WO2007062188A2 - Activin-actriia antagonists and uses for promoting bone growth - Google Patents
Activin-actriia antagonists and uses for promoting bone growth Download PDFInfo
- Publication number
- WO2007062188A2 WO2007062188A2 PCT/US2006/045322 US2006045322W WO2007062188A2 WO 2007062188 A2 WO2007062188 A2 WO 2007062188A2 US 2006045322 W US2006045322 W US 2006045322W WO 2007062188 A2 WO2007062188 A2 WO 2007062188A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- actriia
- polypeptide
- bone
- activin
- amino acid
- Prior art date
Links
- 230000008468 bone growth Effects 0.000 title claims abstract description 38
- 230000001737 promoting effect Effects 0.000 title claims abstract description 14
- 239000005557 antagonist Substances 0.000 title claims description 65
- 238000000034 method Methods 0.000 claims abstract description 111
- 230000037182 bone density Effects 0.000 claims abstract description 48
- 230000001965 increasing effect Effects 0.000 claims abstract description 32
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 264
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 261
- 229920001184 polypeptide Polymers 0.000 claims description 257
- 108010059616 Activins Proteins 0.000 claims description 130
- 210000000988 bone and bone Anatomy 0.000 claims description 127
- 239000000488 activin Substances 0.000 claims description 124
- 108090000623 proteins and genes Proteins 0.000 claims description 114
- 210000004027 cell Anatomy 0.000 claims description 85
- 102000004169 proteins and genes Human genes 0.000 claims description 76
- 230000027455 binding Effects 0.000 claims description 64
- 238000011282 treatment Methods 0.000 claims description 54
- 230000000694 effects Effects 0.000 claims description 53
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 42
- 150000001413 amino acids Chemical class 0.000 claims description 41
- 108020001507 fusion proteins Proteins 0.000 claims description 39
- 102000037865 fusion proteins Human genes 0.000 claims description 39
- 230000014509 gene expression Effects 0.000 claims description 38
- 208000001132 Osteoporosis Diseases 0.000 claims description 36
- 239000003814 drug Substances 0.000 claims description 36
- 206010065687 Bone loss Diseases 0.000 claims description 29
- 102000005606 Activins Human genes 0.000 claims description 28
- 239000003795 chemical substances by application Substances 0.000 claims description 27
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 22
- 230000011664 signaling Effects 0.000 claims description 20
- 238000012360 testing method Methods 0.000 claims description 20
- 230000015572 biosynthetic process Effects 0.000 claims description 19
- 208000035475 disorder Diseases 0.000 claims description 19
- 108091033319 polynucleotide Proteins 0.000 claims description 19
- 102000040430 polynucleotide Human genes 0.000 claims description 19
- 239000002157 polynucleotide Substances 0.000 claims description 19
- 238000000746 purification Methods 0.000 claims description 19
- 239000003446 ligand Substances 0.000 claims description 18
- 210000001519 tissue Anatomy 0.000 claims description 18
- 210000002966 serum Anatomy 0.000 claims description 17
- 238000001727 in vivo Methods 0.000 claims description 16
- 206010027452 Metastases to bone Diseases 0.000 claims description 12
- 206010028980 Neoplasm Diseases 0.000 claims description 11
- 230000037118 bone strength Effects 0.000 claims description 11
- 230000012010 growth Effects 0.000 claims description 10
- 102100040898 Growth/differentiation factor 11 Human genes 0.000 claims description 9
- 108090000445 Parathyroid hormone Proteins 0.000 claims description 9
- 229940011871 estrogen Drugs 0.000 claims description 9
- 239000000262 estrogen Substances 0.000 claims description 9
- 238000004519 manufacturing process Methods 0.000 claims description 9
- 238000002360 preparation method Methods 0.000 claims description 9
- 208000006386 Bone Resorption Diseases 0.000 claims description 8
- 102000055006 Calcitonin Human genes 0.000 claims description 8
- 108060001064 Calcitonin Proteins 0.000 claims description 8
- 101710194452 Growth/differentiation factor 11 Proteins 0.000 claims description 8
- 102000003982 Parathyroid hormone Human genes 0.000 claims description 8
- 230000024279 bone resorption Effects 0.000 claims description 8
- BBBFJLBPOGFECG-VJVYQDLKSA-N calcitonin Chemical compound N([C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(N)=O)C(C)C)C(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1 BBBFJLBPOGFECG-VJVYQDLKSA-N 0.000 claims description 8
- 229960004015 calcitonin Drugs 0.000 claims description 8
- 239000000199 parathyroid hormone Substances 0.000 claims description 8
- 229960001319 parathyroid hormone Drugs 0.000 claims description 8
- 239000000825 pharmaceutical preparation Substances 0.000 claims description 8
- 201000011510 cancer Diseases 0.000 claims description 7
- 230000002401 inhibitory effect Effects 0.000 claims description 7
- 150000002632 lipids Chemical group 0.000 claims description 7
- 238000001542 size-exclusion chromatography Methods 0.000 claims description 7
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 6
- 238000010494 dissociation reaction Methods 0.000 claims description 6
- 230000005593 dissociations Effects 0.000 claims description 6
- 210000004962 mammalian cell Anatomy 0.000 claims description 6
- 229940122361 Bisphosphonate Drugs 0.000 claims description 5
- 108091026890 Coding region Proteins 0.000 claims description 5
- 150000004663 bisphosphonates Chemical class 0.000 claims description 5
- 208000001685 postmenopausal osteoporosis Diseases 0.000 claims description 5
- 102000016970 Follistatin Human genes 0.000 claims description 4
- 108010014612 Follistatin Proteins 0.000 claims description 4
- 108060003951 Immunoglobulin Proteins 0.000 claims description 4
- 206010035226 Plasma cell myeloma Diseases 0.000 claims description 4
- 229930003316 Vitamin D Natural products 0.000 claims description 4
- QYSXJUFSXHHAJI-XFEUOLMDSA-N Vitamin D3 Natural products C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C/C=C1\C[C@@H](O)CCC1=C QYSXJUFSXHHAJI-XFEUOLMDSA-N 0.000 claims description 4
- 239000013543 active substance Substances 0.000 claims description 4
- 210000004978 chinese hamster ovary cell Anatomy 0.000 claims description 4
- 102000018358 immunoglobulin Human genes 0.000 claims description 4
- 108020001756 ligand binding domains Proteins 0.000 claims description 4
- 238000011275 oncology therapy Methods 0.000 claims description 4
- 235000019166 vitamin D Nutrition 0.000 claims description 4
- 239000011710 vitamin D Substances 0.000 claims description 4
- 150000003710 vitamin D derivatives Chemical class 0.000 claims description 4
- 229940046008 vitamin d Drugs 0.000 claims description 4
- 108010085220 Multiprotein Complexes Proteins 0.000 claims description 3
- 102000007474 Multiprotein Complexes Human genes 0.000 claims description 3
- 102000007562 Serum Albumin Human genes 0.000 claims description 3
- 108010071390 Serum Albumin Proteins 0.000 claims description 3
- 125000000539 amino acid group Chemical group 0.000 claims description 3
- 238000009826 distribution Methods 0.000 claims description 3
- 230000004807 localization Effects 0.000 claims description 3
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 3
- 229940095743 selective estrogen receptor modulator Drugs 0.000 claims description 3
- 239000000333 selective estrogen receptor modulator Substances 0.000 claims description 3
- 208000034578 Multiple myelomas Diseases 0.000 claims description 2
- 208000010191 Osteitis Deformans Diseases 0.000 claims description 2
- 208000027868 Paget disease Diseases 0.000 claims description 2
- 229940069978 calcium supplement Drugs 0.000 claims description 2
- 238000012258 culturing Methods 0.000 claims description 2
- 210000005260 human cell Anatomy 0.000 claims description 2
- 208000027202 mammary Paget disease Diseases 0.000 claims description 2
- 239000002510 pyrogen Substances 0.000 claims description 2
- 239000000356 contaminant Substances 0.000 claims 1
- 210000002027 skeletal muscle Anatomy 0.000 claims 1
- 239000013589 supplement Substances 0.000 claims 1
- 238000011269 treatment regimen Methods 0.000 claims 1
- 239000000203 mixture Substances 0.000 abstract description 40
- 102100026818 Inhibin beta E chain Human genes 0.000 description 92
- 235000018102 proteins Nutrition 0.000 description 74
- 150000001875 compounds Chemical class 0.000 description 56
- 102000039446 nucleic acids Human genes 0.000 description 44
- 108020004707 nucleic acids Proteins 0.000 description 44
- 150000007523 nucleic acids Chemical class 0.000 description 44
- 241000699670 Mus sp. Species 0.000 description 40
- 239000013598 vector Substances 0.000 description 32
- 235000001014 amino acid Nutrition 0.000 description 26
- 206010017076 Fracture Diseases 0.000 description 24
- -1 for example Substances 0.000 description 24
- 229940024606 amino acid Drugs 0.000 description 23
- 229940079593 drug Drugs 0.000 description 22
- 238000003556 assay Methods 0.000 description 20
- 108020004414 DNA Proteins 0.000 description 19
- 239000012634 fragment Substances 0.000 description 19
- 230000004927 fusion Effects 0.000 description 19
- 239000002773 nucleotide Substances 0.000 description 19
- 125000003729 nucleotide group Chemical group 0.000 description 19
- 208000010392 Bone Fractures Diseases 0.000 description 18
- 102100039939 Growth/differentiation factor 8 Human genes 0.000 description 15
- 108091028043 Nucleic acid sequence Proteins 0.000 description 15
- 108010023082 activin A Proteins 0.000 description 14
- 230000013595 glycosylation Effects 0.000 description 14
- 238000006206 glycosylation reaction Methods 0.000 description 14
- 241000282414 Homo sapiens Species 0.000 description 13
- 238000004458 analytical method Methods 0.000 description 13
- 230000018678 bone mineralization Effects 0.000 description 13
- 229910052500 inorganic mineral Inorganic materials 0.000 description 13
- 239000011707 mineral Substances 0.000 description 13
- 235000010755 mineral Nutrition 0.000 description 13
- 230000004048 modification Effects 0.000 description 13
- 238000012986 modification Methods 0.000 description 13
- 102000005962 receptors Human genes 0.000 description 13
- 108020003175 receptors Proteins 0.000 description 13
- 230000001225 therapeutic effect Effects 0.000 description 13
- 230000035876 healing Effects 0.000 description 12
- 230000035772 mutation Effects 0.000 description 12
- 239000013612 plasmid Substances 0.000 description 12
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 11
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 11
- 241000282412 Homo Species 0.000 description 11
- 239000000427 antigen Substances 0.000 description 11
- 108091007433 antigens Proteins 0.000 description 11
- 102000036639 antigens Human genes 0.000 description 11
- 238000012216 screening Methods 0.000 description 11
- 101000886562 Homo sapiens Growth/differentiation factor 8 Proteins 0.000 description 10
- 230000001054 cortical effect Effects 0.000 description 10
- 210000004408 hybridoma Anatomy 0.000 description 10
- 230000001404 mediated effect Effects 0.000 description 10
- 238000002483 medication Methods 0.000 description 10
- 230000011164 ossification Effects 0.000 description 10
- 101000970954 Homo sapiens Activin receptor type-2A Proteins 0.000 description 9
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 9
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 9
- 210000003527 eukaryotic cell Anatomy 0.000 description 9
- 239000013604 expression vector Substances 0.000 description 9
- 239000002502 liposome Substances 0.000 description 9
- 230000007246 mechanism Effects 0.000 description 9
- 210000000963 osteoblast Anatomy 0.000 description 9
- 230000001177 retroviral effect Effects 0.000 description 9
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 9
- 206010020649 Hyperkeratosis Diseases 0.000 description 8
- 238000004587 chromatography analysis Methods 0.000 description 8
- 230000006378 damage Effects 0.000 description 8
- 238000001514 detection method Methods 0.000 description 8
- 230000003993 interaction Effects 0.000 description 8
- 238000002703 mutagenesis Methods 0.000 description 8
- 231100000350 mutagenesis Toxicity 0.000 description 8
- 230000001105 regulatory effect Effects 0.000 description 8
- 239000003981 vehicle Substances 0.000 description 8
- 102000004190 Enzymes Human genes 0.000 description 7
- 108090000790 Enzymes Proteins 0.000 description 7
- 206010027476 Metastases Diseases 0.000 description 7
- 241001465754 Metazoa Species 0.000 description 7
- 230000033558 biomineral tissue development Effects 0.000 description 7
- 230000010072 bone remodeling Effects 0.000 description 7
- 229940088598 enzyme Drugs 0.000 description 7
- 230000001976 improved effect Effects 0.000 description 7
- 238000000338 in vitro Methods 0.000 description 7
- 230000009401 metastasis Effects 0.000 description 7
- 230000002265 prevention Effects 0.000 description 7
- 230000008569 process Effects 0.000 description 7
- 235000000346 sugar Nutrition 0.000 description 7
- 229940124597 therapeutic agent Drugs 0.000 description 7
- UBWXUGDQUBIEIZ-UHFFFAOYSA-N (13-methyl-3-oxo-2,6,7,8,9,10,11,12,14,15,16,17-dodecahydro-1h-cyclopenta[a]phenanthren-17-yl) 3-phenylpropanoate Chemical compound CC12CCC(C3CCC(=O)C=C3CC3)C3C1CCC2OC(=O)CCC1=CC=CC=C1 UBWXUGDQUBIEIZ-UHFFFAOYSA-N 0.000 description 6
- OGSPWJRAVKPPFI-UHFFFAOYSA-N Alendronic Acid Chemical compound NCCCC(O)(P(O)(O)=O)P(O)(O)=O OGSPWJRAVKPPFI-UHFFFAOYSA-N 0.000 description 6
- 108010035532 Collagen Proteins 0.000 description 6
- 102000008186 Collagen Human genes 0.000 description 6
- 108010070675 Glutathione transferase Proteins 0.000 description 6
- 102100029100 Hematopoietic prostaglandin D synthase Human genes 0.000 description 6
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 6
- 241000700159 Rattus Species 0.000 description 6
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 6
- 239000004473 Threonine Substances 0.000 description 6
- 229940062527 alendronate Drugs 0.000 description 6
- 230000004075 alteration Effects 0.000 description 6
- 150000001720 carbohydrates Chemical group 0.000 description 6
- 229920001436 collagen Polymers 0.000 description 6
- 230000000295 complement effect Effects 0.000 description 6
- 238000012217 deletion Methods 0.000 description 6
- 230000037430 deletion Effects 0.000 description 6
- 239000003112 inhibitor Substances 0.000 description 6
- 239000011159 matrix material Substances 0.000 description 6
- 210000003205 muscle Anatomy 0.000 description 6
- 229920001223 polyethylene glycol Polymers 0.000 description 6
- 239000002243 precursor Substances 0.000 description 6
- 210000001236 prokaryotic cell Anatomy 0.000 description 6
- 238000000159 protein binding assay Methods 0.000 description 6
- 238000011002 quantification Methods 0.000 description 6
- 210000000689 upper leg Anatomy 0.000 description 6
- 241000699802 Cricetulus griseus Species 0.000 description 5
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 5
- 241000238631 Hexapoda Species 0.000 description 5
- MPBVHIBUJCELCL-UHFFFAOYSA-N Ibandronate Chemical compound CCCCCN(C)CCC(O)(P(O)(O)=O)P(O)(O)=O MPBVHIBUJCELCL-UHFFFAOYSA-N 0.000 description 5
- 208000029725 Metabolic bone disease Diseases 0.000 description 5
- 241000699666 Mus <mouse, genus> Species 0.000 description 5
- 108010056852 Myostatin Proteins 0.000 description 5
- 206010060862 Prostate cancer Diseases 0.000 description 5
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 5
- IIDJRNMFWXDHID-UHFFFAOYSA-N Risedronic acid Chemical compound OP(=O)(O)C(P(O)(O)=O)(O)CC1=CC=CN=C1 IIDJRNMFWXDHID-UHFFFAOYSA-N 0.000 description 5
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 5
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 5
- 238000007792 addition Methods 0.000 description 5
- 230000000692 anti-sense effect Effects 0.000 description 5
- 210000004899 c-terminal region Anatomy 0.000 description 5
- 210000000845 cartilage Anatomy 0.000 description 5
- 230000001086 cytosolic effect Effects 0.000 description 5
- 230000003247 decreasing effect Effects 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 229940088597 hormone Drugs 0.000 description 5
- 239000005556 hormone Substances 0.000 description 5
- 229940015872 ibandronate Drugs 0.000 description 5
- 230000005764 inhibitory process Effects 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 210000002997 osteoclast Anatomy 0.000 description 5
- 239000008194 pharmaceutical composition Substances 0.000 description 5
- 239000006187 pill Substances 0.000 description 5
- GZUITABIAKMVPG-UHFFFAOYSA-N raloxifene Chemical compound C1=CC(O)=CC=C1C1=C(C(=O)C=2C=CC(OCCN3CCCCC3)=CC=2)C2=CC=C(O)C=C2S1 GZUITABIAKMVPG-UHFFFAOYSA-N 0.000 description 5
- 229960004622 raloxifene Drugs 0.000 description 5
- 230000008439 repair process Effects 0.000 description 5
- 229940089617 risedronate Drugs 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- 238000003786 synthesis reaction Methods 0.000 description 5
- 230000003442 weekly effect Effects 0.000 description 5
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 4
- 206010006187 Breast cancer Diseases 0.000 description 4
- 101100297347 Caenorhabditis elegans pgl-3 gene Proteins 0.000 description 4
- 102000012673 Follicle Stimulating Hormone Human genes 0.000 description 4
- 108010079345 Follicle Stimulating Hormone Proteins 0.000 description 4
- 101000869690 Homo sapiens Protein S100-A8 Proteins 0.000 description 4
- 108010004250 Inhibins Proteins 0.000 description 4
- 102100032442 Protein S100-A8 Human genes 0.000 description 4
- 108091030071 RNAI Proteins 0.000 description 4
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 4
- 229930006000 Sucrose Natural products 0.000 description 4
- 102000043168 TGF-beta family Human genes 0.000 description 4
- 108091085018 TGF-beta family Proteins 0.000 description 4
- 241000700605 Viruses Species 0.000 description 4
- 238000001042 affinity chromatography Methods 0.000 description 4
- 239000011324 bead Substances 0.000 description 4
- 239000001506 calcium phosphate Substances 0.000 description 4
- 238000004113 cell culture Methods 0.000 description 4
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 4
- 238000003776 cleavage reaction Methods 0.000 description 4
- 230000008878 coupling Effects 0.000 description 4
- 238000010168 coupling process Methods 0.000 description 4
- 238000005859 coupling reaction Methods 0.000 description 4
- 230000007547 defect Effects 0.000 description 4
- 230000004069 differentiation Effects 0.000 description 4
- 239000000839 emulsion Substances 0.000 description 4
- 230000002255 enzymatic effect Effects 0.000 description 4
- 235000019441 ethanol Nutrition 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 229940028334 follicle stimulating hormone Drugs 0.000 description 4
- 230000009368 gene silencing by RNA Effects 0.000 description 4
- 238000001415 gene therapy Methods 0.000 description 4
- 235000011187 glycerol Nutrition 0.000 description 4
- 210000001624 hip Anatomy 0.000 description 4
- 238000001794 hormone therapy Methods 0.000 description 4
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 4
- 230000002163 immunogen Effects 0.000 description 4
- 239000000893 inhibin Substances 0.000 description 4
- ZPNFWUPYTFPOJU-LPYSRVMUSA-N iniprol Chemical compound C([C@H]1C(=O)NCC(=O)NCC(=O)N[C@H]2CSSC[C@H]3C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(N[C@H](C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC=4C=CC=CC=4)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC=4C=CC=CC=4)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC2=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC=2C=CC=CC=2)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]2N(CCC2)C(=O)[C@@H](N)CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N2[C@@H](CCC2)C(=O)N2[C@@H](CCC2)C(=O)N[C@@H](CC=2C=CC(O)=CC=2)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N2[C@@H](CCC2)C(=O)N3)C(=O)NCC(=O)NCC(=O)N[C@@H](C)C(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@H](C(=O)N1)C(C)C)[C@@H](C)O)[C@@H](C)CC)=O)[C@@H](C)CC)C1=CC=C(O)C=C1 ZPNFWUPYTFPOJU-LPYSRVMUSA-N 0.000 description 4
- 239000003550 marker Substances 0.000 description 4
- 238000010172 mouse model Methods 0.000 description 4
- 239000000816 peptidomimetic Substances 0.000 description 4
- 230000009467 reduction Effects 0.000 description 4
- 238000003571 reporter gene assay Methods 0.000 description 4
- 230000007017 scission Effects 0.000 description 4
- 150000003384 small molecules Chemical class 0.000 description 4
- 241000894007 species Species 0.000 description 4
- 239000003381 stabilizer Substances 0.000 description 4
- 230000000638 stimulation Effects 0.000 description 4
- 238000006467 substitution reaction Methods 0.000 description 4
- 239000005720 sucrose Substances 0.000 description 4
- 150000008163 sugars Chemical class 0.000 description 4
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 4
- 239000000725 suspension Substances 0.000 description 4
- 230000008685 targeting Effects 0.000 description 4
- 238000002560 therapeutic procedure Methods 0.000 description 4
- 241000701447 unidentified baculovirus Species 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- VBICKXHEKHSIBG-UHFFFAOYSA-N 1-monostearoylglycerol Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)CO VBICKXHEKHSIBG-UHFFFAOYSA-N 0.000 description 3
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 3
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 3
- 238000011725 BALB/c mouse Methods 0.000 description 3
- 102100022544 Bone morphogenetic protein 7 Human genes 0.000 description 3
- 208000026310 Breast neoplasm Diseases 0.000 description 3
- 238000011740 C57BL/6 mouse Methods 0.000 description 3
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 3
- 102000014914 Carrier Proteins Human genes 0.000 description 3
- 102000053642 Catalytic RNA Human genes 0.000 description 3
- 108090000994 Catalytic RNA Proteins 0.000 description 3
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 3
- 108010036949 Cyclosporine Proteins 0.000 description 3
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 3
- 102100029379 Follistatin-related protein 3 Human genes 0.000 description 3
- 108010010803 Gelatin Proteins 0.000 description 3
- 206010020100 Hip fracture Diseases 0.000 description 3
- 101001062529 Homo sapiens Follistatin-related protein 3 Proteins 0.000 description 3
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 3
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 3
- 240000007472 Leucaena leucocephala Species 0.000 description 3
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 3
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 3
- 108091034117 Oligonucleotide Proteins 0.000 description 3
- 102000004067 Osteocalcin Human genes 0.000 description 3
- 108090000573 Osteocalcin Proteins 0.000 description 3
- 229910019142 PO4 Inorganic materials 0.000 description 3
- 108010076504 Protein Sorting Signals Proteins 0.000 description 3
- 101100437153 Rattus norvegicus Acvr2b gene Proteins 0.000 description 3
- 241000714474 Rous sarcoma virus Species 0.000 description 3
- 229920002684 Sepharose Polymers 0.000 description 3
- 108010049264 Teriparatide Proteins 0.000 description 3
- 239000002671 adjuvant Substances 0.000 description 3
- 239000000556 agonist Substances 0.000 description 3
- 230000001195 anabolic effect Effects 0.000 description 3
- 230000008485 antagonism Effects 0.000 description 3
- 230000000123 anti-resoprtive effect Effects 0.000 description 3
- 210000000628 antibody-producing cell Anatomy 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- 230000009286 beneficial effect Effects 0.000 description 3
- 239000011230 binding agent Substances 0.000 description 3
- 108091008324 binding proteins Proteins 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 229910052791 calcium Inorganic materials 0.000 description 3
- 239000011575 calcium Substances 0.000 description 3
- 239000002775 capsule Substances 0.000 description 3
- 238000005277 cation exchange chromatography Methods 0.000 description 3
- 238000000423 cell based assay Methods 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 238000001246 colloidal dispersion Methods 0.000 description 3
- 238000007796 conventional method Methods 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 239000010432 diamond Substances 0.000 description 3
- 235000005911 diet Nutrition 0.000 description 3
- 201000010099 disease Diseases 0.000 description 3
- 239000006185 dispersion Substances 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 230000009977 dual effect Effects 0.000 description 3
- 230000004821 effect on bone Effects 0.000 description 3
- 210000002683 foot Anatomy 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 239000008273 gelatin Substances 0.000 description 3
- 229920000159 gelatin Polymers 0.000 description 3
- 235000019322 gelatine Nutrition 0.000 description 3
- 235000011852 gelatine desserts Nutrition 0.000 description 3
- 239000005090 green fluorescent protein Substances 0.000 description 3
- 239000003102 growth factor Substances 0.000 description 3
- 229920000669 heparin Polymers 0.000 description 3
- 238000009396 hybridization Methods 0.000 description 3
- 229910052588 hydroxylapatite Inorganic materials 0.000 description 3
- 208000014674 injury Diseases 0.000 description 3
- 238000002955 isolation Methods 0.000 description 3
- 210000004072 lung Anatomy 0.000 description 3
- 201000005202 lung cancer Diseases 0.000 description 3
- 208000020816 lung neoplasm Diseases 0.000 description 3
- 230000002188 osteogenic effect Effects 0.000 description 3
- 230000001009 osteoporotic effect Effects 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- XYJRXVWERLGGKC-UHFFFAOYSA-D pentacalcium;hydroxide;triphosphate Chemical compound [OH-].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O XYJRXVWERLGGKC-UHFFFAOYSA-D 0.000 description 3
- 239000008177 pharmaceutical agent Substances 0.000 description 3
- 239000012071 phase Substances 0.000 description 3
- 150000003904 phospholipids Chemical class 0.000 description 3
- 229920002704 polyhistidine Polymers 0.000 description 3
- 229920000642 polymer Polymers 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 230000017854 proteolysis Effects 0.000 description 3
- 238000007634 remodeling Methods 0.000 description 3
- 108091092562 ribozyme Proteins 0.000 description 3
- 150000003839 salts Chemical class 0.000 description 3
- 238000007423 screening assay Methods 0.000 description 3
- 206010041569 spinal fracture Diseases 0.000 description 3
- 230000000087 stabilizing effect Effects 0.000 description 3
- 239000000375 suspending agent Substances 0.000 description 3
- 239000003826 tablet Substances 0.000 description 3
- OGBMKVWORPGQRR-UMXFMPSGSA-N teriparatide Chemical compound C([C@H](NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H](N)CO)C(C)C)[C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CNC=N1 OGBMKVWORPGQRR-UMXFMPSGSA-N 0.000 description 3
- 229960005460 teriparatide Drugs 0.000 description 3
- 210000001685 thyroid gland Anatomy 0.000 description 3
- 230000008467 tissue growth Effects 0.000 description 3
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 3
- 241000701161 unidentified adenovirus Species 0.000 description 3
- 239000000080 wetting agent Substances 0.000 description 3
- 210000000707 wrist Anatomy 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- PUPZLCDOIYMWBV-UHFFFAOYSA-N (+/-)-1,3-Butanediol Chemical compound CC(O)CCO PUPZLCDOIYMWBV-UHFFFAOYSA-N 0.000 description 2
- JNYAEWCLZODPBN-JGWLITMVSA-N (2r,3r,4s)-2-[(1r)-1,2-dihydroxyethyl]oxolane-3,4-diol Chemical compound OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O JNYAEWCLZODPBN-JGWLITMVSA-N 0.000 description 2
- FUFLCEKSBBHCMO-UHFFFAOYSA-N 11-dehydrocorticosterone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)C(=O)CO)C4C3CCC2=C1 FUFLCEKSBBHCMO-UHFFFAOYSA-N 0.000 description 2
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 2
- KDCGOANMDULRCW-UHFFFAOYSA-N 7H-purine Chemical compound N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 2
- 108010052946 Activin Receptors Proteins 0.000 description 2
- 102000018918 Activin Receptors Human genes 0.000 description 2
- 229920001817 Agar Polymers 0.000 description 2
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 2
- 241000256844 Apis mellifera Species 0.000 description 2
- 241000416162 Astragalus gummifer Species 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 108010049870 Bone Morphogenetic Protein 7 Proteins 0.000 description 2
- 208000020084 Bone disease Diseases 0.000 description 2
- 241000701822 Bovine papillomavirus Species 0.000 description 2
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 2
- 241000202252 Cerberus Species 0.000 description 2
- 229920001268 Cholestyramine Polymers 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 229920002911 Colestipol Polymers 0.000 description 2
- MFYSYFVPBJMHGN-ZPOLXVRWSA-N Cortisone Chemical compound O=C1CC[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 MFYSYFVPBJMHGN-ZPOLXVRWSA-N 0.000 description 2
- MFYSYFVPBJMHGN-UHFFFAOYSA-N Cortisone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)(O)C(=O)CO)C4C3CCC2=C1 MFYSYFVPBJMHGN-UHFFFAOYSA-N 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- 108010036395 Endoglin Proteins 0.000 description 2
- 102100037241 Endoglin Human genes 0.000 description 2
- 108010013369 Enteropeptidase Proteins 0.000 description 2
- 102100029727 Enteropeptidase Human genes 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 108091006020 Fc-tagged proteins Proteins 0.000 description 2
- 241000206672 Gelidium Species 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 108010031186 Glycoside Hydrolases Proteins 0.000 description 2
- 102000005744 Glycoside Hydrolases Human genes 0.000 description 2
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 2
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 2
- 241000713858 Harvey murine sarcoma virus Species 0.000 description 2
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 2
- 101001059454 Homo sapiens Serine/threonine-protein kinase MARK2 Proteins 0.000 description 2
- 102000008100 Human Serum Albumin Human genes 0.000 description 2
- 108091006905 Human Serum Albumin Proteins 0.000 description 2
- 201000002980 Hyperparathyroidism Diseases 0.000 description 2
- 206010020850 Hyperthyroidism Diseases 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 2
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 2
- 108010036176 Melitten Proteins 0.000 description 2
- 241000713869 Moloney murine leukemia virus Species 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- PHSRRHGYXQCRPU-AWEZNQCLSA-N N-(3-oxododecanoyl)-L-homoserine lactone Chemical compound CCCCCCCCCC(=O)CC(=O)N[C@H]1CCOC1=O PHSRRHGYXQCRPU-AWEZNQCLSA-N 0.000 description 2
- 230000004988 N-glycosylation Effects 0.000 description 2
- 230000004989 O-glycosylation Effects 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- CXOFVDLJLONNDW-UHFFFAOYSA-N Phenytoin Chemical compound N1C(=O)NC(=O)C1(C=1C=CC=CC=1)C1=CC=CC=C1 CXOFVDLJLONNDW-UHFFFAOYSA-N 0.000 description 2
- 208000010067 Pituitary ACTH Hypersecretion Diseases 0.000 description 2
- 208000020627 Pituitary-dependent Cushing syndrome Diseases 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 2
- 102100028904 Serine/threonine-protein kinase MARK2 Human genes 0.000 description 2
- 229920002472 Starch Polymers 0.000 description 2
- 229920001615 Tragacanth Polymers 0.000 description 2
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 239000012190 activator Substances 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 108010023079 activin B Proteins 0.000 description 2
- 238000001261 affinity purification Methods 0.000 description 2
- 235000010419 agar Nutrition 0.000 description 2
- 235000010443 alginic acid Nutrition 0.000 description 2
- 229920000615 alginic acid Polymers 0.000 description 2
- 229910052782 aluminium Inorganic materials 0.000 description 2
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 2
- 150000001412 amines Chemical class 0.000 description 2
- 239000003263 anabolic agent Substances 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 230000003160 anti-catabolic effect Effects 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 229940125717 barbiturate Drugs 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 239000000440 bentonite Substances 0.000 description 2
- 235000012216 bentonite Nutrition 0.000 description 2
- 229910000278 bentonite Inorganic materials 0.000 description 2
- SVPXDRXYRYOSEX-UHFFFAOYSA-N bentoquatam Chemical compound O.O=[Si]=O.O=[Al]O[Al]=O SVPXDRXYRYOSEX-UHFFFAOYSA-N 0.000 description 2
- SESFRYSPDFLNCH-UHFFFAOYSA-N benzyl benzoate Chemical compound C=1C=CC=CC=1C(=O)OCC1=CC=CC=C1 SESFRYSPDFLNCH-UHFFFAOYSA-N 0.000 description 2
- 108010005774 beta-Galactosidase Proteins 0.000 description 2
- 210000004204 blood vessel Anatomy 0.000 description 2
- 230000008416 bone turnover Effects 0.000 description 2
- OSGAYBCDTDRGGQ-UHFFFAOYSA-L calcium sulfate Chemical compound [Ca+2].[O-]S([O-])(=O)=O OSGAYBCDTDRGGQ-UHFFFAOYSA-L 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 230000022159 cartilage development Effects 0.000 description 2
- 230000001925 catabolic effect Effects 0.000 description 2
- 230000003197 catalytic effect Effects 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 235000012000 cholesterol Nutrition 0.000 description 2
- 230000001684 chronic effect Effects 0.000 description 2
- 239000003086 colorant Substances 0.000 description 2
- 238000004440 column chromatography Methods 0.000 description 2
- 230000009918 complex formation Effects 0.000 description 2
- 239000013068 control sample Substances 0.000 description 2
- 239000003246 corticosteroid Substances 0.000 description 2
- 229960001334 corticosteroids Drugs 0.000 description 2
- 229960004544 cortisone Drugs 0.000 description 2
- 239000002537 cosmetic Substances 0.000 description 2
- 230000022811 deglycosylation Effects 0.000 description 2
- 238000005115 demineralization Methods 0.000 description 2
- 230000002328 demineralizing effect Effects 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 230000037213 diet Effects 0.000 description 2
- 239000003995 emulsifying agent Substances 0.000 description 2
- 230000035194 endochondral ossification Effects 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 239000000284 extract Substances 0.000 description 2
- 239000000945 filler Substances 0.000 description 2
- 238000002866 fluorescence resonance energy transfer Methods 0.000 description 2
- 201000003617 glucocorticoid-induced osteoporosis Diseases 0.000 description 2
- 150000002333 glycines Chemical class 0.000 description 2
- 239000008187 granular material Substances 0.000 description 2
- 210000004349 growth plate Anatomy 0.000 description 2
- 238000013537 high throughput screening Methods 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 238000002657 hormone replacement therapy Methods 0.000 description 2
- 229960000890 hydrocortisone Drugs 0.000 description 2
- 230000028993 immune response Effects 0.000 description 2
- 238000002649 immunization Methods 0.000 description 2
