WO2007121978A1 - Abwehrstoff gegen die bildung von haustorien als pflanzenschutzmittel gegen pflanzenparasiten - Google Patents

Abwehrstoff gegen die bildung von haustorien als pflanzenschutzmittel gegen pflanzenparasiten Download PDF

Info

Publication number
WO2007121978A1
WO2007121978A1 PCT/EP2007/003556 EP2007003556W WO2007121978A1 WO 2007121978 A1 WO2007121978 A1 WO 2007121978A1 EP 2007003556 W EP2007003556 W EP 2007003556W WO 2007121978 A1 WO2007121978 A1 WO 2007121978A1
Authority
WO
WIPO (PCT)
Prior art keywords
nucleic acid
polypeptide
plant
spp
sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2007/003556
Other languages
English (en)
French (fr)
Inventor
Ralf Kaldenhoff
Markus Albert
Marc Bleischwitz
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Technische Universitaet Darmstadt
Original Assignee
Technische Universitaet Darmstadt
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Technische Universitaet Darmstadt filed Critical Technische Universitaet Darmstadt
Publication of WO2007121978A1 publication Critical patent/WO2007121978A1/de
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
    • C12N15/8271—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
    • C12N15/8279—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
    • C12N9/64—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue
    • C12N9/6421—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue from mammals
    • C12N9/6472—Cysteine endopeptidases (3.4.22)

