WO2007059030A2 - Llo-encoding dna/nucleic acid vaccines and methods comprising same - Google Patents
Llo-encoding dna/nucleic acid vaccines and methods comprising same Download PDFInfo
- Publication number
- WO2007059030A2 WO2007059030A2 PCT/US2006/043987 US2006043987W WO2007059030A2 WO 2007059030 A2 WO2007059030 A2 WO 2007059030A2 US 2006043987 W US2006043987 W US 2006043987W WO 2007059030 A2 WO2007059030 A2 WO 2007059030A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antigen
- subject
- another embodiment
- tumor
- immune response
- Prior art date
Links
- 238000000034 method Methods 0.000 title claims abstract description 155
- 108700001237 Nucleic Acid-Based Vaccines Proteins 0.000 title description 2
- 229940023146 nucleic acid vaccine Drugs 0.000 title description 2
- 108091007433 antigens Proteins 0.000 claims abstract description 261
- 102000036639 antigens Human genes 0.000 claims abstract description 258
- 239000000427 antigen Substances 0.000 claims abstract description 250
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 165
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 150
- 239000000203 mixture Substances 0.000 claims abstract description 131
- 210000001744 T-lymphocyte Anatomy 0.000 claims abstract description 101
- 239000013598 vector Substances 0.000 claims abstract description 81
- 230000021633 leukocyte mediated immunity Effects 0.000 claims abstract description 56
- 210000004898 n-terminal fragment Anatomy 0.000 claims abstract description 56
- 230000012010 growth Effects 0.000 claims abstract description 36
- 239000012634 fragment Substances 0.000 claims description 183
- 102000004169 proteins and genes Human genes 0.000 claims description 87
- 239000013612 plasmid Substances 0.000 claims description 82
- 230000028993 immune response Effects 0.000 claims description 80
- 239000002773 nucleotide Substances 0.000 claims description 66
- 125000003729 nucleotide group Chemical group 0.000 claims description 66
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 39
- 102000004127 Cytokines Human genes 0.000 claims description 35
- 108090000695 Cytokines Proteins 0.000 claims description 35
- 108010041986 DNA Vaccines Proteins 0.000 claims description 28
- 229940021995 DNA vaccine Drugs 0.000 claims description 28
- 108700026244 Open Reading Frames Proteins 0.000 claims description 20
- 208000035473 Communicable disease Diseases 0.000 claims description 18
- 230000005867 T cell response Effects 0.000 claims description 18
- 208000015181 infectious disease Diseases 0.000 claims description 18
- 102000004457 Granulocyte-Macrophage Colony-Stimulating Factor Human genes 0.000 claims description 14
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 claims description 14
- 230000004927 fusion Effects 0.000 claims description 14
- 108700027766 Listeria monocytogenes hlyA Proteins 0.000 claims description 11
- 230000004936 stimulating effect Effects 0.000 claims description 5
- 101100314454 Caenorhabditis elegans tra-1 gene Proteins 0.000 claims description 4
- 102100031413 L-dopachrome tautomerase Human genes 0.000 claims description 4
- 108091005804 Peptidases Proteins 0.000 claims description 4
- 102000035195 Peptidases Human genes 0.000 claims description 4
- 108010017842 Telomerase Proteins 0.000 claims description 4
- 208000008383 Wilms tumor Diseases 0.000 claims description 4
- 201000008026 nephroblastoma Diseases 0.000 claims description 4
- 235000019833 protease Nutrition 0.000 claims description 4
- 102400000700 Tumor necrosis factor, membrane form Human genes 0.000 claims description 3
- 101800000716 Tumor necrosis factor, membrane form Proteins 0.000 claims description 3
- 102000003425 Tyrosinase Human genes 0.000 claims description 3
- 108060008724 Tyrosinase Proteins 0.000 claims description 3
- 108010051081 dopachrome isomerase Proteins 0.000 claims description 3
- 108020001507 fusion proteins Proteins 0.000 claims description 3
- 102000037865 fusion proteins Human genes 0.000 claims description 3
- 229960005486 vaccine Drugs 0.000 abstract description 14
- 108020004999 messenger RNA Proteins 0.000 abstract description 9
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 46
- 230000001404 mediated effect Effects 0.000 description 42
- 210000004027 cell Anatomy 0.000 description 29
- 108020004414 DNA Proteins 0.000 description 23
- 102100037850 Interferon gamma Human genes 0.000 description 17
- 108010074328 Interferon-gamma Proteins 0.000 description 17
- 241000699670 Mus sp. Species 0.000 description 16
- 230000004044 response Effects 0.000 description 14
- 108010008038 Synthetic Vaccines Proteins 0.000 description 13
- 150000007523 nucleic acids Chemical group 0.000 description 13
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 9
- 108020004707 nucleic acids Proteins 0.000 description 9
- 102000039446 nucleic acids Human genes 0.000 description 9
- 239000003921 oil Substances 0.000 description 9
- 235000019198 oils Nutrition 0.000 description 9
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 8
- 230000015572 biosynthetic process Effects 0.000 description 8
- 238000002474 experimental method Methods 0.000 description 7
- 230000001939 inductive effect Effects 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 6
- 102000000440 Melanoma-associated antigen Human genes 0.000 description 6
- 108050008953 Melanoma-associated antigen Proteins 0.000 description 6
- 150000001413 amino acids Chemical class 0.000 description 6
- 150000001875 compounds Chemical class 0.000 description 6
- 210000004988 splenocyte Anatomy 0.000 description 6
- 238000011740 C57BL/6 mouse Methods 0.000 description 5
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 5
- 241000186781 Listeria Species 0.000 description 5
- 108091028043 Nucleic acid sequence Proteins 0.000 description 5
- 238000004458 analytical method Methods 0.000 description 5
- 239000008121 dextrose Substances 0.000 description 5
- 238000003114 enzyme-linked immunosorbent spot assay Methods 0.000 description 5
- 239000007788 liquid Substances 0.000 description 5
- 239000011780 sodium chloride Substances 0.000 description 5
- -1 MART- 1 Proteins 0.000 description 4
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 4
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 239000000839 emulsion Substances 0.000 description 4
- 238000009472 formulation Methods 0.000 description 4
- 230000002163 immunogen Effects 0.000 description 4
- 230000005847 immunogenicity Effects 0.000 description 4
- 238000001727 in vivo Methods 0.000 description 4
- 238000001990 intravenous administration Methods 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 230000003248 secreting effect Effects 0.000 description 4
- 239000007787 solid Substances 0.000 description 4
- 239000000725 suspension Substances 0.000 description 4
- NIXOWILDQLNWCW-UHFFFAOYSA-N Acrylic acid Chemical compound OC(=O)C=C NIXOWILDQLNWCW-UHFFFAOYSA-N 0.000 description 3
- 108010022366 Carcinoembryonic Antigen Proteins 0.000 description 3
- 102100025475 Carcinoembryonic antigen-related cell adhesion molecule 5 Human genes 0.000 description 3
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 3
- 229920002261 Corn starch Polymers 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- 239000001856 Ethyl cellulose Substances 0.000 description 3
- ZZSNKZQZMQGXPY-UHFFFAOYSA-N Ethyl cellulose Chemical compound CCOCC1OC(OC)C(OCC)C(OCC)C1OC1C(O)C(O)C(OC)C(CO)O1 ZZSNKZQZMQGXPY-UHFFFAOYSA-N 0.000 description 3
- 101710177291 Gag polyprotein Proteins 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 229920002907 Guar gum Polymers 0.000 description 3
- 101000767631 Human papillomavirus type 16 Protein E7 Proteins 0.000 description 3
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 3
- 102000043131 MHC class II family Human genes 0.000 description 3
- 108091054438 MHC class II family Proteins 0.000 description 3
- 101710125418 Major capsid protein Proteins 0.000 description 3
- 239000002202 Polyethylene glycol Substances 0.000 description 3
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 3
- 229920002125 Sokalan® Polymers 0.000 description 3
- 239000011324 bead Substances 0.000 description 3
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 3
- 239000002775 capsule Substances 0.000 description 3
- 229960001631 carbomer Drugs 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 239000008120 corn starch Substances 0.000 description 3
- 229940099112 cornstarch Drugs 0.000 description 3
- 235000019325 ethyl cellulose Nutrition 0.000 description 3
- 229920001249 ethyl cellulose Polymers 0.000 description 3
- 239000000665 guar gum Substances 0.000 description 3
- 235000010417 guar gum Nutrition 0.000 description 3
- 229960002154 guar gum Drugs 0.000 description 3
- 238000009396 hybridization Methods 0.000 description 3
- 239000001863 hydroxypropyl cellulose Substances 0.000 description 3
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 3
- 239000012678 infectious agent Substances 0.000 description 3
- 238000001361 intraarterial administration Methods 0.000 description 3
- 230000003834 intracellular effect Effects 0.000 description 3
- 239000003446 ligand Substances 0.000 description 3
- 201000001441 melanoma Diseases 0.000 description 3
- 108091070501 miRNA Proteins 0.000 description 3
- 239000002679 microRNA Substances 0.000 description 3
- 238000010369 molecular cloning Methods 0.000 description 3
- 229920001223 polyethylene glycol Polymers 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 108010014186 ras Proteins Proteins 0.000 description 3
- 238000003757 reverse transcription PCR Methods 0.000 description 3
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 2
- 102000006435 Chemokine CCL21 Human genes 0.000 description 2
- 108010083702 Chemokine CCL21 Proteins 0.000 description 2
- 108010000916 Fimbriae Proteins Proteins 0.000 description 2
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 241000701806 Human papillomavirus Species 0.000 description 2
- 108010002350 Interleukin-2 Proteins 0.000 description 2
- 108010063738 Interleukins Proteins 0.000 description 2
- 102000015696 Interleukins Human genes 0.000 description 2
- 241000186779 Listeria monocytogenes Species 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- WHNWPMSKXPGLAX-UHFFFAOYSA-N N-Vinyl-2-pyrrolidone Chemical compound C=CN1CCCC1=O WHNWPMSKXPGLAX-UHFFFAOYSA-N 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 235000019483 Peanut oil Nutrition 0.000 description 2
- 108091093037 Peptide nucleic acid Proteins 0.000 description 2
- 108010076504 Protein Sorting Signals Proteins 0.000 description 2
- 102000039471 Small Nuclear RNA Human genes 0.000 description 2
- 229920002472 Starch Polymers 0.000 description 2
- 235000019486 Sunflower oil Nutrition 0.000 description 2
- 102100040396 Transcobalamin-1 Human genes 0.000 description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 2
- 241000607479 Yersinia pestis Species 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- 230000007815 allergy Effects 0.000 description 2
- 230000005809 anti-tumor immunity Effects 0.000 description 2
- 230000005875 antibody response Effects 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 201000011510 cancer Diseases 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 229940075614 colloidal silicon dioxide Drugs 0.000 description 2
- 238000013270 controlled release Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- FLKPEMZONWLCSK-UHFFFAOYSA-N diethyl phthalate Chemical compound CCOC(=O)C1=CC=CC=C1C(=O)OCC FLKPEMZONWLCSK-UHFFFAOYSA-N 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 239000006185 dispersion Substances 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 229960004667 ethyl cellulose Drugs 0.000 description 2
- 238000000684 flow cytometry Methods 0.000 description 2
- 108700014844 flt3 ligand Proteins 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229940014259 gelatin Drugs 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 230000002949 hemolytic effect Effects 0.000 description 2
- 229940071676 hydroxypropylcellulose Drugs 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 238000010255 intramuscular injection Methods 0.000 description 2
- 239000007927 intramuscular injection Substances 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 239000012669 liquid formulation Substances 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 239000002480 mineral oil Substances 0.000 description 2
- 235000010446 mineral oil Nutrition 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 239000004006 olive oil Substances 0.000 description 2
- 235000008390 olive oil Nutrition 0.000 description 2
- 239000000312 peanut oil Substances 0.000 description 2
- 239000003208 petroleum Substances 0.000 description 2
- 239000008194 pharmaceutical composition Substances 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 229920001983 poloxamer Polymers 0.000 description 2
- 229920001987 poloxamine Polymers 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 235000013772 propylene glycol Nutrition 0.000 description 2
- 102000016914 ras Proteins Human genes 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 108091029842 small nuclear ribonucleic acid Proteins 0.000 description 2
- 239000003549 soybean oil Substances 0.000 description 2
- 235000012424 soybean oil Nutrition 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 235000019698 starch Nutrition 0.000 description 2
- 229940032147 starch Drugs 0.000 description 2
- 238000007619 statistical method Methods 0.000 description 2
- 239000002600 sunflower oil Substances 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 208000011580 syndromic disease Diseases 0.000 description 2
- 210000004881 tumor cell Anatomy 0.000 description 2
- 230000004614 tumor growth Effects 0.000 description 2
- 102000003390 tumor necrosis factor Human genes 0.000 description 2
- 235000013311 vegetables Nutrition 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- LKKMLIBUAXYLOY-UHFFFAOYSA-N 3-Amino-1-methyl-5H-pyrido[4,3-b]indole Chemical compound N1C2=CC=CC=C2C2=C1C=C(N)N=C2C LKKMLIBUAXYLOY-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 244000215068 Acacia senegal Species 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- NIXOWILDQLNWCW-UHFFFAOYSA-M Acrylate Chemical compound [O-]C(=O)C=C NIXOWILDQLNWCW-UHFFFAOYSA-M 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 208000026872 Addison Disease Diseases 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 206010002198 Anaphylactic reaction Diseases 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 108010011485 Aspartame Proteins 0.000 description 1
- 206010003594 Ataxia telangiectasia Diseases 0.000 description 1
- 241000972773 Aulopiformes Species 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 206010055128 Autoimmune neutropenia Diseases 0.000 description 1
- 206010050245 Autoimmune thrombocytopenia Diseases 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 208000023328 Basedow disease Diseases 0.000 description 1
- 208000008439 Biliary Liver Cirrhosis Diseases 0.000 description 1
- 208000033222 Biliary cirrhosis primary Diseases 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 239000004255 Butylated hydroxyanisole Substances 0.000 description 1
- 201000007155 CD40 ligand deficiency Diseases 0.000 description 1
- 108010076667 Caspases Proteins 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 102000003805 Chemokine CCL19 Human genes 0.000 description 1
- 108010082161 Chemokine CCL19 Proteins 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 206010008609 Cholangitis sclerosing Diseases 0.000 description 1
- 206010008631 Cholera Diseases 0.000 description 1
- VYZAMTAEIAYCRO-UHFFFAOYSA-N Chromium Chemical compound [Cr] VYZAMTAEIAYCRO-UHFFFAOYSA-N 0.000 description 1
- 208000008818 Chronic Mucocutaneous Candidiasis Diseases 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 208000015943 Coeliac disease Diseases 0.000 description 1
- 206010009944 Colon cancer Diseases 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- 201000004624 Dermatitis Diseases 0.000 description 1
- 206010012468 Dermatitis herpetiformis Diseases 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 238000011510 Elispot assay Methods 0.000 description 1
- 206010018364 Glomerulonephritis Diseases 0.000 description 1
- 206010072579 Granulomatosis with polyangiitis Diseases 0.000 description 1
- 208000015023 Graves' disease Diseases 0.000 description 1
- 208000035895 Guillain-Barré syndrome Diseases 0.000 description 1
- 241000606790 Haemophilus Species 0.000 description 1
- 241000606768 Haemophilus influenzae Species 0.000 description 1
- 208000030836 Hashimoto thyroiditis Diseases 0.000 description 1
- 241000590002 Helicobacter pylori Species 0.000 description 1
- 101710154606 Hemagglutinin Proteins 0.000 description 1
- 208000035186 Hemolytic Autoimmune Anemia Diseases 0.000 description 1
- 208000007514 Herpes zoster Diseases 0.000 description 1
- 101000777387 Homo sapiens C-C motif chemokine 3 Proteins 0.000 description 1
- 101001018097 Homo sapiens L-selectin Proteins 0.000 description 1
- 101000622137 Homo sapiens P-selectin Proteins 0.000 description 1
- 241000341655 Human papillomavirus type 16 Species 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- 108010002231 IgA-specific serine endopeptidase Proteins 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 102100023915 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 102100034353 Integrase Human genes 0.000 description 1
- LEVWYRKDKASIDU-IMJSIDKUSA-N L-cystine Chemical compound [O-]C(=O)[C@@H]([NH3+])CSSC[C@H]([NH3+])C([O-])=O LEVWYRKDKASIDU-IMJSIDKUSA-N 0.000 description 1
- 101710093778 L-dopachrome tautomerase Proteins 0.000 description 1
- 102100033467 L-selectin Human genes 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 201000010743 Lambert-Eaton myasthenic syndrome Diseases 0.000 description 1
- 101000839464 Leishmania braziliensis Heat shock 70 kDa protein Proteins 0.000 description 1
- 241000186780 Listeria ivanovii Species 0.000 description 1
- 241000186807 Listeria seeligeri Species 0.000 description 1
- 241000186814 Listeria welshimeri Species 0.000 description 1
- 101000577064 Lymnaea stagnalis Molluscan insulin-related peptide 1 Proteins 0.000 description 1
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 1
- 102000043129 MHC class I family Human genes 0.000 description 1
- 108091054437 MHC class I family Proteins 0.000 description 1
- 102000009571 Macrophage Inflammatory Proteins Human genes 0.000 description 1
- 108010009474 Macrophage Inflammatory Proteins Proteins 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 201000005505 Measles Diseases 0.000 description 1
- 201000009906 Meningitis Diseases 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 206010049567 Miller Fisher syndrome Diseases 0.000 description 1
- 206010028080 Mucocutaneous candidiasis Diseases 0.000 description 1
- 208000005647 Mumps Diseases 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 101000737895 Mytilus edulis Contraction-inhibiting peptide 1 Proteins 0.000 description 1
- 241000588652 Neisseria gonorrhoeae Species 0.000 description 1
- 241000588650 Neisseria meningitidis Species 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- 102000004473 OX40 Ligand Human genes 0.000 description 1