- 230000003053 immunization Effects 0.000 description 2
- 238000003018 immunoassay Methods 0.000 description 2
- 238000005462 in vivo assay Methods 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 239000003701 inert diluent Substances 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 230000032631 intramembranous ossification Effects 0.000 description 2
- 238000005304 joining Methods 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 239000008101 lactose Substances 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 239000008297 liquid dosage form Substances 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- 230000007774 longterm Effects 0.000 description 2
- 229920002521 macromolecule Polymers 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- VDXZNPDIRNWWCW-UHFFFAOYSA-N melitten Chemical compound NCC(=O)NC(C(C)CC)C(=O)NCC(=O)NC(C)C(=O)NC(C(C)C)C(=O)NC(CC(C)C)C(=O)NC(CCCCN)C(=O)NC(C(C)C)C(=O)NC(CC(C)C)C(=O)NC(C(C)O)C(=O)NC(C(C)O)C(=O)NCC(=O)NC(CC(C)C)C(=O)N1CCCC1C(=O)NC(C)C(=O)NC(CC(C)C)C(=O)NC(C(C)CC)C(=O)NC(CO)C(=O)NC(C(=O)NC(C(C)CC)C(=O)NC(CCCCN)C(=O)NC(CCCNC(N)=N)C(=O)NC(CCCCN)C(=O)NC(CCCNC(N)=N)C(=O)NC(CCC(N)=O)C(=O)NC(CCC(N)=O)C(N)=O)CC1=CNC2=CC=CC=C12 VDXZNPDIRNWWCW-UHFFFAOYSA-N 0.000 description 2
- 230000009245 menopause Effects 0.000 description 2
- 239000000693 micelle Substances 0.000 description 2
- 230000037257 muscle growth Effects 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- 230000003472 neutralizing effect Effects 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 239000004006 olive oil Substances 0.000 description 2
- 230000001582 osteoblastic effect Effects 0.000 description 2
- 230000001575 pathological effect Effects 0.000 description 2
- 210000004197 pelvis Anatomy 0.000 description 2
- 125000001151 peptidyl group Chemical group 0.000 description 2
- 230000002093 peripheral effect Effects 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- 229920000747 poly(lactic acid) Polymers 0.000 description 2
- 239000004626 polylactic acid Substances 0.000 description 2
- 102000054765 polymorphisms of proteins Human genes 0.000 description 2
- 230000001323 posttranslational effect Effects 0.000 description 2
- 230000003389 potentiating effect Effects 0.000 description 2
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 2
- 229960004618 prednisone Drugs 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 230000000750 progressive effect Effects 0.000 description 2
- 230000000644 propagated effect Effects 0.000 description 2
- 238000011321 prophylaxis Methods 0.000 description 2
- 229960004063 propylene glycol Drugs 0.000 description 2
- 210000002307 prostate Anatomy 0.000 description 2
- 238000003259 recombinant expression Methods 0.000 description 2
- 239000011347 resin Substances 0.000 description 2
- 229920005989 resin Polymers 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 239000000523 sample Substances 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 238000002864 sequence alignment Methods 0.000 description 2
- 230000019491 signal transduction Effects 0.000 description 2
- RMAQACBXLXPBSY-UHFFFAOYSA-N silicic acid Chemical compound O[Si](O)(O)O RMAQACBXLXPBSY-UHFFFAOYSA-N 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 239000001509 sodium citrate Substances 0.000 description 2
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- PUZPDOWCWNUUKD-UHFFFAOYSA-M sodium fluoride Chemical compound [F-].[Na+] PUZPDOWCWNUUKD-UHFFFAOYSA-M 0.000 description 2
- 239000007790 solid phase Substances 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 235000019698 starch Nutrition 0.000 description 2
- 150000003431 steroids Chemical class 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 239000006188 syrup Substances 0.000 description 2
- 235000020357 syrup Nutrition 0.000 description 2
- 239000005495 thyroid hormone Substances 0.000 description 2
- 229940036555 thyroid hormone Drugs 0.000 description 2
- 235000010487 tragacanth Nutrition 0.000 description 2
- 239000000196 tragacanth Substances 0.000 description 2
- 229940116362 tragacanth Drugs 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 102000035160 transmembrane proteins Human genes 0.000 description 2
- 108091005703 transmembrane proteins Proteins 0.000 description 2
- 230000008733 trauma Effects 0.000 description 2
- 229940078499 tricalcium phosphate Drugs 0.000 description 2
- 229910000391 tricalcium phosphate Inorganic materials 0.000 description 2
- 235000019731 tricalcium phosphate Nutrition 0.000 description 2
- 210000005166 vasculature Anatomy 0.000 description 2
- 238000011100 viral filtration Methods 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- 210000005253 yeast cell Anatomy 0.000 description 2
- KILNVBDSWZSGLL-KXQOOQHDSA-N 1,2-dihexadecanoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCCCCCCCCC KILNVBDSWZSGLL-KXQOOQHDSA-N 0.000 description 1
- NRJAVPSFFCBXDT-HUESYALOSA-N 1,2-distearoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCCCCCCCCCCC NRJAVPSFFCBXDT-HUESYALOSA-N 0.000 description 1
- TZCPCKNHXULUIY-RGULYWFUSA-N 1,2-distearoyl-sn-glycero-3-phosphoserine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCCCC TZCPCKNHXULUIY-RGULYWFUSA-N 0.000 description 1
- 229940058015 1,3-butylene glycol Drugs 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- GZCWLCBFPRFLKL-UHFFFAOYSA-N 1-prop-2-ynoxypropan-2-ol Chemical compound CC(O)COCC#C GZCWLCBFPRFLKL-UHFFFAOYSA-N 0.000 description 1
- FKJSFKCZZIXQIP-UHFFFAOYSA-N 2-bromo-1-(4-bromophenyl)ethanone Chemical compound BrCC(=O)C1=CC=C(Br)C=C1 FKJSFKCZZIXQIP-UHFFFAOYSA-N 0.000 description 1
- JNODDICFTDYODH-UHFFFAOYSA-N 2-hydroxytetrahydrofuran Chemical compound OC1CCCO1 JNODDICFTDYODH-UHFFFAOYSA-N 0.000 description 1
- HVCOBJNICQPDBP-UHFFFAOYSA-N 3-[3-[3,5-dihydroxy-6-methyl-4-(3,4,5-trihydroxy-6-methyloxan-2-yl)oxyoxan-2-yl]oxydecanoyloxy]decanoic acid;hydrate Chemical compound O.OC1C(OC(CC(=O)OC(CCCCCCC)CC(O)=O)CCCCCCC)OC(C)C(O)C1OC1C(O)C(O)C(O)C(C)O1 HVCOBJNICQPDBP-UHFFFAOYSA-N 0.000 description 1
- OSJPPGNTCRNQQC-UWTATZPHSA-N 3-phospho-D-glyceric acid Chemical compound OC(=O)[C@H](O)COP(O)(O)=O OSJPPGNTCRNQQC-UWTATZPHSA-N 0.000 description 1
- FJKROLUGYXJWQN-UHFFFAOYSA-N 4-hydroxybenzoic acid Chemical compound OC(=O)C1=CC=C(O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-N 0.000 description 1
- 102000013563 Acid Phosphatase Human genes 0.000 description 1
- 108010051457 Acid Phosphatase Proteins 0.000 description 1
- 102100034134 Activin receptor type-1B Human genes 0.000 description 1
- 101710173005 Activin receptor type-1C Proteins 0.000 description 1
- 102100034135 Activin receptor type-1C Human genes 0.000 description 1
- 108700028369 Alleles Proteins 0.000 description 1
- 239000005995 Aluminium silicate Substances 0.000 description 1
- 208000000103 Anorexia Nervosa Diseases 0.000 description 1
- 235000003276 Apios tuberosa Nutrition 0.000 description 1
- 108091023037 Aptamer Proteins 0.000 description 1
- 244000105624 Arachis hypogaea Species 0.000 description 1
- 235000010777 Arachis hypogaea Nutrition 0.000 description 1
- 235000010744 Arachis villosulicarpa Nutrition 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 244000186140 Asperula odorata Species 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 241000271566 Aves Species 0.000 description 1
- 241000714235 Avian retrovirus Species 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 206010006313 Breast tenderness Diseases 0.000 description 1
- 101710132601 Capsid protein Proteins 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 102100025745 Cerberus Human genes 0.000 description 1
- 101710010675 Cerberus Proteins 0.000 description 1
- 208000003044 Closed Fractures Diseases 0.000 description 1
- 101710094648 Coat protein Proteins 0.000 description 1
- 206010010356 Congenital anomaly Diseases 0.000 description 1
- 206010010904 Convulsion Diseases 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 239000004971 Cross linker Substances 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- ZAHDXEIQWWLQQL-IHRRRGAJSA-N Deoxypyridinoline Chemical compound OC(=O)[C@@H](N)CCCC[N+]1=CC(O)=C(C[C@H](N)C([O-])=O)C(CC[C@H](N)C(O)=O)=C1 ZAHDXEIQWWLQQL-IHRRRGAJSA-N 0.000 description 1
- 235000019739 Dicalciumphosphate Nutrition 0.000 description 1
- 206010059866 Drug resistance Diseases 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 201000009273 Endometriosis Diseases 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 206010063560 Excessive granulation tissue Diseases 0.000 description 1
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 1
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 1
- 108010074860 Factor Xa Proteins 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- 101150050927 Fcgrt gene Proteins 0.000 description 1
- 239000004606 Fillers/Extenders Substances 0.000 description 1
- 108700012941 GNRH1 Proteins 0.000 description 1
- 235000008526 Galium odoratum Nutrition 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- KOSRFJWDECSPRO-WDSKDSINSA-N Glu-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(O)=O KOSRFJWDECSPRO-WDSKDSINSA-N 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- JZNWSCPGTDBMEW-UHFFFAOYSA-N Glycerophosphorylethanolamin Natural products NCCOP(O)(=O)OCC(O)CO JZNWSCPGTDBMEW-UHFFFAOYSA-N 0.000 description 1
- ZWZWYGMENQVNFU-UHFFFAOYSA-N Glycerophosphorylserin Natural products OC(=O)C(N)COP(O)(=O)OCC(O)CO ZWZWYGMENQVNFU-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 229930186217 Glycolipid Natural products 0.000 description 1
- 102100021181 Golgi phosphoprotein 3 Human genes 0.000 description 1
- 239000000579 Gonadotropin-Releasing Hormone Substances 0.000 description 1
- BLCLNMBMMGCOAS-URPVMXJPSA-N Goserelin Chemical compound C([C@@H](C(=O)N[C@H](COC(C)(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1[C@@H](CCC1)C(=O)NNC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 BLCLNMBMMGCOAS-URPVMXJPSA-N 0.000 description 1
- 108010069236 Goserelin Proteins 0.000 description 1
- 241001326189 Gyrodactylus prostae Species 0.000 description 1
- 229940121710 HMGCoA reductase inhibitor Drugs 0.000 description 1
- 206010018852 Haematoma Diseases 0.000 description 1
- 208000032843 Hemorrhage Diseases 0.000 description 1
- 239000004705 High-molecular-weight polyethylene Substances 0.000 description 1
- 101000799189 Homo sapiens Activin receptor type-1B Proteins 0.000 description 1
- 101000899361 Homo sapiens Bone morphogenetic protein 7 Proteins 0.000 description 1
- 101000893545 Homo sapiens Growth/differentiation factor 11 Proteins 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical compound O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 1
- 102000009490 IgG Receptors Human genes 0.000 description 1
- 108010073807 IgG Receptors Proteins 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 1
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 1
- 102100025885 Inhibin alpha chain Human genes 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 108010000817 Leuprolide Proteins 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 102000043129 MHC class I family Human genes 0.000 description 1
- 108091054437 MHC class I family Proteins 0.000 description 1
- 241000282567 Macaca fascicularis Species 0.000 description 1
- 101710125418 Major capsid protein Proteins 0.000 description 1
- 206010025476 Malabsorption Diseases 0.000 description 1
- 208000004155 Malabsorption Syndromes Diseases 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 240000003183 Manihot esculenta Species 0.000 description 1
- 235000016735 Manihot esculenta subsp esculenta Nutrition 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 206010027336 Menstruation delayed Diseases 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 102100025751 Mothers against decapentaplegic homolog 2 Human genes 0.000 description 1
- 101710143123 Mothers against decapentaplegic homolog 2 Proteins 0.000 description 1
- 101150118570 Msx2 gene Proteins 0.000 description 1
- 101100060131 Mus musculus Cdk5rap2 gene Proteins 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- OVRNDRQMDRJTHS-CBQIKETKSA-N N-Acetyl-D-Galactosamine Chemical compound CC(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@H](O)[C@@H]1O OVRNDRQMDRJTHS-CBQIKETKSA-N 0.000 description 1
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 1
- MBLBDJOUHNCFQT-UHFFFAOYSA-N N-acetyl-D-galactosamine Natural products CC(=O)NC(C=O)C(O)C(O)C(O)CO MBLBDJOUHNCFQT-UHFFFAOYSA-N 0.000 description 1
- OVRNDRQMDRJTHS-FMDGEEDCSA-N N-acetyl-beta-D-glucosamine Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-FMDGEEDCSA-N 0.000 description 1
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Natural products CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 1
- 101710141454 Nucleoprotein Proteins 0.000 description 1
- 206010030247 Oestrogen deficiency Diseases 0.000 description 1
- 240000007817 Olea europaea Species 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 208000002565 Open Fractures Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 206010049088 Osteopenia Diseases 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 101150012394 PHO5 gene Proteins 0.000 description 1
- 102100036893 Parathyroid hormone Human genes 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 101710083689 Probable capsid protein Proteins 0.000 description 1
- 108010050808 Procollagen Proteins 0.000 description 1
- RJKFOVLPORLFTN-LEKSSAKUSA-N Progesterone Chemical class C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H](C(=O)C)[C@@]1(C)CC2 RJKFOVLPORLFTN-LEKSSAKUSA-N 0.000 description 1
- LCYXYLLJXMAEMT-SAXRGWBVSA-N Pyridinoline Chemical compound OC(=O)[C@@H](N)CCC1=C[N+](C[C@H](O)CC[C@H](N)C([O-])=O)=CC(O)=C1C[C@H](N)C(O)=O LCYXYLLJXMAEMT-SAXRGWBVSA-N 0.000 description 1
- CZPWVGJYEJSRLH-UHFFFAOYSA-N Pyrimidine Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 235000004443 Ricinus communis Nutrition 0.000 description 1
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 102000007374 Smad Proteins Human genes 0.000 description 1
- 108010007945 Smad Proteins Proteins 0.000 description 1
- 108020004459 Small interfering RNA Proteins 0.000 description 1
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 1
- 235000002595 Solanum tuberosum Nutrition 0.000 description 1
- 244000061456 Solanum tuberosum Species 0.000 description 1
- SSZBUIDZHHWXNJ-UHFFFAOYSA-N Stearinsaeure-hexadecylester Natural products CCCCCCCCCCCCCCCCCC(=O)OCCCCCCCCCCCCCCCC SSZBUIDZHHWXNJ-UHFFFAOYSA-N 0.000 description 1
- 108700005078 Synthetic Genes Proteins 0.000 description 1
- 101710137500 T7 RNA polymerase Proteins 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 102100036407 Thioredoxin Human genes 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- AUYYCJSJGJYCDS-LBPRGKRZSA-N Thyrolar Chemical class IC1=CC(C[C@H](N)C(O)=O)=CC(I)=C1OC1=CC=C(O)C(I)=C1 AUYYCJSJGJYCDS-LBPRGKRZSA-N 0.000 description 1
- 102000003978 Tissue Plasminogen Activator Human genes 0.000 description 1
- 108090000373 Tissue Plasminogen Activator Proteins 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 1
- 108010015920 Type I Activin Receptors Proteins 0.000 description 1
- 102000002138 Type I Activin Receptors Human genes 0.000 description 1
- 102000000523 Type II Activin Receptors Human genes 0.000 description 1
- 108010041546 Type II Activin Receptors Proteins 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 206010046788 Uterine haemorrhage Diseases 0.000 description 1
- 206010046865 Vaccinia virus infection Diseases 0.000 description 1
- 206010046910 Vaginal haemorrhage Diseases 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 108010003533 Viral Envelope Proteins Proteins 0.000 description 1
- 229930003448 Vitamin K Natural products 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- 206010048049 Wrist fracture Diseases 0.000 description 1
- 240000008042 Zea mays Species 0.000 description 1
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 1
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 1
- ATBOMIWRCZXYSZ-XZBBILGWSA-N [1-[2,3-dihydroxypropoxy(hydroxy)phosphoryl]oxy-3-hexadecanoyloxypropan-2-yl] (9e,12e)-octadeca-9,12-dienoate Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(COP(O)(=O)OCC(O)CO)OC(=O)CCCCCCC\C=C\C\C=C\CCCCC ATBOMIWRCZXYSZ-XZBBILGWSA-N 0.000 description 1
- 239000002250 absorbent Substances 0.000 description 1
- 230000002745 absorbent Effects 0.000 description 1
- 239000003655 absorption accelerator Substances 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 230000011759 adipose tissue development Effects 0.000 description 1
- 210000004100 adrenal gland Anatomy 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 238000012867 alanine scanning Methods 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 150000001299 aldehydes Chemical class 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 150000001350 alkyl halides Chemical class 0.000 description 1
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 1
- AWUCVROLDVIAJX-UHFFFAOYSA-N alpha-glycerophosphate Natural products OCC(O)COP(O)(O)=O AWUCVROLDVIAJX-UHFFFAOYSA-N 0.000 description 1
- 150000004645 aluminates Chemical class 0.000 description 1
- 235000012211 aluminium silicate Nutrition 0.000 description 1
- 125000003368 amide group Chemical group 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 229940124325 anabolic agent Drugs 0.000 description 1
- 229940070021 anabolic steroids Drugs 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 210000003423 ankle Anatomy 0.000 description 1
- 229940069428 antacid Drugs 0.000 description 1
- 239000003159 antacid agent Substances 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000001455 anti-clotting effect Effects 0.000 description 1
- 230000002788 anti-peptide Effects 0.000 description 1
- 230000000573 anti-seizure effect Effects 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 206010003246 arthritis Diseases 0.000 description 1
- 239000000823 artificial membrane Substances 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 238000002820 assay format Methods 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000003542 behavioural effect Effects 0.000 description 1
- 229960002903 benzyl benzoate Drugs 0.000 description 1
- WQZGKKKJIJFFOK-FPRJBGLDSA-N beta-D-galactose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-FPRJBGLDSA-N 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 230000001588 bifunctional effect Effects 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- 239000003462 bioceramic Substances 0.000 description 1
- 238000002306 biochemical method Methods 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 239000005312 bioglass Substances 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 230000036765 blood level Effects 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 230000037180 bone health Effects 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 230000004097 bone metabolism Effects 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- 235000019437 butane-1,3-diol Nutrition 0.000 description 1
- 239000006227 byproduct Substances 0.000 description 1
- 230000002308 calcification Effects 0.000 description 1
- 230000002092 calcimimetic effect Effects 0.000 description 1
- 229910000019 calcium carbonate Inorganic materials 0.000 description 1
- 235000010216 calcium carbonate Nutrition 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- CJZGTCYPCWQAJB-UHFFFAOYSA-L calcium stearate Chemical compound [Ca+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CJZGTCYPCWQAJB-UHFFFAOYSA-L 0.000 description 1
- 235000013539 calcium stearate Nutrition 0.000 description 1
- 239000008116 calcium stearate Substances 0.000 description 1
- 238000005251 capillar electrophoresis Methods 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 230000021523 carboxylation Effects 0.000 description 1
- 238000006473 carboxylation reaction Methods 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 239000004359 castor oil Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 230000022131 cell cycle Effects 0.000 description 1
- 230000007910 cell fusion Effects 0.000 description 1
- 210000004671 cell-free system Anatomy 0.000 description 1
- 230000033077 cellular process Effects 0.000 description 1
- 230000005754 cellular signaling Effects 0.000 description 1
- 230000007541 cellular toxicity Effects 0.000 description 1
- 239000000919 ceramic Substances 0.000 description 1
- 229930183167 cerebroside Natural products 0.000 description 1
- 150000001784 cerebrosides Chemical class 0.000 description 1
- 229960000541 cetyl alcohol Drugs 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 210000001612 chondrocyte Anatomy 0.000 description 1
- 238000013375 chromatographic separation Methods 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 229960001265 ciclosporin Drugs 0.000 description 1
- 239000004927 clay Substances 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 229940097479 colestid Drugs 0.000 description 1
- GMRWGQCZJGVHKL-UHFFFAOYSA-N colestipol Chemical compound ClCC1CO1.NCCNCCNCCNCCN GMRWGQCZJGVHKL-UHFFFAOYSA-N 0.000 description 1
- 229960002604 colestipol Drugs 0.000 description 1
- 239000000084 colloidal system Substances 0.000 description 1
- 238000004040 coloring Methods 0.000 description 1
- 238000002742 combinatorial mutagenesis Methods 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 238000002591 computed tomography Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 210000002808 connective tissue Anatomy 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 235000005822 corn Nutrition 0.000 description 1
- 238000002316 cosmetic surgery Methods 0.000 description 1
- 235000012343 cottonseed oil Nutrition 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 229930182912 cyclosporin Natural products 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 230000008021 deposition Effects 0.000 description 1
- 239000007933 dermal patch Substances 0.000 description 1
- 230000001066 destructive effect Effects 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 230000000741 diarrhetic effect Effects 0.000 description 1
- NEFBYIFKOOEVPA-UHFFFAOYSA-K dicalcium phosphate Chemical compound [Ca+2].[Ca+2].[O-]P([O-])([O-])=O NEFBYIFKOOEVPA-UHFFFAOYSA-K 0.000 description 1
- 229910000390 dicalcium phosphate Inorganic materials 0.000 description 1
- 229940038472 dicalcium phosphate Drugs 0.000 description 1
- 230000000378 dietary effect Effects 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 1
- 229940064790 dilantin Drugs 0.000 description 1
- 230000000447 dimerizing effect Effects 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Natural products OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 239000008298 dragée Substances 0.000 description 1
- 238000007877 drug screening Methods 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 230000002500 effect on skin Effects 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 230000013020 embryo development Effects 0.000 description 1
- 210000002257 embryonic structure Anatomy 0.000 description 1
- 230000001804 emulsifying effect Effects 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- 230000009786 epithelial differentiation Effects 0.000 description 1
- 230000010437 erythropoiesis Effects 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- 150000002170 ethers Chemical class 0.000 description 1
- 229940093499 ethyl acetate Drugs 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 230000003090 exacerbative effect Effects 0.000 description 1
- 210000002744 extracellular matrix Anatomy 0.000 description 1
- 210000003414 extremity Anatomy 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 238000002875 fluorescence polarization Methods 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 108091006047 fluorescent proteins Proteins 0.000 description 1
- 102000034287 fluorescent proteins Human genes 0.000 description 1
- 208000020694 gallbladder disease Diseases 0.000 description 1
- 150000002270 gangliosides Chemical class 0.000 description 1
- 238000001641 gel filtration chromatography Methods 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 1
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 1
- 150000004676 glycans Polymers 0.000 description 1
- YQEMORVAKMFKLG-UHFFFAOYSA-N glycerine monostearate Natural products CCCCCCCCCCCCCCCCCC(=O)OC(CO)CO YQEMORVAKMFKLG-UHFFFAOYSA-N 0.000 description 1
- SVUQHVRAGMNPLW-UHFFFAOYSA-N glycerol monostearate Natural products CCCCCCCCCCCCCCCCC(=O)OCC(O)CO SVUQHVRAGMNPLW-UHFFFAOYSA-N 0.000 description 1
- 230000002414 glycolytic effect Effects 0.000 description 1
- 229930182470 glycoside Natural products 0.000 description 1
- 150000002338 glycosides Chemical class 0.000 description 1
- 210000001126 granulation tissue Anatomy 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 230000011132 hemopoiesis Effects 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- BXWNKGSJHAJOGX-UHFFFAOYSA-N hexadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCO BXWNKGSJHAJOGX-UHFFFAOYSA-N 0.000 description 1
- 238000012203 high throughput assay Methods 0.000 description 1
- 239000003906 humectant Substances 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 239000002471 hydroxymethylglutaryl coenzyme A reductase inhibitor Substances 0.000 description 1
- 229960002591 hydroxyproline Drugs 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 208000026278 immune system disease Diseases 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 210000004969 inflammatory cell Anatomy 0.000 description 1
- 108010019691 inhibin beta A subunit Proteins 0.000 description 1
- 108010032856 inhibin-alpha subunit Proteins 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- NLYAJNPCOHFWQQ-UHFFFAOYSA-N kaolin Chemical compound O.O.O=[Al]O[Si](=O)O[Si](=O)O[Al]=O NLYAJNPCOHFWQQ-UHFFFAOYSA-N 0.000 description 1
- 208000017169 kidney disease Diseases 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 229910052746 lanthanum Inorganic materials 0.000 description 1
- FZLIPJUXYLNCLC-UHFFFAOYSA-N lanthanum atom Chemical compound [La] FZLIPJUXYLNCLC-UHFFFAOYSA-N 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- RGLRXNKKBLIBQS-XNHQSDQCSA-N leuprolide acetate Chemical compound CC(O)=O.CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 RGLRXNKKBLIBQS-XNHQSDQCSA-N 0.000 description 1
- 230000029226 lipidation Effects 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000019423 liver disease Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 230000004777 loss-of-function mutation Effects 0.000 description 1
- 239000007937 lozenge Substances 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 238000003670 luciferase enzyme activity assay Methods 0.000 description 1
- 229940087857 lupron Drugs 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 230000005291 magnetic effect Effects 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 230000008774 maternal effect Effects 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 210000004779 membrane envelope Anatomy 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- ZAHQPTJLOCWVPG-UHFFFAOYSA-N mitoxantrone dihydrochloride Chemical compound Cl.Cl.O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO ZAHQPTJLOCWVPG-UHFFFAOYSA-N 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- CQDGTJPVBWZJAZ-UHFFFAOYSA-N monoethyl carbonate Chemical compound CCOC(O)=O CQDGTJPVBWZJAZ-UHFFFAOYSA-N 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 230000036651 mood Effects 0.000 description 1
- 239000002324 mouth wash Substances 0.000 description 1
- GACQNVJDWUAPFY-UHFFFAOYSA-N n'-[2-[2-(2-aminoethylamino)ethylamino]ethyl]ethane-1,2-diamine;hydrochloride Chemical compound Cl.NCCNCCNCCNCCN GACQNVJDWUAPFY-UHFFFAOYSA-N 0.000 description 1
- 229950006780 n-acetylglucosamine Drugs 0.000 description 1
- 239000002088 nanocapsule Substances 0.000 description 1
- 229940097496 nasal spray Drugs 0.000 description 1
- 239000007922 nasal spray Substances 0.000 description 1
- 229930014626 natural product Natural products 0.000 description 1
- 229940063121 neoral Drugs 0.000 description 1
- 230000004766 neurogenesis Effects 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 239000012457 nonaqueous media Substances 0.000 description 1
- 108091008104 nucleic acid aptamers Proteins 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 230000000771 oncological effect Effects 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 150000002894 organic compounds Chemical class 0.000 description 1
- 150000002895 organic esters Chemical class 0.000 description 1
- 210000004663 osteoprogenitor cell Anatomy 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- GTUJJVSZIHQLHA-XPWFQUROSA-N pApA Chemical compound C1=NC2=C(N)N=CN=C2N1[C@@H]([C@@H]1O)O[C@H](COP(O)(O)=O)[C@H]1OP(O)(=O)OC[C@H]([C@@H](O)[C@H]1O)O[C@H]1N1C(N=CN=C2N)=C2N=C1 GTUJJVSZIHQLHA-XPWFQUROSA-N 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 230000005298 paramagnetic effect Effects 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 235000010603 pastilles Nutrition 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 239000002304 perfume Substances 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 229960002036 phenytoin Drugs 0.000 description 1
- 235000021317 phosphate Nutrition 0.000 description 1
- 125000001095 phosphatidyl group Chemical group 0.000 description 1
- 150000008104 phosphatidylethanolamines Chemical class 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- SHUZOJHMOBOZST-UHFFFAOYSA-N phylloquinone Natural products CC(C)CCCCC(C)CCC(C)CCCC(=CCC1=C(C)C(=O)c2ccccc2C1=O)C SHUZOJHMOBOZST-UHFFFAOYSA-N 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 230000001817 pituitary effect Effects 0.000 description 1
- 239000000902 placebo Substances 0.000 description 1
- 229940068196 placebo Drugs 0.000 description 1
- 230000003169 placental effect Effects 0.000 description 1
- 230000036470 plasma concentration Effects 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 150000004804 polysaccharides Polymers 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 239000000583 progesterone congener Substances 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 235000013772 propylene glycol Nutrition 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 150000003856 quaternary ammonium compounds Chemical class 0.000 description 1
- 229940073095 questran Drugs 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- 239000000376 reactant Substances 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000007261 regionalization Effects 0.000 description 1
- 201000010384 renal tubular acidosis Diseases 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 238000002271 resection Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 239000003340 retarding agent Substances 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- 229940061969 rheumatrex Drugs 0.000 description 1
- 210000000614 rib Anatomy 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 229940063122 sandimmune Drugs 0.000 description 1
- 230000000276 sedentary effect Effects 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 150000004760 silicates Chemical class 0.000 description 1
- 235000012239 silicon dioxide Nutrition 0.000 description 1
- 230000022379 skeletal muscle tissue development Effects 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 210000003625 skull Anatomy 0.000 description 1
- 230000000391 smoking effect Effects 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 239000011775 sodium fluoride Substances 0.000 description 1
- 235000013024 sodium fluoride Nutrition 0.000 description 1
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000007909 solid dosage form Substances 0.000 description 1
- 239000008247 solid mixture Substances 0.000 description 1
- 210000001082 somatic cell Anatomy 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 150000003408 sphingolipids Chemical class 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 159000000008 strontium salts Chemical class 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 230000008093 supporting effect Effects 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 125000005931 tert-butyloxycarbonyl group Chemical group [H]C([H])([H])C(OC(*)=O)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 239000012085 test solution Substances 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- 108060008226 thioredoxin Proteins 0.000 description 1
- 229940094937 thioredoxin Drugs 0.000 description 1
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 208000005057 thyrotoxicosis Diseases 0.000 description 1
- 230000036964 tight binding Effects 0.000 description 1
- 229960000187 tissue plasminogen activator Drugs 0.000 description 1
- FGMPLJWBKKVCDB-UHFFFAOYSA-N trans-L-hydroxy-proline Natural products ON1CCCC1C(O)=O FGMPLJWBKKVCDB-UHFFFAOYSA-N 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 230000010474 transient expression Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- ITMCEJHCFYSIIV-UHFFFAOYSA-N triflic acid Chemical compound OS(=O)(=O)C(F)(F)F ITMCEJHCFYSIIV-UHFFFAOYSA-N 0.000 description 1
- 238000003160 two-hybrid assay Methods 0.000 description 1
- 238000010396 two-hybrid screening Methods 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 210000004291 uterus Anatomy 0.000 description 1
- 208000007089 vaccinia Diseases 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 210000002845 virion Anatomy 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 235000019168 vitamin K Nutrition 0.000 description 1
- 239000011712 vitamin K Substances 0.000 description 1
- 150000003721 vitamin K derivatives Chemical class 0.000 description 1
- 229940046010 vitamin k Drugs 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 229940033942 zoladex Drugs 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/179—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
-
- C—CHEMISTRY; METALLURGY
- C40—COMBINATORIAL TECHNOLOGY
- C40B—COMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
- C40B30/00—Methods of screening libraries
- C40B30/04—Methods of screening libraries by measuring the ability to specifically bind a target molecule, e.g. antibody-antigen binding, receptor-ligand binding
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
- A61P19/10—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/14—Extraction; Separation; Purification
- C07K1/16—Extraction; Separation; Purification by chromatography
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/71—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/32—Fusion polypeptide fusions with soluble part of a cell surface receptor, "decoy receptors"
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/35—Fusion polypeptide containing a fusion for enhanced stability/folding during expression, e.g. fusions with chaperones or thioredoxin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
Definitions
- disorders of the bone ranging from osteoporosis to fractures, represent a set of pathological states for which there are few effective pharmaceutical agents. Treatment instead focuses on physical and behavioral interventions, including immobilization, exercise and changes in diet. It would be beneficial to have therapeutic agents that promote bone growth and increase bone density for the purpose of treating a variety of bone disorders.
