2 (en) 2003-12-24 2007-04-10 Deciphera Pharmaceuticals, Llc Anti-inflammatory medicaments
US20080045531A1 (en) 2002-12-31 2008-02-21 Flynn Daniel L Anti-inflammatory medicaments
US20040171075A1 (en) 2002-12-31 2004-09-02 Flynn Daniel L Modulation of protein functionalities
WO2004113352A1 (en) 2003-06-19 2004-12-29 Amedis Pharmaceuticals Ltd. Silylated heterocyclylurea derivatives as cytokine-inhibitors
WO2005002673A1 (en) * 2003-07-03 2005-01-13 Astex Therapeutics Limited Raf kinase inhibitors
EP1678147B1 (en) * 2003-09-15 2012-08-08 Lead Discovery Center GmbH Pharmaceutically active 4,6-disubstituted aminopyrimidine derivatives as modulators of protein kinases
WO2005040139A2 (en) * 2003-10-23 2005-05-06 Ab Science 2-aminoaryloxazole compounds as tyrosine kinase inhibitors
WO2005048953A2 (en) 2003-11-13 2005-06-02 Ambit Biosciences Corporation Amide derivatives as kinase modulators
US20080220497A1 (en) 2003-12-24 2008-09-11 Flynn Daniel L Modulation of protein functionalities
US20070191336A1 (en) 2003-12-24 2007-08-16 Flynn Daniel L Anti-inflammatory medicaments
WO2006081034A2 (en) 2004-12-23 2006-08-03 Deciphera Pharmaceuticals, Llc Anti-inflammatory medicaments
US7188498B2 (en) * 2004-12-23 2007-03-13 Gm Global Technology Operations, Inc. Reconfigurable tools and/or dies, reconfigurable inserts for tools and/or dies, and methods of use
WO2007064872A2 (en) * 2005-12-01 2007-06-07 Bayer Healthcare Llc Urea compounds useful in the treatment of cancer
US7790756B2 (en) 2006-10-11 2010-09-07 Deciphera Pharmaceuticals, Llc Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases
US20080248548A1 (en) 2007-04-09 2008-10-09 Flynn Daniel L Modulation of protein functionalities
US20080248487A1 (en) 2007-04-09 2008-10-09 Flynn Daniel L Modulation of protein functionalities

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1994021647A1 (en) 1993-03-18 1994-09-29 Smithkline Beecham Plc Diclavulanate salt with a diamine and process of preparation
WO2003000008A2 (en) 2001-06-22 2003-01-03 The Government Of The United States Of America As Represented By The Secretary Of The Navy High speed electro-optic clock recovery circuit
WO2006071940A2 (en) 2004-12-23 2006-07-06 Deciphera Pharmaceuticals, Llc Enzyme modulators and treatments
WO2013098244A1 (en) 2011-12-30 2013-07-04 Wageningen Universiteit Modified cascade ribonucleoproteins and uses thereof

Non-Patent Citations (6)

* Cited by examiner, † Cited by third party
Title
ETTMAYER, J. MED. CHEM, vol. 47, no. 10, 2004, pages 2393 - 2404
HACKLER, J. HETEROCYCLIC CHEM., vol. 26, 1989, pages 1575 - 8
HUSE, M.; KURIYAN, J. CELL, vol. 109, pages 275 - 282
LORENZI, J. PHARM. EXP. THERPEUTICS, 2005, pages 883 - 8900
PLUK ET AL., CELL, vol. 108, 2002, pages 247
VAN ETTEN, FRENCH CELL BIOL., vol. 9, 1999, pages 179