- 108010042215 OX40 Ligand Proteins 0.000 description 1
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 1
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 1
- 101710116435 Outer membrane protein Proteins 0.000 description 1
- 102100023472 P-selectin Human genes 0.000 description 1
- 241000721454 Pemphigus Species 0.000 description 1
- 101800005149 Peptide B Proteins 0.000 description 1
- 208000031845 Pernicious anaemia Diseases 0.000 description 1
- 201000005702 Pertussis Diseases 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 208000009362 Pneumococcal Pneumonia Diseases 0.000 description 1
- 206010035728 Pneumonia pneumococcal Diseases 0.000 description 1
- 208000000474 Poliomyelitis Diseases 0.000 description 1
- 229920002319 Poly(methyl acrylate) Polymers 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 208000012654 Primary biliary cholangitis Diseases 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 101710176177 Protein A56 Proteins 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 206010037742 Rabies Diseases 0.000 description 1
- 241000725643 Respiratory syncytial virus Species 0.000 description 1
- 208000025747 Rheumatic disease Diseases 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 101710173694 Short transient receptor potential channel 2 Proteins 0.000 description 1
- 208000021386 Sjogren Syndrome Diseases 0.000 description 1
- 240000006394 Sorghum bicolor Species 0.000 description 1
- 208000007156 Spondylarthritis Diseases 0.000 description 1
- 241001219481 Spongospora subterranea Species 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 238000000692 Student's t-test Methods 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 201000009594 Systemic Scleroderma Diseases 0.000 description 1
- 206010042953 Systemic sclerosis Diseases 0.000 description 1
- 206010043376 Tetanus Diseases 0.000 description 1
- 208000031981 Thrombocytopenic Idiopathic Purpura Diseases 0.000 description 1
- 108020004566 Transfer RNA Proteins 0.000 description 1
- 206010052779 Transplant rejections Diseases 0.000 description 1
- DOOTYTYQINUNNV-UHFFFAOYSA-N Triethyl citrate Chemical compound CCOC(=O)CC(O)(C(=O)OCC)CC(=O)OCC DOOTYTYQINUNNV-UHFFFAOYSA-N 0.000 description 1
- 208000006391 Type 1 Hyper-IgM Immunodeficiency Syndrome Diseases 0.000 description 1
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 1
- 208000037386 Typhoid Diseases 0.000 description 1
- 102000044159 Ubiquitin Human genes 0.000 description 1
- 108090000848 Ubiquitin Proteins 0.000 description 1
- 108010046334 Urease Proteins 0.000 description 1
- 208000024780 Urticaria Diseases 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 206010046851 Uveitis Diseases 0.000 description 1
- 241000700647 Variola virus Species 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 206010047400 Vibrio infections Diseases 0.000 description 1
- 108020005202 Viral DNA Proteins 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 206010047642 Vitiligo Diseases 0.000 description 1
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 1
- 208000006110 Wiskott-Aldrich syndrome Diseases 0.000 description 1
- 201000001696 X-linked hyper IgM syndrome Diseases 0.000 description 1
- 208000003152 Yellow Fever Diseases 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 150000001252 acrylic acid derivatives Chemical class 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000011149 active material Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 230000001476 alcoholic effect Effects 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 206010002022 amyloidosis Diseases 0.000 description 1
- 230000036783 anaphylactic response Effects 0.000 description 1
- 208000003455 anaphylaxis Diseases 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 230000006023 anti-tumor response Effects 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 230000005975 antitumor immune response Effects 0.000 description 1
- 239000008365 aqueous carrier Substances 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- IAOZJIPTCAWIRG-QWRGUYRKSA-N aspartame Chemical compound OC(=O)C[C@H](N)C(=O)N[C@H](C(=O)OC)CC1=CC=CC=C1 IAOZJIPTCAWIRG-QWRGUYRKSA-N 0.000 description 1
- 239000000605 aspartame Substances 0.000 description 1
- 235000010357 aspartame Nutrition 0.000 description 1
- 229960003438 aspartame Drugs 0.000 description 1
- 208000010668 atopic eczema Diseases 0.000 description 1
- 201000000448 autoimmune hemolytic anemia Diseases 0.000 description 1
- 239000003613 bile acid Substances 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 201000008275 breast carcinoma Diseases 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 235000019282 butylated hydroxyanisole Nutrition 0.000 description 1
- CZBZUDVBLSSABA-UHFFFAOYSA-N butylated hydroxyanisole Chemical compound COC1=CC=C(O)C(C(C)(C)C)=C1.COC1=CC=C(O)C=C1C(C)(C)C CZBZUDVBLSSABA-UHFFFAOYSA-N 0.000 description 1
- 229940043253 butylated hydroxyanisole Drugs 0.000 description 1
- 229910000019 calcium carbonate Inorganic materials 0.000 description 1
- BPKIGYQJPYCAOW-FFJTTWKXSA-I calcium;potassium;disodium;(2s)-2-hydroxypropanoate;dichloride;dihydroxide;hydrate Chemical compound O.[OH-].[OH-].[Na+].[Na+].[Cl-].[Cl-].[K+].[Ca+2].C[C@H](O)C([O-])=O BPKIGYQJPYCAOW-FFJTTWKXSA-I 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 229910052804 chromium Inorganic materials 0.000 description 1
- 239000011651 chromium Substances 0.000 description 1
- 239000013611 chromosomal DNA Substances 0.000 description 1
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 1
- 208000025302 chronic primary adrenal insufficiency Diseases 0.000 description 1
- 238000011260 co-administration Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 229960000913 crospovidone Drugs 0.000 description 1
- 229960003067 cystine Drugs 0.000 description 1
- 201000001981 dermatomyositis Diseases 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 229960000633 dextran sulfate Drugs 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 206010013023 diphtheria Diseases 0.000 description 1
- 229960003983 diphtheria toxoid Drugs 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 201000002491 encephalomyelitis Diseases 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 108010078428 env Gene Products Proteins 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- 210000003617 erythrocyte membrane Anatomy 0.000 description 1
- HQPMKSGTIOYHJT-UHFFFAOYSA-N ethane-1,2-diol;propane-1,2-diol Chemical compound OCCO.CC(O)CO HQPMKSGTIOYHJT-UHFFFAOYSA-N 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 239000012091 fetal bovine serum Substances 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 244000053095 fungal pathogen Species 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 150000002334 glycols Chemical class 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 210000002216 heart Anatomy 0.000 description 1
- 229940037467 helicobacter pylori Drugs 0.000 description 1
- 244000000013 helminth Species 0.000 description 1
- 239000000185 hemagglutinin Substances 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 208000005252 hepatitis A Diseases 0.000 description 1
- 208000002672 hepatitis B Diseases 0.000 description 1
- 102000043726 human CCL3 Human genes 0.000 description 1
- 239000000017 hydrogel Substances 0.000 description 1
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 1
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 1
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 1
- UFVKGYZPFZQRLF-UHFFFAOYSA-N hydroxypropyl methyl cellulose Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)O)C(CO)O1 UFVKGYZPFZQRLF-UHFFFAOYSA-N 0.000 description 1
- 208000026095 hyper-IgM syndrome type 1 Diseases 0.000 description 1
- 239000012729 immediate-release (IR) formulation Substances 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 206010025135 lupus erythematosus Diseases 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 239000000395 magnesium oxide Substances 0.000 description 1
- CPLXHLVBOLITMK-UHFFFAOYSA-N magnesium oxide Inorganic materials [Mg]=O CPLXHLVBOLITMK-UHFFFAOYSA-N 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- AXZKOIWUVFPNLO-UHFFFAOYSA-N magnesium;oxygen(2-) Chemical compound [O-2].[Mg+2] AXZKOIWUVFPNLO-UHFFFAOYSA-N 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 239000000693 micelle Substances 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 206010063344 microscopic polyangiitis Diseases 0.000 description 1
- 201000006417 multiple sclerosis Diseases 0.000 description 1
- 208000010805 mumps infectious disease Diseases 0.000 description 1
- 206010028417 myasthenia gravis Diseases 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 201000008383 nephritis Diseases 0.000 description 1
- 108091027963 non-coding RNA Proteins 0.000 description 1
- 102000042567 non-coding RNA Human genes 0.000 description 1
- 239000012457 nonaqueous media Substances 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 238000007899 nucleic acid hybridization Methods 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 150000002895 organic esters Chemical class 0.000 description 1
- 229960005030 other vaccine in atc Drugs 0.000 description 1
- 125000003566 oxetanyl group Chemical group 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 244000045947 parasite Species 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 102000013415 peroxidase activity proteins Human genes 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 239000004014 plasticizer Substances 0.000 description 1
- 229920001993 poloxamer 188 Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 201000006292 polyarteritis nodosa Diseases 0.000 description 1
- 239000004626 polylactic acid Substances 0.000 description 1
- 229920000193 polymethacrylate Polymers 0.000 description 1
- 208000005987 polymyositis Diseases 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 235000013809 polyvinylpolypyrrolidone Nutrition 0.000 description 1
- 229920000523 polyvinylpolypyrrolidone Polymers 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 229940116317 potato starch Drugs 0.000 description 1
- 229940069328 povidone Drugs 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 210000003314 quadriceps muscle Anatomy 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 229940100618 rectal suppository Drugs 0.000 description 1
- 239000006215 rectal suppository Substances 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- 206010039083 rhinitis Diseases 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 201000005404 rubella Diseases 0.000 description 1
- 235000019515 salmon Nutrition 0.000 description 1
- 210000003786 sclera Anatomy 0.000 description 1
- 208000010157 sclerosing cholangitis Diseases 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 235000012239 silicon dioxide Nutrition 0.000 description 1
- 229960001866 silicon dioxide Drugs 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229940083542 sodium Drugs 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 235000015424 sodium Nutrition 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- HRZFUMHJMZEROT-UHFFFAOYSA-L sodium disulfite Chemical compound [Na+].[Na+].[O-]S(=O)S([O-])(=O)=O HRZFUMHJMZEROT-UHFFFAOYSA-L 0.000 description 1
- 229940001584 sodium metabisulfite Drugs 0.000 description 1
- 235000010262 sodium metabisulphite Nutrition 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 239000008109 sodium starch glycolate Substances 0.000 description 1
- 229940079832 sodium starch glycolate Drugs 0.000 description 1
- 229920003109 sodium starch glycolate Polymers 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 210000004989 spleen cell Anatomy 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 208000022218 streptococcal pneumonia Diseases 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 229960000814 tetanus toxoid Drugs 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 208000016367 transient hypogammaglobulinemia of infancy Diseases 0.000 description 1
- 238000003146 transient transfection Methods 0.000 description 1
- 239000001069 triethyl citrate Substances 0.000 description 1
- VMYFZRTXGLUXMZ-UHFFFAOYSA-N triethyl citrate Natural products CCOC(=O)C(O)(C(=O)OCC)C(=O)OCC VMYFZRTXGLUXMZ-UHFFFAOYSA-N 0.000 description 1
- 235000013769 triethyl citrate Nutrition 0.000 description 1
- HRXKRNGNAMMEHJ-UHFFFAOYSA-K trisodium citrate Chemical compound [Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O HRXKRNGNAMMEHJ-UHFFFAOYSA-K 0.000 description 1
- 229940038773 trisodium citrate Drugs 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- 201000008827 tuberculosis Diseases 0.000 description 1
- 201000008297 typhoid fever Diseases 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 229940096973 urethral suppository Drugs 0.000 description 1
- 239000006217 urethral suppository Substances 0.000 description 1
- 238000002255 vaccination Methods 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55522—Cytokines; Lymphokines; Interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55522—Cytokines; Lymphokines; Interferons
- A61K2039/55527—Interleukins
- A61K2039/55533—IL-2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/58—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
- A61K2039/585—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6031—Proteins
- A61K2039/6068—Other bacterial proteins, e.g. OMP
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/55—Fusion polypeptide containing a fusion with a toxin, e.g. diphteria toxin
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- the present invention provides vaccines, compositions, and recombinant vectors comprising a gene or mRNA encoding an N-terminal fragment of an LLO protein and an antigen, either fused together or encoded separately, and provides methods of invoking CD4 + and/or CD8 + T cell- mediated immune responses against an antigen and impeding the growth of or shrinking tumors, comprising same.
- DNA vaccines offer many advantages relative to live vaccines. For example, DNA vaccines are relatively stable, can be easily prepared and harvested in large quantities, are relatively safe, and can be repeatedly administered without adverse effects.
- One of the concerns about DNA vaccines is their low immunogenicity. Methods for increasing the immunogenicity of DNA vaccines thus have the potential to contribute to the development of safe vaccines against a variety of infectious agents and cancers.
- the present invention provides vaccines, compositions, and recombinant vectors comprising a gene or mRNA encoding an N-terminal fragment of an LLO protein and an antigen, either fused together or encoded separately, and provides methods of invoking CD4 + and/or CD8 + T cell- mediated immune responses against an antigen and impeding the growth of or shrinking tumors, comprising same.
- the present invention provides a DNA vaccine, comprising a nucleotide molecule that encodes a fusion protein, comprising an N-terminal fragment of an Ii steriolysin (LLO) protein and an antigen.
- LLO Ii steriolysin
- the present invention provides a composition comprising a first plasmid encoding a fusion of an N-terminal fragment of an LLO protein to an antigen and a second plasmid.
- the antigen is a tumor antigen.
- the second plasmid encodes a cytokine.
- the second plasmid encodes an immune- stimulating molecule.
- the present invention provides a composition comprising a first plasmid encoding a fusion of an N-terminal fragment of an LLO protein to an HPV E7 protein and a second plasmid.
- the second plasmid encodes a cytokine.
- the second plasmid encodes an immune-stimulating molecule.
- the present invention provides a recombinant vector, the recombinant vector comprising a gene encoding an N-terminal fragment of an LLO protein and a gene encoding an antigen, wherein the gene encoding an N-terminal fragment of an LLO protein and the gene encoding an antigen are in separate open reading frames.
- the present invention provides a recombinant vector, the recombinant vector comprising a gene encoding an N-terminal fragment of an LLO protein and a gene encoding an HPV E7 protein, wherein the gene encoding an N-terminal fragment of an LLO protein and the gene encoding an HPV E7 protein are in separate open reading frames.
- the present invention provides a method of invoking a CD4 + T cell- mediated immune response against an antigen in a subject, comprising administering to the subject a composition of the present invention, thereby invoking a CD4 + T cell-mediated immune response against an antigen in a subject.
- the present invention provides a method of impeding a growth of an antigen-expressing tumor in a subject, comprising administering to the subject a composition of the present invention, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby impeding a growth of an antigen-expressing tumor in a subject.
- the present invention provides a method of reducing a size of an antigen-expressing tumor in a subject, comprising administering to the subject a composition of the present invention, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby reducing a size of an antigen-expressing tumor in a subject.
- the present invention provides a method of invoking a CD4 + T cell- mediated immune response against an antigen in a subject, comprising administering to the subject a recombinant vector, the recombinant vector comprising a first gene encoding an N-terminal fragment of an LLO protein and a second gene encoding a peptide comprising the antigen, wherein the first gene and the second gene are in separate open reading frames, thereby invoking a CD4 + T cell- mediated immune response against an antigen in a subject.
- the present invention provides a method of impeding a growth of an antigen-expressing tumor in a subject, comprising administering to the subject arecombinant vector, the recombinant vector comprising a first gene encoding an N-terminal fragment of an LLO protein and a second gene encoding a peptide comprising the antigen, wherein the first gene and the second gene are in separate open reading frames, whereby the recombinant vector elicits in the subject an immune response against the tumor antigen, thereby impeding a growth of an antigen-expressing tumor in a subject.
- the present invention provides a method of reducing a size of an antigen-expressing tumor in a subject, comprising administering to the subject arecombinant vector, the recombinant vector comprising a first gene encoding an N-terminal fragment of an LLO protein and a second gene encoding a peptide comprising the antigen, wherein the first gene and the second gene are in separate open reading frames, whereby the recombinant vector elicits in the subject an immune response against the tumor antigen, thereby reducing a size of an antigen-expressing tumor in a subject.
- the present invention provides a method of invoking a CD4 + T cell- mediated immune response against an antigen in a subject, comprising administering to the subject a composition comprising a first nucleotide molecule encoding an N-terminal fragment of an LLO protein and a second nucleotide molecule encoding a peptide comprising the antigen, thereby invoking a CD4 + T cell-mediated immune response against an antigen in a subject.