- Bone growth and mineralization are dependent on the activities of two cell types, osteoclasts and osteoblasts, although chondrocytes and cells of the vasculature also participate in critical aspects of these processes.
- Developmentally, bone formation occurs through two mechanisms, endochondral ossification and intramembranous ossification, with the former responsible for longitudinal bone formation and the later responsible for the formation of topologically flat bones, such as the bones of the skull.
- Endochondral ossification requires the sequential formation and degradation of cartilaginous structures in the growth plates that serve as templates for the formation of osteoblasts, osteoclasts, the vasculature and subsequent mineralization.
- intramembranous ossification bone is formed directly in the connective tissues. Both processes require the infiltration of osteoblasts and subsequent matrix deposition.
- Fractures and other structural disruptions of bone are healed through a process that, at least superficially, resembles the sequence of developmental events of osteogenesis, including the formation of cartilaginous tissue and subsequent
- the process of fracture healing can occur in two ways. Direct or primary bone healing occurs without callus formation. Indirect or secondary bone healing occurs with a callus precursor stage. Primary healing of fractures involves the reformation of mechanical continuity across a closely-set disruption. Under suitable conditions, bone-resorbing cells surrounding the disruption show a tunnelling resorptive response and establish pathways for the penetration of blood vessels and subsequent healing. Secondary healing of bones follows a process of inflammation, soft callus formation, callus mineralisation and callus remodelling. In the inflammation stage, haematoma and haemorrhage formation results from the disruption of periosteal and endosteal blood vessels at the site of injury.
- Inflammatory cells invade the area.
- soft callus formation stage the cells produce new vessels, fibroblasts, intracellular material and supporting cells, forming granulation tissue in the space between the fracture fragments.
- Clinical union across the disruption is established by fibrous or cartilaginous tissue (soft callus). Osteoblasts are formed and mediate the mineralization of soft callus, which is then replaced by lamellar bone and subjected to the normal remodeling processes.
- Bone loss is sometimes characterized as an imbalance in the normal bone remodeling process. Healthy bone is constantly subject to remodeling. Remodeling
- osteoclasts begins with resorption of bone by osteoclasts.
- the resorbed bone is then replaced by new bone tissue, which is characterized by collagen formation by osteoblasts, and subsequent calcification.
- new bone tissue which is characterized by collagen formation by osteoblasts, and subsequent calcification.
- Osteoporosis is a chronic, progressive condition, marked by a shift towards resorption, resulting in an overall decrease in bone mass and bone mineralization.
- Osteoporosis in humans is preceded by clinical osteopenia (bone mineral density that is greater than one standard deviation but less than 2.5 standard deviations below the mean value for young adult bone).
- clinical osteopenia bone mineral density that is greater than one standard deviation but less than 2.5 standard deviations below the mean value for young adult bone.
- methods for controlling the balance between osteoclast and osteoblast activity can be useful for promoting the healing of fractures and other damage to bone as well as the treatment of disorders, such as osteop
- osteoporosis With respect to osteoporosis, estrogen, calcitonin, osteocalcin with vitamin K, or high doses of dietary calcium are all used as therapeutic interventions.
- Other therapeutic approaches to osteoporosis include bisphosphonates, parathyroid hormone, calcimimetics, statins, anabolic steroids, lanthanum and strontium salts, and sodium fluoride. Such therapeutics, however, are often associated with undesirable side effects.
- activin antagonists and “ActRIIa antagonists”
- a soluble form of ActRIIa acts as an inhibitor of activin-ActRIIa signaling and promotes increased bone density, bone growth, and bone strength in vivo.
- most pharmaceutical agents that promote bone growth or inhibit bone loss act as either anti-catabolic agents (also commonly referred to as “catabolic agents”) (e.g., bisphosphonates) or anabolic agents (e.g.,
- the soluble ActRIIa protein exhibits dual activity, having both catabolic and anabolic effects.
- antagonists of the activin-ActRIIa signaling pathway may be used to increase bone density and promote bone growth. While soluble ActRIIa may affect bone through a mechanism other than activin antagonism, the disclosure nonetheless demonstrates that desirable therapeutic agents may be selected on the basis of an activin-ActRIIa antagonist activity.
- the disclosure provides methods for using activin-ActRIIa antagonists, including, for example, activin-binding ActRIIa polypeptides, anti-activin antibodies, anti-ActRIIa antibodies, activin- or ActRIIa-targeted small molecules and aptamers, and nucleic acids that decrease expression of activin and ActRIIa, to treat disorders associated with low bone density or low bone strength, such as osteoporosis, or to promote bone growth in patients in need thereof, such as in patients having a bone fracture. Additionally, the soluble ActRIIa polypeptide promotes bone growth without causing a consistently measurable increase in muscle mass
- the disclosure provides polypeptides comprising a soluble, activin-binding ActRIIa polypeptide that binds to activin.
- ActRIIa polypeptides may be formulated as a pharmaceutical preparation comprising the activin-binding ActRIIa polypeptide and a pharmaceutically acceptable carrier.
- the activin-binding ActRIIa polypeptide binds to activin with a Kp less than 1 micromolar or less than 100, 10 or 1 nanomolar.
- the activin-binding ActRIIa polypeptide selectively binds activin versus GDFl 1 and/or GDF8, and preferably with a K D that is at least 10-fold, 20-fold or 50-fold lower with respect to activin than with respect to GDFl 1 and/or GDF8. While not wishing to be bound to a particular mechanism of action, it is expected that this degree of selectivity for activin inhibition over GDF11/GDF8 inhibition accounts for the selective effect on bone without a consistently measurable effect on muscle.
- an ActRIIa polypeptide will be selected for causing less than 15%, less than 10% or less than 5% increase in muscle at doses that achieve desirable effects on bone.
- the composition is at least 95% pure, with respect to other polypeptide components, as assessed by size exclusion chromatography, and more preferably, the composition is at least 98% pure.
- 10275954_l use in such a preparation may be any of those disclosed herein, such as a polypeptide having an amino acid sequence selected from SEQ ID NOs: 2, 3, 7 or 12, or having an amino acid sequence that is at least 80%, 85%, 90%, 95%, 97% or 99% identical to an amino acid sequence selected from SEQ ID NOs: 2, 3, 7, 12 or 13.
- An activin-binding ActRIIa polypeptide may include a functional fragment of a natural ActRIIa polypeptide, such as one comprising at least 10, 20 or 30 amino acids of a sequence selected from SEQ ID NOs: 1-3 or a sequence of SEQ ID NO: 2, lacking the C-terminal 10 to 15 amino acids (the "tail").
- a soluble, activin-binding ActRIIa polypeptide may include one or more alterations in the amino acid sequence (e.g., in the ligand-binding domain) relative to a naturally occurring ActRIIa polypeptide.
- altered ActRIIa polypeptides are provided in WO 2006/012627, pp. 59-60, incorporated by reference herein.
- the alteration in the amino acid sequence may, for example, alter glycosylation of the polypeptide when produced in a mammalian, insect or other eukaryotic cell or alter proteolytic cleavage of the polypeptide relative to the naturally occurring ActRIIa polypeptide.
- An activin-binding ActRIIa polypeptide may be a fusion protein that has, as one domain, an ActRIIa polypeptide (e.g., a ligand-binding portion of an ActRIIa) and one or more additional domains that provide a desirable property, such as improved pharmacokinetics, easier purification, targeting to particular tissues, etc.
- a domain of a fusion protein may enhance one or more of in vivo stability, in vivo half life, uptake/administration, tissue localization or distribution, formation of protein complexes, multimerization of the fusion protein, and/or purification.
- an activin-binding ActRIIa fusion protein may include an immunoglobulin Fc domain (wild-type or mutant) or a serum albumin or other polypeptide portion that provides desirable properties such as improved pharmacokinetics, improved solubility or improved stability.
- an ActRIIa-Fc fusion comprises a relatively unstructured linker positioned between the Fc domain and the extracellular ActRIIa domain. This unstructured linker may correspond to the roughly 15 amino acid unstructured region at the C-terminal end of the extracellular domain of ActRIIa (the "tail"), or it may be an artificial sequence of 1, 2, 3, 4 or 5 amino acids or a length of between 5
- a linker may be rich in glycine and proline residues and may, for example, contain a single sequence of threonine/serine and glycines or repeating sequences of threonine/serine and glycines (e.g., TG 4 or SG 4 singlets or repeats).
- a fusion protein may include a purification subsequence, such as an epitope tag, a FLAG tag, a polyhistidine sequence, and a GST fusion.
- a soluble ActRIIa polypeptide includes one or more modified amino acid residues selected from: a glycosylated amino acid, a PEGylated amino acid, a farnesylated amino acid, an acetylated amino acid, a biotinylated amino acid, an amino acid conjugated to a lipid moiety, and an amino acid conjugated to an organic derivatizing agent.
- a pharmaceutical preparation may also include one or more additional compounds such as a compound that is used to treat a bone disorder.
- a pharmaceutical preparation is substantially pyrogen free.
- an ActRIIa protein be expressed in a mammalian cell line that mediates suitably natural glycosylation of the ActRIIa protein so as to diminish the likelihood of an unfavorable immune response in a patient.
- Human and CHO cell lines have been used successfully, and it is expected that other common mammalian expression systems will be useful.
- ActRIIa proteins designated ActRIIa-Fc have desirable properties, including selective binding to activin versus GDF8 and/or GDFl 1, high affinity ligand binding and serum half life greater than two weeks in animal models.
- the invention provides ActRIIa-Fc polypeptides and pharmaceutical preparations comprising such polypeptides and a pharmaceutically acceptable excipient.
- an isolated polynucleotide may comprise a coding sequence for a soluble, activin-binding ActRIIa polypeptide, such as described above.
- an isolated nucleic acid may include a sequence coding for an extracellular domain (e.g., ligand-binding domain) of an ActRIIa and a sequence that would code for part or all of the transmembrane domain and/or the cytoplasmic domain of an ActRIIa, but for a stop codon positioned within the
- an isolated polynucleotide may comprise a full-length ActRIIa polynucleotide sequence such as SEQ ID NO: 4 or 5, or a partially truncated version, said isolated polynucleotide further comprising a transcription termination codon at least six hundred nucleotides before the 3 '-terminus or otherwise positioned such that translation of the polynucleotide gives rise to an extracellular domain optionally fused to a truncated portion of a full-length ActRIIa.
- a preferred nucleic acid sequence is SEQ ID NO: 14.
- Nucleic acids disclosed herein may be operably linked to a promoter for expression, and the disclosure provides cells transformed with such recombinant polynucleotides.
- the cell is a mammalian cell such as a CHO cell.
- the disclosure provides methods for making a soluble, activin-binding ActRIIa polypeptide.
- a method may include expressing any of the nucleic acids (e.g., SEQ ID NO: 4, 5 or 14) disclosed herein in a suitable cell, such as a Chinese hamster ovary (CHO) cell.
- a suitable cell such as a Chinese hamster ovary (CHO) cell.
- Such a method may comprise: a) culturing a cell under conditions suitable for expression of the soluble ActRIIa polypeptide, wherein said cell is transformed with a soluble ActRIIa expression construct; and b) recovering the soluble ActRIIa polypeptide so expressed.
- Soluble ActRIIa polypeptides may be recovered as crude, partially purified or highly purified fractions.
- Purification may be achieved by a series of purification steps, including, for example, one, two or three or more of the following, in any order: protein A chromatography, anion exchange chromatography (e.g., Q sepharose), hydrophobic interaction chromatography (e.g., phenylsepharose), size exclusion chromatography, and cation exchange chromatography.
- anion exchange chromatography e.g., Q sepharose
- hydrophobic interaction chromatography e.g., phenylsepharose
- size exclusion chromatography e.g., cation exchange chromatography
- an activin-ActRIIa antagonist disclosed herein such as a soluble, activin-binding ActRIIa polypeptide, may be used in a method for promoting bone growth or increasing bone density in a subject.
- the disclosure provides methods for treating a disorder associated with low bone density, or to promote bone growth, in patients in need thereof.
- a method may comprise administering to a subject in need thereof an effective amount of activin-ActRIIa antagonist.
- the disclosure provides uses of
- the disclosure provides a method for identifying an agent that stimulates growth of, or increased mineralization of, bone.
- the method comprises: a) identifying a test agent that binds to activin or a ligand-binding domain of an ActRIIa polypeptide; and b) evaluating the effect of the agent on growth of, or mineralization of, bone.
- Figure 1 shows the purification of ActRIIa-hFc expressed in CHO cells. The protein purifies as a single, well-defined peak.
- Figure 2 shows the binding of ActRIIa-hFc to activin and GDF-11, as measured by BiaCoreTM assay.
- FIG. 3 shows a schematic for the A-204 Reporter Gene Assay.
- the figure shows the Reporter vector: pGL3 (CAGA) 12 (described in Dennler et al, 1998, EMBO 17: 3091-3100.)
- CAGA12 motif is present in TGF-Beta responsive genes (PAI-I gene), so this vector is of general use for factors signaling through Smad 2 and 3.
- Figure 4 shows the effects of ActRIIa-hFc (diamonds) and ActRIIa-mFc (squares) on GDF-8 signaling in the A-204 Reporter Gene Assay. Both proteins exhibited substantial inhibition of GDF-8 mediated signaling at picomolar concentrations.
- Figure 5 shows the effects of three different preparations of ActRIIa-hFc on GDF-11 signaling in the A-204 Reporter Gene Assay.
- Figure 6 shows examples of DEXA images of control- and ActRIIa-mFc- treated BALB/c mice, before (top panels) and after (bottom panels) the 12-week treatment period. Paler shading indicates increased bone density.
- Figure 7 shows a quantification of the effects of ActRIIa-mFc on bone mineral density in BALB/c mice over the 12-week period. Treatments were control
- Figure 8 shows a quantification of the effects of ActRIIa-mFc on bone mineral content in BALB/c mice over the 12-week period. Treatments were control (diamonds), 2 mg/kg dosing of ActRIIa-mFc (squares), 6 mg/kg dosing of ActRIIa- mFc (triangles) and 10 mg/kg dosing of ActRIIa-mFc (circles).
- Figure 9 shows a quantification of the effects of ActRIIa-mFc on bone mineral density of the trabecular bone in ovariectomized (OVX) or sham operated (SHAM) C57BL6 mice over after a 6-week period. Treatments were control (PBS) or 10 mg/kg dosing of ActRIIa-mFc (ActRIIa) .
- Figure 10 shows a quantification of the effects of ActRIIa-mFc on the trabecular bone in ovariectomized (OVX) C57BL6 mice over a 12-week period. Treatments were control (PBS; pale bars) or 10 mg/kg dosing of ActRIIa-mFc (ActRIIa; dark bars).
- Figure 11 shows a quantification of the effects of ActRIIa-mFc on the trabecular bone in sham operated C57BL6 mice after 6 or 12 weeks of treatment period. Treatments were control (PBS; pale bars) or 10 mg/kg dosing of ActRIIa- mFc (ActRIIa; dark bars).
- Figure 12 shows the results of pQCT analysis of bone density in ovariectomized mice over 12 weeks of treatment. Treatments were control (PBS; pale bars) or ActRIIa-mFc (dark bars), y-axis: mg/ccm
- Figure 13 depicts the results of pQCT analysis of bone density in sham operated mice over 12 weeks of treatment. Treatments were control (PBS; pale bars) or ActRIIa-mFc (dark bars), y-axis; mg/ccm
- Figures 14A and 14B show whole body DEXA analysis after 12 weeks of treatment (A) and ex vivo analysis of femurs (B). Light areas depict areas of high bone density.
- Figure 15 shows ex vivo pQCT analysis of the femoral midshaft after twelve weeks of treatment.
- Treatments were vehicle control (PBS, dark bars) and ActRIIa- mFc (pale bars).
- the four bars to the left show total bone density while the four bars to the right show cortical bone density.
- 10Z75954J represent data from ovariectomized mice while the second pair of bars represent data from sham operated mice.
- Figure 16 shows ex vivo pQCT analysis and diaphyseal bone content of the femoral midshaft after twelve weeks of treatment.
- Treatments were vehicle control (PBS, dark bars) or ActRIIa-mFc (pale bars).
- the four bars to the left show total bone content while the four bars to the right show cortical bone content.
- the first pair of bars in each set of four bars represent data from ovariectomized mice while the second pair of bars represent data from sham operated mice.
- Figure 17 shows ex vivo pQCT analysis of the femoral midshaft and femoral cortical thickness.
- Treatments were control (PBS, dark bars) and ActRIIa-mFc (pale bars).
- the four bars to the left show endosteal circumference while the four bars to the right show periosteal circumference.
- the first pair of bars in each set of four bars represent data from ovariectomized mice while the second pair of bars represent data from sham operated mice.
- Figure 18 depicts the results of mechanical testing of femurs after twelve weeks of treatment.
- Treatments were control (PBS, dark bars) and ActRIIa-mFc (pale bars).
- the two bars to the left represent data from ovariectomized mice while the last two bars represent data from sham operated mice.
- Figure 19 shows the effects of Actrlla-mFc on trabecular bone volume.
- Figure 20 shows the effects of Actrlla-mFc on trabecular architecture in the distal femur.
- Figure 21 shows the effects of Actrlla-mFc on cortical bone.
- Figure 22 shows the effects of Actrlla-mFc on the mechanical strength of bone.
- Figure 23 shows the effects of different doses of ActRIIa-mFc on bone characteristics at three different dosages.
- Figure 24 shows bone histomorphometry indicating that ActRIIa-mFc has dual anabolic and anti-resorptive activity.
- TGF-beta The transforming growth factor-beta (TGF-beta) superfamily contains a variety of growth factors that share common sequence elements and structural motifs. These proteins are known to exert biological effects on a large variety of cell types in both vertebrates and invertebrates. Members of the superfamily perform important functions during embryonic development in pattern formation and tissue specification and can influence a variety of differentiation processes, including adipogenesis, myogenesis, chondrogenesis, cardiogenesis, hematopoiesis, neurogenesis, and epithelial cell differentiation. The family is divided into two general branches: the BMP/GDF and the TGF-beta/Activin/BMPlO branches, whose members have diverse, often complementary effects.
- the Piedmontese and Belgian Blue cattle breeds carry a loss-of-function mutation in the GDF8 (also called myostatin) gene that causes a marked increase in muscle mass. Grobet et al., Nat Genet. 1997, 17(l):71-4. Furthermore, in humans, inactive alleles of GDF8 are associated with increased muscle mass and, reportedly, exceptional strength. Schuelke et al., N Engl J Med 2004, 350:2682-8. Activins are dimeric polypeptide growth factors that belong to the TGF-beta superfamily.
- activin forms There are three principle activin forms (A, B, and AB) that are homo/heterodimers of two closely related ⁇ subunits (PAP A , P B P B , and P A P B )-
- the human genome also encodes an activin C and an activin E, which are primarily expressed in the liver.
- activins are unique and multifunctional factors that can stimulate hormone production in ovarian and placental cells, support neuronal cell survival, influence cell-cycle progress positively or negatively depending on cell type, and induce mesodermal differentiation at least in amphibian embryos (DePaolo et al., 1991, Proc Soc Ep Biol Med.
- EDF erythroid differentiation factor
- activin A acts as a natural, positive regulator of erythropoiesis in the bone marrow.
- activin signaling is antagonized by its related heterodimer, inhibin.
- FSH follicle-stimulating hormone
- Other proteins that may regulate activin bioactivity and/or bind to activin include follistatin (FS), follistatin- related protein (FSRP), ⁇ 2 -macroglobulin, Cerberus, and endoglin.
- TGF- ⁇ signals are mediated by heteromeric complexes of type I and type II serine/ threonine kinase receptors, which phosphorylate and activate downstream Smad proteins upon ligand stimulation (Massague, 2000, Nat. Rev. MoI. Cell Biol. 1 : 169-178).
- type I and type II receptors are transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity.
- Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors.
- Type I and II activin receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors.
- ALK4 is the primary type I receptor for activins, particularly for activin A, and ALK-7 may serve as a receptor for activins as well, particularly for activin B.
- sActRJIa soluble ActRIIa polypeptide
- GDF8 or GDFl 1 TGF-beta family members
- mice models for osteoporosis and bone growth/density that were used in the studies described herein are considered to be highly predictive of efficacy in humans, and therefore, this disclosure provides methods for using ActRIIa polypeptides and other activin-ActRIIa antagonists to promote bone growth and increase bone density in humans.
- Activin-ActRIIa antagonists include, for example, activin-binding soluble ActRIIa polypeptides, antibodies that bind to activin (particularly the activin A or B subunits, also referred to as ⁇ A or ⁇ B) and disrupt ActRIIa binding, antibodies that bind to ActRIIa and disrupt activin binding, non- antibody proteins selected for activin or ActRIIa binding (see e.g., WO/2002/088171, WO/2006/055689, WO/2002/032925, WO/2005/037989, US 2003/0133939, and US 2005/0238646 for examples of such proteins and methods for design and selection of same), randomized peptides selected for activin or ActRIIa binding, often affixed to an Fc domain.
- activin binders that block the type I (e.g., a soluble type I activin receptor) and type II (e.g., a soluble type II activin receptor) binding sites, respectively, may be linked together to create a bifunctional binding molecule.
- Various proteins have activin- ActRIIa antagonist activity, including inhibin (i.e., inhibin alpha subunit), although
- 10275954J inhibin does not universally antagonize activin in all tissues, follistatin (e.g., follistatin-288 and follistatin-315), Cerberus, FSRP, endoglin, activin C, alpha(2)- macroglobulin, and an Ml 08 A (methionine to alanine change at position 108) mutant activin A.
- follistatin e.g., follistatin-288 and follistatin-315
- Cerberus e.g., Cerberus, FSRP, endoglin, activin C, alpha(2)- macroglobulin, and an Ml 08 A (methionine to alanine change at position 108) mutant activin A.
- Ml 08 A methionine to alanine change at position 108 mutant activin A.
- alternative forms of activin particularly those with alterations in the type I receptor binding domain can bind to type II receptors and fail to form an active ternary complex
- nucleic acids such as antisense molecules, siRNAs or ribozymes that inhibit activin A, B, C or E, or, particularly, ActRIIa expression
- the activin-ActRIIa antagonist to be used will exhibit selectivity for inhibiting activin-mediated signaling versus other members of the TGF-beta family, and particularly with respect to GDF8 and GDFl 1.
- Soluble ActRIIb proteins do bind to activin, however, the wild type protein does not exhibit significant selectivity in binding to activin versus GDF8/11, and preliminary experiments suggest that this protein does not provide the desired effects on bone, while also causing substantial muscle growth.
- ActRIIb with different binding properties have been identified (see, e.g., WO 2006/012627, pp. 55-59, incorporated herein by reference) and these proteins may achieve the desired effects on bone.
- Native or altered ActRIIb may be given added specificity for activin by coupling with a second, activin-selective binding agent.
- the terms used in this specification generally have their ordinary meanings in the art, within the context of this invention and in the specific context where each term is used. Certain terms are discussed below or elsewhere in the specification, to provide additional guidance to the practitioner in describing the compositions and methods of the invention and how to make and use them. The scope or meaning of any use of a term will be apparent from the specific context in which the term is used.
- “About” and “approximately” shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Typically, exemplary degrees of error are within 20 percent (%), preferably within 10%, and more preferably within 5% of a given value or range of values.
- the terms “about” and “approximately” may mean values that are within an order of magnitude, preferably within 5-fold and more preferably within 2-fold of a given value. Numerical quantities given herein are approximate unless stated otherwise, meaning that the term “about” or “approximately” can be inferred when not expressly stated.
- the methods of the invention may include steps of comparing sequences to each other, including wild-type sequence to one or more mutants (sequence variants).
- Such comparisons typically comprise alignments of polymer sequences, e.g., using sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
- sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
- sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
- sequence similarity in all its grammatical forms, refers to the degree of identity or correspondence between nucleic acid or amino acid sequences that may or may not share a common evolutionary origin. However, in common usage and in the instant application, the term
- homologous when modified with an adverb such as “highly,” may refer to sequence similarity and may or may not relate to a common evolutionary origin.
- the present invention relates to ActRIIa polypeptides.
- ActRIIa refers to a family of activin receptor type Ha (ActRIIa) proteins from any species and variants derived from such ActRIIa proteins by mutagenesis or other modification. Reference to ActRIIa herein is understood to be a reference to any one of the currently identified forms.
- Members of the ActRIIa family are generally transmembrane proteins, composed of a ligand-binding extracellular domain with a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine kinase activity.
- ActRIIa polypeptide includes polypeptides comprising any naturally occurring polypeptide of an ActRIIa family member as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity.
- ActRIIa polypeptides include polypeptides derived from the sequence of any known ActRIIa having a sequence at least about 80% identical to the sequence of an ActRIIa polypeptide, and preferably at least
- an ActRIIa polypeptide of the invention may bind to and inhibit the function of an ActRIIa protein and/or activin.
- an ActRIIa polypeptide promotes bone growth and bone mineralization.
- Examples of ActRIIa polypeptides include human ActRIIa precursor polypeptide (SEQ ID NO: 1) and soluble human ActRIIa polypeptides (e.g., SEQ ID NOs: 2, 3, 7 and 12).