Cited By (77)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8143293B2 (en) 2007-04-20 2012-03-27 Deciphera Pharmaceuticals, Llc Kinase inhibitors useful for the treatment of myleoprolific diseases and other proliferative diseases
WO2008131253A1 (en) * 2007-04-20 2008-10-30 Deciphera Pharmaceuticals, Llc Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases
WO2008131276A1 (en) * 2007-04-20 2008-10-30 Deciphera Pharmaceuticals, Llc Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases
WO2008140895A1 (en) * 2007-04-20 2008-11-20 Deciphera Pharmaceuticals, Llc Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases
WO2008131227A1 (en) * 2007-04-20 2008-10-30 Deciphera Pharmaceuticals, Llc Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases
EP2481736A1 (en) * 2007-04-20 2012-08-01 Deciphera Pharmaceuticals, LLC. Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases
US8614234B2 (en) 2009-09-03 2013-12-24 Allergan, Inc. Compounds as tyrosine kinase modulators
US9475801B2 (en) 2009-09-03 2016-10-25 Allergan, Inc. Compounds as tyrosine kinase modulators
CN102686577A (en) * 2009-09-03 2012-09-19 阿勒根公司 Compounds as tyrosine kinase modulators
US10221192B2 (en) 2009-09-03 2019-03-05 Allergan, Inc. Compounds as tyrosine kinase modulators
US9725433B2 (en) 2009-09-03 2017-08-08 Allergan, Inc. Compounds as tyrosine kinase modulators
WO2011028995A1 (en) * 2009-09-03 2011-03-10 Allergan, Inc. Compounds as tyrosine kinase modulators
AU2010289353B2 (en) * 2009-09-03 2016-12-08 Allergan, Inc. Compounds as tyrosine kinase modulators
US9328103B2 (en) 2009-09-03 2016-05-03 Allergan, Inc. Compounds as tyrosine kinase modulators
JP2013518089A (en) * 2010-02-01 2013-05-20 キャンサー・リサーチ・テクノロジー・リミテッド 1- (5-tert-butyl-2-phenyl-2H-pyrazol-3-yl) -3- [2-fluoro-4- (1-methyl-2-oxo-2,3-dihydro-1H-imidazo [ 4,5-B] pyridin-7-yloxy) -phenyl] -urea and related compounds and their use in therapy
JP2015180675A (en) * 2010-02-01 2015-10-15 キャンサー・リサーチ・テクノロジー・リミテッド 1-(5-tert-butyl-2-phenyl-2h-pyrazol-3-yl)-3-[2-fluoro-4-(1-methyl- 2-oxo-2,3-dihydro-1h-imidazo[4,5-b]pyridin-7-yloxy)-phenyl]-urea and related compounds and their use in therapy
WO2011137342A1 (en) 2010-04-29 2011-11-03 Deciphera Pharmaceuticals, Llc Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activites
US9296722B2 (en) 2010-05-27 2016-03-29 Ambit Biosciences Corporation Azolyl urea compounds and methods of use thereof
EP2594566A1 (en) * 2010-07-16 2013-05-22 Kyowa Hakko Kirin Co., Ltd. Nitrogenated aromatic heterocyclic ring derivative
EP2594566A4 (en) * 2010-07-16 2014-10-01 Kyowa Hakko Kirin Co Ltd Nitrogenated aromatic heterocyclic ring derivative
WO2012098416A1 (en) 2011-01-21 2012-07-26 Sun Pharma Advanced Research Company Ltd Diarylacetylene hydrazide containing tyrosine kinase inhibitors
US9562055B2 (en) 2011-05-13 2017-02-07 Array Biopharma Inc. Pyrrolidinyl urea, pyrrolidinyl thiourea and pyrrolidinyl guanidine compounds as TrkA kinase inhibitors
US9878997B2 (en) 2011-05-13 2018-01-30 Array Biopharma Inc. Pyrrolidinyl urea, pyrrolidinyl thiourea and pyrrolidinyl guanidine compounds as TrkA kinase inhibitors
US10323022B2 (en) 2011-05-13 2019-06-18 Array Biopharma Inc. Pyrrolidinyl urea, pyrrolidinyl thiourea and pyrrolidinyl guanidine compounds as TrkA kinase inhibitors
USRE48731E1 (en) 2012-06-07 2021-09-14 Deciphera Pharmaceuticals, Llc Dihydronaphthyridines and related compounds useful as kinase inhibitors for the treatment of proliferative diseases
US10889589B2 (en) 2012-11-13 2021-01-12 Array Biopharma Inc. Bicyclic urea, thiourea, guanidine and cyanoguanidine compounds useful for the treatment of pain