- the present invention provides a method of impeding a growth of an antigen-expressing tumor in a subject, comprising administering to the subject a composition comprising a first nucleotide molecule encoding an N-terminal fragment of an LLO protein and a second nucleotide molecule encoding a peptide comprising the antigen, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby impeding a growth of an antigen-expressing tumor in a subject.
- the present invention provides a method of reducing a size of an antigen-expressing tumor in a subject, comprising administering to the subject a composition comprising a first nucleotide molecule encoding an N-terminal fragment of an LLO protein and a second nucleotide molecule encoding a peptide comprising the antigen, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby reducing a size of an antigen-expressing tumor in a subject.
- the present invention provides a method of invoking a CD4 + T cell- mediated immune response against an antigen in a subject, comprising administering to the subject a composition comprising an N-terminal fragment of an LLO protein and a nucleotide molecule encoding a peptide comprising the antigen, thereby invoking a CD4 + T cell-mediated immune response against an antigen in a subject.
- the present invention provides a method of impeding a growth of an antigen-expressing tumor in a subject, comprising administering to the subject a composition comprising an N-terminal fragment of an LLO protein and a nucleotide molecule encoding a peptide comprising the antigen, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby impeding a growth of an antigen-expressing tumor in a subject.
- the present invention provides a method of reducing a size of an antigen-expressing tumor in a subject, comprising administering to the subject a composition comprising an N-terminal fragment of an LLO protein and a nucleotide molecule encoding a peptide comprising the antigen, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby reducing a size of an antigen-expressing tumor in a subject.
- FIG. 1 ⁇ LLO-E7 enhances E7-specific anti-tumor responses. Tumor measurements are shown only for the surviving mice at a given time point. Data are representative of two experiments with similar results.
- FIG. 1 ⁇ LLO-E7 enhances the induction of E7 tetramer 1" CD8 + T cells.
- C57BL/6 mice were immunized and boosted 9 days later with E7 + GM-CSF + MIP- l ⁇ plasmids or ⁇ LLO-E7 + GM-CSF + MIP-I ⁇ plasmids.
- Ex vivo splenocytes were stained with an H-2Db E7 tetramer, anti-CD8, and anti-CD62L. Population analyzed in the figure is CD8 + CD62L low .
- FIG. 3 Construction of thebicistronic message ⁇ LLO-IRES-E7 DNA vaccine.
- A Schematic representations of pcDNA3.1- ⁇ LLO-E7 variations used in experiments below. AU vectors express proteins under the control of the CMV promoter, except for pcDNAS.l- ⁇ LLO-IRES-E?, which also utilizes the IRES element derived from the MigRl vector to drive E7 expression.
- B RT-PCR demonstrates the expression of ⁇ LLO and E7 from the expression plasmid. RNA was isolated from the lysate of transiently transfected 293 FT cells 48 hrs following the transfection. RT-PCR of actin, ⁇ LLO and E7 mRNA was performed by using purified first strand synthesis product.
- FIG. 4 Anti-tumor immunity elicited by various ⁇ LLO +/- E7 constructs. Tumor measurements are shown only for the surviving mice at a given time point. Data from different experimental groups are plotted in two separate figures for clarity.
- the present invention provides vaccines, compositions, and recombinant vectors comprising a gene or mRNA encoding an N-terminal fragment of an LLO protein and an antigen, either fused together or encoded separately, and provides methods of invoking CD4 + and/or CD8 + T cell- mediated immune responses against an antigen and impeding the growth of or shrinking tumors, comprising same.
- the present invention provides a DNA vaccine, comprising a nucleotide molecule that encodes a fusion protein, comprising an N-terminal fragment of an listeriolysin (LLO) protein and an antigen.
- LLO listeriolysin
- the present invention provides a composition comprising a first plasmid encoding a fusion of an N-terminal fragment of an LLO protein to an antigen and a second plasmid.
- the antigen is a tumor antigen.
- the second plasmid encodes a cytokine.
- the second plasmid encodes an immune- stimulating molecule.
- the present invention provides a composition comprising a first plasmid encoding a fusion of an N-terminal fragment of an LLO protein to an HPV E7 protein and a second plasmid.
- the second plasmid encodes a cytokine.
- the second plasmid encodes an immune-stimulating molecule.
- the HPV E7 protein is an HPV- 16 E7 protein.
- the present invention provides a recombinant vector, the recombinant vector comprising a gene encoding an N-terminal fragment of an LLO protein and a gene encoding an antigen, wherein the gene encoding an N-terminal fragment of an LLO protein and the gene encoding an antigen are in separate open reading frames.
- the present invention provides a recombinant vector, the recombinant vector comprising a gene encoding an N-terminal fragment of an LLO protein and a gene encoding an HPV E7 protein, wherein the gene encoding an N-terminal fragment of an LLO protein and the gene encoding an HPV E7 protein are in separate open reading frames.
- the HPV E7 protein is an HPV- 16 E7 protein.
- a plasmid encoding a fusion of the E7 antigen to a fragment of LLO induced significant anti-tumor immune responses (Example 1), including CD8 + T cells (Examples 2 and 4).
- fusion of E7 to a fragment of LLO and co-administration with plasmids encoding a cytokine or immune-stimulating molecule are effective methods of improving the antigenicity of E7 DNA vaccines.
- findings of the present invention demonstrate that LLO-encoding DNA enhances the immunogenicity of DNA vaccines, even when it is not on the same plasmid/nucleotide molecule, or not in the same open reading frame, as the gene encoding the antigen (Example 3).
- CD4 + T cells resulted in a reduction of the number of IFN- ⁇ secreting- cells to background levels for each vaccine group, indicating that the E7-specific CD4 + T cells were induced, and that the IFN- ⁇ secreting-cells detected by ELISPOT, using whole E7 protein as antigen, were CD4 + T cells (Example 5).
- the CD4 + T cells were ThI T cells (Example 6).
- the cytokine utilized in methods and compositions of the present invention is granulocyte macrophage colony stimulating factor (GM-CSF).
- the cytokine is macrophage inflammatory protein- l ⁇ (MIP- l ⁇ ).
- the cytokine is interleukin (IL)-12.
- the cytokine is IL-2.
- the cytokine is IL-15.
- the cytokine is MIP-3 ⁇ .
- the cytokine is MIP-3 ⁇ .
- the cytokine is a chemokine.
- the cytokine is tumor necrosis factor (TNF)- ⁇ .
- the cytokine is any other immunogenic cytokine known in the art.
- an immune- stimulating molecule is utilized in a method of the present invention.
- the immune-stimulating molecule is fms-like tyrosine kinase 3 ligand (Flt3L).
- the immune-stimulating molecule is Fas.
- the immune- stimulating molecule is OX40L.
- the immune-stimulating molecule is secondary lymphoid tissue chemokine (SLC).
- the immune-stimulating molecule is any other immune-stimulating molecule known in the art.
- Each of the above cytokines and immune-stimulating molecules represents a separate embodiment of the present invention.
- a composition comprises one or more plasmids encoding a combination of two of the above cytokines and/or immune-stimulating molecules.
- the plasmid(s) encode a combination of more than 2 of the above cytokines and/or immune-stimulating molecules.
- the combination comprises GM-CSF.
- the combination comprises MIP- l ⁇ .
- the combination comprises GM-CSF and MIP- l ⁇ .
- the present invention provides a vaccine comprising a composition of the present invention.
- the present invention provides a vaccine comprising a recombinant vector of the present invention.
- the present invention provides an immunogenic composition comprising a recombinant vector of the present invention.
- the present invention provides a vaccine comprising the immunogenic composition.
- the LLO utilized in methods and compositions of the present invention is, in another embodiment, a Listeria LLO.
- the Listeria from which the LLO is derived is Listeria monocytogenes (LM).
- the Listeria is Listeria ivanovii.
- the Listeria is Listeria welshimeri.
- the Listeria is Listeria seeligeri.
- the LLO protein is a non-Listerial LLO protein.
- the LLO protein has the sequence:
- the LLO protein has the nucleic acid sequence taacgacgataaagggacagcaggactagaataaagctataaagcaagcatataatattgcgtttcatctttagaagcgaatttcgccaatattataat tatcaaaagagaggggtggcaaacggtatttggcattattaggttaaaaaatgtagaaggagagtgaaacccatgaaaaaaataatgctagttttat tacacttatattagttagtctaccaattgcgcaacaaactgaagcaaaggatgcatctgcattcaataaagaaaattcaatttcatccatggcaccaccE gcatctccgctgcaagtcctaagacgccaatcgaaaagaaacacgcggatgaaatcgcggatgaaatg
- the full length active LLO protein is 504 residues long.
- the LLO protein has a sequence set forth in
- the LLO protein is a variant of an LLO protein.
- the LLO protein is a homologue of an LLO protein.
- truncated LLO or " ⁇ LLO” refers to a fragment of LLO that comprises the PEST-like domain.
- the terms refer to an LLO fragment that does not contain the activation domain at the amino terminus and does not include cystine 484.
- the LLO fragment consists of a PEST sequence.
- the LLO fragment comprises a PEST sequence.
- the LLO fragment consists of about the first 441 amino acids of the LLO protein.
- the LLO fragment is a non-hemolytic form of the LLO protein.
- the LLO fragment comprises a signal sequence from LLO.
- the PEST-like domain referred to above has the sequence:
- KENSISSMAPPASPPASPKTPIEKKHADEIDK SEQ ID NO: 3
- the PEST-like domain is any other PEST-like domain known in the art. Each possibility represents a separate embodiment of the present invention.
- the LLO fragment consists of about residues 1-25. In another embodiment, the LLO fragment consists of about residues 1-50. In another embodiment, the LLO fragment consists of about residues 1-75. In another embodiment, the LLO fragment consists of about residues 1-100. In another embodiment, the LLO fragment consists of about residues 1-125. In another embodiment, the LLO fragment consists of about residues 1-150. In another embodiment, the LLO fragment consists of about residues 1175. In another embodiment, the LLO fragment consists of about residues 1-200. In another embodiment, the LLO fragment consists of about residues 1-225. In another embodiment, the LLO fragment consists of about residues 1-250.
- the LLO fragment consists of about residues 1-275. In another embodiment, the LLO fragment consists of about residues 1-300. In another embodiment, the LLO fragment consists of about residues 1-325. In another embodiment, the LLO fragment consists of about residues 1-350. In another embodiment, the LLO fragment consists of about residues 1-375. In another embodiment, the LLO fragment consists of about residues 1 -400. In another embodiment, the LLO fragment consists of about residues 1-416. In another embodiment, the LLO fragment consists of residues 1-416. In another embodiment, the LLO fragment consists of about residues 1 -425. In another embodiment, the LLO fragment consists of about residues 1-441. In another embodiment, the LLO fragment consists of residues 1-441.
- the LLO fragment is a non-hemolytic LLO fragment.
- LLO proteins or fragments thereof represents a separate embodiment of the present invention.
- the term "antigen" as used herein refers, in another embodiment, to a protein expressed by a tumor cell. In another embodiment, the term refers to a protein expressed by an infectious agent. In another embodiment, the term refers to a fragment of a protein expressed by a tumor cell. In another embodiment, the term refers to a fragment of a protein expressed by an infectious agent. In another embodiment, the fragment is an immunogenic fragment. In another embodiment, the fragment contains one or more MHC class I epitopes. In another embodiment, the fragment contains one or more MHC class II epitopes. In another embodiment, the fragment is any other type of protein fragment known in the art. Each possibility represents a separate embodiment of the present invention.
- the antigen of methods and compositions of the present invention is a HPV E7 protein.
- the antigen is a Her-2 protein.
- the antigen is bcr/abl.
- the antigen is HPV E6
- the antigen is MZ2-E.
- the antigen is MAGE-I.
- the antigen is MUC-I .
- the antigen is NY/ESO-1.
- the antigen is Wilms tumor antigen.
- the antigen is telomerase.
- the antigen is Proteinase 3.
- the antigen is Tyrosinase related protein 2.
- the antigen is HIV-I Gag protein. In another embodiment, the antigen is SIV-I Gag protein. In another embodiment, the antigen is HIV-I Env protein. In another embodiment, the antigen is any other tumor antigen known in the art. In another embodiment, the antigen is any other infectious disease antigen known in the art. Each possibility represents a separate embodiment of the present invention.
- the antigen is derived from a tumor or an infectious organism, including, but not limited to fungal pathogens, bacteria, parasites, helminths, viruses, and the like.
- the antigen is selected from tetanus toxoid, hemagglutinin molecules from influenza virus, diphtheria toxoid, HIV gpl20, HIV gag protein, IgA protease, insulin peptide B, Spongospora subterranea antigen, vibriose antigens, Salmonella antigens, pneumococcus antigens, respiratory syncytial virus antigens, Haemophilus influenza outer membrane proteins, Helicobacter pylori urease, Neisseria meningitidis pilins, N.
- gonorrhoeae pilins the melanoma-associated antigens (TRP-2, MAGE- 1 , MAGE-3 , gp- 100, tyrosinase, MART- 1 , HSP-70, beta-HCG), human papilloma virus antigens El and E2 from type HPV-16, -18, -31, -33, -35 or -45 human papilloma viruses, the tumor antigens CEA, the ras protein, mutated or otherwise, the p53 protein, mutated or otherwise, Mucl, or pSA.
- the antigen is an antigen associated with one of the following diseases; cholera, diphtheria, Haemophilus, hepatitis A, hepatitis B, influenza, measles, meningitis, mumps, pertussis, small pox, pneumococcal pneumonia, polio, rabies, rubella, tetanus, tuberculosis, typhoid, Varicella-zoster, whooping cough3 yellow fever, the immunogens and antigens from Addison's disease, allergies, anaphylaxis, Bruton's syndrome, cancer, including solid and blood borne tumors, eczema, Hashimoto's thyroiditis, polymyositis, dermatomyositis, type 1 diabetes mellitus, acquired immune deficiency syndrome, transplant rejection, such as kidney, heart, pancreas, lung, bone, and liver transplants, Graves' disease,
- the antigen is one of the following tumor antigens: a MAGE (Melanoma- Associated Antigen E) protein, e.g. MAGE 1, MAGE 2, MAGE 3, MAGE 4, a tyrosinase; a mutant ras protein; a mutant p53 protein; p97 melanoma antigen, a ras peptide or p53 peptide associated with advanced cancers; the HPV 16/18 antigens associated with cervical cancers, KLH antigen associated with breast carcinoma, CEA (carcinoembryonic antigen) associated with colorectal cancer, gplOO, a MARTl antigen associated with melanoma, or the PSA antigen associated with prostate cancer.
- the antigen of methods and compositions of the present invention is a HPV E7 protein.
- the HPV E7 protein is an HPV- 16 E7 protein.
- the E7 protein is from an HPV belonging to supergroup A.
- the HPV belongs to supergroup B.
- the HPV belongs to supergroup C.
- the HPV belongs to supergroup D.
- the HPV belongs to supergroup E.
- the E7 protein is from any HPV type known in the art (e.g. any of the 87 HPV types numbered HPV1-HPV-87).
- the E7 protein has the sequence:
- the E7 protein has one of the amino acid or nucleotide sequences set forth in GenBank Accession Number NC_001352, AB211993, NC_001354, X64086, X64084, X56147, X55965, NC_001691, AF536180, AF536179, AF534061, AF548023, AF472509, AF472508, AY044311, AY044310, AY044309, AY044308, AY044307, AY044306, AF293960, U40822, U22461, D50549, D50548, D50547, D50546 D10597, D50545, X05568, X04773, A16170, X64085, U31790, U31785, M75123, M38198, M26798, or M24215.
- methods and compositions of the present invention comprise a fragment of the antigen protein.
- the fragment consists of about one-third to one-half of the antigen protein.
- the fragment consists of about one-tenth to one-fifth thereof.
- the fragment consists of about one-fifth to one-fourth thereof.
- the fragment consists of about one-fourth to one-third thereof.
- the fragment consists of about one-third to one-half thereof.
- the fragment consists of about one-half to three quarters thereof.
- the fragment consists of about three quarters of the antigen protein.
- the fragment consists of about 5-10% thereof.
- the fragment consists of about 10-15% thereof. In another embodiment, the fragment consists of about 15-20% thereof. In another embodiment, the fragment consists of about 20-25% thereof. In another embodiment, the fragment consists of about 25-30% thereof. In another embodiment, the fragment consists of about 30-35% thereof. In another embodiment, the fragment consists of about 35-40% thereof. In another embodiment, the fragment consists of about 45-50% thereof. In another embodiment, the fragment consists of about 50-55% thereof. In another embodiment, the fragment consists of about 55-60% thereof. In another embodiment, the fragment consists of about 5-15% thereof. In another embodiment, the fragment consists of about 10-20% thereof. In another embodiment, the fragment consists of about 15-25% thereof.