- the human ActRIIa precursor protein sequence is as follows:
- the human ActRIIa soluble (extracellular), processed polypeptide sequence is as follows:
- GNMCNEKFSYFPEMEVTQPTSNPVTPKPP SEQ ID NO: 2
- ILGRSETQECLFFN ANWEKDRTNQTGVEPCYGDKDKRRHCFAT WKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCE GNMCNEKFSYFPEM (SEQ ID NO:3)
- the nucleic acid sequence encoding human ActRIIa precursor protein is as follows(nucleotides 164-1705 ofGenbank entry NMJ)01616):
- the nucleic acid sequence encoding a human ActRIIa soluble (extracellular) polypeptide is as follows:
- the invention relates to soluble ActRIIa polypeptides.
- soluble ActRIIa polypeptide generally refers to polypeptides comprising an extracellular domain of an ActRIIa protein.
- soluble ActRIIa polypeptide includes any naturally occurring extracellular domain of an ActRIIa protein as well as any variants thereof (including mutants, fragments and peptidomimetic forms).
- An activin-binding ActRIIa polypeptide is one that retains the ability to bind to activin, particularly activin AA, AB or BB.
- an activin-binding ActRIIa polypeptide will bind to activin AA with a dissociation constant of 1 nM or less.
- Amino acid sequences of human ActRIIa precursor protein is provided below.
- the extracellular domain of an ActRIIa protein binds to activin and is generally soluble, and thus can be termed a soluble, activin-binding ActRIIa polypeptide.
- Examples of soluble, activin-binding ActRIIa polypeptides include the soluble polypeptide illustrated in SEQ ID NOs: 2, 3, 7, 12 and 13. SEQ ID NO:7 is referred to as
- ActRIIa-hFc 10275954J ActRIIa-hFc
- Other examples of soluble, activin-binding ActRIIa polypeptides comprise a signal sequence in addition to the extracellular domain of an ActRIIa protein, for example, the honey bee mellitin leader sequence (SEQ ID NO: 8), the tissue plaminogen activator (TPA) leader (SEQ ID NO: 9) or the native ActRIIa leader (SEQ ID NO: 10).
- TPA tissue plaminogen activator
- SEQ ID NO: 10 the native ActRIIa leader
- the ActRIIa-hFc polypeptide illustrated in SEQ ID NO: 13 uses a TPA leader.
- Functionally active fragments of ActRIIa polypeptides can be obtained by screening polypeptides recombinantly produced from the corresponding fragment of the nucleic acid encoding an ActRIIa polypeptide.
- fragments can be chemically synthesized using techniques known in the art such as conventional Merrifield solid phase f-Moc or t-Boc chemistry. The fragments can be produced (recombinantly or by chemical synthesis) and tested to identify those peptidyl fragments that can function as antagonists (inhibitors) of ActRIIa protein or signaling mediated by activin.
- a functional variant of the ActRIIa polypeptides can be obtained by screening libraries of modified polypeptides recombinantly produced from the corresponding mutagenized nucleic acids encoding an ActRIIa polypeptide. The variants can be produced and tested to identify those that can function as antagonists (inhibitors) of ActRIIa protein or signaling mediated by activin.
- a functional variant of the ActRIIa polypeptides comprises an amino acid sequence that is at least 75% identical to an amino acid sequence selected from SEQ ID NOs: 2 or 3.
- the functional variant has an amino acid sequence at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from SEQ ID NOs: 2 or 3.
- Functional variants may be generated by modifying the structure of an
- ActRIIa polypeptide for such purposes as enhancing therapeutic efficacy, or stability (e.g., ex vivo shelf life and resistance to proteolytic degradation in vivo), are considered functional equivalents of the naturally-occurring ActRIIa polypeptides.
- Modified ActRIIa polypeptides can also be produced, for instance, by amino acid substitution, deletion, or addition. For instance, it is reasonable to expect that an
- the present invention contemplates specific mutations of the ActRIIa polypeptides so as to alter the glycosylation of the polypeptide.
- Such mutations may be selected so as to introduce or eliminate one or more glycosylation sites, such as O-linked or N-linked glycosylation sites.
- Asparagine-linked glycosylation recognition sites generally comprise a tripeptide sequence, asparagine-X-threonine (or asparagines-X-serine) (where "X" is any amino acid) which is specifically recognized by appropriate cellular glycosylation enzymes.
- the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the wild-type ActRIIa polypeptide (for O-linked glycosylation sites).
- a variety of amino acid substitutions or deletions at one or both of the first or third amino acid positions of a glycosylation recognition site (and/or amino acid deletion at the second position) results in non-glycosylation at the modified tripeptide sequence.
- Another means of increasing the number of carbohydrate moieties on an ActRIIa polypeptide is by chemical or enzymatic coupling of glycosides to the ActRIIa polypeptide.
- the sugar(s) may be attached to (a) arginine and histidine; (b) free carboxyl groups; (c) free sulfhydryl groups such as those of cysteine; (d) free hydroxyl groups such as those of serine, threonine, or hydroxyproline; (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan; or (f) the amide group of glutamine.
- arginine and histidine free carboxyl groups
- free sulfhydryl groups such as those of cysteine
- free hydroxyl groups such as those of serine, threonine, or hydroxyproline
- aromatic residues such as those of phenylalanine, tyrosine, or tryptophan
- the amide group of glutamine are described in WO 87/05330 published Sep. 11, 1987, and in Aplin and Wriston (1981) CRC Crit. Rev. Biochem., pp. 259
- Chemical deglycosylation may involve, for example, exposure of the ActRIIa polypeptide to the compound trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetylglucosamine or N-acetylgalactosamine), while leaving the amino acid sequence intact. Chemical deglycosylation is further described by Hakimuddin et al. (1987) Arch. Biochem. Biophys. 259:52 and by Edge et al. (1981) Anal. Biochem. 118:131.
- Enzymatic cleavage of carbohydrate moieties on ActRIIa polypeptides can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al. (1987) Meth. Enzymol. 138:350.
- the sequence of an ActRIIa polypeptide may be adjusted, as appropriate, depending on the type of expression system used, as mammalian, yeast, insect and plant cells may all introduce differing glycosylation patterns that can be affected by the amino acid sequence of the peptide.
- ActRIIa proteins for use in humans will be expressed in a mammalian cell line that provides proper glycosylation, such as HEK293 or CHO cell lines, although other mammalian expression cell lines, yeast cell lines with engineered glycosylation enzymes and insect cells are expected to be useful as well.
- This disclosure further contemplates a method of generating mutants, particularly sets of combinatorial mutants of an ActRIIa polypeptide, as well as truncation mutants; pools of combinatorial mutants are especially useful for identifying functional variant sequences.
- the purpose of screening such combinatorial libraries may be to generate, for example, ActRIIa polypeptide variants which can act as either agonists or antagonist, or alternatively, which possess novel activities all together.
- a variety of screening assays are provided below, and such assays may be used to evaluate variants.
- an ActRIIa polypeptide variant may be screened for ability to bind to an ActRIIa ligand, to prevent binding of an ActRIIa ligand to an ActRIIa polypeptide or to interfere with signaling caused by an ActRIIa ligand.
- an ActRIIa polypeptide or its variants may also be tested in a cell-based or in vivo assay. For example, the effect of an ActRIIa polypeptide variant on the expression of genes involved in bone production or bone destruction may be assessed. This may, as needed, be performed in the presence of one or more
- ActRIIa ligand proteins e.g., activin
- cells may be transfected so as to produce an ActRIIa polypeptide and/or variants thereof, and optionally, an ActRIIa ligand.
- an ActRIIa polypeptide may be administered to a mouse or other animal, and one or more bone properties, such as density or volume may be assessed. The healing rate for bone fractures may also be evaluated.
- Dual-energy x- ray absorptiometiy (DEXA) is a well-established, non-invasive, quantitative technique for assessing bone density in an animal. In humans central DEXA systems may be used to evaluate bone density in the spine and pelvis.
- Peripheral DEXA systems may be used to evaluate bone density in peripheral bones, including, for example, the bones of the hand, wrist, ankle and foot.
- Traditional x-ray imaging systems including CAT scans, may be used to evaluate bone growth and fracture healing. The mechanical strength of bone may also be evaluated.
- Combinatorially-derived variants can be generated which have a selective or generally increased potency relative to a naturally occurring ActRIIa polypeptide.
- mutagenesis can give rise to variants which have intracellular half-lives dramatically different than the corresponding a wild-type ActRIIa polypeptide.
- the altered protein can be rendered either more stable or less stable to proteolytic degradation or other cellular processes which result in destruction of, or otherwise inactivation of a native ActRIIa polypeptide.
- Such variants, and the genes which encode them can be utilized to alter ActRIIa polypeptide levels by modulating the half-life of the ActRIIa polypeptides.
- a short half-life can give rise to more transient biological effects and can allow tighter control of recombinant ActRIIa polypeptide levels within the patient.
- mutations may be made in the linker (if any) and/or the Fc portion to alter the half- life of the protein.
- a combinatorial library may be produced by way of a degenerate library of genes encoding a library of polypeptides which each include at least a portion of potential ActRIIa polypeptide sequences.
- a mixture of synthetic oligonucleotides can be enzymatically ligated into gene sequences such that the degenerate set of potential ActRIIa polypeptide nucleotide sequences are expressible
- the library of potential homologs can be generated from a degenerate oligonucleotide sequence.
- Chemical synthesis of a degenerate gene sequence can be carried out in an automatic DNA synthesizer, and the synthetic genes then be ligated into an appropriate vector for expression.
- the synthesis of degenerate oligonucleotides is well known in the art (see for example, Narang, SA (1983) Tetrahedron 39:3; Itakura et al., (1981) Recombinant DNA, Proc. 3rd Cleveland Sympos. Macromolecules, ed. AG Walton, Amsterdam: Elsevier pp273-289; Itakura et al., (1984) Annu. Rev. Biochem.
- ActRIIa polypeptide variants can be generated and isolated from a library by screening using, for example, alanine scanning mutagenesis and the like (Ruf et al., (1994) Biochemistry 33: 1565-1572; Wang et al., (1994) J. Biol. Chem. 269:3095-3099; Balint et al., (1993) Gene 137:109-118; Grodberg et al., (1993) Eur. J. Biochem. 218:597-601; Nagashima et al., (1993) J. Biol. Chem.
- a wide range of techniques are known in the art for screening gene products of combinatorial libraries made by point mutations and truncations, and, for that matter, for screening cDNA libraries for gene products having a certain property. Such techniques will be generally adaptable for rapid screening of the gene libraries generated by the combinatorial mutagenesis of ActRIIa polypeptides.
- the most widely used techniques for screening large gene libraries typically comprises cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates relatively easy isolation of the vector encoding the gene whose product was detected.
- Preferred assays include activin binding assays and activin-mediated cell signaling assays.
- the ActRIIa polypeptides of the invention may further comprise post-translational modifications in addition to any that are naturally present in the ActRIIa polypeptides.
- modifications include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation, and acylation.
- the modified ActRIIa polypeptides may contain non-amino acid elements, such as polyethylene glycols, lipids, poly- or mono-saccharide, and phosphates. Effects of such non-amino acid elements on the functionality of a
- ActRIIa polypeptide may be tested as described herein for other ActRIIa polypeptide variants.
- an ActRIIa polypeptide is produced in cells by cleaving a nascent form of the ActRIIa polypeptide, post-translational processing may also be important for correct folding and/or function of the protein.
- Different cells such as CHO, HeLa, MDCK, 293, WI38, NIH-3T3 or HEK293 have specific cellular machinery and characteristic mechanisms for such post-translational activities and may be chosen to ensure the correct modification and processing of the ActRIIa polypeptides.
- functional variants or modified forms of the ActRIIa polypeptides include fusion proteins having at least a portion of the ActRIIa polypeptides and one or more fusion domains.
- fusion proteins having at least a portion of the ActRIIa polypeptides and one or more fusion domains.
- Well known examples of such fusion are well known examples of such fusion
- 10275954J domains include, but are not limited to, polyhistidine, Glu-Glu, glutathione S transferase (GST), thioredoxin, protein A, protein G, an immunoglobulin heavy chain constant region (Fc), maltose binding protein (MBP), or human serum albumin.
- a fusion domain may be selected so as to confer a desired property.
- some fusion domains are particularly useful for isolation of the fusion proteins by affinity chromatography.
- relevant matrices for affinity chromatography such as glutathione-, amylase-, and nickel- or cobalt- conjugated resins are used.
- fusion domain may be selected so as to facilitate detection of the ActRIIa polypeptides.
- detection domains include the various fluorescent proteins (e.g., GFP) as well as "epitope tags," which are usually short peptide sequences for which a specific antibody is available.
- epitope tags for which specific monoclonal antibodies are readily available include FLAG, influenza virus haemagglutinin (HA), and c-myc tags.
- the fusion domains have a protease cleavage site, such as for Factor Xa or Thrombin, which allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant proteins therefrom. The liberated proteins can then be isolated from the fusion domain by subsequent chromatographic separation.
- an ActRIIa polypeptide is fused with a domain that stabilizes the ActRIIa polypeptide in vivo (a "stabilizer” domain).
- stabilizing is meant anything that increases serum half life, regardless of whether this is because of decreased destruction, decreased clearance by the kidney, or other pharmacokinetic effect.
- Fusions with the Fc portion of an immunoglobulin are known to confer desirable pharmacokinetic properties on a wide range of proteins.
- fusions to human serum albumin can confer desirable properties.
- Other types of fusion domains that may be selected include multimerizing (e.g., dimerizing, tetramerizing) domains and functional domains (that confer an additional biological function, such as further stimulation of bone growth or muscle growth, as desired).
- the present invention provides a fusion protein comprising a soluble extracellular domain of ActRIIa fused to an Fc domain (e.g., SEQ ID NO: 6).
- THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD A) VSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK (A) VSNKAL PVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGPFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN (A) HYT QKSLSLSPGK*
- the Fc domain has one or more mutations at residues such as Asp-265, lysine 322, and Asn-434.
- the mutant Fc domain having one or more of these mutations e.g., Asp-265 mutation
- the mutant Fc domain having one or more of these mutations has increased ability of binding to the MHC class I-related Fc-receptor (FcRN) relative to a wildtype Fc domain.
- an ActRIIa polypeptide may be placed Oterminal to a heterologous domain, or, alternatively, a heterologous domain may be placed C-terminal to an ActRIIa polypeptide.
- the ActRIIa polypeptide domain and the heterologous domain need not be adjacent in a fusion protein, and additional domains or amino acid sequences may be included C- or N-terminal to either domain or between the domains.
- the ActRIIa polypeptides of the present invention contain one or more modifications that are capable of stabilizing the ActRIIa polypeptides.
- modifications enhance the in vitro half life of the ActRIIa polypeptides, enhance circulatory half life of the ActRIIa polypeptides or reduce proteolytic degradation of the ActRIIa polypeptides.
- stabilizing modifications include, but are not limited to, fusion proteins (including, for example, fusion proteins comprising an ActRIIa polypeptide and a stabilizer domain), modifications of a glycosylation site (including, for example, addition of a
- an ActRIIa polypeptide is fused to a stabilizer domain such as an IgG molecule (e.g., an Fc domain).
- a stabilizer domain such as an IgG molecule
- the term "stabilizer domain” not only refers to a fusion domain (e.g., Fc) as in the case of fusion proteins, but also includes nonproteinaceous modifications such as a carbohydrate moiety, or nonproteinaceous polymer, such as polyethylene glycol.
- the present invention makes available isolated and/or purified forms of the ActRIIa polypeptides, which are isolated from, or otherwise substantially free of, other proteins.
- ActRIIa polypeptides will generally be produced by expression from recombinant nucleic acids.
- the invention provides isolated and/or recombinant nucleic acids encoding any of the ActRIIa polypeptides (e.g., soluble ActRIIa polypeptides), including fragments, functional variants and fusion proteins disclosed herein.
- SEQ ID NO: 4 encodes the naturally occurring human ActRIIa precursor polypeptide
- SEQ ID NO: 5 encodes the processed extracellular domain of ActRIIa.
- the subject nucleic acids may be single-stranded or double stranded.
- Such nucleic acids may be DNA or RNA molecules. These nucleic acids may be used, for example, in methods for making ActRIIa polypeptides or as direct therapeutic agents (e.g., in a gene therapy approach).
- the subject nucleic acids encoding ActRIIa polypeptides are further understood to include nucleic acids that are variants of SEQ ID NO: 4 or 5.
- Variant nucleotide sequences include sequences that differ by one or more nucleotide substitutions, additions or deletions, such as allelic variants.
- the invention provides isolated or recombinant nucleic acid sequences that are at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 4 or 5.
- nucleic acid sequences complementary to SEQ ID NO: 4 or 5, and variants of SEQ ID NO: 4 or 5 are also within the scope of this invention.
- the nucleic acid sequences of the invention can be isolated, recombinant, and/or fused with a heterologous nucleotide sequence, or in a DNA library.
- nucleic acids of the invention also include nucleotide sequences that hybridize under highly stringent conditions to the nucleotide sequence designated in SEQ ID NO: 4 or 5, complement sequence of SEQ ID NO: 4 or 5, or fragments thereof.
- appropriate stringency conditions which promote DNA hybridization can be varied.
- appropriate stringency conditions which promote DNA hybridization can be varied. For example, one could perform the hybridization at 6.0 x sodium chloride/sodium citrate (SSC) at about 45 0 C, followed by a wash of 2.0 x SSC at 50 0 C.
- SSC sodium chloride/sodium citrate
- the salt concentration in the wash step can be selected from a low stringency of about 2.0 x SSC at 50 0 C to a high stringency of about 0.2 x SSC at 50 0 C.
- the temperature in the wash step can be increased from low stringency conditions at room temperature, about 22 0 C, to high stringency conditions at about 65 0 C. Both temperature and salt may be varied, or temperature or salt concentration may be held constant while the other variable is changed.
- the invention provides nucleic acids which hybridize under low stringency conditions of 6 x SSC at room temperature followed by a wash at 2 x SSC at room temperature.
- Isolated nucleic acids which differ from the nucleic acids as set forth in SEQ ID NOs: 4 or 5 due to degeneracy in the genetic code are also within the scope of the invention.
- a number of amino acids are designated by more than one triplet. Codons that specify the same amino acid, or synonyms (for example, CAU and CAC are synonyms for histidine) may result in "silent" mutations which do not affect the amino acid sequence of the protein.
- DNA sequence polymorphisms that do lead to changes in the amino acid sequences of the subject proteins will exist among mammalian cells.
- these variations in one or more nucleotides (up to about 3-5% of the nucleotides) of the nucleic acids encoding a particular protein may exist among
- the recombinant nucleic acids of the invention may be operably linked to one or more regulatory nucleotide sequences in an expression construct.
- Regulatory nucleotide sequences will generally be appropriate to the host cell used for expression. Numerous types of appropriate expression vectors and suitable regulatory sequences are known in the art for a variety of host cells.
- said one or more regulatory nucleotide sequences may include, but are not limited to, promoter sequences, leader or signal sequences, ribosomal binding sites, transcriptional start and termination sequences, translational start and termination sequences, and enhancer or activator sequences. Constitutive or inducible promoters as known in the art are contemplated by the invention.
- the promoters may be either naturally occurring promoters, or hybrid promoters that combine elements of more than one promoter.
- An expression construct may be present in a cell on an episome, such as a plasmid, or the expression construct may be inserted in a chromosome.
- the expression vector contains a selectable marker gene to allow the selection of transformed host cells. Selectable marker genes are well known in the art and will vary with the host cell used.
- the subject nucleic acid is provided in an expression vector comprising a nucleotide sequence encoding an ActRIIa polypeptide and operably linked to at least one regulatory sequence.
- Regulatory sequences are art-recognized and are selected to direct expression of the ActRIIa polypeptide.
- the term regulatory sequence includes promoters, enhancers, and other expression control elements. Exemplary regulatory sequences are described in Goeddel; Gene Expression Technology: Methods in Enzymology, Academic Press, San Diego, CA (1990).
- any of a wide variety of expression control sequences that control the expression of a DNA sequence when operatively linked to it may be used in these vectors to express DNA sequences encoding an ActRIIa polypeptide.
- useful expression control sequences include, for example, the early and late promoters of SV40, tet promoter, adenovirus
- 1027595 4 _l or cytomegalovirus immediate early promoter RSV promoters, the lac system, the trp system, the TAC or TRC system, T7 promoter whose expression is directed by T7 RNA polymerase, the major operator and promoter regions of phage lambda , the control regions for fd coat protein, the promoter for 3-phosphoglycerate kinase or other glycolytic enzymes, the promoters of acid phosphatase, e.g., Pho5, the promoters of the yeast ⁇ -mating factors, the polyhedron promoter of the baculovirus system and other sequences known to control the expression of genes of prokaryotic or eukaryotic cells or their viruses, and various combinations thereof.
- RSV promoters the lac system, the trp system, the TAC or TRC system
- T7 promoter whose expression is directed by T7 RNA polymerase
- the major operator and promoter regions of phage lambda the control regions for
- the design of the expression vector may depend on such factors as the choice of the host cell to be transformed and/or the type of protein desired to be expressed. Moreover, the vector's copy number, the ability to control that copy number and the expression of any other protein encoded by the vector, such as antibiotic markers, should also be considered.
- a recombinant nucleic acid of the invention can be produced by ligating the cloned gene, or a portion thereof, into a vector suitable for expression in either prokaryotic cells, eukaryotic cells (yeast, avian, insect or mammalian), or both.
- Expression vehicles for production of a recombinant ActRIIa polypeptide include plasmids and other vectors.
- suitable vectors include plasmids of the types: pBR322-derived plasmids, pEMBL-derived plasmids, pEX-derived plasmids, pBTac-derived plasmids and pUC-derived plasmids for expression in prokaryotic cells, such as E. coli.
- Some mammalian expression vectors contain both prokaryotic sequences to facilitate the propagation of the vector in bacteria, and one or more eukaryotic transcription units that are expressed in eukaryotic cells.
- the pcDNAI/amp, pcDNAI/neo, pRc/CMV, pSV2gpt, pSV2neo, pSV2-dhfr, pTk2, pRSVneo, pMSG, pSVT7, pko-neo and pHyg derived vectors are examples of mammalian expression vectors suitable for transfection of eukaryotic cells.
- vectors are modified with sequences from bacterial plasmids, such as pBR322, to facilitate replication and drug resistance selection in both prokaryotic and eukaryotic cells.
- bacterial plasmids such as pBR322
- derivatives of viruses such as the bovine papilloma virus (BPV-I), or Epstein-Barr virus (pHEBo, pREP-derived and p205) can be used for transient expression of proteins in eukaryotic cells.
- BBV-I bovine papilloma virus
- pHEBo Epstein-Barr virus
- pREP-derived and p205 Epstein-Barr virus
- 10275954J retroviral expression systems can be found below in the description of gene therapy delivery systems.
- the various methods employed in the preparation of the plasmids and in transformation of host organisms are well known in the art.
- suitable expression systems for both prokaryotic and eukaryotic cells, as well as general recombinant procedures see Molecular Cloning A Laboratory Manual, 3rd Ed., ed. by Sambrook, Fritsch and Maniatis (Cold Spring Harbor Laboratory Press, 2001).
- baculovirus expression systems include pVL-derived vectors (such as pVL1392, pVL1393 and pVL941), pAcUW-derived vectors (such as pAcUWl), and pBlueBac-derived vectors (such as the ⁇ -gal containing pBlueBac III).
- pVL-derived vectors such as pVL1392, pVL1393 and pVL941
- pAcUW-derived vectors such as pAcUWl
- pBlueBac-derived vectors such as the ⁇ -gal containing pBlueBac III.
- a vector will be designed for production of the subject ActRIIa polypeptides in CHO cells, such as a Pcmv-Script vector (Stratagene, La Jolla, Calif.), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pCI-neo vectors (Promega, Madison, Wise).
- a vector will be designed for production of the subject ActRIIa polypeptides in CHO cells, such as a Pcmv-Script vector (Stratagene, La Jolla, Calif.), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pCI-neo vectors (Promega, Madison, Wise).
- the subject gene constructs can be used to cause expression of the subject ActRIIa polypeptides in cells propagated in culture, e.g., to produce proteins, including fusion proteins or variant proteins, for purification.
- This disclosure also pertains to a host cell transfected with a recombinant gene including a coding sequence (e.g., SEQ ID NO: 4 or 5) for one or more of the subject ActRIIa polypeptides.
- the host cell may be any prokaryotic or eukaryotic cell.
- an ActRIIa polypeptide of the invention may be expressed in bacterial cells such as E. coli, insect cells (e.g., using a baculovirus expression system), yeast, or mammalian cells. Other suitable host cells are known to those skilled in the art.
- the present invention further pertains to methods of producing the subject ActRIIa polypeptides.
- a host cell transfected with an expression vector encoding an ActRIIa polypeptide can be cultured under appropriate conditions to allow expression of the ActRIIa polypeptide to occur.
- the ActRIIa polypeptide may be secreted and isolated from a mixture of cells and medium containing the ActRIIa polypeptide.
- 10275954J may be retained cytoplasmically or in a membrane fraction and the cells harvested, lysed and the protein isolated.
- a cell culture includes host cells, media and other byproducts. Suitable media for cell culture are well known in the art.
- the subject ActRIIa polypeptides can be isolated from cell culture medium, host cells, or both, using techniques known in the art for purifying proteins, including ion-exchange chromatography, gel filtration chromatography, ultrafiltration, electrophoresis, immunoaffmity purification with antibodies specific for particular epitopes of the ActRIIa polypeptides and affinity purification with an agent that binds to a domain fused to the ActRIIa polypeptide (e.g., a protein A column may be used to purify an ActRIIa-Fc fusion).
- a protein A column may be used to purify an ActRIIa-Fc fusion.
- the ActRIIa polypeptide is a fusion protein containing a domain which facilitates its purification.
- purification is achieved by a series of column chromatography steps, including, for example, three or more of the following, in any order: protein A chromatography, Q sepharose chromatography, phenylsepharose chromatography, size exclusion chromatography, and cation exchange chromatography.
- the purification could be completed with viral filtration and buffer exchange.
- ActRIIa-hFc protein was purified to a purity of >98% as determined by size exclusion chromatography and >95% as determined by SDS PAGE. This level of purity was sufficient to achieve desirable effects on bone in mice and an acceptable safety profile in mice, rats and non-human primates.
- a fusion gene coding for a purification leader sequence such as a poly-(His)/enterokinase cleavage site sequence at the N- terminus of the desired portion of the recombinant ActRIIa polypeptide, can allow purification of the expressed fusion protein by affinity chromatography using a Ni 2+ metal resin.
- the purification leader sequence can then be subsequently removed by treatment with enterokinase to provide the purified ActRIIa polypeptide (e.g., see Hochuli et al., (1987) J Chromatography 411:177; and Janknecht et al., PNAS USA 88:8972).
- the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers.
- PCR amplification of gene fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can subsequently be annealed to generate a chimeric gene sequence (see, for example, Current Protocols in Molecular Biology, eds. Ausubel et al., John Wiley & Sons: 1992).
- activin- ActRIIa signaling can be used to promote bone growth and bone mineralization.
- soluble ActRIIa polypeptides, and particularly Actrlla-Fc are preferred antagonists, and although such antagonists may affect bone through a mechanism other than activin antagonism (e.g., activin inhibition may be an indicator of the tendency of an agent to inhibit the activities of a spectrum of molecules, including, perhaps, other members of the TGF-beta superfamily, and such collective inhibition may lead to the desired effect on bone)
- other types of activin- ActRIIa antagonists are expected to be useful, including anti-activin (e.g., A, B, C or E) antibodies, anti-ActRIIa antibodies, antisense, RNAi or ribozyme nucleic acids that inhibit the production of ActRIIa and other inhibitors of activin or ActRIIa, particularly those that disrupt activin-ActRIIa binding.
- an antibody that is specifically reactive with an ActRIIa polypeptide e.g., a soluble ActRIIa polypeptide
- an antibody that is specifically reactive with an activin A polypeptide and which disrupts ActRIIa binding may be used as an antagonist.
- anti-protein/anti-peptide antisera or monoclonal antibodies can be made by standard protocols (see, for example, Antibodies: A Laboratory Manual ed. by
- a mammal such as a mouse, a hamster or rabbit can be immunized with an immunogenic form of the ActRIIa polypeptide, an antigenic fragment which is capable of eliciting an antibody response, or a fusion protein.
- Techniques for conferring immunogenicity on a protein or peptide include conjugation to carriers or other techniques well known in the art.
- An immunogenic portion of an ActRIIa or activin polypeptide can be administered in the presence of adjuvant. The progress of immunization can be monitored by detection of antibody titers in plasma or serum. Standard ELISA or other immunoassays can be used with the immunogen as antigen to assess the levels of antibodies.
- antibody-producing cells can be harvested from an immunized animal and fused by standard somatic cell fusion procedures with immortalizing cells such as myeloma cells to yield hybridoma cells.
- Hybridoma cells can be screened immunochemically for production of antibodies specifically reactive with an ActRIIa polypeptide and monoclonal antibodies isolated from a culture comprising such hybridoma cells.
- antibody as used herein is intended to include fragments thereof which are also specifically reactive with a subject polypeptide.
- Antibodies can be fragmented using conventional techniques and the fragments screened for utility in the same manner as described above for whole antibodies. For example, F(ab)2 fragments can be generated by treating antibody with pepsin. The resulting F(ab)2 fragment can be treated to reduce disulfide bridges to produce Fab fragments.
- the antibody of the present invention is further intended to include bispecific, single-
- an antibody may further comprise a label attached thereto and able to be detected (e.g., the label can be a radioisotope, fluorescent compound, enzyme or enzyme co- factor).
- the antibody is a recombinant antibody, which term encompasses any antibody generated in part by techniques of molecular biology, including CDR-grafted or chimeric antibodies, human or other antibodies assembled from library-selected antibody domains, single chain antibodies and single domain antibodies (e.g., human VH proteins or came lid VHH proteins).
- an antibody of the invention is a monoclonal antibody, and in certain embodiments, the invention makes available methods for generating novel antibodies.
- a method for generating a monoclonal antibody that binds specifically to an ActRIIa polypeptide or activin polypeptide may comprise administering to a mouse an amount of an immunogenic composition comprising the antigen polypeptide effective to stimulate a detectable immune response, obtaining antibody-producing cells (e.g., cells from the spleen) from the mouse and fusing the antibody-producing cells with myeloma cells to obtain antibody-producing hybridomas, and testing the antibody-producing hybridomas to identify a hybridoma that produces a monocolonal antibody that binds specifically to the antigen.