Definitions

  • the present invention relates to a peptide inhibitor of a plant cysteine protease which inhibits the formation of haustoria in plant pathogens and its use as a plant protection agent, in particular in tomato or soybean.
  • the family Cuscutaceae (sometimes this family is also counted among the Convolvulaceae) includes about 150 species of the genus Cuscuta, all of which live parasitically on other angiosperms. All Cuscuta A ⁇ en consist of a sinuous shoot, have no roots and only rudimentary, flaky leaves. In local latitudes, Cuscuta europapea, also called devil's twine or spring-silk, is native to and above all found on river meadows, whereby the nettle usually serves as a host plant.
  • haustoria Cwscttta plants make contact with the vascular system of the host plants and deprive them of organic and inorganic nutrients. But these haustoria are not just nutrients.
  • Cuscuta also serves as an effective vector for the delivery of various viruses, and the transfer of RNAs or RNA-protein complexes can not be ruled out.
  • Cuscuta reflexa infects almost every plant and deprives the host plants of important nutrients, which can lead to the death of the infected plants. Whole fields of crops can be destroyed in this way. Especially in soybean and tomato growing in America and Southeast Asia, this has devastating consequences. Since Cuscuta reflexa is a higher plant, it is particularly difficult to effectively combat the parasites without harming the crops.
  • ERSAT ⁇ SHEET (RULE 26) Hand removed In case of larger infestation, the field may be burned down to prevent an epidemic. (Source: http://www.ipm.ucdavis.edulPMGIPESTNOTESlpn7496.html) As an alternative, one uses the spray glyphosate ("RoundUp” ®)
  • haustoria The development of haustoria is vital to Cuscuta's survival and is the key to successful infection. Cellular factors play an essential role in the development of haustoria.
  • Nadler-Hassar et al. (Nadler-Hassar T, Goldshmidt A, Rubin B, Wolf S. Glyphosate inhibits the translocation of green fluorescent protein and sucrose from a transgenic tobacco host to Cuscuta campestris Yunk Planta 2004 Sep; 219 (5): 790-6. Epub 2004 Jun 2.) describe the effect of glyphosate on Cuscuta campestris on tobacco.
  • Torres et al. (Torres MJ, Tomilov AA, Tomilova N, Reagan RL, Yoder Jsc, Pscroph, a parasitic EST database enriched for parasite-associated transcripts, BMC Plant Biol. 2005 Nov 16; 5: 24.) Describe a haustoria-relevant EST database ,
  • Tada et al. (Tada Y, Wakasugi T, Nishikawa A, Furuhashi K, Yamada K) Developmental Regulation of a Low-Molecular-weight Heat Shock Protein During Fodus formation in the seedling of a holoparasitic plant, Cuscuta japonica., Plant Cell Physiol. 2000 Dec; 41 (12): 1373-80.) Describe the identification of a gene involved in the formation of haustoria in Cuscuta japonica.
  • the sequence number AF 138265 relates to a particular cysteine protease (papain-like cysteine proteinase isoform II) from the sweet potato (Ipomoea batatas). This was deposited on March 26, 1999 in the database.
  • the sequence number Q9M7D5 IPOBA also relates to a particular cysteine protease. This was deposited in the database in October 2000.
  • US 6,451,604 also describes a particular cysteine protease (Sequence 165).
  • WO 02/22675 relates to a particular cysteine protease (Sequence 500) from Arabidopsis thaliana.
  • US 4,915,726 relates to a method of controlling Cuscuta, wherein the plant is sprayed with a fungal culture as a mycoherbicide.
  • Valueva and Mosolov (Roe of inhibitors of proteolytic enzymes in plant defense against phytopathogenic microorganisms, Biochemistry (Moses), 2004 Nov; 69 (l): 1305-9) describe various uses of proteinases and their inhibitors.
  • this object is achieved by a polypeptide of a cysteine protease comprising an inhibitor peptide according to SEQ ID NO: 1 or a peptide sequence having at least 80% and preferably 90% amino acid identity to SEQ ID NO: 1
  • a cysteine protease comprising an inhibitor peptide having at least 95% amino acid identity to SEQ ID NO: 1.
  • Peptides preferred according to the invention comprise the inhibitor peptide according to SEQ ID No. 2, optionally with an N- or C-terminal amino acid extension, preferably with a length of 5, more preferably 10, even more preferably 20, 50 or 100 amino acids in length, either from a corresponding protease or as a fusion protein.
  • Components of the fusion protein may be, for example, enzyme labels.
  • the peptide of the invention may be of any length as long as the peptide inhibits haustoria formation under appropriate conditions. However, preference is given to inhibitor peptides according to the invention which do not comprise the complete protease sequence.
  • a polypeptide according to the invention according to SEQ ID No. 2 is particularly preferred.
  • the peptide according to the invention can also be its homologue or orthologue of the peptide of SEQ ID No. 1 or SEQ ID No. 2.
  • the present invention provides a way of preventing parasitic infestation of host plants by house-producing plant pathogens, preferably Cuscuta, pathogenic fungi and particularly preferably C. reflexa, and to prevent plants which have already been attacked by parasites. free.
  • house-producing plant pathogens preferably Cuscuta, pathogenic fungi and particularly preferably C. reflexa
  • a harmless peptide according to the invention in an aqueous solution, for example, which is also biodegradable, penetration of infectious organs of the parasite (haustoria) is prevented or dissolves the parasite from the treated plant. In this way, a spread of the parasite on agricultural land is suppressed.
  • the proteinase according to the invention (SEQ ID NO: 2) is produced by the parasite as a so-called Pra-Pro protein and then secreted by means of pre-peptide to the outside in the vicinity of the potential host.
  • the pro-peptide which acts as an inhibitor of the proteinase function
  • the actual proteinase is activated. If the proteinase is inhibited, this prevents the successful infection and prevents the spread of the parasite.
  • EP 1,637,607 describes promoters for the activation of plant genes after infections with pathogens, such as bacteria, viruses, fungi, unicellulars.
  • the promoters in question should be able to regulate the transcription of specific genes of the host plant by interaction with pathogens or elicitors.
  • a peptide from the parasite Cuscuta is used to repel the parasite.
  • a reaction of the host plant to the infection with the pathogen is not provided.
  • an interaction of host and parasite by establishing chimeric cell walls should just be prevented.
  • the method in EP 1,637,607 also refers to the genes of the host for the identification of genes induced by pathogens.
  • cysteine protease described in the present patent application, however, differs fundamentally.
  • a parasite-specific protease with a Parasite-specific inhibitor is a parasite-specific infection mechanism, the Hau- storien Struktur be prevented.
  • the invention is a cysteine proteinase inhibitor, a peptide from the parasite Cuscuta reflexa, which is intended to protect crops.
  • This peptide can be easily prepared by common biotechnological methods. By spraying this peptide on host plants for the parasite C. reflexa can be successfully prevent parasitization.
  • the present invention is innovative for several reasons: it is easy to manufacture, easy to use, and environmentally friendly.
  • polypeptide of the invention may be characterized by being synthetically produced. Corresponding methods are well known to those skilled in the art and described in the literature. Furthermore, the peptides according to the invention can also be present as retro-inverse peptides or peptidomimetics, which differ in particular from the structure of the peptide backbone of conventional peptides.
  • the invention also relates to a method for optimizing an inhibitor peptide according to the invention, in which the inhibitor peptide is modified in its amino acid sequence by standard methods (eg by conservative or non-conservative amino acid substitutions) and the peptide thus modified is examined for its properties which may normally include effectiveness in inhibiting skin aorta and stability in compositions, but also reduced toxicity or degradability.
  • Correspondingly modified inhibitor peptides are also included in the present invention and also have at least 80% and preferably 90% amino acid identity to SEQ ID NO: 1.
  • a further aspect of the present invention relates to a nucleic acid which codes for a polypeptide according to the invention.
  • the nucleic acid is characterized in that it is a DNA, RNA, mRNA, cDNA, CNA, PNA, preferably a DNA, in particular a double-stranded DNA having a length of at least 24 nucleotides.
  • the nucleic acids according to the invention can also be longer.
  • a nucleic acid according to the invention characterized in that the sequence of the nucleic acid has at least one intron and / or one polyA sequence.
  • Particularly preferred is a nucleic acid according to the invention in the form of its complementary "antisense" sequence.
  • the nucleic acid may be characterized in that it has been produced synthetically. Corresponding methods are well known to those skilled in the art and described in the literature.
  • a further aspect of the present invention then relates to a vector, preferably in the form of a plasmid, shuttle vector, phagemid, cosmid, expression vector, retroviral vector, adenoviral vector or particle and / or gene-therapeutically active vector comprising a nucleic acid according to the invention.
  • Yet another aspect of the present invention relates to a method of producing an antibody directed against a polypeptide of the invention, preferably a polyclonal or monoclonal antibody, for inhibiting a polypeptide of the invention comprising an antibody-producing organism with a polypeptide of the invention or portions thereof having at least 6 amino acids, preferably is immunized with at least 8 amino acids, in particular with at least 12 amino acids.
  • These antibodies can serve as tools in the study of the function of the peptides of the invention.
  • Yet another aspect of the present invention relates to an antibody, particularly monoclonal antibody, prepared as above directed against a polypeptide of the invention.
  • Antibody fragments can also be made, such as recombinant scFv antibody fragments or Fab.
  • the object is achieved by a process for the preparation of a crop protection composition
  • a process for the preparation of a crop protection composition comprising mixing a polypeptide according to the invention with a suitable carrier.
  • the carrier can be an aqueous solution, a combination with a conventional crop protection agent or a cell lysate.
  • a crop protection composition prepared according to the invention comprising a polypeptide according to the invention, a nucleic acid according to the invention and / or an antibody according to the invention, optionally with a suitable carrier as above.
  • the object is achieved by a method for producing a transgenic plant comprising transformation of a plant cell with a nucleic acid according to the invention.
  • the cell is transformed with an expression construct to express a polypeptide of the invention.
  • Preferred is a method wherein the nucleic acid is preceded by an export sequence, so that the peptide is exported from the cell.
  • the polypeptide By expression of the polypeptide by the host plant itself, it is capable of directly repelling the parasite. Preference is given to two possibilities: a) integration of the nucleic acid sequence (s) encoding the polypeptide of the invention into the genome of the host plant, and b) integration of the nucleic acid sequence (s) encoding the polypeptide of the invention into the genome of the host plant including an upstream export sequence such that the peptide is brought outside and in direct contact with the parasite.
  • a preferred export sequence is the presequence of the cysteine protease (AS 1 to 31 of SEQ ID NO: 2).
  • the object is achieved by a transgenic plant produced by a method according to the invention as above.
  • the transgenic plants may be all plants which are infested by haustoria-producing plant pathogens, but especially plants selected from tomato (Solanum lycopersicum L.), soybean ⁇ Glycine max (L.)), sugar beet (Beta vulgaris), alfalfa ( Alfalfa, Medicago sativa), clover (Trifolium spp.), Wine (Vitis spp.), Red pepper (Capsicum spp.), Onion (Allium cepa), broad bean (Viciafaba), lettuce (Lactuca spp.), Spinach (Spinacia spp .), Bonsai tree and citrus plant.
  • the object is achieved by a method for controlling haustoria-producing plant pathogens comprising applying a crop protection composition as above to a plant.
  • a crop protection composition as above to a plant.
  • the inhibitor peptide according to the invention preferably the propeptide (PIN, SEQ ID NO: 1) derived from the precursor sequence of the cysteine proteinase, e.g. produced in E. coli and can either be purified or even applied in E. coli lysate, the formation of haustoria can be specifically prevented.
  • cysteine proteinase inhibitor peptides of the invention may also be present in the composition according to the invention.
  • the method according to the invention for controlling haustoria-producing plant pathogens can in principle be used for all plant pathogens forming haustoria since it is assumed that the present cysteine proteinase inhibits Tor peptides represent a central target for Haustorien Struktur, since the effectiveness was in the experiments carried out in the invention at 100%. Further preferred is an inventive method for controlling haustoria-producing plant pathogens, wherein the plant pathogens are selected from Cuscuta, pathogenic fungi, rust fungi, mildew and parasites of the family Orobranchaceae.
  • the plants to be treated are all plants which are attacked by haustoria-producing plant pathogens, but especially plants such as tomatoes (Solarium lycospersicum L.), soybeans (Glycine max (L.)), sugar beets (Beta vulgaris), alfalfa (Alfalfa , Medicago sativa), clover (Trifolium spp.), Wine (Vitis spp.), Paprika (Capsicum spp.), Onion (Allium cepa), broad beans (Vicia faba), lettuce (Lactuca spp.), Spinach (Spinacia spp .), Bonai trees and citrus plants.
  • tomatoes Small lycospersicum L.
  • soybeans Glycine max (L.)
  • sugar beets Beta vulgaris
  • alfalfa Alfalfa
  • Medicago sativa Medicago sativa
  • clover Trifolium spp.
  • Bonsai trees are understood to mean, in particular, all woody, small-leaved (or small-noble) tree and shrub species, whereby pine trees, junipers, maples, Asian elm species, azaleas, fruit trees such as cultivated apple or Japanese apricot are traditionally used, but also small-leaved maple species - among them the red-leaved Japanese maple varieties - spruce and beech.
  • Particularly preferred is a method for controlling haustoria-producing plant pathogens wherein the application of the peptides of the invention and / or the composition is carried out by spraying on the plant.
  • a still further aspect of the present invention relates to the use of a erf ⁇ ndungswashen peptide, a nucleic acid according to the invention and / or an antibody of the invention for controlling haustoria-producing plant pathogens as already explained above.
  • a way is shown, which prevents parasitic infestation of host plants by preferably C. reflexa and frees already infected plants from the parasite.
  • a non-hazardous peptide for example in an aqueous solution that is also biodegradable, infiltrating infection organs of the parasite, prevents or dissolves the parasite of the treated plant. In this way, a spread of the parasite on agricultural land is suppressed.
  • SEQ ID NO: 1 The amino acid sequence of the propeptide according to the invention (inhibitor sequence) from C. reflexa.
  • SEQ ID NO: 2 The amino acid sequence of the entire inventive cysteine proteinase from C. reflexa.
  • SEQ ID NO: 3 The cDNA sequence according to the invention of the entire cysteine proteinase from C. reflexa.
  • SEQ ID NO: 4 The cDNA sequence according to the invention of the propeptide (inhibitor sequence).
  • FIG. 1 shows the effect of the inhibitor pro-peptide according to the invention.
  • A normal, unaffected infestation
  • B effect of the inhibitor pro-peptide according to the invention 7 days after administration.
  • FIG. 2 a schematic representation of the Gateway® vector used, showing the Rekombinationsort (dashed lined). At the 5'-end are two 35S promoters. The meaning of the abbreviations: attR: attachment site, Cm r : chloramphenicol resistance, ccdB: "killer gene” (the gene product inhibits the helicase of the cell), nos T: transcriptional stop, Hyg r : hygromycin resistance. The vector also contains kanamycin resistance (not shown).
  • a cDNA library in the scope of about 7000 cDNA clones of the parasite Cuscuta was created. Specifically, tissue from Prehau storien and haustoria used to produce the cDNA library. The parasitic cDNA clones were plated in duplicate on "microarray chips.” Two identical “chips” were hybridized with two different cDNA probes, one with total pre-mammorial and haustorial tissue RNA as template, and the other with total RNA were synthesized from Cuscuta shoot as a template. In this way, so far 2000 cDNA clones have been screened differentially for cDNAs whose genes are induced in haustoria development, ie during infection in the parasite Cuscuta reflexa.
  • the cDNA sequence according to the invention of the entire cysteine proteinase (SEQ ID NO: 3) is:
  • the cDNA sequence of the propeptide (inhibitor sequence) (SEQ ID NO: 4) according to the invention is:
  • amino acid sequence of the polypeptide of the invention (protease sequence) (SEQ ID NO: 2) is (starting methionine underlined):
  • amino acid sequence of the propeptide (inhibitor sequence) (SEQ ID NO: 1) according to the invention is:
  • FIG. 1 Examples of the effect of the pro-peptide are shown in FIG. 1. Left (A) shows the normal unaffected infestation, in the right-hand diagram (B) the effect of the pro-peptide 7 days after application. These results were obtained in 100% of the cases.
  • the constructs were made using Gateway® technology (Invitrogen, U.S.A.). This method is based on the recombination of the construct into the vector, using the site-specific recombination sites of the phage lambda instead of "conventional" ligation using endonuclease and ligase. After recombination, the propeptide is located at the 3 'end of two 35S promoters (FIG. 2) which constitutively express the gene.
  • Agrobacteria (GV3101) were incubated overnight at 28 ° C and 200 rpm in 3 ml 2YT-
  • leaf discs from approx. 6 weeks old tobacco leaves were punched out with a cork borer (0 0.8 cm).
  • the leaf discs were sterilized in 2% sodium hypochlorite solution.
  • To transform the leaf cells with the construct the leaf discs were transferred to the bacterial suspension and incubated for 5 min. Thereafter, the leaf discs were placed on an absorbent material to remove excess fluid. Subsequently, the leaf discs were transferred to co-culture medium (composition see below) and incubated in a climatic cabinet for 2 days at 25 ° C and 16 h light (50-60 ⁇ mol / m 2 s).
  • the discs were transferred to selection medium (composition: see above). After incubation for 1 week at the above ratios, the leaf discs were divided into four parts and incubated for a further three weeks on selection medium. After about three weeks, shoots formed, these were cut off at the base when they had reached a length of 5 - 10 mm and transferred to root medium (composition: see above). After the roots had formed roots, they were removed from the agar and planted in a mixture of soil, perlite and macrolite and covered with a transparent foil for 3-7 days. The period of regeneration to the rooted plant was two months. Six more weeks passed until flowering.
  • Co-culture medium 1 x MS (Murashige & Skoge) micro- and
  • Root medium 1 x MS (Murashige & Skoge) micro and macro elements
  • NAA naphthylacetic acid