- the fragment consists of about 20-30% thereof. In another embodiment, the fragment consists of about 25-35% thereof. In another embodiment, the fragment consists of about 30-40% thereof. In another embodiment, the fragment consists of about 35-45% thereof. In another embodiment, the fragment consists of about 45-55% thereof. In another embodiment, the fragment consists of about 50-60% thereof. In another embodiment, the fragment consists of about 55-65% thereof. In another embodiment, the fragment consists of about 60-70% thereof. In another embodiment, the fragment consists of about 65-75% thereof. In another embodiment, the fragment consists of about 70-80% thereof. In another embodiment, the fragment consists of about 5-20% thereof. In another embodiment, the fragment consists of about 10-25% thereof.
- the fragment consists of about 15-30% thereof. In another embodiment, the fragment consists of about 20-35% thereof. In another embodiment, the fragment consists of about 25-40% thereof. In another embodiment, the fragment consists of about 30-45% thereof. In another embodiment, the fragment consists of about 35-50% thereof. In another embodiment, the fragment consists of about 45-60% thereof. In another embodiment, the fragment consists of about 50-65% thereof. In another embodiment, the fragment consists of about 55-70% thereof. In another embodiment, the fragment consists of about 60-75% thereof. In another embodiment, the fragment consists of about 65-80% thereof. In another embodiment, the fragment consists of about 70-85% thereof. In another embodiment, the fragment consists of about 75-90% thereof.
- the fragment consists of about 80-95% thereof. In another embodiment, the fragment consists of about 85-100% thereof. In another embodiment, the fragment consists of about 5-25% thereof. In another embodiment, the fragment consists of about 10-30% thereof. In another embodiment, the fragment consists of about 15-35% thereof. In another embodiment, the fragment consists of about 20-40% thereof. In another embodiment, the fragment consists of about 30-50% thereof. In another embodiment, the fragment consists of about 40-60% thereof. In another embodiment, the fragment consists of about 50-70% thereof. In another embodiment, the fragment consists of about 60-80% thereof. In another embodiment, the fragment consists of about 70-90% thereof. In another embodiment, the fragment consists of about 80-100% thereof.
- the fragment consists of about 5-35% thereof. In another embodiment, the fragment consists of about 10-40% thereof. In another embodiment, the fragment consists of about 15-45% thereof. In another embodiment, the fragment consists of about 20-50% thereof. In another embodiment, the fragment consists of about 30-60% thereof. In another embodiment, the fragment consists of about 40-70% thereof. In another embodiment, the fragment consists of about 50-80% thereof. In another embodiment, the fragment consists of about 60-90% thereof. In another embodiment, the fragment consists of about 70-100% thereof. In another embodiment, the fragment consists of about 5-45% thereof. In another embodiment, the fragment consists of about 10-50% thereof. In another embodiment, the fragment consists of about 20-60% thereof.
- the fragment consists of about 30-70% thereof. In another embodiment, the fragment consists of about 40-80% thereof. In another embodiment, the fragment consists of about 50-90% thereof. In another embodiment, the fragment consists of about 60-100% thereof. In another embodiment, the fragment consists of about 5-55% thereof. In another embodiment, the fragment consists of about 10-60% thereof. In another embodiment, the fragment consists of about 20-70% thereof. In another embodiment, the fragment consists of about 30-80% thereof. In another embodiment, the fragment consists of about 40-90% thereof. In another embodiment, the fragment consists of about 50-100% thereof. In another embodiment, the fragment consists of about 5-65% thereof. In another embodiment, the fragment consists of about 10-70% thereof.
- the fragment consists of about 20-80% thereof. In another embodiment, the fragment consists of about 30-90% thereof. In another embodiment, the fragment consists of about 40-100% thereof. In another embodiment, the fragment consists of about 5-75% thereof. In another embodiment, the fragment consists of about 10-80% thereof. In another embodiment, the fragment consists of about 20-90% thereof. In another embodiment, the fragment consists of about 30-100% thereof. In another embodiment, the fragment consists of about 10-90% thereof. In another embodiment, the fragment consists of about 20-100% thereof. In another embodiment, the fragment consists of about 10-100% thereof.
- the fragment consists of about 5% of the antigen protein. In another embodiment, the fragment consists of about 6% thereof. In another embodiment, the fragment consists of about 8% thereof. In another embodiment, the fragment consists of about 10% thereof. In another embodiment, the fragment consists of about 12% thereof. In another embodiment, the fragment consists of about 15% thereof. In another embodiment, the fragment consists of about 18% thereof. In another embodiment, the fragment consists of about 20% thereof. In another embodiment, the fragment consists of about 25% thereof. In another embodiment, the fragment consists of about 30% thereof. In another embodiment, the fragment consists of about 35% thereof. In another embodiment, the fragment consists of about 40% thereof. In another embodiment, the fragment consists of about 45% thereof.
- the fragment consists of about 50% thereof. In another embodiment, the fragment consists of about 55% thereof. In another embodiment, the fragment consists of about 60% thereof. In another embodiment, the fragment consists of about 65% thereof. In another embodiment, the fragment consists of about 70% thereof. In another embodiment, the fragment consists of about 75% thereof. In another embodiment, the fragment consists of about 80% thereof. In another embodiment, the fragment consists of about 85% thereof. In another embodiment, the fragment consists of about 90% thereof. In another embodiment, the fragment consists of about 95% thereof. In another embodiment, the fragment consists of about 100% thereof. Each possibility represents a separate embodiment of the present invention.
- the fragment is a fragment of the extracellular domain of the antigen protein. In another embodiment, the fragment is from about one-third to one-half of the extracellular domain. In another embodiment, the fragment of the extracellular domain is any of the amounts, fractions, or ranges listed above'for the entire antigen protein. Each possibility represents a separate embodiment of the present invention.
- the fragment is a fragment of the intracellular domain of the antigen protein. In another embodiment, the fragment is from about one-third to one-half of the intracellular domain. In another embodiment, the fragment of the intracellular domain is any of the amounts, fractions, or ranges listed above for the entire antigen protein. Each possibility represents a separate embodiment of the present invention.
- the present invention provides a method of invoking a CD4 + T cell- mediated immune response against an antigen in a subject, comprising administering to the subject a composition of the present invention, thereby invoking a CD4 + T cell-mediated immune response against an antigen in a subject.
- the present invention provides a method of impeding a growth of an antigen-expressing tumor in a subject, comprising administering to the subject a composition of the present invention, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby impeding a growth of an antigen-expressing tumor in a subject.
- the present invention provides a method of reducing a size of an antigen-expressing tumor in a subject, comprising administering to the subject a composition of the present invention, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby reducing a size of an antigen-expressing tumor in a subject.
- the present invention provides a method of invoking a CD4 + T cell- mediated immune response against an antigen in a subject, comprising administering to the subject a recombinant vector, the recombinant vector comprising a first gene encoding an N-terminal fragment of an LLO protein and a second gene encoding a peptide comprising the antigen, wherein the first gene and the second gene are in separate open reading frames, thereby invoking a CD4 + T cell- mediated immune response against an antigen in a subject.
- the present invention provides a method of impeding a growth of an antigen-expressing tumor in a subject, comprising administering to the subject a recombinant vector, the recombinant vector comprising a first gene encoding an N-terminal fragment of an LLO protein and a second gene encoding a peptide comprising the antigen, wherein the first gene and the second gene are in separate open reading frames, whereby the recombinant vector elicits in the subject an immune response against the tumor antigen, thereby impeding a growth of an antigen-expressing tumor in a subject.
- the present invention provides a method of reducing a size of an antigen-expressing tumor in a subject, comprising administering to the subject a recombinant vector, the recombinant vector comprising a first gene encoding an N-terminal fragment of an LLO protein and a second gene encoding a peptide comprising the antigen, wherein the first gene and the second gene are in separate open reading frames, whereby the recombinant vector elicits in the subject an immune response against the tumor antigen, thereby reducing a size of an antigen-expressing tumor in a subject.
- the present invention provides a method of invoking a CD4 + T cell- mediated immune response against an antigen in a subject, comprising administering to the subject a composition comprising a first nucleotide molecule encoding an N-terminal fragment of an LLO protein and a second nucleotide molecule encoding a peptide comprising the antigen, thereby invoking a CD4 + T cell-mediated immune response against an antigen in a subject.
- the present invention provides a method of impeding a growth of an antigen-expressing tumor in a subject, comprising administering to the subject a composition comprising a first nucleotide molecule encoding an N-terminal fragment of an LLO protein and a second nucleotide molecule encoding a peptide comprising the antigen, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby impeding a growth of an antigen-expressing tumor in a subject.
- the present invention provides a method of reducing a size of an antigen-expressing tumor in a subject, comprising administering to the subject a composition comprising a first nucleotide molecule encoding an N-terminal fragment of an LLO protein and a second nucleotide molecule encoding a peptide comprising the antigen, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby reducing a size of an antigen-expressing tumor in a subject.
- the first nucleotide molecule of methods and compositions of the present invention is a recombinant plasmid.
- the first nucleotide molecule is a component of recombinant vector.
- the first nucleotide molecule is component of a DNA vaccine.
- the first nucleotide molecule is any other type of nucleotide molecule known in the art. Each possibility represents a separate embodiment of the present invention.
- the second nucleotide molecule of methods and compositions of the present invention is a recombinant plasmid.
- the second nucleotide molecule is a recombinant vector.
- the second nucleotide molecule is a DNA vaccine.
- the second nucleotide molecule is any other type of nucleotide molecule known in the art. Each possibility represents a separate embodiment of the present invention.
- the first of second nucleotide molecules of methods and compositions of the present invention can be, in other embodiments, any of the types of nucleotide, or deoxynucleotide molecules enumerated herein. Each possibility represents a separate embodiment of the present invention.
- the present invention provides a method of invoking a CD4 + T cell- mediated immune response against an antigen in a subject, comprising administering to the subject a composition comprising an N-terminal fragment of an LLO protein and a nucleotide molecule encoding a peptide comprising the antigen, thereby invoking a CD4 + T cell-mediated immune response against an antigen in a subject.
- the present invention provides a method of impeding a growth of an antigen-expressing tumor in a subject, comprising administering to the subject a composition comprising an N-terminal fragment of an LLO protein and a nucleotide molecule encoding a peptide comprising the antigen, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby impeding a growth of an antigen-expressing tumor in a subject.
- the present invention provides a method of reducing a size of an antigen-expressing tumor in a subject, comprising administering to the subject a composition comprising an N-terminal fragment of an LLO protein and a nucleotide molecule encoding a peptide comprising the antigen, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby reducing a size of an antigen-expressing tumor in a subject.
- the present invention provides a method of invoking a CD4 + T cell- mediated immune response against a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a composition of the present invention, thereby invoking a CD4 + T cell- mediated immune response against a HPV E7 protein-expressing tumor in a subject.
- the present invention provides a method of impeding a growth of a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a composition of the present invention, whereby the composition elicits in the subject an immune response against the HPV E7 protein, thereby impeding a growth of a HPV E7 protein-expressing tumor in a subject.
- the present invention provides a method of reducing a size of a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a composition of the present invention, whereby the composition elicits in the subject an immune response against the HPV E7 protein, thereby reducing a size of a HPV E7 protein-expressing tumor in a subject.
- the present invention provides a method of invoking a CD4 + T cell- mediated immune response against a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a recombinant vector, the recombinant vector comprising a first gene encoding an N-terminal fragment of an LLO protein and a second gene encoding the HPV E7 protein or a fragment thereof, wherein the first gene and the second gene are in separate open reading frames, thereby invoking a CD4 + T cell-mediated immune response against a HPV E7 protein- expressing tumor in a subject.
- the present invention provides a method of impeding a growth of a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a recombinant vector, the recombinant vector comprising a first gene encoding an N-terminal fragment of an LLO protein and a second gene encoding the HPV E7 protein or a fragment thereof, wherein the first gene and the second gene are in separate open reading frames, whereby the recombinant vector elicits in the subject an immune response against the HPV E7 protein, thereby impeding a growth of a HPV E7 protein-expressing tumor in a subject.
- the present invention provides a method of reducing a size of a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a recombinant vector, the recombinant vector comprising a first gene encoding an N-terminal fragment of an LLO protein and a second gene encoding the HPV E7 protein or a fragment thereof, wherein the first gene and the second gene are in separate open reading frames, whereby the recombinant vector elicits in the subject an immune response against the HPV E7 protein-expressing tumor, thereby reducing a size of a HPV E7 protein-expressing tumor in a subject.
- the present invention provides a method of invoking a CD4 + T cell- mediated immune response against a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a composition comprising a first nucleotide molecule encoding an N- terminal fragment of an LLO protein and a second nucleotide molecule encoding the HPV E7 protein or a fragment thereof, thereby invoking a CD4 + T cell-mediated immune response against a HPV E7 protein-expressing tumor in a subject.
- the present invention provides a method of impeding a growth of a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a composition comprising a first nucleotide molecule encoding an N-terminal fragment of an LLO protein and a second nucleotide molecule encoding the HPV E7 protein or a fragment thereof, whereby the composition elicits in the subject an immune response against the HPV E7 protein- expressing tumor, thereby impeding a growth of a HPV E7 protein-expressing tumor in a subject.
- the present invention provides a method of reducing a size of a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a composition comprising a first nucleotide molecule encoding an N-terminal fragment of an LLO protein and a second nucleotide molecule encoding the HPV E7 protein or a fragment thereof, whereby the composition elicits in the subject an immune response against the HPV E7 protein-expressing tumor, thereby reducing a size of a HPV E7 protein-expressing tumor in a subject.
- the present invention provides a method of invoking a CD4 + T cell- mediated immune response against a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a composition comprising an N-terminal fragment of an LLO protein and a nucleotide molecule encoding the HPV E7 protein or a fragment thereof, thereby invoking a CD4 + T cell-mediated immune response against a HPV E7 protein-expressing tumor in a subject.
- the present invention provides a method of impeding a growth of a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a composition comprising an N-terminal fragment of an LLO protein and a nucleotide molecule encoding the HPV E7 protein or a fragment thereof, whereby the composition elicits in the subject an immune response against the HPV E7 protein-expressing tumor, thereby impeding a growth of a HPV E7 protein-expressing tumor in a subject.
- the present invention provides a method of reducing a size of a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a composition comprising an N-terminal fragment of an LLO protein and a nucleotide molecule encoding the HPV E7 protein or a fragment thereof, whereby the composition elicits in the subject an immune response against the HPV E7 protein-expressing tumor, thereby reducing a size of a HPV E7 protein- expressing tumor in a subject.
- the present invention provides a method for inducing or enhancing an MHC class II presentation of an antigen, comprising administering a composition or recombinant vector enumerated herein, thereby inducing or enhancing an MHC class II presentation of an antigen.
- the present invention provides a method for suppressing formation of tumors in a host, comprising administering a composition or recombinant vector enumerated herein, thereby suppressing formation of tumors in a host.
- the present invention provides a method of inducing formation and proliferation of human CTL, comprising administering a composition or recombinant vector enumerated herein, thereby inducing formation and proliferation of human CTL.
- the present invention provides a method of inducing formation of tumor infiltrating CTL, comprising administering a composition or recombinant vector enumerated herein, thereby inducing formation of tumor infiltrating CTL.
- compositions and recombinant vectors of any of the methods described above have any of the characteristics of a compositions or recombinant vector of the present invention. Each characteristic represents a separate embodiment of the present invention.
- a method of the present invention further comprises administering a plasmid encoding a cytokine or immune-stimulating molecule to the subject.
- the antigen-encoding plasmid or vector and cytokine/immune-stimulating molecule-encoding plasmid are administered as a mixture.
- the antigen-encoding plasmid or vector and cytokine/immune-stimulating molecule-encoding plasmid are administered at substantially the same site in the subject.
- the antigen-encoding plasmid or vector and cytokine/immune-stimulating molecule-encoding plasmid are administered to the subject at substantially the same time.
- the CD4 + T cell-mediated immune response that is induced by methods and compositions of the present invention is, in another embodiment, predominantly a ThI CD4 + T cell-mediated response.
- the CD4 + T cell-mediated immune response is entirely a ThI CLM + T cell-mediated response.
- the immune response is at least 60% ThI CD4 + T cell-mediated.
- the immune response is at least 70% ThI CD4 + T cell- mediated.
- the immune response is at least 80% ThI CD4 + T cell-mediated.
- the immune response is at least 90% ThI CD4 + T cell-mediated.
- the immune response is at least 95% ThI CD4 + T cell-mediated.
- the immune response is more than 60% ThI CD4 + T cell-mediated. In another embodiment, the immune response is more than 70% ThI CD4 + T cell-mediated. In another embodiment, the immune response is more than 80% ThI CD4 + T cell-mediated. In another embodiment, the immune response is more than 90% ThI CD4 + T cell-mediated. In another embodiment, the immune response is more than 95% ThI CD4 + T cell-mediated. In another embodiment, no antigen-specific Th2 CD4 + T cell response is detectable by one of the standard detection methods enumerated herein. Each possibility represents a separate embodiment of the present invention.
- the immune response elicited by methods and compositions of the present invention comprises a CD8 + T cell-mediated response.
- the immune response consists predominantly of a CD8 + T cell-mediated response.
- the immune response is at least 60% CD8 + T cell-mediated.
- the immune response is at least 70% CD8 + T cell-mediated.
- the immune response is at least 80% CD8 + T cell-mediated.
- the immune response is at least 90% CD8 + T cell-mediated.