US9790178B2 (en) 2012-11-13 2017-10-17 Array Biopharma Inc. Pyrrolidinyl urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9822118B2 (en) 2012-11-13 2017-11-21 Array Biopharma Inc. Bicyclic heteroaryl urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9828360B2 (en) 2012-11-13 2017-11-28 Array Biopharma Inc. Pyrrolidinyl urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9790210B2 (en) 2012-11-13 2017-10-17 Array Biopharma Inc. N-(monocyclic aryl),N'-pyrazolyl-urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9896435B2 (en) 2012-11-13 2018-02-20 Array Biopharma Inc. N-pyrrolidinyl,N′-pyrazolyl-urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9969694B2 (en) 2012-11-13 2018-05-15 Array Biopharma Inc. N-(arylalkyl)-N′-pyrazolyl-urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9981959B2 (en) 2012-11-13 2018-05-29 Array Biopharma Inc. Thiazolyl and oxazolyl urea, thiourea, guanidine and cyanoguanidine compounds as TrkA kinase inhibitors
US9546156B2 (en) 2012-11-13 2017-01-17 Array Biopharma Inc. N-bicyclic aryl,N'-pyrazolyl urea, thiourea, guanidine cyanoguanidine compounds as TrkA kinase inhibitors
US9809578B2 (en) 2012-11-13 2017-11-07 Array Biopharma Inc. Pyrazolyl urea, thiourea, guanidine and cyanoguanidine compounds as trkA kinase inhibitors
US10851080B2 (en) 2012-11-13 2020-12-01 Array Biopharma Inc. Methods of treatment using pyrrolidinyl urea, thiourea, guanidine and cyanoguanidine compounds
US10351575B2 (en) 2012-11-13 2019-07-16 Array Biopharma Inc. Bicyclic urea, thiourea, guanidine and cyanoguanidine compounds useful for the treatment of pain
US10835533B2 (en) 2014-05-15 2020-11-17 Array Biopharma Inc. 1 -((3S,4R)-4-(3-fluorophenyl)-1-(2-methoxyethyl)pyrrolidin-3-yl)-3-(4-methyl-3-(2-methylpyrimidin-5-yl)-1-phenyl-1H-pyrazol-5-yl)urea as a TrkA kinase inhibitor
US9765072B2 (en) 2014-06-06 2017-09-19 Natco Pharma Limited 1H-1,8-naphthyridin-2ones as anti proliferative compounds
US10047088B2 (en) 2014-06-06 2018-08-14 Natco Pharma Limited 1H-1,8-naphthyridin-2-ones as anti proliferative compounds
WO2015186137A1 (en) 2014-06-06 2015-12-10 Natco Pharma Limited 1h-1,8- naphthyridin-2ones as anti proliferative compounds
US12102620B2 (en) 2018-01-31 2024-10-01 Deciphera Pharmaceuticals, Llc Combination therapy for the treatment of mastocytosis
US11986463B2 (en) 2018-01-31 2024-05-21 Deciphera Pharmaceuticals, Llc Combination therapy for the treatment of gastrointestinal stromal tumor
WO2021013712A1 (en) 2019-07-19 2021-01-28 Anagenesis Biotechnologies S.A.S. Polyaromatic urea derivatives and their use in the treatment of muscle diseases
US11529336B2 (en) 2019-08-12 2022-12-20 Deciphera Pharmaceuticals, Llc Methods of treating gastrointestinal stromal tumors
US12023326B2 (en) 2019-08-12 2024-07-02 Deciphera Pharmaceuticals, Llc Methods of treating gastrointestinal stromal tumors
US10966966B2 (en) 2019-08-12 2021-04-06 Deciphera Pharmaceuticals, Llc Methods of treating gastrointestinal stromal tumors
US12059410B2 (en) 2019-08-12 2024-08-13 Deciphera Pharmaceuticals, Llc Methods of treating gastrointestinal stromal tumors
US11426390B2 (en) 2019-08-12 2022-08-30 Deciphera Pharmaceuticals, Llc Methods of treating gastrointestinal stromal tumors
US11433056B1 (en) 2019-08-12 2022-09-06 Deciphera Pharmaceuticals, Llc Methods of treating gastrointestinal stromal tumors
US11266635B2 (en) 2019-08-12 2022-03-08 Deciphera Pharmaceuticals, Llc Methods of treating gastrointestinal stromal tumors
US11534432B2 (en) 2019-08-12 2022-12-27 Deciphera Pharmaceuticals, Llc Methods of treating gastrointestinal stromal tumors
US12059411B2 (en) 2019-08-12 2024-08-13 Deciphera Pharmaceuticals, Llc Methods of treating gastrointestinal stromal tumors