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Wood Science & Technology (AREA)
  • Biomedical Technology (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Molecular Biology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Cell Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Peptides Or Proteins (AREA)
  • Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
  • Agricultural Chemicals And Associated Chemicals (AREA)

Abstract

Die vorliegende Erfindung betrifft einen Peptid-Inhibitor einer pflanzlichen Cysteinprotease, der die Ausbildung von Haustorien bei Pflanzenpathogenen hemmt und dessen Verwendung als Pflanzenschutzmittel, insbesondere bei Tomate oder Sojabohne.

Description

Abwehrstoff gegen die Bildung von Haustorien als Pflanzenschutzmittel gegen Pflanzenparasiten
Die vorliegende Erfindung betrifft einen Peptid-Inhibitor einer pflanzlichen Cysteinprotease, der die Ausbildung von Haustorien bei Pflanzenpathogenen hemmt und dessen Verwendung als Pflanzenschutzmittel, insbesondere bei Tomate oder Sojabohne.
Die Familie der Cuscutaceae (manchmal wird diese Familie auch zu den Convolvulaceae gezählt) umfasst ca. 150 Spezies der Gattung Cuscuta, die alle parasitisch auf anderen Angiospermen leben. Alle Cuscuta-Aήen bestehen aus einem gewundenen Spross, besitzen keine Wurzeln und nur rudimentäre, schuppenfÖrmige Blätter. In hiesigen Breiten ist Cuscuta euro- paea, auch Teufelszwirn oder Springseide genannt, heimisch und vor allem an Flußauen anzutreffen, wobei meist die Brennnessel als Wirtspflanze dient.
Mit speziellen Organen, den sog. Haustorien, stellen Cwscttta-Pflanzen Kontakt zum Gefäßsystem der Wirtspflanzen her und entziehen diesen organische und anorganische Nährstoffe. Doch werden durch diese Haustorien nicht nur Nährstoffe geschleust. Cuscuta dient ebenso als effektiver Vektor zur Übertragung von verschiedenen Viren, und auch die Übertragung von RNAs bzw. RNA-Protein Komplexen kann nicht ausgeschlossen werden.
Der pflanzliche Parasit Cuscuta reflexa infiziert nahezu jede Pflanze und entzieht den Wirtspflanzen wichtige Nährstoffe, welches zu einem Absterben der infizierten Pflanzen führen kann. Ganze Felder von Nutzpflanzen können auf diese Art vernichtet werden. Vor allem beim Sojabohnen- und Tomatenanbau in Amerika und im südostasiatischen Raum hat dies verheerende Folgen. Da es sich bei Cuscuta reflexa um eine höhere Pflanze handelt, bereitet es besondere Schwierigkeiten den Parasiten wirksam zu bekämpfen ohne die Nutzpflanzen zu schädigen.
Heutzutage werden die Samen von Cuscuta und Nutzpflanzen aufwendig getrennt, um zu vermeiden, dass es einer unkontrollierten Ausbreitung des Schädlings kommt. In vielen Ländern besteht ein striktes Verbot Samen zu verkaufen, welche mit Cuscuta Samen infiziert sind. Falls es zu einem Cuscuta-Befall kommt werden die Pflanzen, bei kleinerem Befall, per
ERSAT^BLATT (REGEL 26) Hand entfernt Bei größerem Befall wird das Feld unter Umständen abgebrannt um eine Epidemie zu verhindern. (Quelle: http://www.ipm.ucdavis.edulPMGIPESTNOTESlpn7496.html) Als Alternative verwendet man das Spritzmittel Glyphosat („RoundUp"®)
Die Entwicklung von Haustorien ist für Cuscuta überlebenswichtig und stellt den zentralen Schritt für eine erfolgreiche Infektion dar. Bei der Ausbildung von Haustorien spielen zelluläre Faktoren eine essentielle Rolle.
Albert et al (in Albert M, Werner M, Proksch P, Fry SC, Kaldenhoff R. The cell wall- modifying xyloglucan endotransglycosylase/hydrolase LeXTHl is expressed during the de- fence reaction of tomato against the plant parasite Cuscuta reflexa. Plant Biol (Stuttg). 2004 Jul;6(4):402-7.) beschreiben die Identifizierung von Genen, die im Frühstadium der Infektion mit Cuscuta induziert werden. Ein identifiziertes Gen war eine Hydrolase, XTH.
Nadler-Hassar et al. (Nadler-Hassar T, Goldshmidt A, Rubin B, Wolf S. Glyphosate inhibits the translocation of green fluorescent protein and sucrose from a transgenic tobacco host to Cuscuta campestris Yunk. Planta. 2004 Sep;219(5):790-6. Epub 2004 Jun 2.) beschreiben die Wirkung von Glyphosat auf Cuscuta campestris an Tabak.
Torres et al. (Torres MJ, Tomilov AA, Tomilova N, Reagan RL, Yoder JI. Pscroph, a parasitic plant EST database enriched for parasite associated transcripts. BMC Plant Biol. 2005 Nov 16;5:24.) beschreiben eine Haustorien-relevante EST-Datenbank.
Tada et al. (Tada Y, Wakasugi T, Nishikawa A, Furuhashi K, Yamada K. Developmental regulation of a gene coding for a low-molecular-weight heat shock protein during haustorium formation in the seedlings of a holoparasitic plant, Cuscuta japonica. Plant Cell Physiol. 2000 Dec;41(12):1373-80.) beschreiben die Identifizierung eines Gens, das an der Bildung von Haustorien in Cuscuta japonica beteiligt ist.
Die Sequenznummer AF 138265 betrifft eine bestimmte Cysteinprotease (papain-like cysteine Proteinase isoform II) aus der Süßkartoffel (Ipomoea batatas). Diese wurde am 26. März 1999 in der Datenbank hinterlegt. Die Sequenznummer Q9M7D5 IPOBA betrifft ebenfalls eine bestimmte Cysteinprotease. Diese wurde im Oktober 2000 in der Datenbank hinterlegt. US 6,451,604 beschreibt ebenfalls eine bestimmte Cysteinprotease (Sequenz 165). WO 02/22675 betrifft eine bestimmte Cysteinprotease (Sequenz 500) aus Arabidopsis thaliana.
US 4,915,726 betrifft ein Verfahren zur Kontrolle von Cuscuta, wobei die Pflanze mit einer Pilzkultur als Mycoherbizid besprüht wird.
Valueva und Mosolov (RoIe of inhibitors of proteolytic enzymes in plant defense against phy- topathogenic microorganisms. Biochemistry (Mose). 2004 Nov;69(l l):1305-9) beschreiben verschiedene Verwendungen von Proteinasen und deren Inhibitoren.
Im Hinblick auf die oben genannten Nachteile des Standes der Technik ist es eine Aufgabe der vorliegenden Erfindung, ein neues und Umwelt-schonendes Verfahren von Haustorien- bildenden Pflanzenpathogenen zur Verfügung zu stellen. Das Verfahren soll auf einem Wirkstoff beruhen, der wirksam, unbedenklich und kostengünstig herzustellen ist.
Gemäß eines ersten Aspekts der vorliegenden Erfindung wird diese Aufgabe durch ein Polypeptid einer Cystein-Protease, umfassend ein Inhibitor-Peptid gemäß SEQ ID Nr. 1 oder eine Peptidsequenz mit mindestens 80% und bevorzugt 90% Aminosäure-Identität zu SEQ ID Nr. 1 gelöst. Bevorzugt ist eine Cystein-Protease, die ein Inhibitor-Peptid mit mindestens 95% Aminosäure-Identität zu SEQ ID Nr. 1 umfaßt. Erfindungsgemäß bevorzugte Peptide umfassen das Inhibitor-Peptid gemäß SEQ ID Nr. 2, gegebenenfalls mit einer N- oder C- terminalen Aminosäure- Verlängerung, bevorzugt mit einer Länge von 5, weiter bevorzugt 10, noch weiter bevorzugt 20, 50 oder 100 Aminosäuren Länge, entweder aus einer entsprechenden Protease oder als Fusionsprotein. Bestandteile des Fusionsproteins können zum Beispiel Enzymmarker sein. Das erfindungsgemäße Peptid kann jede Länge aufweisen, solange das Peptid die Haustorien-Bildung unter geeigneten Bedingungen inhibiert. Bevorzugt sind jedoch erfindungsgemäße Inhibitor-Peptide, die nicht die vollständige Proteasesequenz umfassen. Besonders bevorzugt ist ein erfindungsgemäßes Polypeptid gemäß SEQ ID Nr. 2. Das erfindungsgemäße Peptid kann auch sein Homolog oder Ortholog des Peptids der SEQ ID Nr. 1 oder SEQ ID Nr. 2 sein.