- the immune response is at least 95% CD8 + T cell-mediated.
- the immune response is more than 60% CD8 + T cell-mediated.
- the immune response is more than 70% CD8 + T cell-mediated. In another embodiment, the immune response is more than 80% CD8 + T cell-mediated. In another embodiment, the immune response is more than 90% CD8 + T cell-mediated. In another embodiment, the immune response is more than 95% CD8 + T cell-mediated. In another embodiment, the only detectable component of the immune response is a CD8 + T cell-mediated response.
- the immune response elicited by methods and compositions of the present invention comprises a CD4 + T cell-mediated response.
- the immune response consists primarily of a CD4 + T cell-mediated response.
- the immune response is at least 60% CD4 + T cell-mediated.
- the immune response is at least 70% CD4 + T cell-mediated.
- the immune response is at least 80% CD4 + T cell-mediated.
- the immune response is at least 90% CD4 + T cell-mediated.
- the immune response is at least 95% CD4 + T cell-mediated.
- the immune response is more than 60% CD4 + T cell-mediated.
- the immune response is more than 70% CD4 + T cell-mediated. In another embodiment, the immune response is more than 80% CD4 + T cell-mediated. In another embodiment, the immune response is more than 90% CD4 + T cell-mediated. In another embodiment, the immune response is more than 95% CD4 + T cell-mediated. In another embodiment, the only detectable component of the immune response is a CD4 + T cell-mediated response.
- the CD4 + T cell-mediated response is accompanied by a measurable antibody response against the antigen. In another embodiment, the CD4 + T cell-mediated response is not accompanied by a measurable antibody response against the antigen.
- the immune response elicited by methods and compositions of the present invention contains both a CD8 + T cell and CD4 + T cell-mediated responses.
- the dosage is 1 microgram (mcg)/dose. In another embodiment, the dosage is 1.5 meg/dose. In another embodiment, the dosage is 2 meg/dose. In another embodiment, the dosage is 3 meg/dose. In another embodiment, the dosage is 4 meg/dose. In another embodiment, the dosage is 6 meg/dose. In another embodiment, the dosage is 8 meg/dose. In another embodiment, the dosage is 10 meg/dose. In another embodiment, the dosage is 15 meg/dose. In another embodiment, the dosage is 20 meg/dose. In another embodiment, the dosage is 30 meg/dose. In another embodiment, the dosage is 40 meg/dose.
- the dosage is 60 meg/dose. In another embodiment, the dosage is 80 meg/dose. In another embodiment, the dosage is 100 meg/dose. In another embodiment, the dosage is 150 meg/dose. In another embodiment, the dosage is 200 meg/dose. In another embodiment, the dosage is 300 meg/dose. In another embodiment, the dosage is 400 meg/dose. In another embodiment, the dosage is 600 meg/dose. In another embodiment, the dosage is 800 meg/dose. In another embodiment, the dosage is 1000 meg/dose. Each possibility represents a separate embodiment of the present invention.
- the antigen comprises a peptide recognized by cytotoxic T lymphocytes (CTL) after vaccination.
- CTL cytotoxic T lymphocytes
- the peptide is the same as an antigenic peptide recognized by an infected vertebrate.
- a method of the present invention comprises administration of a vaccine or compound directly to the subject that is being treated.
- the administration is to the cells of the subject ex vivo.
- the administration is to the cells of a donor ex vivo.
- the administration is to the cells of a donor in vivo, then the cells are transferred to the subject.
- Methods of measuring immune responses include, e.g. measuring suppression of tumor growth (Examples 1 and 3 herein), flow cytometry (FACS; Example 2), ELISPOT (Examples 4 and 5) antibody ELISA (Example 6), target cell lysis assays (e.g. chromium release assay), the use of tetramers, and others.
- FACS flow cytometry
- ELISPOT EnzySPOT
- antibody ELISA Example 6
- target cell lysis assays e.g. chromium release assay
- a treatment protocol of the present invention is therapeutic.
- the protocol is prophylactic.
- Each possibility represents a separate embodiment of the present invention.
- homology when in reference to any protein or peptide, refer, in another embodiment, to a percentage of amino acid residues in the candidate sequence that are identical with the residues of a corresponding native polypeptide, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent homology, and not considering any conservative substitutions as part of the sequence identity. Methods and computer programs for the alignment are well known in the art.
- Homology is, in another embodiment, determined by computer algorithm for sequence alignment, by methods well described in the art.
- computer algorithm analysis of nucleic acid sequence homology may include the utilization of any number of software packages available, such as, for example, the BLAST, DOMAIN, BEAUTY (BLAST Enhanced Alignment Utility), GENPEPT and TREMBL packages.
- “homology” refers to identity to a sequence selected from SEQ ID No: 1-3 of greater than 70%. In another embodiment, “homology” refers to identity to a sequence selected from SEQ ID No: 1-3 of greater than 72%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1-3 of greater than 75%. In another embodiment, “homology” refers to identity to a sequence selected from SEQ ID No: 1-3 of greater than 78%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1-3 of greater than 80%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1-3 of greater than 82%.
- “homology” refers to identity to a sequence selected from SEQ ID No: 1-3 of greater than 83%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1-3 of greater than 85%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1-3 of greater than 87%. In another embodiment, “homology” refers to identity to a sequence selected from SEQ ID No: 1-3 of greater than 88%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1-3 of greater than 90%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1-3 of greater than 92%.
- “homology” refers to identity to a sequence selected from SEQ ID No: 1-3 of greater than 93%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1-3 of greater than 95%. In another embodiment, “homology” refers to identity to a sequence selected from SEQ ID No: 1-3 of greater than 96%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1-3 of greater than 97%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1-3 of greater than 98%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1-3 of greater than 99%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1-3 of 100%.
- homology is determined is via determination of candidate sequence hybridization, methods of which are well described in the art (See, for example, “Nucleic Acid Hybridization” Hames, B. D., and Higgins S. J., Eds. (1985); Sambrook et al., 2001, Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Press, N.Y.; and Ausubel et al., 1989, Current Protocols in Molecular Biology, Green Publishing Associates and Wiley Interscience, N. Y).
- methods of hybridization may be carried out under moderate to stringent conditions, to the complement of a DNA encoding a native caspase peptide.
- Hybridization conditions being, for example, overnight incubation at 42 0 C in a solution comprising: 10-20 % formamide, 5 X SSC (150 mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH 7. 6), 5 X Denhardt's solution, 10 % dextran sulfate, and 20 ⁇ g/ml denatured, sheared salmon sperm DNA.
- nucleic acids refers to a string of at least two base-sugar-phosphate combinations.
- the term includes, in another embodiment, DNA and RNA.
- Nucleotides refers, in another embodiment, to the monomeric units of nucleic acid polymers.
- RNA may be, in another embodiment, in the form of a tRNA (transfer RNA), snRNA (small nuclear RNA), rRNA (ribosomal RNA), mRNA (messenger RNA), anti-sense RNA, small inhibitory RNA (siRNA), micro RNA (miRNA) and ribozymes.
- DNA may be in form of plasmid DNA, viral DNA, linear DNA, or chromosomal DNA or derivatives of these groups.
- these forms of DNA and RNA may be single, double, triple, or quadruple stranded.
- the term also includes, in another embodiment, artificial nucleic acids that may contain other types of backbones but the same bases.
- the artificial nucleic acid is aPNA (peptide nucleic acid).
- PNA contain peptide backbones and nucleotide bases and are able to bind, in another embodiment, to both DNA and RNA molecules.
- the nucleotide is oxetane modified. In another embodiment, the nucleotide is modified by replacement of one or more phosphodiester bonds with a phosphorothioate bond.
- the artificial nucleic acid contains any other variant of the phosphate backbone of native nucleic acids known in the art. The use of phosphothiorate nucleic acids and PNA are known to those skilled in the art, and are described in, for example, Neilsen PE, Curr Opin Struct Biol 9:353-57; and Raz NK et al Biochem Biophys Res Commun. 297 : 1075-84.
- nucleic acid derivative represents a separate embodiment of the present invention.
- Protein and/or peptide homology for any amino acid sequence listed herein is determined, in another embodiment, by methods well described in the art, including immunoblot analysis, or via computer algorithm analysis of amino acid sequences, utilizing any of a number of software packages available, via established methods. Some of these packages may include the FASTA, BLAST, MPsrch or Scanps packages, and may employ the use of the Smith and Waterman algorithms, and/or global/local or BLOCKS alignments for analysis, for example. Each method of determining homology represents a separate embodiment of the present invention.
- the promoter used to express the antigen peptides, cytokines, and immune-stimulating molecules can be, in other embodiments, any promoter known in art (e.g. the CMV promoter, the ubiquitin promoter, etc). Each promoter represents a separate embodiment of the present invention.
- the present invention provides a kit comprising a reagent utilized in performing a method of the present invention.
- the present invention provides a kit comprising a composition, tool, or instrument of the present invention.
- the vaccine, recombinant vector, or composition of the present invention can be, in other embodiments, administered to a subject by any method known to a person skilled in the art, such as parenterally, paracancerally, transmucosally, transdermally, intramuscularly, intravenously, intra- dermally, subcutaneously, intra-peritonealy, intra-ventricularly, intra-cranially, intra-vaginally or intra-tumorally.
- the vaccine, recombinant vector, or composition is administered orally, and is thus formulated in a form suitable for oral administration, i.e. as a solid or a liquid preparation.
- suitable solid oral formulations include tablets, capsules, pills, granules, pellets and the like.
- Suitable liquid oral formulations include solutions, suspensions, dispersions, emulsions, oils and the like.
- the active ingredient is formulated in a capsule.
- the compositions of the present invention comprise, in addition to the active compound and the inert carrier or diluent, a hard gelating capsule.
- the vaccine, recombinant vector, or composition is administered by intravenous, intra-arterial, or intra-muscular injection of a liquid preparation. Suitable liquid formulations include solutions, suspensions, dispersions, emulsions, oils and the like.
- the vaccine, recombinant vector, or composition is administered intravenously and are thus formulated in a form suitable for intravenous administration.
- the vaccine, recombinant vector, or composition is administered intra- arterially and is thus formulated in a form suitable for intra-arterial administration.
- the vaccine, recombinant vector, or composition is administered intra-muscularly and is thus formulated in a form suitable for intra-muscular administration.
- the vaccine, recombinant vector, or composition is administered as a suppository, for example a rectal suppository or a urethral suppository.
- the vaccine, recombinant vector, or composition is delivered in a vesicle, e.g. a liposome.
- solid carriers/diluents include, but are not limited to, a gum, a starch (e.g. corn starch, pregeletanized starch), a sugar (e.g., lactose, mannitol, sucrose, dextrose), a cellulosic material (e.g. microcrystalline cellulose), an acrylate (e.g. polymethylacrylate), calcium carbonate, magnesium oxide, talc, or mixtures thereof.
- a gum e.g. corn starch, pregeletanized starch
- a sugar e.g., lactose, mannitol, sucrose, dextrose
- a cellulosic material e.g. microcrystalline cellulose
- an acrylate e.g. polymethylacrylate
- pharmaceutically acceptable carriers for liquid formulations can be aqueous or non- aqueous solutions, suspensions, emulsions or oils.
- non-aqueous solvents are propylene glycol, polyethylene glycol, and injectable organic esters such as ethyl oleate.
- Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
- oils are those of petroleum, animal, vegetable, or synthetic origin, for example, peanut oil, soybean oil, mineral oil, olive oil, sunflower oil, and fish-liver oil.
- Parenteral vehicles for subcutaneous, intravenous, intraarterial, or intramuscular injection
- Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers such as those based on Ringer's dextrose, and the like.
- sterile liquids such as water and oils, with or without the addition of a surfactant and other pharmaceutically acceptable adjuvants.
- water, saline, aqueous dextrose and related sugar solutions, and glycols such as propylene glycols or polyethylene glycol are preferred liquid carriers, particularly for injectable solutions.
- oils are those of petroleum, animal, vegetable, or synthetic origin, for example, peanut oil, soybean oil, mineral oil, olive oil, sunflower oil, and fish-liver oil.
- compositions further comprise binders (e.g. acacia, cornstarch, gelatin, carbomer, ethyl cellulose, guar gum, hydroxypropyl cellulose, hydroxypropyl methyl cellulose, povidone), disintegrating agents (e.g.
- binders e.g. acacia, cornstarch, gelatin, carbomer, ethyl cellulose, guar gum, hydroxypropyl cellulose, hydroxypropyl methyl cellulose, povidone
- disintegrating agents e.g.
- cornstarch potato starch, alginic acid, silicon dioxide, croscarmelose sodium, crospovidone, guar gum, sodium starch glycolate), buffers (e.g., Tris-HCL, acetate, phosphate) of various pH and ionic strength, additives such as albumin or gelatin to prevent absorption to surfaces, detergents (e.g., Tween 20, Tween 80, Pluronic F68, bile acid salts), protease inhibitors, surfactants (e.g.
- sodium lauryl sulfate sodium lauryl sulfate
- permeation enhancers solubilizing agents (e.g., glycerol, polyethylene glycerol), anti-oxidants (e.g., ascorbic acid, sodium metabisulfite, butylated hydroxy anisole), stabilizers (e.g. hydroxypropyl cellulose, hyroxypropylmethyl cellulose), viscosity increasing agents(e.g. carbomer, colloidal silicon dioxide, ethyl cellulose, guar gum), sweeteners (e.g. aspartame, citric acid), preservatives (e.g., Thimerosal, benzyl alcohol, parabens), lubricants (e.g.
- stearic acid magnesium stearate, polyethylene glycol, sodium lauryl sulfate), flow-aids (e.g. colloidal silicon dioxide), plasticizers (e.g. diethyl phthalate, triethyl citrate), emulsifiers (e.g. carbomer, hydroxypropyl cellulose, sodium lauryl sulfate), polymer coatings (e.g., poloxamers or poloxamines), coating and film forming agents (e.g. ethyl cellulose, acrylates, polymethacrylates) and/or adjuvants.
- plasticizers e.g. diethyl phthalate, triethyl citrate
- emulsifiers e.g. carbomer, hydroxypropyl cellulose, sodium lauryl sulfate
- polymer coatings e.g., poloxamers or poloxamines
- coating and film forming agents e.g. ethyl cellulose
- the pharmaceutical compositions provided herein are controlled- release compositions, i.e. compositions in which the vaccine, recombinant vector, or composition compound is released over a period of time after administration.
- Controlled- or sustained-release compositions include formulation in lipophilic depots (e.g. fatty acids, waxes, oils).
- the composition is an immediate-release composition, i.e. a composition in which all of the vaccine, recombinant vector, or composition compound is released immediately after administration.
- compositions also include, in another embodiment, incorporation of the active material into or onto particulate preparations of polymeric compounds such as polylactic acid, polglycolic acid, hydrogels, etc, or onto liposomes, microemulsions, micelles, unilamellar or multilamellar vesicles, erythrocyte ghosts, or spheroplasts.)
- polymeric compounds such as polylactic acid, polglycolic acid, hydrogels, etc.
- liposomes such as polylactic acid, polglycolic acid, hydrogels, etc.
- Such compositions will influence the physical state, solubility, stability, rate of in vivo release, and rate of in vivo clearance.
- particulate compositions coated with polymers e.g. poloxamers or poloxamines
- polymers e.g. poloxamers or poloxamines
- administering refers to bringing a subject in contact with a vaccine, recombinant vector, or composition compound of the present invention.
- administration is accomplished in vitro, i.e. in a test tube.
- administration is accomplished in vivo, i.e. in cells or tissues of a living organism.
- the methods of the present invention comprise administering a vaccine, recombinant vector, or composition of the present invention as the sole active ingredient.
- methods that comprise administering the vaccine, recombinant vector, or composition in combination with one or more therapeutic agents are also encompassed within the scope of the present invention.
- EXAMPLE 1 FUSION OF ALLO TO E7 AND ADDITION OF CYTOKINE EXPRESSING PLASMIDS ENHANCE IMMUNITY ELICITED BY E7-EXPRESSING
- pGG-55 the source of the ⁇ LLO-E7 gene for the constructs, contains an hly- HPV 16 E7 fusion gene (including the hly promoter and the portion of hly encoding the first 441 amino acids of LLO; referred to below as " ⁇ LLO") fused to E7.
- ⁇ LLO hly- HPV 16 E7 fusion gene
- ⁇ LLO-E7 DNA encoding a fusion of ⁇ LLO to E7 was amplified from pGG55 by PCR using primers that introduced Nhe I and Not I restriction sites at the 5' and 3' ends of the amplified fragments, respectively.
- Amplified ⁇ LLO-E7 DNA was then cloned into the unique Nhe I and Not I cloning sites of the pcDNA3.1 (-) expression vector (Invitrogen, Carlsbad, CA) downstream of the cytomegalovirus promoter.
- pcDNA3.1- ⁇ LLO-IRES-E7 expressing ⁇ LLO and E7 as separate proteins, was generated from the ⁇ LLO-E7 -expressing parent plasmid by inserting a PCR-amplified IRES element into a unique Xho I site located between the ⁇ LLO and E7 elements.
- the IRES element was amplified from MIGRl, obtained from Dr. W. Pear (University of Pennsylvania).