US11576904B2 (en) 2019-08-12 2023-02-14 Deciphera Pharmaceuticals, Llc Methods of treating gastrointestinal stromal tumors
US12023325B2 (en) 2019-08-12 2024-07-02 Deciphera Pharmaceuticals, Llc Methods of treating gastrointestinal stromal tumors
US12023327B2 (en) 2019-08-12 2024-07-02 Deciphera Pharmaceuticals, Llc Methods of treating gastrointestinal stromal tumors
US11344536B1 (en) 2019-08-12 2022-05-31 Deciphera Pharmaceuticals, Llc Methods of treating gastrointestinal stromal tumors
US11969414B2 (en) 2019-08-12 2024-04-30 Deciphera Pharmaceuticals, Llc Methods of treating gastrointestinal stromal tumors
US11813251B2 (en) 2019-08-12 2023-11-14 Deciphera Pharmaceuticals, Llc Methods of treating gastrointestinal stromal tumors
US11969415B1 (en) 2019-12-30 2024-04-30 Deciphera Pharmaceuticals, Llc (methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoropheyl)-3-phenylurea
US11850241B1 (en) 2019-12-30 2023-12-26 Deciphera Pharmaceuticals, Llc Compositions of 1-(4-bromo-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoropheyl)-3-phenylurea
US11185535B2 (en) 2019-12-30 2021-11-30 Deciphera Pharmaceuticals, Llc Amorphous kinase inhibitor formulations and methods of use thereof
US11793795B2 (en) 2019-12-30 2023-10-24 Deciphera Pharmaceuticals, Llc Compositions of 1-(4-bromo-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)-3-phenylurea
US11903933B2 (en) 2019-12-30 2024-02-20 Deciphera Pharmaceuticals, Llc Compositions of 1-(4-bromo-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoropheyl)-3-phenylurea
US11911370B1 (en) 2019-12-30 2024-02-27 Deciphera Pharmaceuticals, Llc Compositions of 1-(4-bromo-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoropheyl)-3-phenylurea
US11918564B1 (en) 2019-12-30 2024-03-05 Deciphera Pharmaceuticals, Llc Compositions of 1-(4-bromo-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoropheyl)-3-phenylurea
US11801237B2 (en) 2019-12-30 2023-10-31 Deciphera Pharmaceuticals, Llc Amorphous kinase inhibitor formulations and methods of use thereof
US11844788B1 (en) 2019-12-30 2023-12-19 Deciphera Pharmaceuticals, Llc Compositions of 1-(4-bromo-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoropheyl)-3-phenylurea
US11850240B1 (en) 2019-12-30 2023-12-26 Deciphera Pharmaceuticals, Llc Compositions of 1-(4-bromo-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoropheyl)-3-phenylurea
US11896585B2 (en) 2019-12-30 2024-02-13 Deciphera Pharmaceuticals, Llc Compositions of 1-(4-bromo-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)-3-phenylurea
US12064422B2 (en) 2019-12-30 2024-08-20 Deciphera Pharmaceuticals, Llc Compositions of 1-(4-bromo-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoropheyl)-3-phenylurea
US11612591B2 (en) 2019-12-30 2023-03-28 Deciphera Pharmaceuticals, Llc Compositions of 1-(4-bromo-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)-3-phenylurea
US12023328B2 (en) 2019-12-30 2024-07-02 Deciphera Pharmaceuticals, Llc Compositions of 1-(4-bromo-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluoropheyl)-3-phenylurea
US11576903B2 (en) 2019-12-30 2023-02-14 Deciphera Pharmaceuticals, Llc Amorphous kinase inhibitor formulations and methods of use thereof
US11395818B2 (en) 2019-12-30 2022-07-26 Deciphera Pharmaceuticals, Llc Compositions of 1-(4-bromo-5-(1-ethyl-7-(methylamino)-2-oxo-1,2-dihydro-1,6-naphthyridin-3-yl)-2-fluorophenyl)-3-phenylurea
EP4029501A1 (en) 2021-01-19 2022-07-20 Anagenesis Biotechnologies Combination of polyaromatic urea derivatives and glucocorticoid or hdac inhibitor for the treatment of diseases or conditions associated with muscle cells and/or satellite cells
US11779572B1 (en) 2022-09-02 2023-10-10 Deciphera Pharmaceuticals, Llc Methods of treating gastrointestinal stromal tumors