Durch die vorliegende Erfindung wird ein Weg aufgezeigt, der einen Parasitenbefall von Wirtspflanzen durch Haustorien-bildenden Pflanzenpathogene, bevorzugt Cuscuta, pathogene Pilze und besonders bevorzugt C. reflexa verhindert und bereits befallene Pflanzen vom Para- siten befreit. Durch die Anwendung eines erfindungsgemäßen ungefährlichen Peptids in einer z.B. wässrigen Lösung, das zudem biologisch abbaubar ist, wird ein Eindringen von Infektionsorganen des Parasiten (Haustorien), verhindert bzw. löst sich der Parasit von der behandelten Pflanze ab. Auf diese Weise wird eine Ausbreitung des Parasiten auf landwirtschaftlich genutzten Anbauflächen unterbunden.
Die erfindungsgemäße Proteinase (SEQ ID Nr. 2) wird als so genanntes Pra-Pro-Protein vom Parasiten hergestellt und dann mittels Prä-Peptid nach außen in die Nahe des potentiellen Wirtes geschleust. Durch Abspalten des Pro-Peptids, welches als Inhibitor der Proteinase- funktion wirkt, wird die eigentliche Proteinase aktiviert. Ist die Proteinase gehemmt, wird dadurch die erfolgreiche Infektion verhindert und eine Verbreitung des Parasiten unterbunden.
EP 1,637,607 beschreibt Promotoren zur Aktivierung von Pflanzengenen nach Infektionen mit Pathogenen, wie Bakterien, Viren, Pilzen, Einzellern. Die betreffenden Promotoren sollen in der Lage sein, durch Interaktion mit Pathogenen bzw. Elicitoren die Transkription spezieller Gene der Wirtspflanze zu regulieren. Im Gegensatz dazu wird in der vorliegenden Patentanmeldung ein Peptid aus dem Parasiten Cuscuta zur Abwehr des Parasiten verwendet. Eine Reaktion der Wirtspflanze auf die Infektion mit dem Pathogen ist nicht vorgesehen. Im Gegenteil, eine Interaktion von Wirt und Parasit durch Etablierung chimärer Zellwände soll gerade verhindert werden. Darüber hinaus bezieht sich auch das Verfahren in EP 1,637,607 zur Identifikation von Genen, die durch Pathogene induziert werden, ausschließlich auf die Gene des Wirtes.
Rooney et al (in Rooney HC, Van't Klooster JW, van der Hoorn RA, Joosten MH, Jones JD, de Wit PJ. Cladosporium Avr2 inhibits tomato Rcr3 protease required for Cf-2-dependent disease resistance. Science. 2005 Jun 17;308(5729): 1783-6. Epub 2005 Apr 21.) beschreiben, daß durch die Komplexbildung einer extrazellulären Cystein-Protease aus der Tomate (Rcr3) mit einem inhibitorischen Protein aus dem Pathogen Cladosporium fuhum (Avr2) das Cf-2- Protein der Tomate eine HR-Reaktion auslösen kann. Es handelt sich also um das interessante Phänomen, daß durch die Inhibition einer wirtsspezifischen Protease mit einem pathogen- spezifischen Inhibitor eine Abwehrreaktion der Wirtspflanze induziert wird. Die Funktion der in der vorliegenden Patentanmeldung beschriebenen Cystein-Protease unterscheidet sich demgegenüber grundlegend. Durch Inhibition einer Parasit-spezifischen Protease mit einem Parasit-spezifischen Inhibitor soll ein Parasit-spezifischer Infektionsmechanismus, die Hau- storienbildung, verhindert werden.
Bei der Erfindung handelt es sich in einer bevorzugten Ausführungsform um einen Cystein- proteinase-Inhibitor, ein Peptid aus dem Parasiten Cuscuta reflexa, das dem Pflanzenschutz dienen soll. Dieses Peptid lässt sich einfach mit gängigen biotechnologischen Methoden herstellen. Durch Aufsprühen dieses Peptids auf Wirtspflanzen für den Parasiten C. reflexa lässt sich eine Parasitierung erfolgreich verhindern. Die vorliegende Erfindung ist aus mehreren Gründen innovativ: Sie ist leicht herzustellen, leicht anzuwenden und umweltverträglich.
Das erfindungsgemäße Polypeptid kann dadurch gekennzeichnet sein, daß es synthetisch hergestellt worden ist. Entsprechende Verfahren sind dem Fachmann bestens bekannt und in der Literatur beschrieben. Weiterhin können die erfindungsgemäßen Peptide auch als retro- inverse Peptide oder Peptidomimetika vorliegen, die sich insbesondere durch den Aufbau des Peptidrückgrats von herkömmlichen Peptiden unterscheiden.
Die Erfindung betrifft auch ein Verfahren zur Optimierung eines erfindungsgemäßen Inhibitor-Peptids, bei dem das Inhibitor-Peptid in seiner Aminosäuresequenz durch Standardverfahren verändert wird (z.B. durch konservative oder nicht-konservative Aminosäure-Austausche) und das so veränderte Peptid auf seine Eigenschaften hin untersucht wird, die normalerwiese Effektivität bei der Inhibierung der Hautorien und Stabilität in Zusammensetzungen, aber auch eine reduzierte Toxizität oder Abbaubarkeit einschließen können. Entsprechend veränderte Inhibitor-Peptide sind ebenfalls von der vorliegenden Erfindung umfaßt und weisen ebenfalls zu mindestens 80% und bevorzugt 90% Aminosäure- Identität zu SEQ ID Nr. 1 auf.
Ein weiterer Aspekt der vorliegenden Erfindung betrifft eine Nukleinsäure, die für ein erfindungsgemäßes Polypeptid kodiert. Die Nukleinsäure ist dadurch gekennzeichnet, daß sie eine DNA, RNA, mRNA, cDNA, CNA, PNA, vorzugsweise eine DNA, insbesondere eine doppelsträngige DNA ist mit einer Länge von mindestens 24 Nukleotiden ist. Die erfindungsgemäßen Nukleinsäuren können aber auch länger sein. Weiter bevorzugt ist eine erfindungsgemäße Nukleinsäure, dadurch gekennzeichnet, daß die Sequenz der Nukleinsäure mindestens ein Intron und/oder eine polyA-Sequenz aufweist. Besonders bevorzugt ist ein erfindungsgemäße Nukleinsäure in Form ihrer komplementären "antisense"-Sequenz. Erfindungsgemäß kann die Nukleinsäure dadurch gekennzeichnet sein, daß sie synthetisch hergestellt worden ist. Entsprechende Verfahren sind dem Fachmann bestens bekannt und in der Literatur beschrieben. Ein weiterer Aspekt der vorliegenden Erfindung betrifft dann einen Vektor, vorzugsweise in Form eines Plasmids, Shuttle Vektors, Phagemids, Cosmids, Expressionsvektors, retroviralen Vektors, adenoviralen Vektors oder Partikels und/oder gentherapeutisch wirksamen Vektors, umfassend eine erfindungsgemäße Nukleinsäure.
Ein noch weiterer Aspekt der vorliegenden Erfindung betrifft ein Verfahren zur Herstellung eines gegen ein erfindungsgemäßes Polypeptid gerichteten Antikörpers, vorzugsweise eines polyklonalen oder monoklonalen Antikörpers zur Inhibierung eines erfindungsgemäßen Polypeptids, wobei ein Antikörper produzierender Organismus mit einem erfindungsgemäßen Polypeptid oder Teilen davon mit mindestens 6 Aminosäuren, vorzugsweise mit mindestens 8 Aminosäuren, insbesondere mit mindestens 12 Aminosäuren immunisiert wird. Diese Antikörper können als Werkzeuge bei der Untersuchung der Funktion der erfindungsgemäßen Peptide dienen. Ein noch weiterer Aspekt der vorliegenden Erfindung betrifft einen Antikörper, insbesondere monoklonalen Antikörper, hergestellt wie oben, der gegen ein erfindungsgemäßes Polypeptid gerichtet ist. Es können auch Antikörper-Fragmente hergestellt werden, wie zum Beispiel rekombinante scFv-Antikörperfragmente oder Fab.
Gemäß eines weiteren Aspekts der vorliegenden Erfindung wird die Aufgabe durch ein Verfahren zur Herstellung einer Pflanzenschutz-Zusammensetzung gelöst, umfassend Mischen eines erfindungsgemäßen Polypeptids mit einem geeigneten Träger. Bevorzugt kann der Träger eine wäßrige Lösung, eine Kombination mit einem herkömmlichen Pflanzenschutzmittel oder ein Zellysat sein. Weiter bevorzugt ist eine erfindungsgemäß hergestellte Pflanzenschutz-Zusammensetzung, umfassend ein erfindungsgemäßes Polypeptid eine erfindungsgemäße Nukleinsäure und/oder einen erfindungsgemäßen Antikörper, gegebenenfalls mit einem geeigneten Träger wie oben.