- pcDNA3.1- ⁇ LLO expressing ⁇ LLO alone was generated from the same parent plasmid by excising the E7 element and inserting a linker encoding a stop codon (Figure 3A).
- Ability of these vectors to mediate transcription of the appropriate DNA elements was tested by transient transfection in 293FT cells and RT-PCR, which demonstrated recovery of mRNA specific for these constructs ( Figure 3B). Expression was also verified by Western blot, which showed the presence of ⁇ LLO protein of the appropriate molecular weight in cell Iy sates.
- pcDNA-E7 was obtained from Dr. T-C. Wu, The Johns Hopkins Medical Institutes, Baltimore, Maryland. The resulting plasmid expressed the proteins under control of the CMV promoter. E7 DNA was cloned into the unique BamHI and HindIII cloning sites of the pcDNA3.1(-).
- pcDNA-GM-CSF and pcDNA-MIP-l ⁇ were obtained from Dr. David Weiner, University of Pennsylvania, Philadelphia, Pennsylvania.
- Murine GM-CSF DNA was cloned into the unique EcoRI and Xbal cloning sites of the pcDNA3.1.
- Human MIP- 1 ⁇ DNA was cloned into the unique Kpnl and BamHI cloning sites of the pcDNA3.1.
- ⁇ LLO-E7 and E7 plasmids were purified by Puresin Inc. (Malvern, Pennsylvania). Plasmids ⁇ LLO-IRES-E7, ⁇ LLO, GM-CSF and MEP-l ⁇ were purified using Qiagen plasmid mega kits (Qiagen Sciences, Maryland). DNA concentration was determined by the A 260 . The presence of the insert was confirmed by restriction enzyme digestion and gel electrophoresis.
- TC-I cells were injected into C57BL/6 mice subcutaneously at a dose of 2 x 10 4 cells/mouse in the left flank. 3 and 10 days later, mice were injected intramuscularly with 50 ⁇ g each of plasmid(s). The shortest and longest surface diameters of the tumors were measured every 3 days with calipers. Mice were sacrificed if mean tumor diameter reached 20 mm; tumor diameters are shown only for the surviving mice. Splenocytes were harvested 7 or 9 days after the booster injection.
- a DNA vaccine expressing a fusion of E7 to a fragment of LLO is efficacious at inducing an immune response.
- the pcDNA3.1 - ⁇ LLO-E7 plasmid was modified to create constructs expressing either ⁇ LLO alone or ⁇ LLO and E7 from the same mRNA transcript, but in different open reading frames (using an internal ribosomal entry site (IRES).
- IRES internal ribosomal entry site
- ⁇ LLO-E7 induced complete tumor regression in 5/8 mice (62.5%), while both ⁇ LLO-IRES-E7 and the ⁇ LLO and E7 plasmids, administered together as a mixture, induced complete tumor regression in 3/8 mice (37.5%). Tumor regression was not observed in the other 5 groups ((a) no treatment (b) empty vector, (c) E7 alone, (d) ⁇ LLO alone and (e) ⁇ LLO + E7 plasmids, injected at separate sites [the opposite quadriceps muscles]; Figure 4).
- 96-well filtration plates (Millipore, Bedford, MA) were coated with 15 ⁇ g/ml rat anti-mouse IFN- ⁇ antibody (clone ANl 8, MABTECH, Mariemont, OH) in 100 ⁇ l of PBS. After overnight incubation at 4° C, the wells were washed and blocked with culture medium containing 10% fetal bovine serum. Splenocytes (I x 10 5 /well) were added to the wells along with 5 ⁇ g/ml of E7 protein or E7-specific H-2Db CTL epitope plus IL-2 (5 units (U)/ml) and were incubated at 37° C for 24 hrs.
- rat anti-mouse IFN- ⁇ antibody clone ANl 8, MABTECH, Mariemont, OH
- CD8 + cells (this Example) and CD4 + cells (following Example) were depleted using magnetic beads coated with magnetic beads coated with anti-CD8 or anti-CD4 monoclonal antibodies (Miltenyi Biotec, Auburn CA), respectively.
- mice were immunized and boosted 7 days later with 50 ⁇ g of the constructs described in the previous Example, mixed with GM-CSF and MIP-l ⁇ -expressing plasmids before injection.
- Splenocytes were harvested 7 days after boosting, were cultured with the E7-specific H-2Db CTL epitope peptide, RAHYNIVTF and EL-2 (5 U/rnl), and the number of E7-specific, IFN- ⁇ -producing CD8 + T cells was determined by ELISPOT.
- ⁇ LLO-E7 fusion DNA significantly enhanced IFN- ⁇ -producing CD8 + T cells (p ⁇ 0.01 compared to each of the other groups), while the other vaccines (E7, ⁇ LLO-IRES-E7 or a mixture of ⁇ LLO and E7) did not induce detectable numbers of IFN- ⁇ -producing CD8 + T cells compared to the ⁇ LLO control ( Figure 5).
- the other vaccines E7, ⁇ LLO-IRES-E7 or a mixture of ⁇ LLO and E7
- Figure 5 When CD8 + cells were depleted, using magnetic beads coated with anti- CD8 monoclonal antibodies, the numbers of IFN- ⁇ -secreting CD8 + T cells were significantly diminished in the ⁇ LLO-E7 mice, but were unchanged in the other groups.
- the IFN- ⁇ producing-cells induced by ⁇ LLO-E7 were CD8 + T cells.
- CD4 + and CD8 + T cells were depleted in separate samples prior to the assay. Depletion of CD8 + cells, leaving only the CD4 + antigen-specific cells, resulted in equal numbers of IFN- ⁇ secreting-cells between the three groups with the highest responses ( ⁇ LLO-IRES-E7, ⁇ LLO + E7 (mixed) and ⁇ LLO-E7).
- LLO fragments need not be fused to an antigen for elicitation of CD4 + T cell responses; rather, the LLO fragments may be either in the form of bicistronic message or administered on a separate plasmid/nucleotide molecule at the same site as the antigen.
- mice were immunized twice with empty vector, E7 or ⁇ LLO-E7 DNA, together with the GM-CSF and MIP-Ia plasmids. Blood was collected at day 14 after the boost and subjected to anti-E7 ELISA using 96-well plates coated with E7 protein. No anti-E7 IgG was detected in the sera of any vaccinated mice, while the positive control (a commercial anti-E7 monoclonal antibody) was well detected by the ELISA. Thus, the CD4 + T cells induced by ⁇ LLO-E7 were ThI CD4 + cells.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Medicinal Chemistry (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Virology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
The present invention provides vaccines, compositions, and recombinant vectors comprising a gene or mRNA encoding an N-terminal fragment of an LLO protein and an antigen, either fused together or encoded separately, and provides methods of invoking CD4+ and/or CD8+ T cell-mediated immune responses against an antigen and impeding the growth of or shrinking tumors, comprising same.
Description
LLO-ENCODING DNA/NUCLEIC ACID VACCINES AND METHODS COMPRISING
SAME
FIELD OF INVENTION
[0001] The present invention provides vaccines, compositions, and recombinant vectors comprising a gene or mRNA encoding an N-terminal fragment of an LLO protein and an antigen, either fused together or encoded separately, and provides methods of invoking CD4+ and/or CD8+ T cell- mediated immune responses against an antigen and impeding the growth of or shrinking tumors, comprising same.
BACKGROUND OF THE INVENTION
[0002] DNA vaccines offer many advantages relative to live vaccines. For example, DNA vaccines are relatively stable, can be easily prepared and harvested in large quantities, are relatively safe, and can be repeatedly administered without adverse effects. One of the concerns about DNA vaccines is their low immunogenicity. Methods for increasing the immunogenicity of DNA vaccines thus have the potential to contribute to the development of safe vaccines against a variety of infectious agents and cancers.
SUMMARY OF THE INVENTION
[0003] The present invention provides vaccines, compositions, and recombinant vectors comprising a gene or mRNA encoding an N-terminal fragment of an LLO protein and an antigen, either fused together or encoded separately, and provides methods of invoking CD4+ and/or CD8+ T cell- mediated immune responses against an antigen and impeding the growth of or shrinking tumors, comprising same.
[0004] In one embodiment, the present invention provides a DNA vaccine, comprising a nucleotide molecule that encodes a fusion protein, comprising an N-terminal fragment of an Ii steriolysin (LLO) protein and an antigen.
[0005] In another embodiment, the present invention provides a composition comprising a first plasmid encoding a fusion of an N-terminal fragment of an LLO protein to an antigen and a second plasmid. In another embodiment, the antigen is a tumor antigen. In another embodiment, the second
plasmid encodes a cytokine. In another embodiment, the second plasmid encodes an immune- stimulating molecule. Each possibility represents a separate embodiment of the present invention.
[0006] In another embodiment, the present invention provides a composition comprising a first plasmid encoding a fusion of an N-terminal fragment of an LLO protein to an HPV E7 protein and a second plasmid. In another embodiment, the second plasmid encodes a cytokine. In another embodiment, the second plasmid encodes an immune-stimulating molecule.
[0007] In another embodiment, the present invention provides a recombinant vector, the recombinant vector comprising a gene encoding an N-terminal fragment of an LLO protein and a gene encoding an antigen, wherein the gene encoding an N-terminal fragment of an LLO protein and the gene encoding an antigen are in separate open reading frames.
[0008] In another embodiment, the present invention provides a recombinant vector, the recombinant vector comprising a gene encoding an N-terminal fragment of an LLO protein and a gene encoding an HPV E7 protein, wherein the gene encoding an N-terminal fragment of an LLO protein and the gene encoding an HPV E7 protein are in separate open reading frames.
[0009] In another embodiment, the present invention provides a method of invoking a CD4+ T cell- mediated immune response against an antigen in a subject, comprising administering to the subject a composition of the present invention, thereby invoking a CD4+ T cell-mediated immune response against an antigen in a subject.
[00010] In another embodiment, the present invention provides a method of impeding a growth of an antigen-expressing tumor in a subject, comprising administering to the subject a composition of the present invention, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby impeding a growth of an antigen-expressing tumor in a subject.
[00011] In another embodiment, the present invention provides a method of reducing a size of an antigen-expressing tumor in a subject, comprising administering to the subject a composition of the present invention, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby reducing a size of an antigen-expressing tumor in a subject.
[00012] In another embodiment, the present invention provides a method of invoking a CD4+ T cell- mediated immune response against an antigen in a subject, comprising administering to the subject a
recombinant vector, the recombinant vector comprising a first gene encoding an N-terminal fragment of an LLO protein and a second gene encoding a peptide comprising the antigen, wherein the first gene and the second gene are in separate open reading frames, thereby invoking a CD4+ T cell- mediated immune response against an antigen in a subject.
[00013] In another embodiment, the present invention provides a method of impeding a growth of an antigen-expressing tumor in a subject, comprising administering to the subject arecombinant vector, the recombinant vector comprising a first gene encoding an N-terminal fragment of an LLO protein and a second gene encoding a peptide comprising the antigen, wherein the first gene and the second gene are in separate open reading frames, whereby the recombinant vector elicits in the subject an immune response against the tumor antigen, thereby impeding a growth of an antigen-expressing tumor in a subject.
[00014] In another embodiment, the present invention provides a method of reducing a size of an antigen-expressing tumor in a subject, comprising administering to the subject arecombinant vector, the recombinant vector comprising a first gene encoding an N-terminal fragment of an LLO protein and a second gene encoding a peptide comprising the antigen, wherein the first gene and the second gene are in separate open reading frames, whereby the recombinant vector elicits in the subject an immune response against the tumor antigen, thereby reducing a size of an antigen-expressing tumor in a subject.
[00015] In another embodiment, the present invention provides a method of invoking a CD4+ T cell- mediated immune response against an antigen in a subject, comprising administering to the subject a composition comprising a first nucleotide molecule encoding an N-terminal fragment of an LLO protein and a second nucleotide molecule encoding a peptide comprising the antigen, thereby invoking a CD4+ T cell-mediated immune response against an antigen in a subject.
[00016] In another embodiment, the present invention provides a method of impeding a growth of an antigen-expressing tumor in a subject, comprising administering to the subject a composition comprising a first nucleotide molecule encoding an N-terminal fragment of an LLO protein and a second nucleotide molecule encoding a peptide comprising the antigen, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby impeding a growth of an antigen-expressing tumor in a subject.
[00017] In another embodiment, the present invention provides a method of reducing a size of an antigen-expressing tumor in a subject, comprising administering to the subject a composition comprising a first nucleotide molecule encoding an N-terminal fragment of an LLO protein and a second nucleotide molecule encoding a peptide comprising the antigen, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby reducing a size of an antigen-expressing tumor in a subject.
[00018] In another embodiment, the present invention provides a method of invoking a CD4+ T cell- mediated immune response against an antigen in a subject, comprising administering to the subject a composition comprising an N-terminal fragment of an LLO protein and a nucleotide molecule encoding a peptide comprising the antigen, thereby invoking a CD4+ T cell-mediated immune response against an antigen in a subject.
[00019] In another embodiment, the present invention provides a method of impeding a growth of an antigen-expressing tumor in a subject, comprising administering to the subject a composition comprising an N-terminal fragment of an LLO protein and a nucleotide molecule encoding a peptide comprising the antigen, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby impeding a growth of an antigen-expressing tumor in a subject.
[00020] In another embodiment, the present invention provides a method of reducing a size of an antigen-expressing tumor in a subject, comprising administering to the subject a composition comprising an N-terminal fragment of an LLO protein and a nucleotide molecule encoding a peptide comprising the antigen, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby reducing a size of an antigen-expressing tumor in a subject.
BRIEF DESCRIPTION OF THE FIGURES
[00021] Figure 1. ΔLLO-E7 enhances E7-specific anti-tumor responses. Tumor measurements are shown only for the surviving mice at a given time point. Data are representative of two experiments with similar results.
[00022] Figure 2. ΔLLO-E7 enhances the induction of E7 tetramer1" CD8+ T cells. C57BL/6 mice were immunized and boosted 9 days later with E7 + GM-CSF + MIP- lα plasmids or ΔLLO-E7 + GM-CSF + MIP-I α plasmids. Ex vivo splenocytes were stained with an H-2Db E7 tetramer, anti-CD8, and
anti-CD62L. Population analyzed in the figure is CD8+CD62Llow.
[00023] Figure 3. Construction of thebicistronic message ΔLLO-IRES-E7 DNA vaccine. A. Schematic representations of pcDNA3.1-ΔLLO-E7 variations used in experiments below. AU vectors express proteins under the control of the CMV promoter, except for pcDNAS.l-ΔLLO-IRES-E?, which also utilizes the IRES element derived from the MigRl vector to drive E7 expression. B. RT-PCR demonstrates the expression of ΔLLO and E7 from the expression plasmid. RNA was isolated from the lysate of transiently transfected 293 FT cells 48 hrs following the transfection. RT-PCR of actin, ΔLLO and E7 mRNA was performed by using purified first strand synthesis product.
[00024] Figure 4. Anti-tumor immunity elicited by various ΔLLO +/- E7 constructs. Tumor measurements are shown only for the surviving mice at a given time point. Data from different experimental groups are plotted in two separate figures for clarity.
[00025] Figure 5. LLO-E7 induces an E7-specific CD8+ T cell response. Mice were immunized with the indicated vaccines, and the number of IFN-γ producing E7-specific CD8+ T cells determined by ELISpot. Spot numbers represent the mean of triplicates ± STD in each vaccinated group. Data are representative of two experiments with similar results.
[00026] Figure 6. Fusion of ΔLLO to E7 is not required to induce an E7-specific CD4+ T cell response. The spot numbers represent the mean of triplicates ± STD in each vaccinated group. Data are representative of three experiments with similar results.
DETAILED DESCRIPTION OF THE INVENTION
[00027] The present invention provides vaccines, compositions, and recombinant vectors comprising a gene or mRNA encoding an N-terminal fragment of an LLO protein and an antigen, either fused together or encoded separately, and provides methods of invoking CD4+ and/or CD8+ T cell- mediated immune responses against an antigen and impeding the growth of or shrinking tumors, comprising same.
[00028] In one embodiment, the present invention provides a DNA vaccine, comprising a nucleotide molecule that encodes a fusion protein, comprising an N-terminal fragment of an listeriolysin (LLO) protein and an antigen.
[00029] In another embodiment, the present invention provides a composition comprising a first plasmid encoding a fusion of an N-terminal fragment of an LLO protein to an antigen and a second plasmid. In another embodiment, the antigen is a tumor antigen. In another embodiment, the second plasmid encodes a cytokine. In another embodiment, the second plasmid encodes an immune- stimulating molecule. Each possibility represents a separate embodiment of the present invention.
[00030] In another embodiment, the present invention provides a composition comprising a first plasmid encoding a fusion of an N-terminal fragment of an LLO protein to an HPV E7 protein and a second plasmid. In another embodiment, the second plasmid encodes a cytokine. In another embodiment, the second plasmid encodes an immune-stimulating molecule. In another embodiment, the HPV E7 protein is an HPV- 16 E7 protein.
[00031] In another embodiment, the present invention provides a recombinant vector, the recombinant vector comprising a gene encoding an N-terminal fragment of an LLO protein and a gene encoding an antigen, wherein the gene encoding an N-terminal fragment of an LLO protein and the gene encoding an antigen are in separate open reading frames.