- antibody-producing cells e.g., cells from the spleen
- a hybridoma can be propagated in a cell culture, optionally in culture conditions where the hybridoma-derived cells produce the monoclonal antibody that binds specifically to the antigen.
- the monoclonal antibody may be purified from the cell culture.
- the adjective "specifically reactive with” as used in reference to an antibody is intended to mean, as is generally understood in the art, that the antibody is sufficiently selective between the antigen of interest (e.g., an ActRIIa polypeptide) and other antigens that are not of interest that the antibody is useful for, at minimum, detecting the presence of the antigen of interest in a particular type of biological sample. In certain methods employing the antibody, such as therapeutic applications, a higher degree of specificity in binding may be desirable. Monoclonal antibodies generally have a greater tendency (as compared to polyclonal antibodies)
- 10275954_I to discriminate effectively between the desired antigens and cross-reacting polypeptides.
- One characteristic that influences the specificity of an antibody rantigen interaction is the affinity of the antibody for the antigen.
- affinity a dissociation constant
- a neutralizing anti-activin or anti-ActRIIa antibody would generally have a dissociation constant of 10 '10 or less.
- the techniques used to screen antibodies in order to identify a desirable antibody may influence the properties of the antibody obtained. For example, if an antibody is to be used for binding an antigen in solution, it may be desirable to test solution binding.
- a variety of different techniques are available for testing interaction between antibodies and antigens to identify particularly desirable antibodies. Such techniques include ELISAs, surface plasmon resonance binding assays (e.g., the BiacoreTM binding assay, Biacore AB, Uppsala, Sweden), sandwich assays (e.g., the paramagnetic bead system of IGEN International, Inc., Gaithersburg, Maryland), western blots, immunoprecipitation assays, and immunohistochemistry.
- a nucleic acid compound may be single or double stranded.
- a double stranded compound may also include regions of overhang or non- complementarity, where one or the other of the strands is single stranded.
- a single stranded compound may include regions of self-complementarity, meaning that the compound forms a so-called "hairpin” or "stem-loop” structure, with a region of double helical structure.
- a nucleic acid compound may comprise a nucleotide sequence that is complementary to a region consisting of no more than 1000, no more than 500, no more than 250, no more than 100 or no more than 50, 35, 30, 25, 22, 20 or 18 nucleotides of the full-length ActRIIa nucleic acid sequence or activin ⁇ A or activin ⁇ B nucleic acid sequence.
- the region of complementarity will preferably be at least 8 nucleotides, and optionally at least 10 or at least 15 nucleotides, and optionally between 15 and 25 nucleotides.
- 10 2 75954_l complementarity may fall within an intron, a coding sequence or a noncoding sequence of the target transcript, such as the coding sequence portion.
- a nucleic acid compound will have a length of about 8 to about 500 nucleotides or base pairs in length, and optionally the length will be about 14 to about 50 nucleotides.
- a nucleic acid may be a DNA (particularly for use as an antisense), RNA or RNA:DNA hybrid. Any one strand may include a mixture of DNA and RNA, as well as modified forms that cannot readily be classified as either DNA or RNA.
- a double stranded compound may be DNA:DNA, DNA:RNA or RNArRNA, and any one strand may also include a mixture of DNA and RNA, as well as modified forms that cannot readily be classified as either DNA or RNA.
- a nucleic acid compound may include any of a variety of modifications, including one or modifications to the backbone (the sugar-phosphate portion in a natural nucleic acid, including interaucleotide linkages) or the base portion (the purine or pyrimidine portion of a natural nucleic acid).
- An antisense nucleic acid compound will preferably have a length of about 15 to about 30 nucleotides and will often contain one or more modifications to improve characteristics such as stability in the serum, in a cell or in a place where the compound is likely to be delivered, such as the stomach in the case of orally delivered compounds and the lung for inhaled compounds.
- the strand complementary to the target transcript will generally be RNA or modifications thereof.
- the other strand may be RNA, DNA or any other variation.
- the duplex portion of double stranded or single stranded "hairpin" RNAi construct will preferably have a length of 18 to 40 nucleotides in length and optionally about 21 to 23 nucleotides in length, so long as it serves as a Dicer substrate.
- Catalytic or enzymatic nucleic acids may be ribozymes or DNA enzymes and may also contain modified forms.
- Nucleic acid compounds may inhibit expression of the target by about 50%, 75%, 90% or more when contacted with cells under physiological conditions and at a concentration where a nonsense or sense control has little or no effect. Preferred concentrations for testing the effect of nucleic acid compounds are 1, 5 and 10 micromolar. Nucleic acid compounds may also be tested for effects on, for example, bone growth and mineralization.
- the present invention relates to the use of ActRIIa polypeptides (e.g., soluble ActRIIa polypeptides) and activin polypeptides to identify compounds (agents) which are agonist or antagonists of the activin-ActRIIa signaling pathway.
- ActRIIa polypeptides e.g., soluble ActRIIa polypeptides
- activin polypeptides e.g., soluble ActRIIa polypeptides
- Compounds identified through this screening can be tested to assess their ability to modulate bone growth or mineralization in vitro.
- these compounds can further be tested in animal models to assess their ability to modulate tissue growth in vivo.
- high-throughput screening of compounds can be carried out to identify agents that perturb activin or ActRIIa-mediated effects on bone.
- the assay is carried out to screen and identify compounds that specifically inhibit or reduce binding of an ActRIIa polypeptide to activin.
- the assay can be used to identify compounds that enhance binding of an ActRIIa polypeptide to activin.
- the compounds can be identified by their ability to interact with an activin or ActRIIa polypeptide.
- test compounds (agents) of the invention may be created by any combinatorial chemical method.
- the subject compounds may be naturally occurring biomolecules synthesized in vivo or in vitro.
- Compounds (agents) to be tested for their ability to act as modulators of tissue growth can be produced, for example, by bacteria, yeast, plants or other organisms (e.g., natural products), produced chemically (e.g., small molecules, including peptidomimetics), or produced recombinantly.
- Test compounds contemplated by the present invention include non-peptidyl organic molecules, peptides, polypeptides, peptidomimetics, sugars, hormones, and nucleic acid molecules.
- the test agent is a small organic molecule having a molecular weight of less than about 2,000 daltons.
- test compounds of the invention can be provided as single, discrete entities, or provided in libraries of greater complexity, such as made by combinatorial chemistry.
- libraries can comprise, for example, alcohols, alkyl halides, amines, amides, esters, aldehydes, ethers and other classes of organic compounds.
- Presentation of test compounds to the test system can be in either an isolated form or as mixtures of compounds, especially in initial screening steps.
- the compounds may be optionally derivatized with other compounds and have derivatizing groups that facilitate isolation of the compounds.
- Non-limiting examples of derivatizing groups include biotin, fluorescein, digoxygenin, green fluorescent protein, isotopes, polyhistidine, magnetic beads, glutathione S transferase (GST), photoactivatible crosslinkers or any combinations thereof.
- the compound of interest is contacted with an isolated and purified ActRIIa polypeptide which is ordinarily capable of binding to activin.
- an isolated and purified ActRIIa polypeptide which is ordinarily capable of binding to activin.
- a composition containing an ActRIIa ligand is then added to the mixture of the compound and ActRIIa polypeptide.
- Detection and quantification of ActRIIa/activin complexes provides a means for determining the compound's efficacy at inhibiting (or potentiating) complex formation between the ActRIIa polypeptide and activin.
- the efficacy of the compound can be assessed by generating dose response curves from data obtained using various concentrations of the test compound.
- a control assay can also be performed to provide a baseline for comparison.
- Complex formation between the ActRIIa polypeptide and activin may be detected by a variety of techniques. For instance, modulation of the formation of complexes can be quantitated using, for example, detectably labeled proteins such as radiolabeled (e.g., 32 P, 35 S, 14 C or 3 H), fluorescently labeled (e.g., FITC), or enzymatically labeled ActRIIa polypeptide or activin, by immunoassay, or by chromatographic detection.
- detectably labeled proteins such as radiolabeled (e.g., 32 P, 35 S, 14 C or 3 H), fluorescently labeled (e.g., FITC), or enzymatically labeled ActRIIa polypeptide or activin, by immunoassay, or by chromatographic detection.
- the present invention contemplates the use of fluorescence polarization assays and fluorescence resonance energy transfer (FRET) assays in measuring, either directly or indirectly, the degree of interaction between an ActRIIa polypeptide and its binding protein.
- FRET fluorescence resonance energy transfer
- other modes of detection such as those based on optical waveguides (PCT Publication WO 96/26432 and U.S. Pat. No. 5,677,196), surface plasmon resonance (SPR), surface charge sensors, and surface force sensors, are compatible with many embodiments of the invention.
- the present invention contemplates the use of an interaction trap assay, also known as the "two hybrid assay," for identifying agents that disrupt or potentiate interaction between an ActRIIa polypeptide and its binding protein.
- the present invention contemplates the use of reverse two hybrid systems to identify compounds (e.g., small molecules or peptides) that dissociate interactions between an ActRIIa polypeptide and its binding protein.
- the subject compounds are identified by their ability to interact with an ActRIIa or activin polypeptide of the invention.
- the interaction between the compound and the ActRIIa or activin polypeptide may be covalent or non-covalent.
- such interaction can be identified at the protein level using in vitro biochemical methods, including photo-crosslinking, radiolabeled ligand binding, and affinity chromatography (Jakoby WB et al., 1974, Methods in Enzymology 46: 1).
- the compounds may be screened in a mechanism based assay, such as an assay to detect compounds which bind to an activin or ActRIIa polypeptide. This may include a solid phase or fluid phase binding event.
- the gene encoding an activin or ActRIIa polypeptide can be transfected with a reporter system (e.g., ⁇ -galactosidase, luciferase, or green fluorescent protein) into a cell and screened against the library preferably by a high throughput screening or with individual members of the library.
- a reporter system e.g., ⁇ -galactosidase, luciferase, or green fluorescent protein
- Other mechanism based binding assays may be used, for example, binding assays which detect changes in free energy. Binding assays can be performed with the target fixed to a well, bead or chip or captured by an immobilized antibody or resolved by capillary electrophoresis. The bound compounds may be detected usually using colorimetric or fluorescence or surface plasmon resonance.
- the present invention provides methods and agents for modulating (stimulating or inhibiting) bone formation and increasing bone mass. Therefore, any compound identified can be tested in whole cells or tissues, in vitro or in vivo, to confirm their ability to modulate bone growth or mineralization. Various methods known in the art can be utilized for this purpose.
- the effect of the ActRIIa or activin polypeptides or test compounds on bone or cartilage growth can be determined by measuring induction of Msx2 or differentiation of osteoprogenitor cells into osteoblasts in cell based assays (see, e.g., Daluiski et al., Nat Genet. 2001, 27(l):84-8; Hino et al., Front Biosci. 2004, 9:1520-9).
- cell-based assays includes analyzing the osteogenic activity of the subject ActRIIa or activin polypeptides and test compounds in mesenchymal progenitor and osteoblastic cells.
- recombinant adenoviruses expressing an activin or ActRIIa polypeptide can be constructed to infect pluripotent mesenchymal progenitor C3H10T1/2 cells,
- Osteogenic activity is then determined by measuring the induction of alkaline phosphatase, osteocalcin, and matrix mineralization (see, e.g., Cheng et al, J bone Joint Surg Am. 2003, 85- A(8): 1544-52).
- the present invention also contemplates in vivo assays to measure bone or cartilage growth.
- Namkung-Matthai et al., Bone, 28:80-86 (2001) discloses a rat osteoporotic model in which bone repair during the early period after fracture is studied.
- the present invention makes use of fracture healing assays that are known in the art.
- assays include fracture technique, histological analysis, and biomechanical analysis, which are described in, for example, U.S. Pat. No. 6,521,750, which is incorporated by reference in its entirety for its disclosure of experimental protocols for causing as well as measuring the extent of fractures, and the repair process.
- activin-ActRJIa antagonists e.g., ActRIIa polypeptides
- the present invention provides methods of treating or preventing bone damage in an individual in need thereof through administering to the individual a therapeutically effective amount of an activin-ActRIIa antagonist, particularly an ActRIIa polypeptide.
- the present invention provides methods of promoting bone growth or mineralization in an individual in need thereof through administering to the
- an activin-ActRIIa antagonist particularly an ActRIIa polypeptide.
- These methods are preferably aimed at therapeutic and prophylactic treatments of animals, and more preferably, humans.
- the disclosure provides for the use of activin-ActRIIa antagonists (particularly soluble ActRIIa polypeptides and neutralizing antibodies targeted to activin or ActRIIa) for the treatment of disorders associated with low bone density or decreased bone strength.
- a therapeutic that "prevents" a disorder or condition refers to a compound that, in a statistical sample, reduces the occurrence of the disorder or condition in the treated sample relative to an untreated control sample, or delays the onset or reduces the severity of one or more symptoms of the disorder or condition relative to the untreated control sample.
- treating includes prophylaxis of the named condition or amelioration or elimination of the condition once it has been established. In either case, prevention or treatment may be discerned in the diagnosis provided by a physician and the intended result of administration of the therapeutic agent.
- the disclosure provides methods of inducing bone and/or cartilage formation, preventing bone loss, increasing bone mineralization or preventing the demineralization of bone.
- the subject activin-ActRIIa antagonists have application in treating osteoporosis and the healing of bone fractures and cartilage defects in humans and other animals.
- ActRIIa or activin polypeptides may be useful in patients that are diagnosed with subclinical low bone density, as a protective measure against the development of osteoporosis.
- methods and compositions of the present invention may find medical utility in the healing of bone fractures and cartilage defects in humans and other animals.
- the subject methods and compositions may also have prophylactic use in closed as well as open fracture reduction and also in the improved fixation of artificial joints.
- De novo bone formation induced by an osteogenic agent contributes to the repair of congenital, trauma-induced, or oncologic resection induced craniofacial defects, and also is useful in cosmetic plastic surgery.
- the subject activin-ActRIIa antagonists may
- 1Q275954J provide an environment to attract bone-forming cells, stimulate growth of bone- forming cells or induce differentiation of progenitors of bone-forming cells.
- Activin-ActRIIa antagonists of the invention may also be useful in the treatment of osteoporosis.
- Methods and compositions of the invention can be applied to conditions characterized by or causing bone loss, such as osteoporosis (including secondary osteoporosis), hyperparathyroidism, Cushing's disease, Paget' s disease, thyrotoxicosis, chronic diarrheal state or malabsorption, renal tubular acidosis, or anorexia nervosa.
- Osteoporosis may be caused by, or associated with, various factors.
- a post-menopausal female having a low body weight, and leading a sedentary lifestyle are all risk factors for osteoporosis (loss of bone mineral density, leading to fracture risk).
- Persons having any of the following profiles may be candidates for treatment with an ActRIIa antagonist: a post-menopausal woman and not taking estrogen or other hormone replacement therapy; a person with a personal or maternal history of hip fracture or smoking; a post-menopausal woman who is tall (over 5 feet 7 inches) or thin (less than 125 pounds); a man with clinical conditions associated with bone loss; a person using medications that are known to cause bone loss, including corticosteroids such as PrednisoneTM, various anti-seizure medications such as DilantinTM and certain barbiturates, or high-dose thyroid replacement drugs; a person having type 1 diabetes, liver disease, kidney disease or a family history of osteoporosis; a person having high bone turnover (e.g., excessive collagen in urine samples); a
- osteoporosis can also result as a condition associated with another disorder or from the use of certain medications. Osteoporosis resulting from drugs or another medical condition is known as secondary osteoporosis. In a condition known as Cushing's disease, the excess amount of Cortisol produced by the body results in osteoporosis and fractures. The most common medications
- 10275954_l associated with secondary osteoporosis are the corticosteroids, a class of drugs that act like Cortisol, a hormone produced naturally by the adrenal glands. Although adequate levels of thyroid hormones (which are produced by the thyroid gland) are needed for the development of the skeleton, excess thyroid hormone can decrease bone mass over time. Antacids that contain aluminum can lead to bone loss when taken in high doses by people with kidney problems, particularly those undergoing dialysis.
- Other medications that can cause secondary osteoporosis include phenytoin (Dilantin) and barbiturates that are used to prevent seizures; methotrexate (Rheumatrex, Immunex, Folex PFS), a drug for some forms of arthritis, cancer, and immune disorders; cyclosporine (Sandimmune, Neoral), a drug used to treat some autoimmune diseases and to suppress the immune system in organ transplant patients; luteinizing hormone-releasing hormone agonists (Lupron, Zoladex), used to treat prostate cancer and endometriosis; heparin (Calciparine, Liquaemin), an anticlotting medication; and cholestyramine (Questran) and colestipol (Colestid), used to treat high cholesterol.
- Bone loss resulting from cancer therapy is widely recognized and termed cancer therapy induced bone loss (CTIBL). Bone metastases can create cavities in the bone that may be corrected by treatment with activin- ActRIIa antagonists.
- CTIBL cancer therapy induced bone
- activin-ActRIIa antagonists particularly a soluble ActRIIa, disclosed herein may be used in cancer patients.
- Patients having certain tumors e.g. prostate, breast, multiple myeloma or any tumor causing hyperparathyroidism
- Such patients may be treated with activin-ActRIIa antagonists even in the absence of evidence of bone loss or bone metastases.
- Patients may also be monitored for evidence of bone loss or bone metastases, and may be treated with activin-ActRIIa antagonists in the event that indicators suggest an increased risk.
- BSAP Bone specific alkaline phosphatase
- Blood levels of BSAP are increased in patients with bone metastasis and other conditions that result in increased bone remodeling. Osteocalcin and procollagen peptides are
- I 0275954_l also associated with bone formation and bone metastases. Increases in BSAP have been detected in patients with bone metastasis caused by prostate cancer, and to a lesser degree, in bone metastases from breast cancer. Bone Morphogenetic Protein-7 (BMP-7) levels are high in prostate cancer that has metastasized to bone, but not in bone metastases due to bladder, skin, liver, or lung cancer. Type I Carboxy-terminal telopeptide (ICTP) is a crosslink found in collagen that is formed during to the resorption of bone. Since bone is constantly being broken down and reformed, ICTP will be found throughout the body. However, at the site of bone metastasis, the level will be significantly higher than in an area of normal bone.
- ICTP Carboxy-terminal telopeptide
- ICTP has been found in high levels in bone metastasis due to prostate, lung, and breast cancer.
- Another collagen crosslink, Type I N-terminal telopeptide (NTx) is produced along with ICTP during bone turnover.
- the amount of NTx is increased in bone metastasis caused by many different types of cancer including lung, prostate, and breast cancer.
- the levels of NTx increase with the progression of the bone metastasis. Therefore, this marker can be used to both detect metastasis as well as measure the extent of the disease.
- Other markers of resorption include pyridinoline and deoxypyridinoline. Any increase in resorption markers or markers of bone metastases indicate the need for activin-ActRIIa antagonist therapy in a patient.
- Activin-ActRIIa antagonists may be conjointly administered with other pharmaceutical agents. Conjoint administration may be accomplished by administration of a single co-formulation, by simultaneous administration or by administration at separate times. Activin-ActRIIa antagonists may be particularly advantageous if administered with other bone-active agents. A patient may benefit from conjointly receiving activin-ActRIIa antagonist and taking calcium supplements, vitamin D, appropriate exercise and/or, in some cases, other medication. Examples of other medications incude, bisphosphonates (alendronate, ibandronate and risedronate), calcitonin, estrogens, parathyroid hormone and raloxifene.
- the bisphosphonates (alendronate, ibandronate and risedronate), calcitonin, estrogens and raloxifene affect the bone remodeling cycle and are classified as anti-resorptive medications.
- Bone remodeling consists of two distinct stages: bone resorption and bone formation. Anti-resorptive medications slow or stop the bone-resorbing portion of the bone-remodeling cycle but do not slow the
- Alendronate also is approved for treatment of glucocorticoid-induced osteoporosis in men and women as a result of long-term use of these medications (i.e., prednisone and cortisone) and for the treatment of osteoporosis in men.
- Alendronate plus vitamin D is approved for the treatment of osteoporosis in postmenopausal women (70 mg once a week plus vitamin D), and for treatment to improve bone mass in men with osteoporosis.
- Ibandronate is approved for the prevention and treatment of postmenopausal osteoporosis. Taken as a once-a-month pill (150 mg), ibandronate should be taken on the same day each month.
- Ibandronate reduces bone loss, increases bone density and reduces the risk of spine fractures.
- Risedronate is approved for the prevention and treatment of postmenopausal osteoporosis. Taken daily (5 mg dose) or weekly (35 mg dose or 35 mg dose with calcium), risedronate slows bone loss, increases bone density and reduces the risk of spine and non-spine fractures.
- Risedronate also is approved for use by men and women to prevent and/or treat glucocorticoid- induced osteoporosis that results from long-term use of these medications (i.e., prednisone or cortisone).
- Calcitonin is a naturally occurring hormone involved in calcium regulation and bone metabolism.
- calcitonin slows bone loss, increases spinal bone density, and may relieve the pain associated with bone fractures. Calcitonin reduces the risk of spinal fractures. Calcitonin is available as an injection (50-100 IU daily) or nasal spray (200 IU daily). Estrogen therapy (ET)/Hormone therapy (HT) is approved for the prevention of osteoporosis. ET has been shown to reduce bone loss, increase bone density in both the spine and hip, and reduce the risk of hip and spinal fractures in postmenopausal women. ET is administered most commonly in the form of a pill or skin patch that delivers a low dose of approximately 0.3 mg daily or a standard dose of approximately 0.625 mg daily and is effective even when started after age
- SERMs Selective Estrogen Receptor Modulators
- Raloxifene increases bone mass and reduces the risk of spine fractures.
- Data are not yet available to demonstrate that raloxifene can reduce the risk of hip and other non- spine fractures.
- Teriparatide a form of parathyroid hormone, is approved for the treatment of osteoporosis in postmenopausal women and men who are at high risk for a fracture. This medication stimulates new bone formation and significantly increases bone mineral density. In postmenopausal women, fracture reduction was noted in the spine, hip, foot, ribs and wrist. In men, fracture reduction was noted in the spine, but there were insufficient data to evaluate fracture reduction at other sites.
- Teriparatide is self-administered as a daily injection for up to 24 months.
- activin-ActRIIa antagonists e.g., ActRIIa polypeptides
- a pharmaceutically acceptable carrier e.g., an ActRIIa polypeptide can be administered alone or as a component of a pharmaceutical formulation (therapeutic composition).
- the subject compounds may be formulated for administration in any convenient way for use in human or veterinary medicine.
- the therapeutic method of the invention includes administering the composition systemically, or locally as an implant or device.
- the therapeutic composition for use in this invention is, of course, in a pyrogen-free, physiologically acceptable form.
- 10275954_l agents other than the ActRIIa antagonists which may also optionally be included in the composition as described above, may be administered simultaneously or sequentially with the subject compounds (e.g., ActRIIa polypeptides) in the methods of the invention.
- ActRIIa antagonists will be administered parentally.
- compositions suitable for parenteral administration may comprise one or more ActRIIa polypeptides in combination with one or more pharmaceutically acceptable sterile isotonic aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain antioxidants, buffers, bacteriostats, solutes which render the formulation isotonic with the blood of the intended recipient or suspending or thickening agents.
- aqueous and nonaqueous carriers examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
- polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
- vegetable oils such as olive oil
- injectable organic esters such as ethyl oleate.
- Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- the composition may be encapsulated or injected in a form for delivery to a target tissue site (e.g., bone).
- compositions of the present invention may include a matrix capable of delivering one or more therapeutic compounds (e.g., ActRIIa polypeptides) to a target tissue site (e.g., bone), providing a structure for the developing tissue and optimally capable of being resorbed into the body.
- a target tissue site e.g., bone
- the matrix may provide slow release of the ActRIIa polypeptides.
- Such matrices may be formed of materials presently in use for other implanted medical applications.
- compositions may be biodegradable and chemically
- 10275954J defined calcium sulfate, tricalciumphosphate, hydroxyapatite, polylactic acid and polyanhydrides.
- Other potential materials are biodegradable and biologically well defined, such as bone or dermal collagen.
- Further matrices are comprised of pure proteins or extracellular matrix components.
- Other potential matrices are non- biodegradable and chemically defined, such as sintered hydroxyapatite, bioglass, aluminates, or other ceramics.
- Matrices may be comprised of combinations of any of the above mentioned types of material, such as polylactic acid and hydroxyapatite or collagen and tricalciumphosphate.
- the bioceramics may be altered in composition, such as in calcium-aluminate-phosphate and processing to alter pore size, particle size, particle shape, and biodegradability.
- methods of the invention can be administered for orally, e.g., in the form of capsules, cachets, pills, tablets, lozenges (using a flavored basis, usually sucrose and acacia or tragacanth), powders, granules, or as a solution or a suspension in an aqueous or non-aqueous liquid, or as an oil-in-water or water- in-oil liquid emulsion, or as an elixir or syrup, or as pastilles (using an inert base, such as gelatin and glycerin, or sucrose and acacia) and/or as mouth washes and the like, each containing a predetermined amount of an agent as an active ingredient.
- An agent may also be administered as a bolus, electuary or paste.
- one or more therapeutic compounds of the present invention may be mixed with one or more pharmaceutically acceptable carriers, such as sodium citrate or dicalcium phosphate, and/or any of the following: (1) fillers or extenders, such as starches, lactose, sucrose, glucose, mannitol, and/or silicic acid; (2) binders, such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, sucrose, and/or acacia; (3) humectants, such as glycerol; (4) disintegrating agents, such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate; (5) solution retarding agents, such as paraffin; (6) absorption accelerators, such as quaternary ammonium compounds; (7) wetting agents, such as
- the pharmaceutical compositions may also comprise buffering agents.
- Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugars, as well as high molecular weight polyethylene glycols and the like.
- Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and elixirs.
- the liquid dosage forms may contain inert diluents commonly used in the art, such as water or other solvents, solubilizing agents and emulsif ⁇ ers, such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
- the oral compositions can also include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, coloring, perfuming, and preservative agents.
- Suspensions in addition to the active compounds, may contain suspending agents such as ethoxylated isostearyl alcohols, polyoxyethylene sorbitol, and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
- suspending agents such as ethoxylated isostearyl alcohols, polyoxyethylene sorbitol, and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
- compositions of the invention may also contain adjuvants, such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of the action of microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption, such as aluminum monostearate and gelatin. It is understood that the dosage regimen will be determined by the attending physician considering various factors which modify the action of the subject
- 10275954_I compounds of the invention e.g., ActRIIa polypeptides.
- the various factors include, but are not limited to, amount of bone weight desired to be formed, the degree of bone density loss, the site of bone damage, the condition of the damaged bone, the patient's age, sex, and diet, the severity of any disease that may be contributing to bone loss, time of administration, and other clinical factors.
- the dosage may vary with the type of matrix used in the reconstitution and the types of compounds in the composition.
- the addition of other known growth factors to the final composition, may also affect the dosage.
- Progress can be monitored by periodic assessment of bone growth and/or repair, for example, X-rays (including DEXA), histomorphometric determinations, and tetracycline labeling.
- mice have demonstrated that effects of ActRIIa-Fc on bone are detectable when the compound is dosed at intervals and amounts sufficient to achieve serum concentrations of 0.2 ⁇ g/kg or greater, and serum levels of 1 ⁇ g/kg or 2 ⁇ g/kg or greater are desirable for achieving significant effects on bone density and strength.
- dosing regimens may be designed to reach serum concentrations of between 0.2 and 15 ⁇ g/kg, and optionally between 1 and 5 ⁇ g/kg.
- serum levels of 0.2 ⁇ g/kg may be achieved with a single dose of 0.1 mg/kg or greater and serum levels of 1 ⁇ g/kg may be achieved with a single dose of 0.3 mg/kg or greater.
- the observed serum half-life of the molecule is between about 20 and 30 days, substantially longer than most Fc fusion proteins, and thus a sustained effective serum level may be achieved, for example, by dosing with 0.2- 0.4 mg/kg on a weekly or biweekly basis, or higher doses may be used with longer intervals between dosings.
- doses of 1-3 mg/kg might be used on a monthly or bimonthly basis, and the effect on bone may be sufficiently durable that dosing is necessary only once every 3, 4, 5, 6, 9, 12 or more months.
- the present invention also provides gene therapy for the in vivo production of ActRIIa polypeptides.
- Such therapy would achieve its therapeutic effect by introduction of the ActRIIa polynucleotide sequences into cells or tissues having the disorders as listed above. Delivery of ActRIIa polynucleotide sequences can be achieved using a recombinant expression vector such as a chimeric
- RNA virus such as a retrovirus
- retroviral vector is a derivative of a murine or avian retrovirus.
- retroviral vectors in which a single foreign gene can be inserted include, but are not limited to: Moloney murine leukemia virus (MoMuLV), Harvey murine sarcoma virus (HaMuSV), murine mammary tumor virus (MuMTV), and Rous Sarcoma Virus (RSV).
- MoMuLV Moloney murine leukemia virus
- HaMuSV Harvey murine sarcoma virus
- MuMTV murine mammary tumor virus
- RSV Rous Sarcoma Virus
- Retroviral vectors can transfer or incorporate a gene for a selectable marker so that transduced cells can be identified and generated.
- Retroviral vectors can be made target-specific by attaching, for example, a sugar, a glycolipid, or a protein. Preferred targeting is accomplished by using an antibody.
- specific polynucleotide sequences can be inserted into the retroviral genome or attached to a viral envelope to allow target specific delivery of the retroviral vector containing the ActRIIa polynucleotide.
- the vector is targeted to bone or cartilage.
- tissue culture cells can be directly transfected with plasmids encoding the retroviral structural genes gag, pol and env, by conventional calcium phosphate transfection. These cells are then transfected with the vector plasmid containing the genes of interest. The resulting cells release the retroviral vector into the culture medium.
- colloidal dispersion systems include macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
- the preferred colloidal system of this invention is a liposome.
- Liposomes are artificial membrane vesicles which are useful as delivery vehicles in vitro and in vivo. RNA, DNA and intact virions can be encapsulated within the aqueous interior and be delivered to cells in a biologically active form (see e.g., Fraley, et al., Trends Biochem. Sci., 6:77, 1981). Methods for efficient gene transfer using a liposome vehicle, are known in the art,
- the composition of the liposome is usually a combination of phospholipids, usually in combination with steroids, especially cholesterol. Other phospholipids or other lipids may also be used.
- the physical characteristics of liposomes depend on pH, ionic strength, and the presence of divalent cations.
- lipids useful in liposome production include phosphatidyl compounds, such as phosphatidylglycerol, phosphatidylcholine, phosphatidylserine, phosphatidylethanolamine, sphingolipids, cerebrosides, and gangliosides.