Gemäß eines weiteren Aspekts der vorliegenden Erfindung wird die Aufgabe durch ein Verfahren zur Herstellung einer transgene Pflanze gelöst, umfassend Transformation einer Pflanzenzelle mit einer erfindungsgemäßen Nukleinsäure. Bevorzugt wird die Zelle mit einem Expressionskonstrukt transformiert, so dass sie ein erfindungsgemäßes Polypeptid exprimiert. Bevorzugt ist ein Verfahren, wobei der Nukleinsäure eine Exportsequenz vorgeschaltet ist, so daß das Peptid aus der Zelle exportiert wird.
Durch Expression des Polypeptids durch die Wirtspflanze selbst ist diese in der Lage, den Parasiten direkt abzuwehren. Bevorzugt sind zwei Möglichkeiten: a) Integration der das erfindungsgemäße Polypeptid kodierenden Nukleinsäuresequenz(en) in das Genom der Wirtspflanze, und b) Integration der das erfindungsgemäße Polypeptid kodierenden Nukleinsäure- sequenz(en) in das Genom der Wirtspflanze einschließlich einer vorgeschalten Exportsequenz, so daß das Peptid nach außen und in direkten Kontakt mit dem Parasiten gebracht wird. Eine bevorzugte Exportsequenz ist die Präsequenz der Cystein-Protease (AS 1 bis 31 der SEQ ID Nr. 2).
Gemäß eines weiteren Aspekts der vorliegenden Erfindung wird die Aufgabe durch eine transgene Pflanze, hergestellt nach einem erfindungsgemäßen Verfahren wie oben, gelöst. Die transgenen Pflanzen können alle Pflanzen sein, die durch Haustorien-bildende Pflanzenpathogene befallen werden, besonders jedoch Pflanzen ausgewählt aus Tomate (So- lanum lycopersicum L.), Sojabohne {Glycine max (L.)), Zuckerrübe (Beta vulgaris), Luzerne (Alfalfa, Medicago sativa), Klee (Trifolium spp.), Wein (Vitis spp.), Paprika (Capsicum spp.), Zwiebel (Allium cepa), dicke Bohne (Viciafaba), Salat (Lactuca spp.), Spinat (Spinacia spp.), Bonsai-Baum und Zitruspflanze.
Gemäß eines weiteren Aspekts der vorliegenden Erfindung wird die Aufgabe durch ein Verfahren zur Bekämpfung von Haustorien-bildenden Pflanzenpathogenen, umfassend Aufbringen einer Pflanzenschutz-Zusammensetzung wie oben auf eine Pflanze gelöst. Durch die erfindungsgemäß bevorzugte äußere Applikation des Inhibitor-Peptids, bevorzugt des ProPeptids (PIN, SEQ ID Nr. 1), das von der Vorläufersequenz der Cysteinproteinase abstammt, die z.B. in E. coli hergestellt wird und entweder aufgereinigt oder sogar im E. coli Lysat aufgetragen werden kann, kann die Ausbildung von Haustorien gezielt verhindert werden. In der erfindungsgemäßen Zusammensetzung können auch mehrere erfindungsgemäße Cysteinproteinase Inhibitor-Peptide vorhanden sein.
Das erfindungsgemäße Verfahren zur Bekämpfung von Haustorien-bildenden Pflanzenpathogenen kann grundsätzlich für alle Pflanzenpathogene verwendet werden, die Haustorien aubilden, da angenommen wird, dass die vorliegenden Cysteinproteinase Inhibi- tor-Peptide einen zentralen Angriffspunkt auf die Haustorienbildung darstellen, da die Effektivität in den im Rahmen der Erfindung durchgeführten Experimenten bei 100% lag. Weiter bevorzugt ist ein erfindungsgemäßes Verfahren zur Bekämpfung von Haustorien-bildenden Pflanzenpathogenen, wobei die Pflanzenpathogene ausgewählt sind aus Cuscuta, pathogenen Pilzen, Rostpilzen, Mehltau und Parasiten der Familie der Orobranchaceae.
Die zu behandelnden Pflanzen sind alle Pflanzen, die durch Haustorien-bildende Pflanzenpathogene befallen werden, besonders jedoch Pflanzen wie Tomaten (Solarium lyco- persicum L.), Sojabohnen (Glycine max (L.)), Zuckerrüben (Beta vulgaris), Luzerne (Alfalfa, Medicago sativa), Klee (Trifolium spp.), Wein (Vitis spp.), Paprika (Capsicum spp.), Zwiebel (Allium cepa), dicke Bohnen (Vicia fabä), Salat (Lactuca spp.), Spinat (Spinacia spp.), Bon- sai-Bäumen und Zitruspflanzen. Unter Bonsai-Bäumen werden insbesondere alle verholzenden, kleinblättrigen (bzw. kleinnadligen) Baum- und Straucharten verstanden, wobei traditionell Kiefern, Wacholder, Ahorne, asiatische Ulmenarten, Azaleen, Fruchtbäume wie Kulturapfel oder japanische Aprikose verwendet werden, aber auch kleinblättrige Ahornarten - unter ihnen die rotblättrigen japanischen Ahornsorten - Fichten und Buchen.
Besonders bevorzugt ist ein Verfahren zur Bekämpfung von Haustorien-bildenden Pflanzenpathogenen wobei das Aufbringen der erfindungsgemäßen Peptide und/oder der Zusammensetzung durch Aufsprühen auf die Pflanze erfolgt.
Zuletzt betrifft ein noch weiterer Aspekt der vorliegenden Erfindung die Verwendung eines erfϊndungsgemäßen Peptids, einer erfindungsgemäßen Nukleinsäure und/oder eines erfindungsgemäßen Antikörpers zur Bekämpfung von Haustorien-bildenden Pflanzenpathogenen wie oben ereits erläutert.
Durch die hier dargestellte Erfindung wird ein Weg aufgezeigt, der einen Parasitenbefall von Wirtspflanzen durch bevorzugt C. reflexa verhindert und bereits befallene Pflanzen vom Parasiten befreit. Durch die Anwendung eines ungefährlichen Peptids z.B. in einer wässrigen Lösung, das zudem biologisch abbaubar ist, wird ein Eindringen von Infektionsorganen des Parasiten, verhindert bzw. löst sich der Parasit von der behandelten Pflanze ab. Auf diese Weise wird eine Ausbreitung des Parasiten auf landwirtschaftlich genutzten Anbauflächen unterbunden. Das Peptid ist ein natürliches Produkt, das vollständig abbaubar ist. Es lässt sich spezifisch nur gegen den Parasiten anwenden, eventuelle Nützlinge, sowie die zu schützende Nutzpflanze (=Wirtspflanze) nehmen aller Voraussicht nach keinen Schaden.
Die vorliegende Erfindung soll im folgenden anhand der beigefügten Beispiele weiter beschrieben werden, ohne jedoch auf diese beschränkt zu werden. In den Figuren und Sequenzen zeigt:
SEQ ID Nr. 1 : Die Aminosäure-Sequenz des erfindungsgemäßen Propeptids (Inhibitor-Sequenz) aus C. reflexa.
SEQ ID Nr. 2: Die Aminosäure-Sequenz der gesamten erfindungsgemäßen Cystein-Proteinase aus C. reflexa.
SEQ ID Nr. 3: Die erfindungsgemäße cDNA-Sequenz der gesamten Cystein-Proteinase aus C. reflexa.
SEQ ID Nr. 4: Die erfindungsgemäße cDNA-Sequenz des Propeptids (Inhibitor-Sequenz).
Figur 1 : die Wirkung des erfindungsgemäßen Inhibitor-Pro-Peptids. (A) normaler unbeein- flusster Befall, (B) Wirkung des erfindungsgemäßen Inhibitor-Pro-Peptids 7 Tage nach Applikation.
Figur 2: eine schematische Darstellung des verwendeten Gateway® Vektors, welche den Rekombinationsort zeigt (gestrichelt unterlegt). Am 5'-Ende befinden sich zwei 35S Promotoren. Die Bedeutung der Abkürzungen: attR: attachment site, Cmr: Chloramphenicolresistenz, ccdB: "Killergen" (Das Genprodukt inhibiert die Helikase der Zelle), nos T: Transkriptions- stop, Hygr: Hygromycinresistenz. Der Vektor enthält ebenfalls eine Kanamycinresistenz (nicht gezeigt).
Beispiele