[00032] In another embodiment, the present invention provides a recombinant vector, the recombinant vector comprising a gene encoding an N-terminal fragment of an LLO protein and a gene encoding an HPV E7 protein, wherein the gene encoding an N-terminal fragment of an LLO protein and the gene encoding an HPV E7 protein are in separate open reading frames. In another embodiment, the HPV E7 protein is an HPV- 16 E7 protein.
[00033] As provided herein, a plasmid encoding a fusion of the E7 antigen to a fragment of LLO induced significant anti-tumor immune responses (Example 1), including CD8+ T cells (Examples 2 and 4). Thus, (a) fusion of E7 to a fragment of LLO and (b) co-administration with plasmids encoding a cytokine or immune-stimulating molecule are effective methods of improving the antigenicity of E7 DNA vaccines. In addition, findings of the present invention demonstrate that LLO-encoding DNA enhances the immunogenicity of DNA vaccines, even when it is not on the same plasmid/nucleotide molecule, or not in the same open reading frame, as the gene encoding the antigen (Example 3).
[00034] In addition, depletion of CD4+ cells resulted in a reduction of the number of IFN-γ secreting- cells to background levels for each vaccine group, indicating that the E7-specific CD4+ T cells were
induced, and that the IFN-γ secreting-cells detected by ELISPOT, using whole E7 protein as antigen, were CD4+ T cells (Example 5). The CD4+ T cells were ThI T cells (Example 6). These results show that LLO need not be fused to an antigen for elicitation of CD4+ T cell responses, and indeed can be administered at the same site on a separate plasmid/nucleotide molecule. However, when the CD8 peptide epitope was used as the antigen, depletion of CD8+ cells reduced the number of IFN-γ secreting-cells in the ΔLLO-E7 group only (Example 5). Thus, IFN-γ was produced by both CD4+ and CD8+ T cells in ΔLLO-E7 immunized mice in response to E7 stimulation.
[00035] In another embodiment, the cytokine utilized in methods and compositions of the present invention is granulocyte macrophage colony stimulating factor (GM-CSF). In another embodiment, the cytokine is macrophage inflammatory protein- lα (MIP- lα). In another embodiment, the cytokine is interleukin (IL)-12. In another embodiment, the cytokine is IL-2. In another embodiment, the cytokine is IL-15. In another embodiment, the cytokine is MIP-3α. In another embodiment, the cytokine is MIP-3β. In another embodiment, the cytokine is a chemokine. In another embodiment, the cytokine is tumor necrosis factor (TNF)-α. In another embodiment, the cytokine is any other immunogenic cytokine known in the art.
[00036] In another embodiment, an immune- stimulating molecule is utilized in a method of the present invention. In another embodiment, the immune-stimulating molecule is fms-like tyrosine kinase 3 ligand (Flt3L). In another embodiment, the immune-stimulating molecule is Fas. Each possibility represents a separate embodiment of the present invention. In another embodiment, the immune- stimulating molecule is OX40L. In another embodiment, the immune-stimulating molecule is secondary lymphoid tissue chemokine (SLC). In another embodiment, the immune-stimulating molecule is any other immune-stimulating molecule known in the art. Each of the above cytokines and immune-stimulating molecules represents a separate embodiment of the present invention.
[00037] In another embodiment, a composition comprises one or more plasmids encoding a combination of two of the above cytokines and/or immune-stimulating molecules. In another embodiment, the plasmid(s) encode a combination of more than 2 of the above cytokines and/or immune-stimulating molecules. In another embodiment, the combination comprises GM-CSF. In another embodiment, the combination comprises MIP- lα. In another embodiment, the combination
comprises GM-CSF and MIP- lα. Each possibility represents a separate embodiment of the present invention.
[00038] In another embodiment, the present invention provides a vaccine comprising a composition of the present invention.
[00039] In another embodiment, the present invention provides a vaccine comprising a recombinant vector of the present invention.
[00040] In another embodiment, the present invention provides an immunogenic composition comprising a recombinant vector of the present invention. In another embodiment, the present invention provides a vaccine comprising the immunogenic composition.
[00041] The LLO utilized in methods and compositions of the present invention is, in another embodiment, a Listeria LLO. In another embodiment, the Listeria from which the LLO is derived is Listeria monocytogenes (LM). In another embodiment, the Listeria is Listeria ivanovii. In another embodiment, the Listeria is Listeria welshimeri. In another embodiment, the Listeria is Listeria seeligeri. In another embodiment, the LLO protein is a non-Listerial LLO protein.
[00042] In another embodiment, the LLO protein has the sequence:
MKKMLVFITLILVSLPIAQQTEAKDASAFNKENSISSMAPP ASPPASPKTPIEKKHADEIDKY
IQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNAISSL
TYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNT
LVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKM
QEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGRQVYLKL
STNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGGSAKDEVQIIDGNLGDLRD]
LKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKINIDHSGGYVAQF
NISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPGNARNINVY AKECTGLAWEW
WRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKVDNPIE
(GenBank Accession No. P13128; SEQ ID NO: 1;
[00043] In another embodiment, the LLO protein has the nucleic acid sequence
taacgacgataaagggacagcaggactagaataaagctataaagcaagcatataatattgcgtttcatctttagaagcgaatttcgccaatattataat tatcaaaagagaggggtggcaaacggtatttggcattattaggttaaaaaatgtagaaggagagtgaaacccatgaaaaaaataatgctagtttttat tacacttatattagttagtctaccaattgcgcaacaaactgaagcaaaggatgcatctgcattcaataaagaaaattcaatttcatccatggcaccaccE gcatctccgcctgcaagtcctaagacgccaatcgaaaagaaacacgcggatgaaatcgataagtatatacaaggattggattacaataaaaacaat gtattagtataccacggagatgcagtgacaaatgtgccgccaagaaaaggttacaaagatggaaatgaatatattgttgtggagaaaaagaagaaa tccatcaatcaaaataatgcagacattcaagttgtgaatgcaatttcgagcctaacctatccaggtgctctcgtaaaagcgaattcggaattagtagaa aatcaaccagatgttctccctgtaaaacgtgattcattaacactcagcattgatttgccaggtatgactaatcaagacaataaaatcgttgtaaaaaatg ccactaaatcaaacgttaacaacgcagtaaatacattagtggaaagatggaatgaaaaatatgctcaagcttatccaaatgtaagtgcaaaaattgat tatgatgacgaaatggcttacagtgaatcacaattaattgcgaaatttggtacagcatttaaagctgtaaataatagcttgaatgtaaacttcggcgcaa tcagtgaagggaaaatgcaagaagaagtcattagttttaaacaaatttactataacgtgaatgttaatgaacctacaagaccttccagatttttcggcaa agctgttactaaagagcagttgcaagcgcttggagtgaatgcagaaaatcctcctgcatatatctcaagtgtggcgtatggccgtcaagtttatttgaa attatcaactaattcccatagtactaaagtaaaagctgcttttgatgctgccgtaagcggaaaatctgtctcaggtgatgtagaactaacaaatatcatc aaaaattcttccttcaaagccgtaatttacggaggttccgcaaaagatgaagttcaaatcatcgacggcaacctcggagacttacgcgatattttgaa aaaaggcgctacttttaatcgagaaacaccaggagttcccattgcttatacaacaaacttcctaaaagacaatgaattagctgttattaaaaacaactc agaatatattgaaacaacttcaaaagcttatacagatggaaaaattaacatcgatcactctggaggatacgttgctcaattcaacatttcttgggatgaa gtaaattatgatcctgaaggtaacgaaattgttcaacataaaaactggagcgaaaacaataaaagcaagctagctcatttcacatcgtccatctatttg ccaggtaacgcgagaaatattaatgtttacgctaaagaatgcactggtttagcttgggaatggtggagaacggtaattgatgaccggaacttaccac ttgtgaaaaatagaaatatctccatctggggcaccacgctttatccgaaatatagtaataaagtagataatccaatcgaataattgtaaaagtaataaaa aattaagaataaaaccgcttaacacacacgaaaaaataagcttgttttgcactcttcgtaaattattttgtgaagaatgtagaaacaggcttattttttaatt tttttagaagaattaacaaatgtaaaagaatatctgactgtttatccatataatataagcatatcccaaagtttaagccacctatagtttctactgcaaaac gtataatttagttcccacatatactaaaaaacgtgtccttaactctctctgtcagattagttgta SEQ ID NO: 2). The first 25 amino acids of the proprotein corresponding to this sequence are the signal sequence and are cleaved from
LLO when it is secreted by the bacterium. Thus, in this embodiment, the full length active LLO protein is 504 residues long. In other embodiments, the LLO protein has a sequence set forth in
GenBank Accession No. DQ054588, DQ054589, AY878649, U25452, or U25452. In another embodiment, the LLO protein is a variant of an LLO protein. In another embodiment, the LLO protein is a homologue of an LLO protein. Each possibility represents a separate embodiment of the present invention.
[00044] In another embodiment, "truncated LLO" or "ΔLLO" refers to a fragment of LLO that comprises the PEST-like domain. In another embodiment, the terms refer to an LLO fragment that does not contain the activation domain at the amino terminus and does not include cystine 484. In
another embodiment, the LLO fragment consists of a PEST sequence. In another embodiment, the LLO fragment comprises a PEST sequence. In another embodiment, the LLO fragment consists of about the first 441 amino acids of the LLO protein. In another embodiment, the LLO fragment is a non-hemolytic form of the LLO protein. In another embodiment, the LLO fragment comprises a signal sequence from LLO.
[00045] In another embodiment, the PEST-like domain referred to above has the sequence:
[00046] KENSISSMAPPASPPASPKTPIEKKHADEIDK (SEQ ID NO: 3). In another embodiment, the PEST-like domain is any other PEST-like domain known in the art. Each possibility represents a separate embodiment of the present invention.
[00047] In another embodiment, the LLO fragment consists of about residues 1-25. In another embodiment, the LLO fragment consists of about residues 1-50. In another embodiment, the LLO fragment consists of about residues 1-75. In another embodiment, the LLO fragment consists of about residues 1-100. In another embodiment, the LLO fragment consists of about residues 1-125. In another embodiment, the LLO fragment consists of about residues 1-150. In another embodiment, the LLO fragment consists of about residues 1175. In another embodiment, the LLO fragment consists of about residues 1-200. In another embodiment, the LLO fragment consists of about residues 1-225. In another embodiment, the LLO fragment consists of about residues 1-250. In another embodiment, the LLO fragment consists of about residues 1-275. In another embodiment, the LLO fragment consists of about residues 1-300. In another embodiment, the LLO fragment consists of about residues 1-325. In another embodiment, the LLO fragment consists of about residues 1-350. In another embodiment, the LLO fragment consists of about residues 1-375. In another embodiment, the LLO fragment consists of about residues 1 -400. In another embodiment, the LLO fragment consists of about residues 1-416. In another embodiment, the LLO fragment consists of residues 1-416. In another embodiment, the LLO fragment consists of about residues 1 -425. In another embodiment, the LLO fragment consists of about residues 1-441. In another embodiment, the LLO fragment consists of residues 1-441.
[00048] In another embodiment, the LLO fragment is a non-hemolytic LLO fragment.
[00049] Each of the above types of LLO proteins or fragments thereof represents a separate embodiment of the present invention.
[00050] The term "antigen" as used herein refers, in another embodiment, to a protein expressed by a tumor cell. In another embodiment, the term refers to a protein expressed by an infectious agent. In another embodiment, the term refers to a fragment of a protein expressed by a tumor cell. In another embodiment, the term refers to a fragment of a protein expressed by an infectious agent. In another embodiment, the fragment is an immunogenic fragment. In another embodiment, the fragment contains one or more MHC class I epitopes. In another embodiment, the fragment contains one or more MHC class II epitopes. In another embodiment, the fragment is any other type of protein fragment known in the art. Each possibility represents a separate embodiment of the present invention.
[00051] In another embodiment, the antigen of methods and compositions of the present invention is a HPV E7 protein. In another embodiment, the antigen is a Her-2 protein. In another embodiment, the antigen is bcr/abl. In another embodiment, the antigen is HPV E6 In another embodiment, the antigen is MZ2-E. In another embodiment, the antigen is MAGE-I. In another embodiment, the antigen is MUC-I . In another embodiment, the antigen is NY/ESO-1. In another embodiment, the antigen is Wilms tumor antigen. In another embodiment, the antigen is telomerase. In another embodiment, the antigen is Proteinase 3. In another embodiment, the antigen is Tyrosinase related protein 2. In another embodiment, the antigen is HIV-I Gag protein. In another embodiment, the antigen is SIV-I Gag protein. In another embodiment, the antigen is HIV-I Env protein. In another embodiment, the antigen is any other tumor antigen known in the art. In another embodiment, the antigen is any other infectious disease antigen known in the art. Each possibility represents a separate embodiment of the present invention.
[00052] In other embodiments, the antigen is derived from a tumor or an infectious organism, including, but not limited to fungal pathogens, bacteria, parasites, helminths, viruses, and the like. In other embodiments, the antigen is selected from tetanus toxoid, hemagglutinin molecules from influenza virus, diphtheria toxoid, HIV gpl20, HIV gag protein, IgA protease, insulin peptide B, Spongospora subterranea antigen, vibriose antigens, Salmonella antigens, pneumococcus antigens, respiratory syncytial virus antigens, Haemophilus influenza outer membrane proteins, Helicobacter pylori urease, Neisseria meningitidis pilins, N. gonorrhoeae pilins, the melanoma-associated antigens (TRP-2, MAGE- 1 , MAGE-3 , gp- 100, tyrosinase, MART- 1 , HSP-70, beta-HCG), human papilloma virus antigens El and E2 from type HPV-16, -18, -31, -33, -35 or -45 human papilloma viruses, the
tumor antigens CEA, the ras protein, mutated or otherwise, the p53 protein, mutated or otherwise, Mucl, or pSA.
[00053] In other embodiments, the antigen is an antigen associated with one of the following diseases; cholera, diphtheria, Haemophilus, hepatitis A, hepatitis B, influenza, measles, meningitis, mumps, pertussis, small pox, pneumococcal pneumonia, polio, rabies, rubella, tetanus, tuberculosis, typhoid, Varicella-zoster, whooping cough3 yellow fever, the immunogens and antigens from Addison's disease, allergies, anaphylaxis, Bruton's syndrome, cancer, including solid and blood borne tumors, eczema, Hashimoto's thyroiditis, polymyositis, dermatomyositis, type 1 diabetes mellitus, acquired immune deficiency syndrome, transplant rejection, such as kidney, heart, pancreas, lung, bone, and liver transplants, Graves' disease, polyendocrine autoimmune disease, hepatitis, microscopic polyarteritis, polyarteritis nodosa, pemphigus, primary biliary cirrhosis, pernicious anemia, coeliac disease, antibody-mediated nephritis, glomerulonephritis, rheumatic diseases, systemic lupus erthematosus, rheumatoid arthritis, seronegative spondylarthritides, rhinitis, Sjogren's syndrome, systemic sclerosis, sclerosing cholangitis, Wegener's granulomatosis, dermatitis herpetiformis, psoriasis, vitiligo, multiple sclerosis, encephalomyelitis, Guillain-Barre syndrome, myasthenia gravis, Lambert-Eaton syndrome, sclera, episclera, uveitis, chronic mucocutaneous candidiasis, urticaria, transient hypogammaglobulinemia of infancy, myeloma, X-linked hyper IgM syndrome, Wiskott- Aldrich syndrome, ataxia telangiectasia, autoimmune hemolytic anemia, autoimmune thrombocytopenia, autoimmune neutropenia, Waldenstrom's macroglobulinemia, amyloidosis, chronic lymphocytic leukemia, non-Hodgkin's lymphoma, malarial circumsporozite protein, microbial antigens, viral antigens, autoantigens, and lesteriosis.
[00054] In other embodiments, the antigen is one of the following tumor antigens: a MAGE (Melanoma- Associated Antigen E) protein, e.g. MAGE 1, MAGE 2, MAGE 3, MAGE 4, a tyrosinase; a mutant ras protein; a mutant p53 protein; p97 melanoma antigen, a ras peptide or p53 peptide associated with advanced cancers; the HPV 16/18 antigens associated with cervical cancers, KLH antigen associated with breast carcinoma, CEA (carcinoembryonic antigen) associated with colorectal cancer, gplOO, a MARTl antigen associated with melanoma, or the PSA antigen associated with prostate cancer.
[00055] In another embodiment, the antigen of methods and compositions of the present invention is a HPV E7 protein. In another embodiment, the HPV E7 protein is an HPV- 16 E7 protein. In another
embodiment, the E7 protein is from an HPV belonging to supergroup A. In another embodiment, the HPV belongs to supergroup B. In another embodiment, the HPV belongs to supergroup C. In another embodiment, the HPV belongs to supergroup D. In another embodiment, the HPV belongs to supergroup E. In other embodiments, the E7 protein is from any HPV type known in the art (e.g. any of the 87 HPV types numbered HPV1-HPV-87).