- Illustrative phospholipids include egg phosphatidylcholine, dipalmitoylphosphatidylcholine, and distearoylphosphatidylcholine.
- the targeting of liposomes is also possible based on, for example, organ-specificity, cell- specificity, and organelle-specificity and is known in the art.
- Example 1 ActRIIa-Fc Fusion Proteins Applicants constructed a soluble ActRIIa fusion protein that has the extracellular domain of human ActRIIa fused to a human or mouse Fc domain with a minimal linker in between. The constructs are referred to as ActRIIa-hFc and ActRIIa-mFc, respectively.
- ActRIIa-hFc is shown below as purified from CHO cell lines (SEQ ID NO: 7):
- Tissue Plasminogen Activator TPA: MDAMKRGLCCVLLLCGAVFVSP (SEQ ID NO: 9)
- the ActRIIa-hFc protein was purified to a purity of >98% as determined by size exclusion chromatography and >95% as determined by SDS PAGE. ActRIIa-hFc and ActRIIa-mFc showed a high affinity for ligands, particularly activin A. GDF-11 or Activin A ("ActA") were immobilized on a Biacore CM5 chip using standard amine coupling procedure. ActRIIa-hFc and ActRIIa-mFc proteins were loaded onto the system, and binding was measured.
- Day 2 A-204 cells transfected with 10 ⁇ g pGL3(CAGA)12 or pGL3(CAGA)12 (10 ⁇ g)+ pRLCMV (1 ⁇ g) and Fugene.
- Day 3 Add factors (diluted into medium+ 0.1 % BSA). Inhibitors need to be preincubated with Factors for 1 hr before adding to cells. 6 hrs later, cells rinsed with PBS, and lyse cells.
- Activin A shows roughly 10 fold stimulation of reporter gene expression and an ED50 ⁇ 2 ng/ml.
- GDF-11 16 fold stimulation, ED50: ⁇ 1.5 ng/ml.
- GDF-8 shows an effect similar to GDF-11.
- ActRIIa-hFc and ActRIIa-mFc inhibit GDF-8 mediated signaling at picomolar concentrations.
- three different preparations of ActRIIa-hFc inhibited GDF-11 signaling with an IC 50 of approximately 200 pM.
- the ActRIIa-hFc was very stable in pharmacokinetic studies. Rats were dosed with 1 mg/kg, 3 mg/kg or 10 mg/kg of ActRIIa-hFc protein and plasma levels of the protein were measured at 24, 48, 72, 144 and 168 hours. In a separate study, rats were dosed at 1 mg/kg, 10 mg/kg or 30 mg/kg.
- ActRIIa-hFc had an 11- 14 day serum half life and circulating levels of the drug were quite high after two weeks (11 ⁇ g/ml, 110 ⁇ g/ml or 304 ⁇ g/ml for initial administrations of 1 mg/kg, 10 mg/kg or 30 mg/kg, respectively.)
- the plasma half life was substantially greater than 14 days and circulating levels of the drug were 25 ⁇ g/ml, 304 ⁇ g/ml or 1440 ⁇ g/ml for initial administrations of 1 mg/kg, 10 mg/kg or 30 mg/kg, respectively.
- Preliminary results in humans suggests that the serum half life is between about 20 and 30 days.
- mice Normal female mice (BALB/c) were dosed with ActRIIa-mFc at a level of 1 mg/kg/dose, 3 mg/kg/dose or 10 mg/kg/dose, with doses given twice weekly. Bone mineral density and bone mineral content were determined by DEXA, see figure 6.
- antagonism of ActRIIa caused increased bone density and content in normal female mice.
- ActRIIa-mFc effect of ActRIIa-mFc on bone in a mouse model for osteoporosis was tested.
- ActRIIa-mFc also caused a substantial increase in trabecular bone. See figure 11. After 6 and 12 weeks, the treatment produced a 35% increase relative to controls.
- OVX mice ovariectomized (OVX) or sham operated mice as described above were treated with ActRIIa-mFc (10 mg/kg, twice weekly) or control (PBS) over twelve weeks. Similar to the results described above for ActRIIa-mFc, OVX mice receiving ActRIIa-mFc exhibited an increase in trabecular bone density of 15% by as early as four weeks and 25% after 12 weeks of treatment (Figure 12). Sham operated mice receiving ActRIIa-mFc similarly showed an increase in trabecular bone density of 22% by as early as four weeks and of 32% after 12 weeks of treatment (Figure 13).
- Ex vivo pQCT analysis of the femoral midshaft demonstrated a significant increase in both total and cortical bone content after twelve weeks of treatment with ActRIIa-mFc while both ovariectomized and sham operated vehicle control-treated mice exhibited comparable bone content (Figure 16).
- Ex vivo pQCT analysis of the femoral midshaft also showed that ActRIIa-mFc treated mice did not show a change in periosteal circumference; however ActRIIa-mFc treatment resulted in a decrease in endosteal circumference indicating an increase in cortical thickness due to growth on the inner surface of the femur ( Figure 17).
- mice were ovariectomized or sham operated at 4 weeks, and beginning at 12 weeks received either placebo or ActRIIa-mFc (2 times/week, 10mg/kg) (also referred to as RAP-I l in Figures 19-24), for a further period of 12 weeks.
- ActRIIa-mFc increased vertebral trabecular bone volume to total volume ratios (BV/TV) in both the OVX and SHAM operated mice.
- ActRIIa-mFc also improved the trabecular architecture ( Figure 20), increased cortical thickness (Figure 21) and improved bone strength (Figure 22).
- ActRIIa-mFc produced desirable effects at a range of doses from lmg/kg to 10 mg/kg.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Physical Education & Sports Medicine (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Immunology (AREA)
- Toxicology (AREA)
- Cell Biology (AREA)
- Epidemiology (AREA)
- Rheumatology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Endocrinology (AREA)
- Oncology (AREA)
- Analytical Chemistry (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Medicinal Preparation (AREA)
Abstract
Description
Claims
Priority Applications (35)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020137027593A KR101557375B1 (en) | 2005-11-23 | 2006-11-22 | Activin-actrπa antagonists and uses for promoting bone growth |
RS20080336A RS58231B1 (en) | 2005-11-23 | 2006-11-22 | Activin-actriia antagonists and uses for promoting bone growth |
MEP-2008-592A ME00380B (en) | 2005-11-23 | 2006-11-22 | Activin-actriia antagonists and uses for promoting bone growth |
EP06838343A EP1973559B1 (en) | 2005-11-23 | 2006-11-22 | Activin-actriia antagonists and uses for promoting bone growth |
SI200631558T SI1973559T1 (en) | 2005-11-23 | 2006-11-22 | Activin-actriia antagonists and uses for promoting bone growth |
PL06838343T PL1973559T3 (en) | 2005-11-23 | 2006-11-22 | Activin-actriia antagonists and uses for promoting bone growth |
EP17175570.5A EP3269381B1 (en) | 2005-11-23 | 2006-11-22 | Activin-actriia antagonists in use for promoting bone growth |
CA2631013A CA2631013C (en) | 2005-11-23 | 2006-11-22 | Activin-actriia antagonists and uses for promoting bone growth |
DK06838343.9T DK1973559T3 (en) | 2005-11-23 | 2006-11-22 | Activin-ActRIIa antagonists as well as applications for bone growth |
KR1020207010015A KR20200041386A (en) | 2005-11-23 | 2006-11-22 | Activin-actrπa antagonists and uses for promoting bone growth |
KR1020157026709A KR20150115961A (en) | 2005-11-23 | 2006-11-22 | Activin-actrπa antagonists and uses for promoting bone growth |
CN200680051538.9A CN101370511B (en) | 2005-11-23 | 2006-11-22 | Activin-ActRlla antagonists and uses for promoting bone growth |
MX2008006626A MX2008006626A (en) | 2005-11-23 | 2006-11-22 | Activin-actriia antagonists and uses for promoting bone growth. |
AU2006318449A AU2006318449B2 (en) | 2005-11-23 | 2006-11-22 | Activin-actRIIa antagonists and uses for promoting bone growth |
JP2008542460A JP5261187B2 (en) | 2005-11-23 | 2006-11-22 | Activin-ActRIIa antagonist and use for promoting bone growth |
KR1020197000694A KR20190006086A (en) | 2005-11-23 | 2006-11-22 | Activin-actrπa antagonists and uses for promoting bone growth |
BRPI0618947-4A BRPI0618947B1 (en) | 2005-11-23 | 2006-11-22 | ACTRIIA POLYPEPTIDE THAT BINDS ACTIVIN, POLYNUCLEOTIDE ISOLATED, POLYNUCLEOTIDE, RECOMBINANT, METHOD FOR PREPARING AN ACTRIIA POLYPEPTIDE THAT BINDS ACTIVIN, PHARMACEUTICAL PREPARATION AND USE OF AN ACTRIIA-FC FUSION PROTEIN TO PROMOTE BONE GROWTH AND INHIBITS BONE RESORPTION |
IN2553DEN2015 IN2015DN02553A (en) | 2005-11-23 | 2006-11-22 | |
UAA200807174A UA98447C2 (en) | 2005-11-23 | 2006-11-22 | ACTIVIN-ActRIIa ANTAGONISTS AND USES FOR PROMOTING BONE GROWTH |
KR1020197023598A KR20190097310A (en) | 2005-11-23 | 2006-11-22 | Activin-actrπa antagonists and uses for promoting bone growth |
KR1020187007304A KR20180030264A (en) | 2005-11-23 | 2006-11-22 | Activin-actrπa antagonists and uses for promoting bone growth |
EA200801406A EA015105B1 (en) | 2005-11-23 | 2006-11-22 | Activin-actriia antagonists and uses for promoting bone growth |
ES06838343T ES2401805T3 (en) | 2005-11-23 | 2006-11-22 | Activin-ActRlla antagonists and uses to promote bone growth |
KR1020167032479A KR20160137665A (en) | 2005-11-23 | 2006-11-22 | Activin-actrπa antagonists and uses for promoting bone growth |
EP20195163.9A EP3811965A1 (en) | 2005-11-23 | 2006-11-22 | Activin-actriia antagonists in use for promoting bone growth |
UAA201115190A UA115859C2 (en) | 2005-11-23 | 2006-11-22 | THE SOLUTION ACTIVIN A BINDING POLYPEPTIDE AND THE COMPOSITION CONTAINING IT |
NZ568369A NZ568369A (en) | 2005-11-23 | 2006-11-22 | Activin-actriia antagonists and uses for promoting bone growth |
IL191596A IL191596A (en) | 2005-11-23 | 2008-05-21 | Activin-actriia antagonists and uses for promoting bone growth |
EC2008008463A ECSP088463A (en) | 2005-11-23 | 2008-05-22 | ACTIVINA-ACTRIIA ANTAGONISTS AND USES TO PROMOTE BONE GROWTH |
HRP20080377AA HRP20080377B1 (en) | 2005-11-23 | 2008-07-30 | ACTIVIN ActRIIa ANTAGONISTS AND USES FOR PROMOTING BONE GROWTH |
HK09102689.3A HK1123215A1 (en) | 2005-11-23 | 2009-03-20 | Activin-actriia antagonists and uses for promoting bone growth activin-actriia |
IL230645A IL230645A (en) | 2005-11-23 | 2014-01-26 | Anti-activin a or b antibodies and uses thereof for promoting bone growth |
IL23064614A IL230646B (en) | 2005-11-23 | 2014-01-26 | Activin-actrlla antagonists and uses for promoting bone growth |
IL259893A IL259893B (en) | 2005-11-23 | 2018-06-07 | Activin-actriia antagonists and uses for promoting bone growth |
IL280877A IL280877A (en) | 2005-11-23 | 2021-02-15 | Activin-actriia antagonists and uses for promoting bone growth |
Applications Claiming Priority (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US73946205P | 2005-11-23 | 2005-11-23 | |
US60/739,462 | 2005-11-23 | ||
US78332206P | 2006-03-17 | 2006-03-17 | |
US60/783,322 | 2006-03-17 | ||
US84485506P | 2006-09-15 | 2006-09-15 | |
US60/844,855 | 2006-09-15 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2007062188A2 true WO2007062188A2 (en) | 2007-05-31 |
WO2007062188A3 WO2007062188A3 (en) | 2007-09-13 |
Family
ID=38067939
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2006/045322 WO2007062188A2 (en) | 2005-11-23 | 2006-11-22 | Activin-actriia antagonists and uses for promoting bone growth |
Country Status (25)
Country | Link |
---|---|
US (8) | US7612041B2 (en) |
EP (5) | EP1973559B1 (en) |
JP (9) | JP5261187B2 (en) |
KR (8) | KR101585623B1 (en) |
CN (4) | CN105001320A (en) |
AU (1) | AU2006318449B2 (en) |
BR (1) | BRPI0618947B1 (en) |
CA (2) | CA2631013C (en) |
CR (1) | CR10008A (en) |
DK (1) | DK1973559T3 (en) |
EA (4) | EA018450B1 (en) |
EC (1) | ECSP088463A (en) |
ES (3) | ES2649983T3 (en) |
HK (3) | HK1123215A1 (en) |
HR (1) | HRP20080377B1 (en) |
IL (5) | IL191596A (en) |
IN (1) | IN2015DN02553A (en) |
ME (1) | ME00380B (en) |
MX (1) | MX2008006626A (en) |
NZ (1) | NZ568369A (en) |
PL (1) | PL1973559T3 (en) |
PT (1) | PT1973559E (en) |
RS (1) | RS58231B1 (en) |
SG (1) | SG10201509620SA (en) |
WO (1) | WO2007062188A2 (en) |
Cited By (43)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2008076437A3 (en) * | 2006-12-18 | 2008-09-18 | Acceleron Pharma Inc | Activin-actrii antagonists and uses for increasing red blood cell levels |
WO2008094708A3 (en) * | 2007-02-01 | 2008-11-06 | Acceleron Pharma Inc | Activin-actriia antagonists and uses for treating or preventing breast cancer |
WO2008100384A3 (en) * | 2007-02-09 | 2008-12-11 | Acceleron Pharma Inc | Activin-actriia antagonists and uses for promoting bone growth in cancer patients |
US7612041B2 (en) | 2005-11-23 | 2009-11-03 | Acceleron Pharma Inc. | Isolated activin-binding ActRIIa polypeptide comprising the SEQ ID NO: 7 and uses for promoting bone growth |
WO2009137075A1 (en) * | 2008-05-06 | 2009-11-12 | Acceleron Pharma Inc. | Anti-activin antibodies and uses for promoting bone growth |
WO2009158033A2 (en) | 2008-06-26 | 2009-12-30 | Acceleron Pharma Inc. | Antagonists of activin-actriia and uses for increasing red blood cell levels |
WO2009158035A2 (en) | 2008-06-26 | 2009-12-30 | Acceleron Pharma Inc. | Methods for dosing an activin-actriia antagonist and monitoring of treated patients |
WO2010114860A1 (en) * | 2009-03-30 | 2010-10-07 | Acceleron Pharma Inc. | Bmp-alk3 antagonists and uses for promoting bone growth |
US7842663B2 (en) | 2007-02-02 | 2010-11-30 | Acceleron Pharma Inc. | Variants derived from ActRIIB and uses therefor |
JP2010539236A (en) * | 2007-09-18 | 2010-12-16 | アクセルロン ファーマ, インコーポレイテッド | Activin-ActRIIa Antagonist and Use for Reducing or Inhibiting FSH Secretion |
JP2011520961A (en) * | 2008-05-22 | 2011-07-21 | ブリストル−マイヤーズ スクイブ カンパニー | Scaffold domain protein based on multivalent fibronectin |
US8128933B2 (en) | 2005-11-23 | 2012-03-06 | Acceleron Pharma, Inc. | Method of promoting bone growth by an anti-activin B antibody |
US8138142B2 (en) | 2009-01-13 | 2012-03-20 | Acceleron Pharma Inc. | Methods for increasing adiponectin in a patient in need thereof |
JP2012509900A (en) * | 2008-11-24 | 2012-04-26 | ブリストル−マイヤーズ スクイブ カンパニー | Bispecific EGFR / IGFIR binding molecule |
US8178488B2 (en) | 2009-06-08 | 2012-05-15 | Acceleron Pharma, Inc. | Methods for increasing thermogenic adipocytes |
US8216997B2 (en) | 2008-08-14 | 2012-07-10 | Acceleron Pharma, Inc. | Methods for increasing red blood cell levels and treating anemia using a combination of GDF traps and erythropoietin receptor activators |
US8361957B2 (en) | 2008-08-14 | 2013-01-29 | Acceleron Pharma, Inc. | Isolated GDF trap polypeptide |
EP2578684A1 (en) * | 2007-03-19 | 2013-04-10 | National Research Council Of Canada | Antagonists of ligands and uses thereof |
US8710016B2 (en) | 2009-11-17 | 2014-04-29 | Acceleron Pharma, Inc. | ActRIIB proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy |
US8969289B2 (en) | 2010-05-03 | 2015-03-03 | Bristol-Myers Squibb Company | Serum albumin binding molecules |
US9234028B2 (en) | 2008-02-14 | 2016-01-12 | Bristol-Myers Squibb Company | Targeted therapeutics based on engineered proteins that bind EGFR |
AU2013204959B2 (en) * | 2007-02-09 | 2016-05-19 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for promoting bone growth in cancer patients |
AU2013221910B2 (en) * | 2006-12-18 | 2016-11-17 | Acceleron Pharma Inc. | Activin-ActRII antagonists and uses for increasing red blood cell levels |
US9562089B2 (en) | 2010-05-26 | 2017-02-07 | Bristol-Myers Squibb Company | Fibronectin based scaffold proteins having improved stability |
US9745559B2 (en) | 2009-06-12 | 2017-08-29 | Acceleron Pharma Inc. | Method for decreasing the body fat content in a subject by administering an ActRIIB protein |
US9850298B2 (en) | 2014-06-13 | 2017-12-26 | Acceleron Pharma Inc. | Methods for treating ulcers in thalassemia syndrome with an ActRIIB polypeptide |
WO2018013936A1 (en) | 2016-07-15 | 2018-01-18 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
AU2016202691B2 (en) * | 2007-02-09 | 2018-03-15 | Acceleron Pharma Inc. | Activin-ActRIIa antagonists and uses for promoting bone growth in cancer patients |
EP3351260A1 (en) | 2012-04-06 | 2018-07-25 | Acceleron Pharma Inc. | Methods and compositions for increasing red blood cells |
US10093707B2 (en) | 2006-12-18 | 2018-10-09 | Acceleron Pharma Inc. | Antagonists of activin-ActRIIa and uses for increasing red blood cell levels |
AU2016250354B2 (en) * | 2006-12-18 | 2019-01-17 | Acceleron Pharma Inc. | Activin-ActRII antagonists and uses for increasing red blood cell levels |
US10195249B2 (en) | 2012-11-02 | 2019-02-05 | Celgene Corporation | Activin-ActRII antagonists and uses for treating bone and other disorders |
US10221232B2 (en) | 2006-11-22 | 2019-03-05 | Bristol-Myers Squibb Company | Methods of treating cancer by administering IGF-IR binding molecules |
EP2726092B1 (en) * | 2011-06-28 | 2019-06-19 | Inhibrx, LP | Serpin fusion polypeptides and methods of use thereof |
US10400029B2 (en) | 2011-06-28 | 2019-09-03 | Inhibrx, Lp | Serpin fusion polypeptides and methods of use thereof |
US10442851B2 (en) | 2014-03-20 | 2019-10-15 | Bristol-Myers Squibb Company | Serum albumin-binding fibronectin type III domains |
US10548976B2 (en) | 2015-05-20 | 2020-02-04 | Celgene Corporation | In vitro cell culture methods for beta-thalassemia using activin type II receptor ligand traps |
AU2018200463B2 (en) * | 2009-09-09 | 2020-07-09 | Acceleron Pharma Inc. | ActRIIb antagonists and dosing and uses thereof |
US10766946B2 (en) | 2015-09-23 | 2020-09-08 | Bristol-Myers Squibb Company | Fast-off rate serum albumin binding fibronectin type III domains |
EP4026556A1 (en) | 2016-10-05 | 2022-07-13 | Acceleron Pharma Inc. | Compositions and method for treating kidney disease |
US11471510B2 (en) | 2014-12-03 | 2022-10-18 | Celgene Corporation | Activin-ActRII antagonists and uses for treating anemia |
US11813308B2 (en) | 2014-10-09 | 2023-11-14 | Celgene Corporation | Treatment of cardiovascular disease using ActRII ligand traps |
US11834508B2 (en) | 2017-03-24 | 2023-12-05 | Novartis Ag | Method of treating structural and/or functional cardiac abnormalities by administering an anti-ActRII receptor antibody |
Families Citing this family (24)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP2314617B1 (en) | 2004-07-23 | 2015-06-24 | Acceleron Pharma Inc. | ActRII receptor polypeptides |
US20100028332A1 (en) * | 2006-12-18 | 2010-02-04 | Acceleron Pharma Inc. | Antagonists of actriib and uses for increasing red blood cell levels |
RU2519645C2 (en) | 2008-05-14 | 2014-06-20 | Эгрикалчер Виктория Сервисиз Пти Лтд | Application of angiogenin or angiogenin agonists for treating diseases and disorders |
CA2779472C (en) * | 2009-11-03 | 2021-03-16 | Acceleron Pharma Inc. | The use of a composition comprising an activin type iib receptor polypeptide in the treatment of fatty liver disease |
WO2012027065A2 (en) * | 2010-08-27 | 2012-03-01 | Celgene Corporation | Combination therapy for treatment of disease |
CA2817008A1 (en) | 2010-11-08 | 2012-05-18 | Acceleron Pharma Inc. | Actriia binding agents and uses thereof |
AU2013204740C1 (en) | 2012-05-10 | 2015-10-01 | Agriculture Victoria Services Pty Ltd | Methods of treating cancer using angiogenin or an angiogenin agonist |
US20140120149A1 (en) * | 2012-10-30 | 2014-05-01 | The Royal Institution For The Advancement Of Learning/Mcgill University | Calcium sulphate based composite |
MX2016013635A (en) | 2014-04-18 | 2017-02-02 | Acceleron Pharma Inc | Methods for increasing red blood cell levels and treating sickle-cell disease. |
MA41119A (en) | 2014-12-03 | 2017-10-10 | Acceleron Pharma Inc | METHODS OF TREATMENT OF MYELODYSPLASIC SYNDROMES AND SIDEROBLASTIC ANEMIA |
SI3280727T1 (en) | 2015-04-06 | 2021-07-30 | Acceleron Pharma Inc. | Single-arm type i and type ii receptor fusion proteins and uses thereof |
MA41919A (en) | 2015-04-06 | 2018-02-13 | Acceleron Pharma Inc | ALK4 HETEROMULTIMERS: ACTRIIB AND THEIR USES |
KR20180002659A (en) | 2015-04-06 | 2018-01-08 | 악셀레론 파마 인코포레이티드 | TGF-beta superfamily type I and type II receptor variant polymorphs and uses thereof |
AU2016359695A1 (en) | 2015-11-23 | 2018-06-14 | Acceleron Pharma Inc. | Methods for treating eye disorders |
US20170306027A1 (en) | 2016-04-06 | 2017-10-26 | Acceleron Pharma Inc. | Alk7 antagonists and uses thereof |
FI3490582T3 (en) | 2016-07-27 | 2024-08-01 | Acceleron Pharma Inc | Compositions for use in treating myelofibrosis |
AU2017338921A1 (en) | 2016-10-05 | 2019-04-18 | Acceleron Pharma Inc. | ALK4:ActRIIB heteromultimers and uses thereof |
US11013785B2 (en) | 2016-11-10 | 2021-05-25 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
EP3706777B1 (en) | 2017-11-09 | 2024-05-22 | Keros Therapeutics, Inc. | Activin receptor type iia variants and methods of use thereof |
CA3087008A1 (en) | 2018-01-12 | 2019-07-18 | Keros Therapeutics, Inc. | Activin receptor type iib variants and methods of use thereof |
CN109320597B (en) * | 2018-10-26 | 2021-10-26 | 中国农业科学院特产研究所 | Fox subfamily activin A protein and preparation and application thereof |
CN114594170B (en) * | 2020-12-03 | 2024-05-17 | 复旦大学 | In-vivo drug analysis method combining magnetic solid phase extraction with rapid in-situ derivatization |
WO2022261437A2 (en) * | 2021-06-11 | 2022-12-15 | Acceleron Pharma Inc. | Actrii proteins and uses thereof |
US11945856B2 (en) | 2022-01-28 | 2024-04-02 | 35Pharma Inc. | Activin receptor type IIB variants and uses thereof |
Family Cites Families (217)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JPH0637520B2 (en) | 1985-07-03 | 1994-05-18 | 味の素株式会社 | Polypeptide |
JPS63502716A (en) | 1986-03-07 | 1988-10-13 | マサチューセッツ・インステチュート・オブ・テクノロジー | How to enhance glycoprotein stability |
US4973577A (en) | 1986-04-04 | 1990-11-27 | The Salk Institute For Biological Studies | FSH-releasing peptides |
US5080891A (en) | 1987-08-03 | 1992-01-14 | Ddi Pharmaceuticals, Inc. | Conjugates of superoxide dismutase coupled to high molecular weight polyalkylene glycols |
US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
US5198346A (en) | 1989-01-06 | 1993-03-30 | Protein Engineering Corp. | Generation and selection of novel DNA-binding proteins and polypeptides |
US5096815A (en) | 1989-01-06 | 1992-03-17 | Protein Engineering Corporation | Generation and selection of novel dna-binding proteins and polypeptides |
EP0548276A4 (en) | 1990-09-13 | 1993-12-29 | Children's Hospital Medical Center Of Northern California | Method for increasing red blood cell production by treatment with activin or activin-related peptides |
US5118667A (en) | 1991-05-03 | 1992-06-02 | Celtrix Pharmaceuticals, Inc. | Bone growth factors and inhibitors of bone resorption for promoting bone formation |
US5885794A (en) | 1991-05-10 | 1999-03-23 | The Salk Institute For Biological Studies | Recombinant production of vertebrate activin receptor polypeptides and identification of receptor DNAs in the activin/TGF-β superfamily |
EP0542971A1 (en) | 1991-05-10 | 1993-05-26 | The Salk Institute For Biological Studies | CLONING AND RECOMBINANT PRODUCTION OF RECEPTOR(S) OF THE ACTIVIN/TGF-$g(b) SUPERFAMILY |
US20050186593A1 (en) | 1991-05-10 | 2005-08-25 | The Salk Institute For Biological Studies | Cloning and recombinant production of CRF receptor(s) |
US6162896A (en) | 1991-05-10 | 2000-12-19 | The Salk Institute For Biological Studies | Recombinant vertebrate activin receptors |
US6287816B1 (en) | 1991-06-25 | 2001-09-11 | Genetics Institute, Inc. | BMP-9 compositions |
WO1993000432A1 (en) | 1991-06-25 | 1993-01-07 | Genetics Institute, Inc. | Bmp-9 compositions |
AU3968793A (en) * | 1992-04-02 | 1993-11-08 | United States Of America, As Represented By The Secretary Of Health And Human Services | Use of restriction endonucleases against viruses, including HIV |
US6692925B1 (en) | 1992-11-17 | 2004-02-17 | Ludwig Institute For Cancer Research | Proteins having serine/threonine kinase domains, corresponding nucleic acid molecules, and their use |
CA2153652A1 (en) | 1993-01-12 | 1994-07-21 | Se-Jin Lee | Growth differentiation factor-3 |
US5637480A (en) | 1993-05-12 | 1997-06-10 | Genetics Institute, Inc. | DNA molecules encoding bone morphogenetic protein-10 |
DE69433742T2 (en) | 1993-05-12 | 2005-07-07 | Genetics Institute, LLC, Cambridge | BMP-10 COMPOSITIONS |
US5677196A (en) | 1993-05-18 | 1997-10-14 | University Of Utah Research Foundation | Apparatus and methods for multi-analyte homogeneous fluoro-immunoassays |
US5831050A (en) * | 1993-06-07 | 1998-11-03 | Creative Biomolecules, Inc. | Morphogen cell surface receptor |
WO1995010611A1 (en) | 1993-10-14 | 1995-04-20 | President And Fellows Of Harvard College | Method of inducing and maintaining neuronal cells |
US5525490A (en) | 1994-03-29 | 1996-06-11 | Onyx Pharmaceuticals, Inc. | Reverse two-hybrid method |
US5658876A (en) | 1994-04-28 | 1997-08-19 | The General Hospital Corporation | Activin antagonists as novel contraceptives |
JPH10511840A (en) * | 1994-04-29 | 1998-11-17 | クリエイティブ バイオモレキュールズ,インコーポレイテッド | Morphogenetic protein-specific cell surface receptors and uses thereof |
IL114397A0 (en) * | 1994-07-01 | 1995-10-31 | Bioph Biotech Entw Pharm Gmbh | Growth/differentiation factor of the TGF-beta-family |
US5760010A (en) | 1995-01-01 | 1998-06-02 | Klein; Ira | Method of treating liver disorders with a macrolide antibiotic |
IL117175A (en) * | 1995-02-20 | 2005-11-20 | Sankyo Co | Osteoclastogenesis inhibitory factor protein |
US5814565A (en) | 1995-02-23 | 1998-09-29 | University Of Utah Research Foundation | Integrated optic waveguide immunosensor |
ATE352638T1 (en) | 1995-04-11 | 2007-02-15 | Gen Hospital Corp | REVERSE TWO-HYBRID SYSTEMS |
EP0771873A3 (en) * | 1995-10-27 | 1998-03-04 | Takeda Chemical Industries, Ltd. | Neuronal cell-specific receptor protein |
GB9526131D0 (en) | 1995-12-21 | 1996-02-21 | Celltech Therapeutics Ltd | Recombinant chimeric receptors |
US6004780A (en) | 1996-03-26 | 1999-12-21 | Human Genome Sciences, Inc. | Growth factor HTTER36 |
US20050244867A1 (en) | 1996-03-26 | 2005-11-03 | Human Genome Sciences, Inc. | Growth factor HTTER36 |
BR9712675A (en) | 1996-10-25 | 1999-10-19 | Searle & Co | Circularly exchanged erythropoietin receptor agonists. |
US6605699B1 (en) * | 1997-01-21 | 2003-08-12 | Human Genome Sciences, Inc. | Galectin-11 polypeptides |
US6034062A (en) | 1997-03-13 | 2000-03-07 | Genetics Institute, Inc. | Bone morphogenetic protein (BMP)-9 compositions and their uses |