Im Rahmen der vorliegenden Erfindung wurde eine cDNA-Bibliothek im Umfang von ca. 7000 cDNA Klonen des Parasiten Cuscuta angelegt. Es wurde speziell Gewebe aus Prähau- storien und Haustorien zur Herstellung der cDNA-Bibliothek verwendet. Die parasitären cDNA-Klone wurden in zweifacher Ausfuhrung auf „Microarray chips" aufgetragen. Zwei identische „Chips" wurden mit zwei unterschiedlichen cDNASonden hybridisiert, die einmal mit Gesamt-RNA aus prähaustorialem und haustorialem Gewebe als Matrize, und im andern Fall mit Gesamt-RNA aus Cuscuta-Spross als Matrize synthetisiert wurden. Auf diese Weise sind bis jetzt 2000 cDNA-Klone differentiell nach cDNAs durchmustert worden, deren Gene bei der Haustorienentwicklung, also während der Infektion im Parasiten Cuscuta reflexa induziert sind.
cDNA-Klone deren Gene während der Infektion in Cwscwta-Prähaustorien induziert sind, auf dem Chip also deutliche Signale gaben, wurden sequenziert. Deren cDNA, sowie Protein- Sequenzen wurden in Datenbanken (NCBI) mit bekannten Sequenzen verglichen.
Dabei wurde die Sequenz für die erfindungsgemäße Cystein Proteinase, sowie die darin enthaltene Teilsequenz des erfindungsgemäßen Inhibitor-Peptids identifiziert, die in der cDNA zu 86% und in der Aminosäuresequenz zu 90% zu einer Cystein-Protease aus der Süßkartoffel {Ipomoea batatas) identisch war.
Die erfϊndungsgemäße cDNA-Sequenz der gesamten Cystein-Proteinase (SEQ ID Nr. 3) lautet:
ATGGCACTCCGTTTATCTCTCATGTTCTTACTATGCTCCTTCCTCCTAGTGACAACGTCTTTGGGGCTCGCCGAC
TTCACAGTTTTCAAGAAGCGGTTCGGAAAGGCGTACGCCTCGGAGGAGGAGCACGATTACAGGTTCTCTGTGTTC
GATTTGACCCCATCCGAATTCAAACGCAACTTTCTCGGATTGAATCGCCGGCTTAGGTTTCCAGCCGATGCTCAA ACAGCTCCCACCCTTCCCACCGACGATCTCCCGTCAGATTTCGATTGGAGAGACCATGGTGCCGTTACGGCAGTA
ACTGGGAAGCTCGTGAGCCTTAGTGAGCAACAGCTTGTGGATTGTGATCACGAGTGTGACCCTGAAGAAGCTGGT TCTTGTGATTCTGGCTGCAATGGCGGGCTCATGACCAGCGCCTTTGAATACACATTGAAAGCTGGCGGGCTAATG AGGGAAGAAGACTACCCTTACACAGGCAACGATGCTCAAGTCTGCAACTTTGACAAAACCAAGATTGCAGCCAAG GTTGCCAACTTCAGCGTGGTATCCCTCGACGAAGACCAAATCGCTGCAAATCTGGTCAAGAACGGCCCTCTTGCA GTGGCAATCAACGCAGTGTTCATGCAGACATACGCAGGGGGAGTTTCATGCCCATACATTTGCTCCAAGCGGTTG GACCATGGCGTCCTGCTGGTGGGTTATGGTTCAGCAGGCTATGCCCCTGTTCGGGCGAAAGAGAAGCCTTATTGG GTCATCAAGAACTCTTGGGGAGAGCAATGGGGGGAGAAGGGGTACTACAAGATATGCAGGGGAAGCAATGTGTGT GGAGTGGACTCCATGGTTTCAACTGTTGCAGCTGTTAGCACCAACTCGGAGTAGCAGCAGCAAAGAAAGTAGCTT TTGTACATAAGTTTTTTTTTGCGTGTGATGTCCTGGGGAGCCATAACACAATACAGCATCACATTATGCAAGTGT
GTGTATTCACTATTATTTcATTAATCTATTTCTCAATTTGGTCAAAAAAAAAAAAAAAAAAAAAAAAAA
Die erfindungsgemäße cDNA-Sequenz des Propeptids (Inhibitor-Sequenz) (SEQ ID Nr. 4) ist:
ATTCTGATCCGTCAAGTTGTCGGAGACGACGGCGCACTGCTGAGCGACGACCACCAATTCACAGTTTTCAAGAAG CGGTTCGGAAAGGCGTACGCCTCGGAGGAGGAGCACGATTACAGGTTCTCTGTGTTCAAGGCTAACATGCGCCTT GCAAAGCAACACCAACAGCTCGACCCCTCCGCCGTCCACGGTGTCACTCGCTTCTCCGATTTGACCCCATCCGAA TTCAAACGCAACTTTCTCGGATTGAATCGCCGGCTTAGGTTTCCAGCCGATGCTCAAACAGCTCCCACCCTTCCC ACCGACGAT
Die Aminosäure-Sequenz des erfindungsgemäßen Polypeptids (Protease-Sequenz) (SEQ ID Nr. 2) lautet (Start-Methionin unterstrichen):
MALRLSLMFLLCSFLLVTTSLGLADGSSSDDILIRQVVGDDGALLSDDHQFTVFKKRFGKAYASEEEHDYRFSVF KANMRLAKQHQQLDPSAVHGVTRFSDLTPSEFKRNFLGLNRRLRFPADAQTAPTLPTDDLPSDFDWRDHGAVTAV KNQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEAGSCDSGCNGGLMTSAFEYTLKAGGLM REEDYPYTGNDAQVCNFDKTKIAAKVANFSVVSLDEDQIAANLVKNGPLAVAINAVFMQTYAGGVSCPYICSKRL DHGVLLVGYGSAGYAPVRAKEKPYWVIKNSWGEQWGEKGYYKICRGSNVCGVDSMVSTVAAVSTNSE
DieAminosäure-Sequenzdes erfindungsgemäßen Propeptids(Inhibitor-Sequenz) (SEQ ID Nr.1) lautet:
ILIRQVVGDDGALLSDDHQFTVFKKRFGKAYASEEEHDYRFSVFKANMRLAKQHQQLDPSAVHGVTRFSDLTPSE FKRNFLGLNRRLRFPADAQTAPTLPTDD
Die oben beschriebene Wirkung des Pro-Peptid wurde in Gewächshausversuchen an Cuscuta reflexa mit den Wirtspflanzenspezies Tabak (Nicotiana tabacum vor. Samsuή). Tomate (Ly- copersicon esculentum var. Money Maker) und Buntnessel (Coleus blumeϊ) durchgeführt.
Beispiele der Wirkung des Pro-Peptids verdeutlicht Figur 1. Links (A) ist der normale unbe- einflusste Befall zu sehen, in der rechten Abbildung (B) die Wirkung des Pro-Peptids 7 Tage nach Applikation. Diese Ergebnisse wurden in 100% der Fälle erhalten.
Konstitutive Expression des Propeptids in Nicotiana tabacum
Herstellung des Konstruktes
Die Konstrukte wurden mit Hilfe der Gateway® Technologie hergestellt (Invitrogen, U.S.A). Diese Methode basiert auf der Rekombination des Konstrukts in den Vektor und nutzt dabei die orts-spezifischen Rekombinationsstellen des Phagen Lambda, anstelle von "herkömmlicher" Ligation mittels Endonuklease und Ligase. Das Propeptid befindet sich nach erfolgter Rekombination am 3 '-Ende von zwei 35S-Promotoren (Figur 2), welche das Gen konstitutiv exprimieren. Das hergestellte Konstrukt wurde durch Hitzeschocktransformation in Agrobak- terien (GV3101) kloniert. Der Vektor wurde über ABRC-Stocks (http://www.arabidopsis.org/servlets/Order?state=catalog) bezogen. Der Vektor wurde dort von Mark D. Curtis und UeIi Grossnikiaus (2003) bereitgestellt.
Stabile Transformation von Nicotiana tabacum nach Horsch et al. (1985)
Die Agrobakterien (GV3101) wurden über Nacht bei 28 °C und 200 U/min in 3 ml 2YT-
Medium angezogen. 1 ml dieser Kultur wuH<5 dazu benutzt um 50 ml 2YT zu inokulieren. Das Medium enthielt jeweils 200 mg/L Kanamycin und 150 mg/1 Rifampicin. Die Kultur wurde bei 28 °C für weitere 24 Stunden inkubiert. Danach wurde die O.D.600 auf 1,0 mit 2YT eingestellt. Dies ergab eine Suspension mit einem Endvolumen von ca. 150 ml.
Es wurden 100 Blattscheiben aus ca. 6 Wochen alten Tabakblättern mit einem Korkbohrer (0 0,8 cm) ausgestanzt. Die Blattscheiben wurden in 2%iger Natriumhypochlorit-Lösung sterilisiert. Zur Transformation der Blattzellen mit dem Konstrukt wurden die Blattscheiben in die Bakterien-Suspension überführt und für 5 min inkubiert. Danach wurden die Blattscheiben auf ein saugfähiges Material gelegt, um überschüssige Flüssigkeit zu entfernen. Anschließend wurden die Blattscheiben auf Co-Kultivierungsmedium (Zusammensetzung s.u.) transferiert und in einem Klimaschrank für 2 Tage bei 25 °C und 16 h Licht (50-60 μmol/m2s) inkubiert.
Es erfolgte ein Transfer der Scheiben auf Selektionsmedium (Zusammensetzung: s.u.). Nach einer Inkubation von 1 Woche bei obengenannten Verhältnissen wurden die Blattscheiben in vier Teile geteilt und weitere drei Wochen auf Selektionsmedium inkubiert. Nach ca. drei Wochen bildeten sich Sprosse, diese wurden an der Basis abgeschnitten, wenn sie ein Länge von 5 - 10 mm erreicht hatten und auf Wurzelmedium überführt (Zusammensetzung: s.u.). Nachdem die Sprosse Wurzeln gebildet hatten, wurden sie vom Agar befreit und in einer Mischung aus Erde, Perlit und Makrolit eingepflanzt und für 3-7 Tage mit einer transparenten Folie abgedeckt. Die Zeitspanne der Regeneration bis zur bewurzelten Pflanze, betrug zwei Monate. Sechs weitere Wochen vergingen bis zur Blütenbildung.
2YT-Medium: lό g Trypton
10 g Yeast Extrakt 5,0 g NaCl 200 mg/1 Kanamycin 150 mg/1 Rifampicin
Co-Kultivierungs-Medium: 1 x MS (Murashige & Skoge) Mikro- und
Makroelemente 3 % Sucrose (ICN) 1 mg/1 6-Benzylaminopurin (BAP) pH 5,8 mit KOH 0,8 % Pflanzen Agar MS-Vitamine Selektions-Medium: wie Co-Kultivierungsmedium Antibiotika applizieren: 70 mg/L Hygromycin B 500 mg/L Carbenicillin
Wurzel-Medium: 1 x MS (Murashige & Skoge) Mikro- und Makroelemente
3 % Sucrose (ICN)
0,1 mg/1 Naphtylessigsäure (NAA)
MS -Vitamine
0,8 % Pflanzen Agar pH 5,8 mit KOH
Erdenzusammensetzung : 2 Teile Perlit
3 Teile Vermikulit (Hydroglimmer)
4 Teile Pflanzenerde