Also Published As

Publication number Publication date
CN101553233B (en) 2013-05-29
BR122020010667B8 (en) 2021-07-27
AU2007307679A1 (en) 2008-04-17
BRPI0719195A8 (en) 2018-03-13
JP2012158606A (en) 2012-08-23
IL197933A (en) 2015-02-26
BR122020010667B1 (en) 2021-03-09
RU2009117615A (en) 2010-11-20
WO2008046003A3 (en) 2008-08-21
PT2073811E (en) 2015-06-09
CA2666563C (en) 2015-12-22
MX2009003704A (en) 2009-08-12
JP5042314B2 (en) 2012-10-03
BRPI0719195B8 (en) 2021-05-25
IL197933A0 (en) 2009-12-24
CN101553233A (en) 2009-10-07
KR20090080517A (en) 2009-07-24
AU2007307679B9 (en) 2013-11-21
US20080090856A1 (en) 2008-04-17
US8586565B2 (en) 2013-11-19
US7790756B2 (en) 2010-09-07
EP2073811B1 (en) 2015-03-11
RU2482112C2 (en) 2013-05-20
SG175640A1 (en) 2011-11-28
BRPI0719195B1 (en) 2020-10-13
ES2538215T3 (en) 2015-06-18
EP2073811A2 (en) 2009-07-01
KR101439823B1 (en) 2014-09-15
EP2073811A4 (en) 2009-11-11
CA2666563A1 (en) 2008-04-17
JP2010506850A (en) 2010-03-04
BRPI0719195A2 (en) 2015-05-26
US20110136760A1 (en) 2011-06-09
AU2007307679B2 (en) 2013-10-31
JP5557872B2 (en) 2014-07-23
DK2073811T3 (en) 2015-06-22
HK1139036A1 (en) 2010-09-10

Similar Documents

Publication Publication Date Title
AU2007307679B9 (en) Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases
AU2007296450C1 (en) Kinase inhibitors useful for the treatment of proliferative diseases
US8143293B2 (en) Kinase inhibitors useful for the treatment of myleoprolific diseases and other proliferative diseases
US20120225057A1 (en) Methods and compositions for the treatment of myeloproliferative diseases and other proliferative diseases
WO2013036232A2 (en) Methods and compositions for the treatment of myeloproliferative diseases and other proliferative diseases
EP2942349A1 (en) Enzyme modulators and treatments
US20110189167A1 (en) Methods and Compositions for the Treatment of Myeloproliferative Diseases and other Proliferative Diseases

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200780045591.2

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 07844173

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 2007844173

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 197933

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: MX/A/2009/003704

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 12009500645

Country of ref document: PH

WWE Wipo information: entry into national phase

Ref document number: 1945/CHENP/2009

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 2666563

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2007307679

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 2009532577

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 1020097009667

Country of ref document: KR

ENP Entry into the national phase

Ref document number: 2009117615

Country of ref document: RU

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2007307679

Country of ref document: AU

Date of ref document: 20071011

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: PI0719195

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20090409