US6231880B1 (en) | 1997-05-30 | 2001-05-15 | Susan P. Perrine | Compositions and administration of compositions for the treatment of blood disorders |
US6300127B1 (en) | 1997-07-30 | 2001-10-09 | Emory University | Bone mineralization proteins, DNA, vectors, expression systems |
US6891082B2 (en) | 1997-08-01 | 2005-05-10 | The Johns Hopkins University School Of Medicine | Transgenic non-human animals expressing a truncated activintype II receptor |
US6656475B1 (en) | 1997-08-01 | 2003-12-02 | The Johns Hopkins University School Of Medicine | Growth differentiation factor receptors, agonists and antagonists thereof, and methods of using same |
US6696260B1 (en) | 1997-08-01 | 2004-02-24 | The Johns Hopkins University School Of Medicine | Methods to identify growth differentiation factor (GDF) binding proteins |
WO1999006559A1 (en) | 1997-08-01 | 1999-02-11 | The Johns Hopkins University School Of Medicine | Methods to identify growth differentiation factor (gdf) receptors |
EP1015468A4 (en) | 1997-08-29 | 2000-09-06 | Human Genome Sciences Inc | Follistatin-3 |
US6953662B2 (en) | 1997-08-29 | 2005-10-11 | Human Genome Sciences, Inc. | Follistatin-3 |
CN1277632A (en) | 1997-10-03 | 2000-12-20 | 中外制药株式会社 | Natural human antibody |
US6696411B1 (en) | 1998-04-22 | 2004-02-24 | Cornell Research Foundation, Inc. | Canine erythropoietin gene and recombinant protein |
CA2330939A1 (en) | 1998-06-16 | 1999-12-23 | Biogen, Inc. | Variant type ii tgf-beta receptor fusion proteins and methods |
EP1113799A4 (en) * | 1998-09-17 | 2004-06-09 | Lilly Co Eli | Protein formulations |
WO2000017350A1 (en) | 1998-09-22 | 2000-03-30 | Long Yu | New human growth differentiation factor encoding sequence and polypeptide encoded by such dna sequence and producing method thereof |
US6472179B2 (en) * | 1998-09-25 | 2002-10-29 | Regeneron Pharmaceuticals, Inc. | Receptor based antagonists and methods of making and using |
US6548634B1 (en) | 1998-09-30 | 2003-04-15 | Chiron Corporation | Synthetic peptides having FGF receptor affinity |
US6238860B1 (en) | 1998-11-05 | 2001-05-29 | Dyax Corp. | Binding moieties for human parvovirus B19 |
US6777205B1 (en) | 1998-11-06 | 2004-08-17 | Sterrenbeld Biotechnologie North America, Inc. | Host cells expressing recombinant human erythropoietin |
JP4813660B2 (en) * | 1998-11-27 | 2011-11-09 | ダーウィン ディスカバリー リミテッド | Compositions and methods for increasing bone mineralization |
US20040009535A1 (en) * | 1998-11-27 | 2004-01-15 | Celltech R&D, Inc. | Compositions and methods for increasing bone mineralization |
NZ513642A (en) | 1999-01-21 | 2004-02-27 | Metamorphix Inc | Growth differentiation factor inhibitors and uses therefor |
US6914128B1 (en) | 1999-03-25 | 2005-07-05 | Abbott Gmbh & Co. Kg | Human antibodies that bind human IL-12 and methods for producing |
WO2000062809A1 (en) | 1999-04-19 | 2000-10-26 | Kyowa Hakko Kogyo Co., Ltd. | Proliferation inhibitor for androgen-independent tumor |
US6468543B1 (en) | 1999-05-03 | 2002-10-22 | Zymogenetics, Inc. | Methods for promoting growth of bone using ZVEGF4 |
EP1231943A1 (en) | 1999-11-12 | 2002-08-21 | Maxygen Holdings Ltd | Interferon gamma conjugates |
AU777166B2 (en) | 1999-12-15 | 2004-10-07 | Research Development Foundation | Betaglycan as an inhibin receptor and uses thereof |
US20030224501A1 (en) | 2000-03-17 | 2003-12-04 | Young Paul E. | Bone morphogenic protein polynucleotides, polypeptides, and antibodies |
JP4487376B2 (en) | 2000-03-31 | 2010-06-23 | 味の素株式会社 | Kidney disease treatment |
BRPI0110914B8 (en) | 2000-05-15 | 2021-05-25 | Hoffmann La Roche | 'liquid pharmaceutical composition, process for its preparation and use of a pharmaceutical composition' |
US6627424B1 (en) | 2000-05-26 | 2003-09-30 | Mj Bioworks, Inc. | Nucleic acid modifying enzymes |
AU2001269709A1 (en) | 2000-07-19 | 2002-02-05 | Eli Lilly And Company | Nucleic acids, vectors, host cells, polypeptides, and uses thereof |
US6632180B1 (en) | 2000-09-07 | 2003-10-14 | John H. Laragh | Method for evaluating and treating hypertension |
DE10045591A1 (en) | 2000-09-15 | 2002-04-04 | Klaus Pfizenmaier | Site-specific, antibody-mediated activation of proapoptotic cytokines - AMAIZe (Antibody-Mediated Apoptosis Inducing Cytokines) |
EP1356075A4 (en) | 2000-10-16 | 2005-04-13 | Compound Therapeutics Inc | Protein scaffolds for antibody mimics and other binding proteins |
US7087224B2 (en) | 2000-10-31 | 2006-08-08 | Amgen Inc. | Method of treating anemia by administering IL-1ra |
CN1474831A (en) | 2000-11-20 | 2004-02-11 | ����ŵ˹������ѧ�йܻ� | Membrane scaffold proteins |
AU2002236558A1 (en) | 2000-12-01 | 2002-06-11 | Regents Of The University Of California | Method and composition for modulating bone growth |
US20030082233A1 (en) | 2000-12-01 | 2003-05-01 | Lyons Karen M. | Method and composition for modulating bone growth |
US20030133939A1 (en) | 2001-01-17 | 2003-07-17 | Genecraft, Inc. | Binding domain-immunoglobulin fusion proteins |
US7754208B2 (en) | 2001-01-17 | 2010-07-13 | Trubion Pharmaceuticals, Inc. | Binding domain-immunoglobulin fusion proteins |
TW200526779A (en) | 2001-02-08 | 2005-08-16 | Wyeth Corp | Modified and stabilized GDF propeptides and uses thereof |
US20040132675A1 (en) | 2002-02-08 | 2004-07-08 | Calvin Kuo | Method for treating cancer and increasing hematocrit levels |
US20040132971A1 (en) * | 2001-02-09 | 2004-07-08 | Haaning Jesper Mortensen | Rank ligand-binding polypeptides |
US7294472B2 (en) * | 2001-03-14 | 2007-11-13 | Caden Biosciences | Method for identifying modulators of G protein coupled receptor signaling |
WO2002074340A1 (en) | 2001-03-16 | 2002-09-26 | Takeda Chemical Industries, Ltd. | Process for producing sustained release preparation |
JP4369662B2 (en) | 2001-04-26 | 2009-11-25 | アビディア インコーポレイテッド | Combinatorial library of monomer domains |
EA010594B1 (en) | 2001-05-24 | 2008-10-30 | Займодженетикс, Инк. | Taci-immunoglobulin fusion proteins |
EP1390497A2 (en) | 2001-05-25 | 2004-02-25 | Genset | Human cdnas and proteins and uses thereof |
AUPR638101A0 (en) * | 2001-07-13 | 2001-08-09 | Bioa Pty Limited | Composition and method for treatment of disease |
US7396642B2 (en) | 2001-07-17 | 2008-07-08 | Teijin Limited | Methods of screening for a compound that enhances thermogenesis |
US6855344B2 (en) | 2001-07-17 | 2005-02-15 | Integrated Chinese Medicine Holdings, Ltd. | Compositions and methods for prostate and kidney health and disorders, an herbal preparation |
KR100453877B1 (en) | 2001-07-26 | 2004-10-20 | 메덱스젠 주식회사 | METHOD OF MANUFACTURING Ig-FUSION PROTEINS BY CONCATAMERIZATION, TNFR/Fc FUSION PROTEINS MANUFACTURED BY THE METHOD, DNA CODING THE PROTEINS, VECTORS INCLUDING THE DNA, AND CELLS TRANSFORMED BY THE VECTOR |
US7320789B2 (en) | 2001-09-26 | 2008-01-22 | Wyeth | Antibody inhibitors of GDF-8 and uses thereof |
US6784154B2 (en) | 2001-11-01 | 2004-08-31 | University Of Utah Research Foundation | Method of use of erythropoietin to treat ischemic acute renal failure |
DK1463823T3 (en) | 2001-12-06 | 2013-06-03 | Fibrogen Inc | METHODS OF INCREASING ENDOGENT ERYTHROPOETIN (EPO) |
US20030144203A1 (en) | 2001-12-19 | 2003-07-31 | Voyager Pharmaceutical Corporation | Methods for slowing senescence and treating and preventing diseases associated with senescence |
US20060234918A1 (en) | 2001-12-19 | 2006-10-19 | Voyager Pharmaceutical Corporation | Methods for treating and preventing cancers that express the hypothalamic-pituitary-gonadal axis of hormones and receptors |
US6998118B2 (en) | 2001-12-21 | 2006-02-14 | The Salk Institute For Biological Studies | Targeted retrograde gene delivery for neuronal protection |
CA2472922A1 (en) | 2002-02-11 | 2003-08-21 | Genentech, Inc. | Antibody variants with faster antigen association rates |
WO2003072715A2 (en) | 2002-02-21 | 2003-09-04 | Wyeth | Gasp1: a follistatin domain containing protein |
US20030219846A1 (en) | 2002-02-28 | 2003-11-27 | Pfizer Inc. | Assay for activity of the ActRIIB kinase |
US8053552B2 (en) * | 2002-04-18 | 2011-11-08 | Mtm Laboratories, Ag | Neopeptides and methods useful for detection and treatment of cancer |
DE10234192B4 (en) | 2002-07-26 | 2009-11-26 | Epoplus Gmbh Co.Kg | Use of erythropoietin |
AU2003261246A1 (en) | 2002-08-16 | 2004-03-03 | Wyeth | Bmp-2 estrogen responsive element and methods of using the same |
US7261893B2 (en) | 2002-10-22 | 2007-08-28 | Wyeth | Neutralizing antibodies against GDF-8 and uses therefor |
US20040223966A1 (en) | 2002-10-25 | 2004-11-11 | Wolfman Neil M. | ActRIIB fusion polypeptides and uses therefor |
AU2002953327A0 (en) | 2002-12-12 | 2003-01-09 | Monash University | Methods of diagnosing prognosing and treating activin associated diseases and conditions |
WO2004069237A1 (en) | 2003-02-07 | 2004-08-19 | Prometic Biosciences Inc. | Medium-chain length fatty acids, glycerides and analogues as stimulators of erythropoiesis |
US20040197828A1 (en) | 2003-03-26 | 2004-10-07 | Gaddy Dana P. | Method for diagnosis and treatment of bone turnover |
WO2005028517A2 (en) | 2003-05-09 | 2005-03-31 | The General Hospital Corporation | SOLUBLE TGF-β TYPE III RECEPTOR FUSION PROTEINS |
CA2526669A1 (en) | 2003-06-02 | 2004-12-16 | Wyeth | Use of myostatin (gdf8) inhibitors in conjunction with corticosteroids for treating neuromuscular disorders |
MEP2808A (en) | 2003-06-16 | 2010-02-10 | Celltech R & D Inc | Antibodies specific for sclerostin and methods for increasing bone mineralization |
WO2005009460A2 (en) | 2003-07-25 | 2005-02-03 | Medexis, S.A. | Pharmaceutical composition comprising activin a, alk-4 or derivatives thereof for the treatment of ophthalmic disorders or cancer |
US8895540B2 (en) | 2003-11-26 | 2014-11-25 | DePuy Synthes Products, LLC | Local intraosseous administration of bone forming agents and anti-resorptive agents, and devices therefor |
ATE443724T1 (en) * | 2004-01-22 | 2009-10-15 | Merck Patent Gmbh | ANTI-CANCER ANTIBODIES WITH REDUCED COMPLEMENT FIXATION |
US20050197292A1 (en) * | 2004-01-30 | 2005-09-08 | Glennda Smithson | Compositions and methods for treating T-cell mediated pathological conditions |
JP2007530055A (en) | 2004-03-26 | 2007-11-01 | アクセルロン ファーマ インコーポレーテッド | BMP-3 propeptide and related methods |
JP2008500816A (en) * | 2004-03-31 | 2008-01-17 | ゼンコー・インコーポレイテッド | BMP-7 variants with improved properties |
US7741284B2 (en) | 2004-05-12 | 2010-06-22 | Acceleron Pharma Inc. | BMP10 propeptides and related methods |
AU2005258286A1 (en) | 2004-06-24 | 2006-01-05 | Acceleron Pharma Inc. | GDF3 propeptides and related methods |
EP2314617B1 (en) | 2004-07-23 | 2015-06-24 | Acceleron Pharma Inc. | ActRII receptor polypeptides |
US8617815B2 (en) | 2004-08-05 | 2013-12-31 | The Regents Of The University Of California | Molecules with effects on cellular development and function |
MX2007000976A (en) | 2004-08-12 | 2007-04-10 | Wyeth Corp | Combination therapy for diabetes, obesity, and cardiovascular diseases using gdf-8 inhibitors. |
EP1804824B1 (en) | 2004-09-29 | 2017-01-04 | Icahn School of Medicine at Mount Sinai | Fsh and fsh receptor modulator compositions and methods for inhibiting osteoclastic bone resorption and bone loss in osteoporosis |
AU2005307789A1 (en) | 2004-11-16 | 2006-05-26 | Avidia Research Institute | Protein scaffolds and uses thereof |
NL1027887C2 (en) | 2004-12-24 | 2006-06-27 | Bosch Gmbh Robert | Transmission with bombed pulley discs and a driving belt. |
NZ538097A (en) | 2005-02-07 | 2006-07-28 | Ovita Ltd | Method and compositions for improving wound healing |
WO2006088972A2 (en) | 2005-02-16 | 2006-08-24 | The General Hospital Corporation | Use of modulatirs of compounds of tgf-beta superfamily to regulate hepcidin-mediated iron metabolism |
DOP2006000093A (en) | 2005-04-25 | 2007-01-31 | Pfizer | ANTIBODIES AGAINST MYOSTATIN |
EP1884235A1 (en) | 2005-04-26 | 2008-02-06 | Ajinomoto Co., Inc. | Myeloerythroid progenitor differentiation inducer |
JP2007099764A (en) | 2005-09-09 | 2007-04-19 | Ajinomoto Co Inc | Hypoglycaemic agent |
EP1931697B1 (en) | 2005-09-28 | 2010-09-15 | ZymoGenetics, Inc. | Il-17a and il-17f antagonists and methods of using the same |
US8067562B2 (en) | 2005-11-01 | 2011-11-29 | Amgen Inc. | Isolated nucleic acid molecule comprising the amino acid sequence of SEQ ID NO:1 |
EP1973559B1 (en) | 2005-11-23 | 2013-01-09 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for promoting bone growth |
US8128933B2 (en) | 2005-11-23 | 2012-03-06 | Acceleron Pharma, Inc. | Method of promoting bone growth by an anti-activin B antibody |
AU2006321906C1 (en) | 2005-12-06 | 2014-01-16 | Amgen Inc. | Uses of myostatin antagonists |
WO2007071023A1 (en) | 2005-12-20 | 2007-06-28 | Merck Frosst Canada Ltd. | Heteroaromatic compounds as inhibitors of stearoyl-coenzyme a delta-9 desaturase |
WO2007075702A2 (en) | 2005-12-21 | 2007-07-05 | Schering Corporation | Treatment of nonalcoholic fatty liver disease using cholesterol lowering agents and h3 receptor antagonist/inverse agonist |
EP1973909A2 (en) | 2005-12-22 | 2008-10-01 | Biogen Idec MA Inc. | Transforming growth factor modulators |
US7361510B2 (en) | 2006-01-20 | 2008-04-22 | Beckman Coulter, Inc. | Methods of detection of iron deficiency |
WO2007087505A2 (en) | 2006-01-25 | 2007-08-02 | Wellstat Therapeutics Corporation | Compounds for the treatment of metabolic disorders |
AU2007220868B2 (en) | 2006-02-28 | 2011-06-09 | Wellstat Therapeutics Corporation | Compounds for the treatment of metabolic disorders |
WO2007120767A2 (en) | 2006-04-14 | 2007-10-25 | Amgen Inc. | Agonist erythropoietin receptor antibodies |
WO2007123391A1 (en) | 2006-04-20 | 2007-11-01 | Academisch Ziekenhuis Leiden | Therapeutic intervention in a genetic disease in an individual by modifying expression of an aberrantly expressed gene. |
WO2007133653A2 (en) | 2006-05-09 | 2007-11-22 | Hemaquest Pharmaceuticals, Inc. | Methods for treating blood disorders |
TW200803123A (en) * | 2006-06-02 | 2008-01-01 | Delta Electronics Inc | Power converter and magnetic structure thereof |
NZ574331A (en) | 2006-07-21 | 2011-01-28 | Lyne Lab | Liquid compositions of calcium acetate |
GB0615129D0 (en) | 2006-07-29 | 2006-09-06 | Univ Cardiff | Anti-cancer activity of BMP-9 and BMP-10 and their use in cancer therapies |
CL2007002567A1 (en) | 2006-09-08 | 2008-02-01 | Amgen Inc | ISOLATED PROTEINS FROM LINK TO ACTIVINE TO HUMAN. |
US7547781B2 (en) | 2006-09-11 | 2009-06-16 | Curis, Inc. | Quinazoline based EGFR inhibitors containing a zinc binding moiety |
WO2008060139A1 (en) | 2006-11-17 | 2008-05-22 | Erasmus University Medical Center Rotterdam | Methods for controlling mineralization of extracellular matrix, therapeutic methods based thereon and medicaments for use therein |
US20100003190A1 (en) | 2006-12-08 | 2010-01-07 | Caritas St. Elizabeth's Medical Center Of Boston, Inc. | Method for protecting renal tubular epithelial cells from radiocontrast nephropathy (RCN) |
WO2008072723A1 (en) | 2006-12-14 | 2008-06-19 | Forerunner Pharma Research Co., Ltd. | ANTI-Claudin-3 MONOCLONAL ANTIBODY, AND TREATMENT AND DIAGNOSIS OF CANCER USING THE SAME |
US8895016B2 (en) | 2006-12-18 | 2014-11-25 | Acceleron Pharma, Inc. | Antagonists of activin-actriia and uses for increasing red blood cell levels |
SI2124999T1 (en) | 2006-12-18 | 2013-02-28 | Acceleron Pharma, Inc. | Activin-actrii antagonists and uses for treating anemia |
US20100028332A1 (en) | 2006-12-18 | 2010-02-04 | Acceleron Pharma Inc. | Antagonists of actriib and uses for increasing red blood cell levels |
CA2677007A1 (en) | 2007-02-01 | 2008-08-07 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for treating or preventing breast cancer |
TW201803890A (en) | 2007-02-02 | 2018-02-01 | 艾瑟勒朗法瑪公司 | Variants derived from ActRIIB and uses therefor |
CA3039330C (en) | 2007-02-09 | 2021-11-09 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for promoting bone growth in cancer patients |
TWI454479B (en) | 2007-03-06 | 2014-10-01 | Amgen Inc | Variant activin receptor polypeptides and uses thereof |
US8501678B2 (en) | 2007-03-06 | 2013-08-06 | Atara Biotherapeutics, Inc. | Variant activin receptor polypeptides and uses thereof |
WO2013106175A1 (en) | 2011-12-19 | 2013-07-18 | Amgen Inc. | Variant activin receptor polypeptides, alone or in combination with chemotherapy, and uses thereof |
WO2008151078A1 (en) | 2007-06-01 | 2008-12-11 | Wyeth | Methods and compositions for modulating bmp-10 activity |
WO2009009059A1 (en) | 2007-07-09 | 2009-01-15 | Biogen Idec Ma Inc. | Spiro compounds as antagonists of tgf-beta |
US20090025308A1 (en) * | 2007-07-26 | 2009-01-29 | Deans Brian W | Seismic support and reinforcement systems |
JP2010535708A (en) | 2007-08-03 | 2010-11-25 | ビオマリン アイジーエー リミテッド | Drug combinations for the treatment of Duchenne muscular dystrophy |
GB0715087D0 (en) | 2007-08-03 | 2007-09-12 | Summit Corp Plc | Drug combinations for the treatment of duchenne muscular dystrophy |
GB0715938D0 (en) | 2007-08-15 | 2007-09-26 | Vastox Plc | Method of treatment of duchenne muscular dystrophy |
WO2009025651A1 (en) | 2007-08-17 | 2009-02-26 | University Of Maine System Board Of Trustees | Biologically active peptide and method of using the same |
US20100279409A1 (en) | 2007-09-13 | 2010-11-04 | Neil Robson | Method for modifying celluar immune resonse by modulating activin activity |
CN103877564A (en) | 2007-09-18 | 2014-06-25 | 阿塞勒隆制药公司 | Activin-actriia antagonists and uses for decreasing or inhibiting fsh secretion |
PE20091163A1 (en) | 2007-11-01 | 2009-08-09 | Wyeth Corp | ANTIBODIES FOR GDF8 |
AU2008330125B2 (en) | 2007-11-21 | 2012-11-22 | Amgen Inc. | Wise binding antibodies and epitopes |
CA2718403A1 (en) | 2008-03-13 | 2009-09-17 | The General Hospital Corporation | Inhibitors of the bmp signaling pathway |
WO2009137075A1 (en) * | 2008-05-06 | 2009-11-12 | Acceleron Pharma Inc. | Anti-activin antibodies and uses for promoting bone growth |
JP2011523357A (en) | 2008-05-06 | 2011-08-11 | ジョスリン ダイアビーティス センター インコーポレイテッド | Methods and compositions for inducing brown adipocyte differentiation |
AU2009262970A1 (en) | 2008-06-26 | 2009-12-30 | Acceleron Pharma Inc. | Methods for dosing an activin-ActRIIa antagonist and monitoring of treated patients |
NZ590326A (en) | 2008-06-26 | 2013-05-31 | Acceleron Pharma Inc | Antagonists of activin-actriia and uses for increasing red blood cell levels |
DK2340031T3 (en) | 2008-08-14 | 2019-07-15 | Acceleron Pharma Inc | GDF CUSTOMER FOR USE OF ANALYSIS TREATMENT |
US8216997B2 (en) | 2008-08-14 | 2012-07-10 | Acceleron Pharma, Inc. | Methods for increasing red blood cell levels and treating anemia using a combination of GDF traps and erythropoietin receptor activators |
WO2010059861A1 (en) | 2008-11-20 | 2010-05-27 | University Of Southern California | Compositions and methods to modulate hair growth |
NZ627111A (en) | 2008-11-26 | 2015-10-30 | Amgen Inc | Variants of activin iib receptor polypeptides and uses thereof |
EP2387412A4 (en) | 2009-01-13 | 2013-04-03 | Acceleron Pharma Inc | Methods for increasing adiponectin |
US8110355B2 (en) | 2009-02-20 | 2012-02-07 | GenRemedy, LLC | Methods for identifying agents that inhibit cell migration, promote cell adhesion and prevent metastasis |
CN102753578B (en) | 2009-04-27 | 2015-04-22 | 诺华股份有限公司 | Compositions and methods for increasing muscle growth |
MX2011013172A (en) | 2009-06-08 | 2012-04-02 | Acceleron Pharma Inc | Methods for increasing thermogenic adipocytes. |
KR20120028358A (en) | 2009-06-12 | 2012-03-22 | 악셀레론 파마 인코포레이티드 | Truncated actriib-fc fusion proteins |
IL287990B (en) | 2009-08-13 | 2022-07-01 | Acceleron Pharma Inc | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels |
BR112012005225B8 (en) | 2009-09-09 | 2023-01-10 | Acceleron Pharma Inc | USE OF AN ACTRIIB-FC FUSION PROTEIN FOR THE TREATMENT OF A DISORDER RELATED TO BONE OR ASSOCIATED WITH MUSCLE LOSS DUE TO FAULT MUSCLE GROWTH |
CA2779472C (en) | 2009-11-03 | 2021-03-16 | Acceleron Pharma Inc. | The use of a composition comprising an activin type iib receptor polypeptide in the treatment of fatty liver disease |
EP3332796A1 (en) | 2009-11-17 | 2018-06-13 | Acceleron Pharma Inc. | Actriib proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy |
WO2012027065A2 (en) | 2010-08-27 | 2012-03-01 | Celgene Corporation | Combination therapy for treatment of disease |
US8580922B2 (en) | 2011-03-04 | 2013-11-12 | Shire Human Genetic Therapies, Inc. | Peptide linkers for polypeptide compositions and methods for using same |
WO2013006437A1 (en) | 2011-07-01 | 2013-01-10 | Novartis Ag | Method for treating metabolic disorders |
EA202090053A3 (en) | 2011-10-17 | 2020-06-30 | Акселерон Фарма, Инк. | METHODS AND COMPOSITIONS FOR TREATING NON-EFFECTIVE ERYTHROPOESIS |
WO2013063536A1 (en) | 2011-10-27 | 2013-05-02 | Acceleron Pharma, Inc. | Actriib binding agents and uses thereof |
US8765385B2 (en) | 2011-10-27 | 2014-07-01 | Ravindra Kumar | Method of detection of neutralizing anti-actriib antibodies |
EP2771017A4 (en) | 2011-10-28 | 2015-04-01 | Paranta Biosciences Ltd | A method of treating mucus hypersecretion |
US9254311B2 (en) | 2012-04-02 | 2016-02-09 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of proteins |
EP2861620A2 (en) | 2012-06-14 | 2015-04-22 | The Medical Research, Infrastructure, And Health Services Fund Of The Tel Aviv Medical Center | Use of blocking agents of bone morphogenie protein (bmp) signaling for the treatment of neuroinflammatory and neurodegenerative diseases |
WO2014007198A1 (en) | 2012-07-02 | 2014-01-09 | 協和発酵キリン株式会社 | Therapeutic agent for anemia including renal anemia and cancer-induced anemia which contains anti-bmp9 antibody as active ingredient |
WO2014066487A2 (en) | 2012-10-24 | 2014-05-01 | Celgene Corporation | Methods for treating anemia |
ES2753811T3 (en) | 2012-10-24 | 2020-04-14 | Celgene Corp | Biomarker for use in treating anemia |
WO2014064292A1 (en) | 2012-10-26 | 2014-05-01 | Universite Pierre Et Marie Curie (Paris 6) | A method for preventing or treating atrial fibrillation |
KR20210091358A (en) | 2012-11-02 | 2021-07-21 | 셀진 코포레이션 | Activin-actrii antagonists and uses for treating bone and other disorders |
EP2916827B1 (en) | 2012-11-08 | 2020-06-10 | Clearside Biomedical Inc. | Methods for the treatment of ocular disease in human subjects |
WO2014093531A1 (en) | 2012-12-11 | 2014-06-19 | Los Angeles Biomedical Research Institute At Harbor-Ucla Medical Center | Modulation of myofiber repair by anti-myostatin in strategies with stem cells |
US20140220033A1 (en) | 2013-02-01 | 2014-08-07 | Santa Maria Biotherapeutics, Inc. | Administration of an Anti-Activin-A Compound to a Subject |
EP2970940B1 (en) | 2013-03-14 | 2018-07-25 | Translate Bio, Inc. | Mrna therapeutic compositions and use to treat diseases and disorders |
TW201920262A (en) | 2013-07-30 | 2019-06-01 | 美商再生元醫藥公司 | Anti-activin A antibodies and uses thereof |
TN2016000057A1 (en) | 2013-08-14 | 2017-07-05 | Novartis Ag | Methods of treating sporadic inclusion body myositis |
WO2015089575A1 (en) | 2013-12-16 | 2015-06-25 | Paranta Biosciences Limited | Method of diagnosis and treatment |
US20160333418A1 (en) | 2014-01-14 | 2016-11-17 | Santa Maria Biotherapeutics, Inc. | Activin Inhibitor Response Prediction and Uses for Treatment |
WO2015111008A2 (en) | 2014-01-27 | 2015-07-30 | Novartis Ag | Biomarkers predictive of muscle atrophy, method and use |
US10260068B2 (en) | 2014-03-31 | 2019-04-16 | Sumitomo Dainippon Pharma Co., Ltd. | Prophylactic agent and therapeutic agent for fibrodysplasia ossificans progressiva |
MX2016013635A (en) | 2014-04-18 | 2017-02-02 | Acceleron Pharma Inc | Methods for increasing red blood cell levels and treating sickle-cell disease. |
TW201622746A (en) | 2014-04-24 | 2016-07-01 | 諾華公司 | Methods of improving or accelerating physical recovery after surgery for hip fracture |
EA202090632A1 (en) | 2014-06-04 | 2020-07-31 | Акселерон Фарма Инк. | METHODS AND COMPOSITIONS FOR TREATING DISORDERS WITH THE USE OF FALLISTATIN POLYPEPTIDES |
SG11201610432UA (en) | 2014-06-13 | 2017-01-27 | Santa Maria Biotherapeutics Inc | Formulated receptor polypeptides and related methods |
CN107847562A (en) | 2015-05-13 | 2018-03-27 | 细胞基因公司 | Using ACTRII with bulk trap treatment beta Thalassemia |
-
2006
- 2006-11-22 EP EP06838343A patent/EP1973559B1/en active Active
- 2006-11-22 JP JP2008542460A patent/JP5261187B2/en active Active
- 2006-11-22 KR KR1020087014725A patent/KR101585623B1/en active IP Right Grant
- 2006-11-22 KR KR1020157026709A patent/KR20150115961A/en active Application Filing
- 2006-11-22 EA EA201100158A patent/EA018450B1/en active IP Right Revival
- 2006-11-22 KR KR1020167032479A patent/KR20160137665A/en not_active Application Discontinuation
- 2006-11-22 ES ES14166241.1T patent/ES2649983T3/en active Active
- 2006-11-22 EP EP17175570.5A patent/EP3269381B1/en active Active
- 2006-11-22 EP EP14166241.1A patent/EP2781222B1/en active Active
- 2006-11-22 EP EP20195163.9A patent/EP3811965A1/en not_active Withdrawn
- 2006-11-22 EP EP10009325.1A patent/EP2329837B1/en active Active
- 2006-11-22 KR KR1020197023598A patent/KR20190097310A/en not_active Application Discontinuation
- 2006-11-22 KR KR1020207010015A patent/KR20200041386A/en not_active Application Discontinuation
- 2006-11-22 ES ES17175570T patent/ES2839549T3/en active Active
- 2006-11-22 PT PT68383439T patent/PT1973559E/en unknown
- 2006-11-22 KR KR1020187007304A patent/KR20180030264A/en not_active Application Discontinuation
- 2006-11-22 ES ES06838343T patent/ES2401805T3/en active Active
- 2006-11-22 ME MEP-2008-592A patent/ME00380B/en unknown
- 2006-11-22 EA EA200801406A patent/EA015105B1/en unknown
- 2006-11-22 CN CN201510284086.XA patent/CN105001320A/en active Pending
- 2006-11-22 US US11/603,485 patent/US7612041B2/en active Active
- 2006-11-22 CN CN2013103142194A patent/CN103432568A/en active Pending
- 2006-11-22 IN IN2553DEN2015 patent/IN2015DN02553A/en unknown
- 2006-11-22 KR KR1020137027593A patent/KR101557375B1/en active Application Filing