Claims

Patentansprüche
1. Polypeptid einer Cystein-Protease, umfassend ein Inhibitor-Peptid gemäß SEQ ID Nr. 1 oder eine Peptidsequenz mit mindestens 80% Aminosäure-Identität zu SEQ ID Nr. 1.
2. Polypeptid im wesentlichen bestehend aus SEQ ID Nr. 1 oder SEQ ID Nr. 2.
3. Nukleinsäure, die für ein Polypeptid nach einem der Ansprüche 1 oder 2 kodiert.
4. Nukleinsäure nach Anspruch 3, dadurch gekennzeichnet, daß sie eine DNA, RNA, mRNA, cDNA, CNA, PNA, vorzugsweise eine DNA, insbesondere eine doppelsträngige DNA ist mit einer Länge von mindestens 24 Nukleotiden ist.
5. Nukleinsäure nach einem der Ansprüche 3 oder 4, dadurch gekennzeichnet, daß die Sequenz der Nukleinsäure mindestens ein Intron und/oder eine polyA-Sequenz aufweist.
6. Nukleinsäure nach einem der Ansprüche 3 bis 5 in Form ihrer komplementären "antisense"-Sequenz.
7. Nukleinsäure nach einem der Ansprüche 3 bis 6, dadurch gekennzeichnet, daß die Nukleinsäure synthetisch hergestellt worden ist.
8. Vektor, vorzugsweise in Form eines Plasmids, Shuttle Vektors, Phagemids, Cosmids, Expressionsvektors, retroviralen Vektors, adenoviralen Vektors oder Partikels und/oder gentherapeutisch wirksamen Vektors, umfassend eine Nukleinsäure nach einem der Ansprüche 3 bis 7.
9. Polypeptid nach Anspruch 1 oder 2, dadurch gekennzeichnet, daß das Polypeptid synthetisch hergestellt worden ist.
10. Verfahren zur Herstellung eines gegen ein Polypeptid gerichteten Antikörpers, vorzugsweise eines polyklonalen oder monoklonalen Antikörpers zur Inhibierung eines Polypeptids nach Anspruch 1, 2 oder 9, dadurch gekennzeichnet, daß ein Antikörper produzierender Organismus mit einem Polypeptid oder Teilen davon mit mindestens 6 Aminosäuren, vorzugsweise mit mindestens 8 Aminosäuren, insbesondere mit mindestens 12 Aminosäuren nach einem der Ansprüche 1, 2 oder 9 immunisiert wird.
11. Antikörper, insbesondere monoklonaler Antikörper, hergestellt nach Anspruch 10, dadurch gekennzeichnet, daß er gegen ein Polypeptid nach einem der Ansprüche 1, 2 oder 9 gerichtet ist.
12. Verfahren zur Herstellung einer Pflanzenschutz-Zusammensetzung, umfassend Mischen eines Polypeptids nach einem der Ansprüche 1 , 2 oder 9 mit einem geeigneten Träger.
13. Verfahren nach Anspruch 12, dadurch gekennzeichnet, daß der Träger eine wäßrige Lösung ist.
14. Pflanzenschutz-Zusammensetzung, umfassend ein Polypeptid nach einem der Ansprüche
I, 2 oder 9, eine Nukleinsäure nach Anspruch 6 und/oder einen Antikörper nach Anspruch
I 1 , gegebenenfalls mit einem geeigneten Träger.
15. Verfahren zur Herstellung einer transgene Pflanze, umfassend Transformation einer Pflanzenzelle mit einer Nukleinsäure nach einem der Ansprüche 3 bis 8.
16. Verfahren nach Anspruch 15, wobei die Pflanzenzelle ein Polypeptid nach einem der Ansprüche 1 oder 2 exprimiert.
17. Verfahren nach Anspruch 15 oder 16, wobei der Nukleinsäure eine Exportsequenz vorgeschaltet ist, so daß das Peptid aus der Zelle exportiert wird.
18. Transgene Pflanze, hergestellt nach einem der Ansprüche 1 bis 17.
19. Transgene Pflanze nach Anspruch 18, ausgewählt aus Tomate {Solarium lycopersicum L.), Sojabohne {Glycine max (L.)), Zuckerrübe {Beta vulgaris), Luzerne (Alfalfa, Medicago sativa), Klee {Tήfolium spp.), Wein {Vitis spp.), Paprika {Capsicum spp.), Zwiebel (AlIi- um cepά), dicke Bohne (Vicia faba), Salat {Lactuca spp.), Spinat {Spinacia spp.), Bonsai- Baum und Zitruspflanze.
20. Verfahren zur Bekämpfung von Haustorien-bildenden Pflanzenpathogenen, umfassend Aufbringen einer Pflanzenschutz-Zusammensetzung nach Anspruch 14 auf eine Pflanze.
21. Verfahren nach Anspruch 20, dadurch gekennzeichnet, daß die Pflanzenpathogene ausgewählt sind aus Cuscuta, pathogenen Pilzen, Rostpilzen, Mehltau und Parasiten der Familie der Orobranchaceae.
22. Verfahren nach Anspruch 20 oder 21, dadurch gekennzeichnet, daß die Pflanzen ausgewählt sind aus Tomaten (Solarium lycopersicum L.), Sojabohnen (Glycine max (L.)), Zuckerrüben (Beta vulgaris), Luzerne (Alfalfa, Medicago sativa), Klee (Trifolium spp.), Wein (Vitis spp.), Paprika (Capsicum spp.), Zwiebel (Allium cepa), dicke Bohnen (Vicia fabä), Salat (Lactuca spp.), Spinat (Spinacia spp.), Bonsai-Bäumen und Zitruspflanzen.
23. Verfahren nach einem der Ansprüche 20 bis 22, dadurch gekennzeichnet, daß das Aufbringen durch Aufsprühen erfolgt.
24. Verwendung eines Polypeptids nach einem der Ansprüche 1 , 2 oder 9, einer Nukleinsäure nach Anspruch 6 und/oder eines Antikörpers nach Anspruch 1 1 , zur Bekämpfung von Haustorien-bildenden Pflanzenpathogenen.
PCT/EP2007/003556 2006-04-21 2007-04-23 Abwehrstoff gegen die bildung von haustorien als pflanzenschutzmittel gegen pflanzenparasiten Ceased WO2007121978A1 (de)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
DE102006018583.8A DE102006018583B4 (de) 2006-04-21 2006-04-21 Abwehrstoff gegen die Bildung von Haustorien als Pflanzenschutzmittel gegen Pflanzenparasiten
DE102006018583.8 2006-04-21