- 2006-11-22 BR BRPI0618947-4A patent/BRPI0618947B1/en active IP Right Grant
- 2006-11-22 KR KR1020197000694A patent/KR20190006086A/en not_active Application Discontinuation
- 2006-11-22 CA CA2631013A patent/CA2631013C/en active Active
- 2006-11-22 EA EA201300330A patent/EA026874B1/en active IP Right Revival
- 2006-11-22 CA CA3045808A patent/CA3045808C/en active Active
- 2006-11-22 SG SG10201509620SA patent/SG10201509620SA/en unknown
- 2006-11-22 EA EA201692543A patent/EA201692543A1/en unknown
- 2006-11-22 NZ NZ568369A patent/NZ568369A/en unknown
- 2006-11-22 RS RS20080336A patent/RS58231B1/en unknown
- 2006-11-22 DK DK06838343.9T patent/DK1973559T3/en active
- 2006-11-22 CN CN201310316553.3A patent/CN103479994B/en active Active
- 2006-11-22 CN CN201510282517.9A patent/CN104844713B/en active Active
- 2006-11-22 WO PCT/US2006/045322 patent/WO2007062188A2/en active Application Filing
- 2006-11-22 MX MX2008006626A patent/MX2008006626A/en active IP Right Grant
- 2006-11-22 PL PL06838343T patent/PL1973559T3/en unknown
- 2006-11-22 AU AU2006318449A patent/AU2006318449B2/en active Active
-
2008
- 2008-05-21 IL IL191596A patent/IL191596A/en active IP Right Grant
- 2008-05-22 CR CR10008A patent/CR10008A/en unknown
- 2008-05-22 EC EC2008008463A patent/ECSP088463A/en unknown
- 2008-07-30 HR HRP20080377AA patent/HRP20080377B1/en active IP Right Grant
- 2008-09-24 US US12/284,862 patent/US8067360B2/en active Active
- 2008-09-24 US US12/284,864 patent/US7951771B2/en active Active
-
2009
- 2009-03-20 HK HK09102689.3A patent/HK1123215A1/en unknown
- 2009-03-20 HK HK11113275.6A patent/HK1158548A1/en unknown
- 2009-11-26 JP JP2009269343A patent/JP2010094129A/en not_active Withdrawn
-
2011
- 2011-07-05 US US13/176,718 patent/US8629109B2/en active Active
-
2012
- 2012-03-30 JP JP2012080382A patent/JP5785129B2/en active Active
-
2013
- 2013-05-13 JP JP2013101251A patent/JP2013153765A/en not_active Withdrawn
- 2013-09-16 US US14/027,542 patent/US9163075B2/en active Active
-
2014
- 2014-01-26 IL IL230645A patent/IL230645A/en active IP Right Grant
- 2014-01-26 IL IL23064614A patent/IL230646B/en active IP Right Grant
-
2015
- 2015-09-09 US US14/849,313 patent/US10071135B2/en active Active
- 2015-11-02 JP JP2015215653A patent/JP6195885B2/en active Active
- 2015-11-02 JP JP2015215654A patent/JP2016026212A/en not_active Withdrawn
-
2017
- 2017-10-06 JP JP2017195841A patent/JP2018000205A/en not_active Withdrawn
-
2018
- 2018-06-07 IL IL259893A patent/IL259893B/en active IP Right Grant
- 2018-07-03 HK HK18108602.3A patent/HK1248598A1/en unknown
- 2018-08-03 US US16/054,107 patent/US11129873B2/en active Active
-
2019
- 2019-06-21 JP JP2019115565A patent/JP2019156848A/en not_active Withdrawn
-
2021
- 2021-02-15 IL IL280877A patent/IL280877A/en unknown
- 2021-06-23 JP JP2021104040A patent/JP2021151266A/en not_active Withdrawn
- 2021-08-24 US US17/410,175 patent/US20220211806A1/en not_active Abandoned
Non-Patent Citations (2)
Title |
---|
"Molecular Cloning A Laboratoiy Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS |
GOEDDEL: "Gene Expression Technology: Methods in Enzymology", 1990, ACADEMIC PRESS |
Cited By (146)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US9572865B2 (en) | 2005-11-23 | 2017-02-21 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for treating multiple myeloma |
US8486403B2 (en) | 2005-11-23 | 2013-07-16 | Acceleron Pharma, Inc. | Method of promoting bone growth by an anti-activin A antibody |
US9480742B2 (en) | 2005-11-23 | 2016-11-01 | Acceleron Pharma Inc. | Method of promoting bone growth by an anti-actriia antibody |
US7612041B2 (en) | 2005-11-23 | 2009-11-03 | Acceleron Pharma Inc. | Isolated activin-binding ActRIIa polypeptide comprising the SEQ ID NO: 7 and uses for promoting bone growth |
US10071135B2 (en) | 2005-11-23 | 2018-09-11 | Acceleron Pharma Inc. | Method of identifying an agent that promotes bone growth or increases bone density |
US8629109B2 (en) | 2005-11-23 | 2014-01-14 | Acceleron Pharma Inc. | Method for promoting bone growth using activin-actriia antagonists |
US10239940B2 (en) | 2005-11-23 | 2019-03-26 | Acceleron Pharma Inc. | Method of promoting bone growth by an anti-actriia antibody |
US8067360B2 (en) | 2005-11-23 | 2011-11-29 | Acceleron Pharma Inc. | Method for promoting bone growth using activin-ActRIIa antagonists |
US7951771B2 (en) | 2005-11-23 | 2011-05-31 | Acceleron Pharma Inc. | Activin-ActRIIa antagonists and uses for promoting bone growth |
US8128933B2 (en) | 2005-11-23 | 2012-03-06 | Acceleron Pharma, Inc. | Method of promoting bone growth by an anti-activin B antibody |
US11129873B2 (en) | 2005-11-23 | 2021-09-28 | Acceleron Pharma Inc. | Method for promoting bone growth using activin-actriia antagonists |
US10221232B2 (en) | 2006-11-22 | 2019-03-05 | Bristol-Myers Squibb Company | Methods of treating cancer by administering IGF-IR binding molecules |
US11149077B2 (en) | 2006-11-22 | 2021-10-19 | Bristol-Myers Squibb Company | Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including IGF-IR |
EP2468290A1 (en) * | 2006-12-18 | 2012-06-27 | Acceleron Pharma, Inc. | Activin-ActRII Antagonists and Uses for Increasing Red Blood Cell Levels |
AU2016250354B2 (en) * | 2006-12-18 | 2019-01-17 | Acceleron Pharma Inc. | Activin-ActRII antagonists and uses for increasing red blood cell levels |
EA018037B1 (en) * | 2006-12-18 | 2013-05-30 | Акселерон Фарма Инк. | Method for increasing red blood cell levels |
WO2008076437A3 (en) * | 2006-12-18 | 2008-09-18 | Acceleron Pharma Inc | Activin-actrii antagonists and uses for increasing red blood cell levels |
US7988973B2 (en) | 2006-12-18 | 2011-08-02 | Acceleron Pharma Inc. | Activin-ActRII antagonists and uses for increasing red blood cell levels |
EP3320911A3 (en) * | 2006-12-18 | 2018-06-27 | Acceleron Pharma, Inc. | Activin-actrii antagonists and uses for increasing red blood cell levels |
US8007809B2 (en) | 2006-12-18 | 2011-08-30 | Acceleron Pharma Inc. | Activin-actrii antagonists and uses for increasing red blood cell levels |
AU2013221910B2 (en) * | 2006-12-18 | 2016-11-17 | Acceleron Pharma Inc. | Activin-ActRII antagonists and uses for increasing red blood cell levels |
EP2446896A1 (en) * | 2006-12-18 | 2012-05-02 | Acceleron Pharma, Inc. | Activin-ActRII Antagonists for use in Increasing Red Blood Cells, increasing reticulocyte levels, or promoting erythropoiesis |
EP4026553A1 (en) * | 2006-12-18 | 2022-07-13 | Acceleron Pharma, Inc. | Activin-actrii antagonists and uses for increasing red blood cell levels |
EP2468291A1 (en) * | 2006-12-18 | 2012-06-27 | Acceleron Pharma, Inc. | Activin-ActRII Antagonists and Uses for Increasing Red Blood Cell Levels |
US10093707B2 (en) | 2006-12-18 | 2018-10-09 | Acceleron Pharma Inc. | Antagonists of activin-ActRIIa and uses for increasing red blood cell levels |
CN101835485B (en) * | 2007-02-01 | 2016-10-26 | 阿塞勒隆制药公司 | Activin-ACTRIIA antagonist and the purposes in treatment or Breast Cancer Prevention |
EP2599495A1 (en) * | 2007-02-01 | 2013-06-05 | Acceleron Pharma, Inc. | Activin-ActRIIa Antagonists and Uses for Treating or Preventing Breast Cancer |
CN103920139A (en) * | 2007-02-01 | 2014-07-16 | 阿塞勒隆制药公司 | Activin-actriia Antagonists And Uses For Treating Or Preventing Breast Cancer |
KR101526613B1 (en) * | 2007-02-01 | 2015-06-26 | 악셀레론 파마 인코포레이티드 | Activin-actriia antagonists and uses for treating or preventing breast cancer |
AU2008211007B2 (en) * | 2007-02-01 | 2013-09-19 | Acceleron Pharma Inc. | Activin-ActRIIa antagonists and uses for treating or preventing breast cancer |
WO2008094708A3 (en) * | 2007-02-01 | 2008-11-06 | Acceleron Pharma Inc | Activin-actriia antagonists and uses for treating or preventing breast cancer |
CN103920139B (en) * | 2007-02-01 | 2018-02-02 | 阿塞勒隆制药公司 | Activin A CTRIIA antagonists and the purposes in breast cancer is treated or prevented |
US7842663B2 (en) | 2007-02-02 | 2010-11-30 | Acceleron Pharma Inc. | Variants derived from ActRIIB and uses therefor |
US10259861B2 (en) | 2007-02-02 | 2019-04-16 | Acceleron Pharma Inc. | Variants derived from ActRIIB and uses therefor |
US8343933B2 (en) | 2007-02-02 | 2013-01-01 | Acceleron Pharma, Inc. | Variants derived from ActRIIB and uses therefor |
EP2481415A1 (en) * | 2007-02-09 | 2012-08-01 | Acceleron Pharma, Inc. | Activin-ActRIIa Antagonists and Uses for Promoting Bone Growth in Cancer Patients |
CN101687016B (en) * | 2007-02-09 | 2014-12-31 | 阿塞勒隆制药公司 | Activin-actriia antagonists and uses for promoting bone growth in cancer patients |
EA018221B1 (en) * | 2007-02-09 | 2013-06-28 | Акселерон Фарма Инк. | ACTIVIN-ActRIIa ANTAGONISTS AND USES FOR PROMOTING BONE GROWTH IN CANCER PATIENTS |
WO2008100384A3 (en) * | 2007-02-09 | 2008-12-11 | Acceleron Pharma Inc | Activin-actriia antagonists and uses for promoting bone growth in cancer patients |
EP2484372A1 (en) * | 2007-02-09 | 2012-08-08 | Acceleron Pharma, Inc. | Activin-ActRIIa Antagonists and Uses for Promoting Bone Growth in Cancer Patients |
AU2008216896B2 (en) * | 2007-02-09 | 2013-06-20 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for promoting bone growth in cancer patients |
AU2013204959B2 (en) * | 2007-02-09 | 2016-05-19 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for promoting bone growth in cancer patients |
AU2016202691B2 (en) * | 2007-02-09 | 2018-03-15 | Acceleron Pharma Inc. | Activin-ActRIIa antagonists and uses for promoting bone growth in cancer patients |
CN104548056B (en) * | 2007-02-09 | 2022-09-09 | 阿塞勒隆制药公司 | activin-ACTRIIA antagonists and uses for promoting bone growth in cancer patients |
CN104189889A (en) * | 2007-02-09 | 2014-12-10 | 阿塞勒隆制药公司 | Activin-actriia antagonists and uses for promoting bone growth in cancer patients |
EP2578684A1 (en) * | 2007-03-19 | 2013-04-10 | National Research Council Of Canada | Antagonists of ligands and uses thereof |
JP2014031380A (en) * | 2007-09-18 | 2014-02-20 | Acceleron Pharma Inc | USE FOR REDUCTION OR INHIBITION OF ACTIVIN-ActRIIa ANTAGONIST AND FSH SECRETION |
US20110218147A1 (en) * | 2007-09-18 | 2011-09-08 | Acceleron Pharma Inc. | Activin-actriia antagonists for inhibiting germ cell maturation |
EP3243524A1 (en) * | 2007-09-18 | 2017-11-15 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for decreasing or inhibiting fsh secretion |
US7960343B2 (en) | 2007-09-18 | 2011-06-14 | Acceleron Pharma Inc. | Activin-ActRIIa antagonists and uses for decreasing or inhibiting FSH secretion |
JP2010539236A (en) * | 2007-09-18 | 2010-12-16 | アクセルロン ファーマ, インコーポレイテッド | Activin-ActRIIa Antagonist and Use for Reducing or Inhibiting FSH Secretion |
JP2016026225A (en) * | 2007-09-18 | 2016-02-12 | アクセルロン ファーマ, インコーポレイテッド | Activin-actriia antagonists and uses for decreasing or inhibiting fsh secretion |
US20160319254A1 (en) * | 2007-09-18 | 2016-11-03 | Acceleron Pharma Inc. | Activin-actriia antagonists for inhibiting germ cell maturation |
US8367611B2 (en) | 2007-09-18 | 2013-02-05 | Acceleron Pharma Inc. | Activin-actriia antagonists for inhibiting germ cell maturation |
US10781247B2 (en) | 2008-02-14 | 2020-09-22 | Bristol-Myers Squibb Company | Targeted therapeutics based on engineered proteins that bind EGFR |
US9234028B2 (en) | 2008-02-14 | 2016-01-12 | Bristol-Myers Squibb Company | Targeted therapeutics based on engineered proteins that bind EGFR |
US9920108B2 (en) | 2008-02-14 | 2018-03-20 | Bristol-Myers Squibb Company | Targeted therapeutics based on engineered proteins that bind EGFR |
WO2009137075A1 (en) * | 2008-05-06 | 2009-11-12 | Acceleron Pharma Inc. | Anti-activin antibodies and uses for promoting bone growth |
US9902762B2 (en) | 2008-05-22 | 2018-02-27 | Bristol-Myers Squibb Company | Multivalent fibronectin based scaffold domain proteins |
US8728483B2 (en) | 2008-05-22 | 2014-05-20 | Bristol-Myers Squibb Company | Multivalent fibronectin based scaffold domain proteins |
JP2011520961A (en) * | 2008-05-22 | 2011-07-21 | ブリストル−マイヤーズ スクイブ カンパニー | Scaffold domain protein based on multivalent fibronectin |
US10774130B2 (en) | 2008-05-22 | 2020-09-15 | Bristol-Myers Squibb Company | Method of treating cancer by administering multivalent fibronectin based scaffold domain proteins |
EP3415161A1 (en) | 2008-06-26 | 2018-12-19 | Acceleron Pharma Inc. | The use of an actriib antagonist for the treatment of anemia |
JP2019006805A (en) * | 2008-06-26 | 2019-01-17 | アクセルロン ファーマ, インコーポレイテッド | ANTAGONISTS OF ACTIVIN-ActRIIa AND USES THEREOF FOR INCREASING RED BLOOD CELL LEVELS |
EP3620795A1 (en) | 2008-06-26 | 2020-03-11 | Acceleron Pharma Inc. | Antagonists of soluble activin-actriia and uses for increasing red blood cell levels |
JP2015187180A (en) * | 2008-06-26 | 2015-10-29 | アクセルロン ファーマ, インコーポレイテッド | Activin-actriia antagonist and use thereof for enhancing erythrocyte level |
EP3363453A1 (en) | 2008-06-26 | 2018-08-22 | Acceleron Pharma Inc. | Soluble actriia as activin-actriia antagonist for use in treating anemia or bone-related disorders |
CN107252486A (en) * | 2008-06-26 | 2017-10-17 | 阿塞勒隆制药公司 | Activin A CTRII antagonist and the purposes in hematocrit level is improved |
CN107252486B (en) * | 2008-06-26 | 2021-10-22 | 阿塞勒隆制药公司 | Antagonists of activin-ACTRII and uses in increasing red blood cell levels |
WO2009158035A2 (en) | 2008-06-26 | 2009-12-30 | Acceleron Pharma Inc. | Methods for dosing an activin-actriia antagonist and monitoring of treated patients |
WO2009158033A2 (en) | 2008-06-26 | 2009-12-30 | Acceleron Pharma Inc. | Antagonists of activin-actriia and uses for increasing red blood cell levels |
JP2011525917A (en) * | 2008-06-26 | 2011-09-29 | アクセルロン ファーマ, インコーポレイテッド | Methods of administering activin-ActRIIa antagonists and methods of monitoring patients to be treated |
US11155791B2 (en) | 2008-08-14 | 2021-10-26 | Acceleron Pharma Inc. | Methods for treating anemia in a subject in need thereof |
US10689427B2 (en) | 2008-08-14 | 2020-06-23 | Acceleron Pharma Inc. | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels |
US10829532B2 (en) | 2008-08-14 | 2020-11-10 | Acceleron Pharma Inc. | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels |
US10889626B2 (en) | 2008-08-14 | 2021-01-12 | Acceleron Pharma Inc. | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels |
US10377996B2 (en) | 2008-08-14 | 2019-08-13 | Acceleron Pharma Inc. | Methods of identifying ActRIIB variants |
US9932379B2 (en) | 2008-08-14 | 2018-04-03 | Acceleron Pharma Inc. | Isolated nucleotide sequences encoding GDF traps |
US8361957B2 (en) | 2008-08-14 | 2013-01-29 | Acceleron Pharma, Inc. | Isolated GDF trap polypeptide |
US11168311B2 (en) | 2008-08-14 | 2021-11-09 | Acceleron Pharma Inc. | Methods for treating anemia in a subject in need thereof |
US11162085B2 (en) | 2008-08-14 | 2021-11-02 | Acceleron Pharma Inc. | Methods for treating anemia in a subject in need thereof |
US10829533B2 (en) | 2008-08-14 | 2020-11-10 | Acceleron Pharma Inc. | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels |
US8216997B2 (en) | 2008-08-14 | 2012-07-10 | Acceleron Pharma, Inc. | Methods for increasing red blood cell levels and treating anemia using a combination of GDF traps and erythropoietin receptor activators |
US9771411B2 (en) | 2008-11-24 | 2017-09-26 | Bristol-Myers Squibb Company | Method of treating cancer by administering EGFR and EGFR/IGFIR binding molecules |
JP2012509900A (en) * | 2008-11-24 | 2012-04-26 | ブリストル−マイヤーズ スクイブ カンパニー | Bispecific EGFR / IGFIR binding molecule |
US9017655B2 (en) | 2008-11-24 | 2015-04-28 | Bristol-Myers Squibb Company | Bispecific EGFR/IGFIR binding molecules |
US10183987B2 (en) | 2008-11-24 | 2019-01-22 | Bristol-Myers Squibb Company | Polynucleotides encoding bispecific EGFR/IGF-IR binding molecules |
US10954286B2 (en) | 2008-11-24 | 2021-03-23 | Bristol-Myers Squibb Company | Bispecific EGFR/IGFIR binding molecules |
US8138142B2 (en) | 2009-01-13 | 2012-03-20 | Acceleron Pharma Inc. | Methods for increasing adiponectin in a patient in need thereof |
US8338377B2 (en) | 2009-03-30 | 2012-12-25 | Acceleron Pharma Inc. | BMP-ALK3 antagonists and uses for promoting bone growth |
US9914762B2 (en) | 2009-03-30 | 2018-03-13 | Acceleron Pharma Inc. | BMP-ALK3 antagonists and uses for promoting bone growth |
AU2010232693B2 (en) * | 2009-03-30 | 2016-04-21 | Acceleron Pharma Inc. | BMP-ALK3 antagonists and uses for promoting bone growth |
AU2018201132B2 (en) * | 2009-03-30 | 2020-03-26 | Acceleron Pharma Inc. | BMP-ALK3 antagonists and uses for promoting bone growth |
CN102548617B (en) * | 2009-03-30 | 2017-11-07 | 阿塞勒隆制药公司 | BMP ALK3 antagonists and the purposes for promoting bone uptake |
CN102548617A (en) * | 2009-03-30 | 2012-07-04 | 阿塞勒隆制药公司 | Bmp-alk3 antagonists and uses for promoting bone growth |
WO2010114860A1 (en) * | 2009-03-30 | 2010-10-07 | Acceleron Pharma Inc. | Bmp-alk3 antagonists and uses for promoting bone growth |
US8945877B2 (en) | 2009-03-30 | 2015-02-03 | Acceleron Pharma, Inc. | Polynucleotides encoding BMP-ALK3 antagonists |
US10968282B2 (en) | 2009-06-08 | 2021-04-06 | Acceleron Pharma Inc. | Methods for screening compounds for increasing thermogenic adipocytes |
US9790284B2 (en) | 2009-06-08 | 2017-10-17 | Acceleron Pharma Inc. | Methods for increasing thermogenic adipocytes |
US8178488B2 (en) | 2009-06-08 | 2012-05-15 | Acceleron Pharma, Inc. | Methods for increasing thermogenic adipocytes |
US11066654B2 (en) | 2009-06-12 | 2021-07-20 | Acceleron Pharma Inc. | Methods and compositions for reducing serum lipids |
US10358633B2 (en) | 2009-06-12 | 2019-07-23 | Acceleron Pharma Inc. | Method for producing an ActRIIB-Fc fusion polypeptide |
US9745559B2 (en) | 2009-06-12 | 2017-08-29 | Acceleron Pharma Inc. | Method for decreasing the body fat content in a subject by administering an ActRIIB protein |
AU2018200463B2 (en) * | 2009-09-09 | 2020-07-09 | Acceleron Pharma Inc. | ActRIIb antagonists and dosing and uses thereof |
US8710016B2 (en) | 2009-11-17 | 2014-04-29 | Acceleron Pharma, Inc. | ActRIIB proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy |
US10968262B2 (en) | 2009-11-17 | 2021-04-06 | Acceleron Pharma Inc. | Methods of increasing sarcolemmal utrophin |
US9617319B2 (en) | 2009-11-17 | 2017-04-11 | Acceleron Pharma Inc. | ActRIIB proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy |
US10934572B2 (en) | 2010-05-03 | 2021-03-02 | Bristol-Myers Squibb Company | Serum albumin binding molecules |
US9540424B2 (en) | 2010-05-03 | 2017-01-10 | Bristol-Myers Squibb Company | Serum albumin binding molecules |
US10221438B2 (en) | 2010-05-03 | 2019-03-05 | Bristol-Myers Squibb Company | Serum albumin binding molecules |
US8969289B2 (en) | 2010-05-03 | 2015-03-03 | Bristol-Myers Squibb Company | Serum albumin binding molecules |
US10273286B2 (en) | 2010-05-26 | 2019-04-30 | Bristol-Myers Squibb Company | Fibronectin based scaffold proteins having improved stability |
US9562089B2 (en) | 2010-05-26 | 2017-02-07 | Bristol-Myers Squibb Company | Fibronectin based scaffold proteins having improved stability |
US11161893B2 (en) | 2010-05-26 | 2021-11-02 | Bristol-Myers Squibb Company | Fibronectin based scaffold proteins having improved stability |
US11046752B2 (en) | 2011-06-28 | 2021-06-29 | Inhibrx, Inc. | Serpin fusion polypeptides and methods of use thereof |
US11827691B2 (en) | 2011-06-28 | 2023-11-28 | Inhibrx, Inc. | Serpin fusion polypeptides and methods of use thereof |
US11965017B2 (en) | 2011-06-28 | 2024-04-23 | Inhibrx, Inc. | Serpin fusion polypeptides and methods of use thereof |
EP2726092B1 (en) * | 2011-06-28 | 2019-06-19 | Inhibrx, LP | Serpin fusion polypeptides and methods of use thereof |
US10730929B2 (en) | 2011-06-28 | 2020-08-04 | Inhibrx Lp | Serpin fusion polypeptides and methods of use thereof |
US10400029B2 (en) | 2011-06-28 | 2019-09-03 | Inhibrx, Lp | Serpin fusion polypeptides and methods of use thereof |
US10723785B2 (en) | 2011-06-28 | 2020-07-28 | Inhibrx, Inc. | Serpin fusion polypeptides and methods of use thereof |
EP3351260A1 (en) | 2012-04-06 | 2018-07-25 | Acceleron Pharma Inc. | Methods and compositions for increasing red blood cells |
US10195249B2 (en) | 2012-11-02 | 2019-02-05 | Celgene Corporation | Activin-ActRII antagonists and uses for treating bone and other disorders |
US11203630B2 (en) | 2014-03-20 | 2021-12-21 | Bristol-Myers Squibb Company | Serum albumin-binding fibronectin type III domains |
US10442851B2 (en) | 2014-03-20 | 2019-10-15 | Bristol-Myers Squibb Company | Serum albumin-binding fibronectin type III domains |
US10487144B2 (en) | 2014-06-13 | 2019-11-26 | Acceleron Pharma Inc. | Methods for treating ulcers in a hemoglobinopathy anemia with a soluble actRIIB polypeptide |
US9850298B2 (en) | 2014-06-13 | 2017-12-26 | Acceleron Pharma Inc. | Methods for treating ulcers in thalassemia syndrome with an ActRIIB polypeptide |
US11260107B2 (en) | 2014-06-13 | 2022-03-01 | Acceleron Pharma Inc. | Methods and compositions for treating ulcers |
US11813308B2 (en) | 2014-10-09 | 2023-11-14 | Celgene Corporation | Treatment of cardiovascular disease using ActRII ligand traps |
US11471510B2 (en) | 2014-12-03 | 2022-10-18 | Celgene Corporation | Activin-ActRII antagonists and uses for treating anemia |
US10548976B2 (en) | 2015-05-20 | 2020-02-04 | Celgene Corporation | In vitro cell culture methods for beta-thalassemia using activin type II receptor ligand traps |
US11434275B2 (en) | 2015-09-23 | 2022-09-06 | Bristol-Myers Squibb Company | Fast-off rate serum albumin binding fibronectin type III domains |
US10766946B2 (en) | 2015-09-23 | 2020-09-08 | Bristol-Myers Squibb Company | Fast-off rate serum albumin binding fibronectin type III domains |
US10695405B2 (en) | 2016-07-15 | 2020-06-30 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
US11318188B2 (en) | 2016-07-15 | 2022-05-03 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
US11219666B2 (en) | 2016-07-15 | 2022-01-11 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
EP3928784A1 (en) | 2016-07-15 | 2021-12-29 | Acceleron Pharma Inc. | Compositions comprising actriia polypeptides for use in treating pulmonary hypertension |
US11065303B2 (en) | 2016-07-15 | 2021-07-20 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
US10973880B2 (en) | 2016-07-15 | 2021-04-13 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
US11497794B2 (en) | 2016-07-15 | 2022-11-15 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
US11622992B2 (en) | 2016-07-15 | 2023-04-11 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
WO2018013936A1 (en) | 2016-07-15 | 2018-01-18 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
US10946067B2 (en) | 2016-07-15 | 2021-03-16 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
US10722558B2 (en) | 2016-07-15 | 2020-07-28 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
EP4026556A1 (en) | 2016-10-05 | 2022-07-13 | Acceleron Pharma Inc. | Compositions and method for treating kidney disease |
US11834508B2 (en) | 2017-03-24 | 2023-12-05 | Novartis Ag | Method of treating structural and/or functional cardiac abnormalities by administering an anti-ActRII receptor antibody |
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20220211806A1 (en) | Method for promoting bone growth using activin-actriia antagonists | |
US20210261682A1 (en) | Activin-actriia antagonists and uses for treating multiple myeloma | |
US20210040192A1 (en) | Method of promoting bone growth by an anti-actriia antibody | |
WO2009137075A1 (en) | Anti-activin antibodies and uses for promoting bone growth | |
AU2019222887B2 (en) | Activin-ActRIIa antagonists and uses for promoting bone growth | |
AU2017203993B2 (en) | Activin-ActRIIa antagonists and uses for promoting bone growth |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
WWE | Wipo information: entry into national phase |
Ref document number: 568369 Country of ref document: NZ Ref document number: 2006318449 Country of ref document: AU |
|
WWE | Wipo information: entry into national phase |
Ref document number: 191596 Country of ref document: IL Ref document number: 2008050841 Country of ref document: EG |
|
WWE | Wipo information: entry into national phase |
Ref document number: MX/a/2008/006626 Country of ref document: MX Ref document number: 2008542460 Country of ref document: JP Ref document number: CR2008-010008 Country of ref document: CR |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2631013 Country of ref document: CA Ref document number: 12008501237 Country of ref document: PH Ref document number: 4430/DELNP/2008 Country of ref document: IN |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
WWE | Wipo information: entry into national phase |
Ref document number: 08055106 Country of ref document: CO |
|
ENP | Entry into the national phase |
Ref document number: 2006318449 Country of ref document: AU Date of ref document: 20061122 Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: 1020087014725 Country of ref document: KR |
|
WWE | Wipo information: entry into national phase |
Ref document number: 200801406 Country of ref document: EA Ref document number: 2006838343 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: A200807174 Country of ref document: UA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 200680051538.9 Country of ref document: CN |
|
WWE | Wipo information: entry into national phase |
Ref document number: P20080377A Country of ref document: HR |
|
WWE | Wipo information: entry into national phase |
Ref document number: P-2008/0336 Country of ref document: RS |
|
ENP | Entry into the national phase |
Ref document number: PI0618947 Country of ref document: BR Kind code of ref document: A2 Effective date: 20080523 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 1020137027593 Country of ref document: KR |
|
WWE | Wipo information: entry into national phase |
Ref document number: 1020157026709 Country of ref document: KR |
|
WWE | Wipo information: entry into national phase |
Ref document number: 1020167032479 Country of ref document: KR |