Publications (1)

Publication Number Publication Date
WO2007121978A1 true WO2007121978A1 (de) 2007-11-01

Family

ID=38456548

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2007/003556 Ceased WO2007121978A1 (de) 2006-04-21 2007-04-23 Abwehrstoff gegen die bildung von haustorien als pflanzenschutzmittel gegen pflanzenparasiten

Country Status (2)

Country Link
DE (1) DE102006018583B4 (de)
WO (1) WO2007121978A1 (de)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002094008A2 (en) * 2001-01-26 2002-11-28 Virginia Tech Intellectual Properties, Inc. Transgenic plants protected against parasitic plants
US20030082724A1 (en) * 1999-06-04 2003-05-01 Genesis Research And Development Corporation Limited Compositions affecting programmed cell death and their use in the modification of plant development
WO2005030967A2 (en) * 2003-09-25 2005-04-07 Pioneer Hi-Bred International, Inc. Crop plant cystatin proteinase inhibitors and methods of use

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2336337B1 (de) * 1998-11-12 2015-07-29 Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. Chimäre Promotoren, befähigt zur Vermittlung der Genexpression in Pflanzen bei Infektion mit Pathogenen sowie deren Verwendungen

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20030082724A1 (en) * 1999-06-04 2003-05-01 Genesis Research And Development Corporation Limited Compositions affecting programmed cell death and their use in the modification of plant development
WO2002094008A2 (en) * 2001-01-26 2002-11-28 Virginia Tech Intellectual Properties, Inc. Transgenic plants protected against parasitic plants
WO2005030967A2 (en) * 2003-09-25 2005-04-07 Pioneer Hi-Bred International, Inc. Crop plant cystatin proteinase inhibitors and methods of use

Non-Patent Citations (8)

* Cited by examiner, † Cited by third party
Title
ALBERT, MARKUS: "Studien zur Interaktion des pflanzlichen Parasiten Cuscuta reflexa mit dem inkompatiblen Wirt Lycopersicon esculentum", 2005, TU DARMSTADT, FACHBEREICH BIOLOGIE, DARMSTADT, XP002449793 *
DIEGO RUBIALES ET AL: "Screening techniques and sources of resistance against parasitic weeds in grain legumes", EUPHYTICA, KLUWER ACADEMIC PUBLISHERS, DO, vol. 147, no. 1-2, 1 January 2006 (2006-01-01), pages 187 - 199, XP019395492, ISSN: 1573-5060 *
HAQ S K ET AL: "Protein proteinase inhibitor genes in combat against insects, pests, and pathogens: natural and engineered phytoprotection", ARCHIVES OF BIOCHEMISTRY AND BIOPHYSICS, NEW YORK, US, US, vol. 431, no. 1, 1 November 2004 (2004-11-01), pages 145 - 159, XP004581268, ISSN: 0003-9861 *
HUANG D J ET AL: "Expression and function of a cysteine proteinase cDNA from sweet potato (Ipomoea batatas [L.] Lam 'Tainong 57') storage roots", PLANT SCIENCE, LIMERICK, IE, vol. 169, no. 2, August 2005 (2005-08-01), pages 423 - 431, XP004965462, ISSN: 0168-9452 *
KOSKELA TANJA ET AL: "Resistance and tolerance in a host plant-holoparasitic plant interaction: Genetic variation and costs", EVOLUTION, vol. 56, no. 5, May 2002 (2002-05-01), pages 899 - 908, XP002449786, ISSN: 0014-3820 *
PARKER C: "PROTECTION OF CROPS AGAINST PARASITIC WEEDS", CROP PROTECTION, vol. 10, no. 1, 1991, pages 6 - 22, XP002449785, ISSN: 0261-2194 *
PECHAN T ET AL: "A unique 33-kD cysteine proteinase accumulates in response to larval feeding in maize genotypes resistant to fall armyworm and other Lepidoptera", PLANT CELL, AMERICAN SOCIETY OF PLANT PHYSIOLOGISTS, ROCKVILLE, MD, US, vol. 12, no. 7, July 2000 (2000-07-01), pages 1031 - 1040, XP002320387, ISSN: 1040-4651 *
SINGH ARCHANA ET AL: "Incompatibility of Cuscuta haustoria with the resistant hosts-Ipomoea batatas L. and Lycopersicon esculentum Mill", JOURNAL OF PLANT PHYSIOLOGY, vol. 150, no. 5, 1997, pages 592 - 596, XP008083413, ISSN: 0176-1617 *

Also Published As

Publication number Publication date
DE102006018583B4 (de) 2017-05-11
DE102006018583A1 (de) 2007-10-25

Similar Documents

Publication Publication Date Title
Smýkal et al. The role of the testa during development and in establishment of dormancy of the legume seed
DE69223080T2 (de) Nematode Bekämpfung mit Proteinase-Inhibitoren
KR101891950B1 (ko) 식물 질병에 대한 내성 유도 방법
CN111246875B (zh) 用于治疗韧皮杆菌属病害和其它细菌性病害的组合物和方法
Aly Trafficking of molecules between parasitic plants and their hosts
Rugini et al. A review of genetic improvement of main fruit trees through modern biotechnological tools and considerations of the cultivation and research of the engineered plant restrictions.
EP2836612B1 (de) Neuartiger pseudomonas fluorescens stamm und verwendungen davon bei der biologischen bekämpfung von bakterien- oder pilzerkrankungen
DE69434071T2 (de) Antimikrobielle proteine
Wysoki et al. The arthropod pests of mango in Israel
Baghyalakshmi et al. Orobanche menace in crop plants: Host resistance as a potential tool to control
Qasem Parasitic Weeds of Jordan: Species, Hosts, Distribution and Management
Bruening et al. Cooperative efforts contained spread of Pierce's disease and found genetic resistance
WO2007121978A1 (de) Abwehrstoff gegen die bildung von haustorien als pflanzenschutzmittel gegen pflanzenparasiten
Javadi Khederi et al. Study of defense-related gene expression in grapevine infested by Colomerus vitis (Acari: Eriophyidae)
Egedigwe et al. GROWTH RESPONSES OF ABELMOSCHUS ESCULENTUS (L.) MOENCH UNDER STRESSES OF DROUGHT AND MELOIDOGYNE INCOGNITA INFECTION.
US7494955B2 (en) Use of tobacco mild green mosaic virus (TMGMV) mediated lethal hypersensitive response (HR) as a novel method of weed control
AU2022362673A1 (en) Use of an extract of part of a plant for stimulating plant defenses against viruses, and associated composition and methods
Abdel-Baset et al. Damage Threshold of Root-Knot Nematode, Meloidogyne incognita on Common Bean Influenced by Planting Dates, and Inoculum Levels under Greenhouse Conditions
US12507698B2 (en) Use of an extract of part of a rocket plant for stimulating the defenses of plants and trees and associated composition and method
DE60035972T2 (de) Verfahren zur vermittlung von bnyvv-resistenz in zuckerrübenpflanzen
Elimem et al. Check list of piercing-sucking insects in North-Eastern Tunisia in the region of cap-bon and their host plants
Laneesha et al. Papaya mealybug (Paracoccus marginatus)(Hemiptera: Pseudococcidae): A new threat to agri-horticulture ecosystem
CN108463108B (zh) 活性物质用于防治植物病毒感染的用途
Tripathi et al. Transgenic bananas with enhanced resistance against Xanthomonas wilt disease
Fernandes Effect of Different Forms of Nitrogen Nutrition on Kiwifruit Development and Resistance to Pseudomonas Syringae pv. actinidiae

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 07724486

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 07724486

Country of ref document: EP

Kind code of ref document: A1