[00056] In another embodiment, the E7 protein has the sequence:
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCC KCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP (SEQ ID NO: 4).
[00057] In other embodiments, the E7 protein has one of the amino acid or nucleotide sequences set forth in GenBank Accession Number NC_001352, AB211993, NC_001354, X64086, X64084, X56147, X55965, NC_001691, AF536180, AF536179, AF534061, AF548023, AF472509, AF472508, AY044311, AY044310, AY044309, AY044308, AY044307, AY044306, AF293960, U40822, U22461, D50549, D50548, D50547, D50546 D10597, D50545, X05568, X04773, A16170, X64085, U31790, U31785, M75123, M38198, M26798, or M24215.
[00058] Each of the above types of E7 proteins represents a separate embodiment of the present invention.
[00059] In another embodiment, methods and compositions of the present invention comprise a fragment of the antigen protein. In another embodiment, the fragment consists of about one-third to one-half of the antigen protein. In another embodiment, the fragment consists of about one-tenth to one-fifth thereof. In another embodiment, the fragment consists of about one-fifth to one-fourth thereof. In another embodiment, the fragment consists of about one-fourth to one-third thereof. In another embodiment, the fragment consists of about one-third to one-half thereof. In another embodiment, the fragment consists of about one-half to three quarters thereof. In another embodiment, the fragment consists of about three quarters of the antigen protein. In another embodiment, the fragment consists of about 5-10% thereof. In another embodiment, the fragment consists of about 10-15% thereof. In another embodiment, the fragment consists of about 15-20% thereof. In another embodiment, the fragment consists of about 20-25% thereof. In another embodiment, the fragment consists of about 25-30% thereof. In another embodiment, the fragment consists of about 30-35% thereof. In another embodiment, the fragment consists of about 35-40%
thereof. In another embodiment, the fragment consists of about 45-50% thereof. In another embodiment, the fragment consists of about 50-55% thereof. In another embodiment, the fragment consists of about 55-60% thereof. In another embodiment, the fragment consists of about 5-15% thereof. In another embodiment, the fragment consists of about 10-20% thereof. In another embodiment, the fragment consists of about 15-25% thereof. In another embodiment, the fragment consists of about 20-30% thereof. In another embodiment, the fragment consists of about 25-35% thereof. In another embodiment, the fragment consists of about 30-40% thereof. In another embodiment, the fragment consists of about 35-45% thereof. In another embodiment, the fragment consists of about 45-55% thereof. In another embodiment, the fragment consists of about 50-60% thereof. In another embodiment, the fragment consists of about 55-65% thereof. In another embodiment, the fragment consists of about 60-70% thereof. In another embodiment, the fragment consists of about 65-75% thereof. In another embodiment, the fragment consists of about 70-80% thereof. In another embodiment, the fragment consists of about 5-20% thereof. In another embodiment, the fragment consists of about 10-25% thereof. In another embodiment, the fragment consists of about 15-30% thereof. In another embodiment, the fragment consists of about 20-35% thereof. In another embodiment, the fragment consists of about 25-40% thereof. In another embodiment, the fragment consists of about 30-45% thereof. In another embodiment, the fragment consists of about 35-50% thereof. In another embodiment, the fragment consists of about 45-60% thereof. In another embodiment, the fragment consists of about 50-65% thereof. In another embodiment, the fragment consists of about 55-70% thereof. In another embodiment, the fragment consists of about 60-75% thereof. In another embodiment, the fragment consists of about 65-80% thereof. In another embodiment, the fragment consists of about 70-85% thereof. In another embodiment, the fragment consists of about 75-90% thereof. In another embodiment, the fragment consists of about 80-95% thereof. In another embodiment, the fragment consists of about 85-100% thereof. In another embodiment, the fragment consists of about 5-25% thereof. In another embodiment, the fragment consists of about 10-30% thereof. In another embodiment, the fragment consists of about 15-35% thereof. In another embodiment, the fragment consists of about 20-40% thereof. In another embodiment, the fragment consists of about 30-50% thereof. In another embodiment, the fragment consists of about 40-60% thereof. In another embodiment, the fragment consists of about 50-70% thereof. In another embodiment, the fragment consists of about 60-80% thereof. In another embodiment, the fragment consists of about 70-90% thereof. In another
embodiment, the fragment consists of about 80-100% thereof. In another embodiment, the fragment consists of about 5-35% thereof. In another embodiment, the fragment consists of about 10-40% thereof. In another embodiment, the fragment consists of about 15-45% thereof. In another embodiment, the fragment consists of about 20-50% thereof. In another embodiment, the fragment consists of about 30-60% thereof. In another embodiment, the fragment consists of about 40-70% thereof. In another embodiment, the fragment consists of about 50-80% thereof. In another embodiment, the fragment consists of about 60-90% thereof. In another embodiment, the fragment consists of about 70-100% thereof. In another embodiment, the fragment consists of about 5-45% thereof. In another embodiment, the fragment consists of about 10-50% thereof. In another embodiment, the fragment consists of about 20-60% thereof. In another embodiment, the fragment consists of about 30-70% thereof. In another embodiment, the fragment consists of about 40-80% thereof. In another embodiment, the fragment consists of about 50-90% thereof. In another embodiment, the fragment consists of about 60-100% thereof. In another embodiment, the fragment consists of about 5-55% thereof. In another embodiment, the fragment consists of about 10-60% thereof. In another embodiment, the fragment consists of about 20-70% thereof. In another embodiment, the fragment consists of about 30-80% thereof. In another embodiment, the fragment consists of about 40-90% thereof. In another embodiment, the fragment consists of about 50-100% thereof. In another embodiment, the fragment consists of about 5-65% thereof. In another embodiment, the fragment consists of about 10-70% thereof. In another embodiment, the fragment consists of about 20-80% thereof. In another embodiment, the fragment consists of about 30-90% thereof. In another embodiment, the fragment consists of about 40-100% thereof. In another embodiment, the fragment consists of about 5-75% thereof. In another embodiment, the fragment consists of about 10-80% thereof. In another embodiment, the fragment consists of about 20-90% thereof. In another embodiment, the fragment consists of about 30-100% thereof. In another embodiment, the fragment consists of about 10-90% thereof. In another embodiment, the fragment consists of about 20-100% thereof. In another embodiment, the fragment consists of about 10-100% thereof.
[00060] In another embodiment, the fragment consists of about 5% of the antigen protein. In another embodiment, the fragment consists of about 6% thereof. In another embodiment, the fragment consists of about 8% thereof. In another embodiment, the fragment consists of about 10% thereof. In another embodiment, the fragment consists of about 12% thereof. In another embodiment, the
fragment consists of about 15% thereof. In another embodiment, the fragment consists of about 18% thereof. In another embodiment, the fragment consists of about 20% thereof. In another embodiment, the fragment consists of about 25% thereof. In another embodiment, the fragment consists of about 30% thereof. In another embodiment, the fragment consists of about 35% thereof. In another embodiment, the fragment consists of about 40% thereof. In another embodiment, the fragment consists of about 45% thereof. In another embodiment, the fragment consists of about 50% thereof. In another embodiment, the fragment consists of about 55% thereof. In another embodiment, the fragment consists of about 60% thereof. In another embodiment, the fragment consists of about 65% thereof. In another embodiment, the fragment consists of about 70% thereof. In another embodiment, the fragment consists of about 75% thereof. In another embodiment, the fragment consists of about 80% thereof. In another embodiment, the fragment consists of about 85% thereof. In another embodiment, the fragment consists of about 90% thereof. In another embodiment, the fragment consists of about 95% thereof. In another embodiment, the fragment consists of about 100% thereof. Each possibility represents a separate embodiment of the present invention.
[00061] In another embodiment, the fragment is a fragment of the extracellular domain of the antigen protein. In another embodiment, the fragment is from about one-third to one-half of the extracellular domain. In another embodiment, the fragment of the extracellular domain is any of the amounts, fractions, or ranges listed above'for the entire antigen protein. Each possibility represents a separate embodiment of the present invention.
[00062] In another embodiment, the fragment is a fragment of the intracellular domain of the antigen protein. In another embodiment, the fragment is from about one-third to one-half of the intracellular domain. In another embodiment, the fragment of the intracellular domain is any of the amounts, fractions, or ranges listed above for the entire antigen protein. Each possibility represents a separate embodiment of the present invention.
[00063] In another embodiment, the present invention provides a method of invoking a CD4+ T cell- mediated immune response against an antigen in a subject, comprising administering to the subject a composition of the present invention, thereby invoking a CD4+ T cell-mediated immune response against an antigen in a subject.
[00064] In another embodiment, the present invention provides a method of impeding a growth of an antigen-expressing tumor in a subject, comprising administering to the subject a composition of the
present invention, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby impeding a growth of an antigen-expressing tumor in a subject.
[00065] In another embodiment, the present invention provides a method of reducing a size of an antigen-expressing tumor in a subject, comprising administering to the subject a composition of the present invention, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby reducing a size of an antigen-expressing tumor in a subject.
[00066] In another embodiment, the present invention provides a method of invoking a CD4+ T cell- mediated immune response against an antigen in a subject, comprising administering to the subject a recombinant vector, the recombinant vector comprising a first gene encoding an N-terminal fragment of an LLO protein and a second gene encoding a peptide comprising the antigen, wherein the first gene and the second gene are in separate open reading frames, thereby invoking a CD4+ T cell- mediated immune response against an antigen in a subject.
[00067] In another embodiment, the present invention provides a method of impeding a growth of an antigen-expressing tumor in a subject, comprising administering to the subject a recombinant vector, the recombinant vector comprising a first gene encoding an N-terminal fragment of an LLO protein and a second gene encoding a peptide comprising the antigen, wherein the first gene and the second gene are in separate open reading frames, whereby the recombinant vector elicits in the subject an immune response against the tumor antigen, thereby impeding a growth of an antigen-expressing tumor in a subject.
[00068] In another embodiment, the present invention provides a method of reducing a size of an antigen-expressing tumor in a subject, comprising administering to the subject a recombinant vector, the recombinant vector comprising a first gene encoding an N-terminal fragment of an LLO protein and a second gene encoding a peptide comprising the antigen, wherein the first gene and the second gene are in separate open reading frames, whereby the recombinant vector elicits in the subject an immune response against the tumor antigen, thereby reducing a size of an antigen-expressing tumor in a subject.
[00069] In another embodiment, the present invention provides a method of invoking a CD4+ T cell- mediated immune response against an antigen in a subject, comprising administering to the subject a composition comprising a first nucleotide molecule encoding an N-terminal fragment of an LLO
protein and a second nucleotide molecule encoding a peptide comprising the antigen, thereby invoking a CD4+ T cell-mediated immune response against an antigen in a subject.
[00070] In another embodiment, the present invention provides a method of impeding a growth of an antigen-expressing tumor in a subject, comprising administering to the subject a composition comprising a first nucleotide molecule encoding an N-terminal fragment of an LLO protein and a second nucleotide molecule encoding a peptide comprising the antigen, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby impeding a growth of an antigen-expressing tumor in a subject.
[00071] In another embodiment, the present invention provides a method of reducing a size of an antigen-expressing tumor in a subject, comprising administering to the subject a composition comprising a first nucleotide molecule encoding an N-terminal fragment of an LLO protein and a second nucleotide molecule encoding a peptide comprising the antigen, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby reducing a size of an antigen-expressing tumor in a subject.
[00072] In another embodiment, the first nucleotide molecule of methods and compositions of the present invention is a recombinant plasmid. In another embodiment, the first nucleotide molecule is a component of recombinant vector. In another embodiment, the first nucleotide molecule is component of a DNA vaccine. In another embodiment, the first nucleotide molecule is any other type of nucleotide molecule known in the art. Each possibility represents a separate embodiment of the present invention.
[00073] In another embodiment, the second nucleotide molecule of methods and compositions of the present invention is a recombinant plasmid. In another embodiment, the second nucleotide molecule is a recombinant vector. In another embodiment, the second nucleotide molecule is a DNA vaccine. In another embodiment, the second nucleotide molecule is any other type of nucleotide molecule known in the art. Each possibility represents a separate embodiment of the present invention.
[00074] The first of second nucleotide molecules of methods and compositions of the present invention can be, in other embodiments, any of the types of nucleotide, or deoxynucleotide molecules enumerated herein. Each possibility represents a separate embodiment of the present invention.
[00075] In another embodiment, the present invention provides a method of invoking a CD4+ T cell- mediated immune response against an antigen in a subject, comprising administering to the subject a composition comprising an N-terminal fragment of an LLO protein and a nucleotide molecule encoding a peptide comprising the antigen, thereby invoking a CD4+ T cell-mediated immune response against an antigen in a subject.
[00076] In another embodiment, the present invention provides a method of impeding a growth of an antigen-expressing tumor in a subject, comprising administering to the subject a composition comprising an N-terminal fragment of an LLO protein and a nucleotide molecule encoding a peptide comprising the antigen, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby impeding a growth of an antigen-expressing tumor in a subject.
[00077] In another embodiment, the present invention provides a method of reducing a size of an antigen-expressing tumor in a subject, comprising administering to the subject a composition comprising an N-terminal fragment of an LLO protein and a nucleotide molecule encoding a peptide comprising the antigen, whereby the composition elicits in the subject an immune response against the tumor antigen, thereby reducing a size of an antigen-expressing tumor in a subject.
[00078] In another embodiment, the present invention provides a method of invoking a CD4+ T cell- mediated immune response against a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a composition of the present invention, thereby invoking a CD4+ T cell- mediated immune response against a HPV E7 protein-expressing tumor in a subject.
[00079] In another embodiment, the present invention provides a method of impeding a growth of a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a composition of the present invention, whereby the composition elicits in the subject an immune response against the HPV E7 protein, thereby impeding a growth of a HPV E7 protein-expressing tumor in a subject.
[00080] In another embodiment, the present invention provides a method of reducing a size of a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a composition of the present invention, whereby the composition elicits in the subject an immune response against the HPV E7 protein, thereby reducing a size of a HPV E7 protein-expressing tumor in a subject.
[00081] In another embodiment, the present invention provides a method of invoking a CD4+ T cell- mediated immune response against a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a recombinant vector, the recombinant vector comprising a first gene encoding an N-terminal fragment of an LLO protein and a second gene encoding the HPV E7 protein or a fragment thereof, wherein the first gene and the second gene are in separate open reading frames, thereby invoking a CD4+ T cell-mediated immune response against a HPV E7 protein- expressing tumor in a subject.
[00082] In another embodiment, the present invention provides a method of impeding a growth of a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a recombinant vector, the recombinant vector comprising a first gene encoding an N-terminal fragment of an LLO protein and a second gene encoding the HPV E7 protein or a fragment thereof, wherein the first gene and the second gene are in separate open reading frames, whereby the recombinant vector elicits in the subject an immune response against the HPV E7 protein, thereby impeding a growth of a HPV E7 protein-expressing tumor in a subject.
[00083] In another embodiment, the present invention provides a method of reducing a size of a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a recombinant vector, the recombinant vector comprising a first gene encoding an N-terminal fragment of an LLO protein and a second gene encoding the HPV E7 protein or a fragment thereof, wherein the first gene and the second gene are in separate open reading frames, whereby the recombinant vector elicits in the subject an immune response against the HPV E7 protein-expressing tumor, thereby reducing a size of a HPV E7 protein-expressing tumor in a subject.
[00084] In another embodiment, the present invention provides a method of invoking a CD4+ T cell- mediated immune response against a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a composition comprising a first nucleotide molecule encoding an N- terminal fragment of an LLO protein and a second nucleotide molecule encoding the HPV E7 protein or a fragment thereof, thereby invoking a CD4+ T cell-mediated immune response against a HPV E7 protein-expressing tumor in a subject.
[00085] In another embodiment, the present invention provides a method of impeding a growth of a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a composition comprising a first nucleotide molecule encoding an N-terminal fragment of an LLO
protein and a second nucleotide molecule encoding the HPV E7 protein or a fragment thereof, whereby the composition elicits in the subject an immune response against the HPV E7 protein- expressing tumor, thereby impeding a growth of a HPV E7 protein-expressing tumor in a subject.
[00086] In another embodiment, the present invention provides a method of reducing a size of a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a composition comprising a first nucleotide molecule encoding an N-terminal fragment of an LLO protein and a second nucleotide molecule encoding the HPV E7 protein or a fragment thereof, whereby the composition elicits in the subject an immune response against the HPV E7 protein-expressing tumor, thereby reducing a size of a HPV E7 protein-expressing tumor in a subject.
[00087] In another embodiment, the present invention provides a method of invoking a CD4+ T cell- mediated immune response against a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a composition comprising an N-terminal fragment of an LLO protein and a nucleotide molecule encoding the HPV E7 protein or a fragment thereof, thereby invoking a CD4+ T cell-mediated immune response against a HPV E7 protein-expressing tumor in a subject.
[00088] In another embodiment, the present invention provides a method of impeding a growth of a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a composition comprising an N-terminal fragment of an LLO protein and a nucleotide molecule encoding the HPV E7 protein or a fragment thereof, whereby the composition elicits in the subject an immune response against the HPV E7 protein-expressing tumor, thereby impeding a growth of a HPV E7 protein-expressing tumor in a subject.
[00089] In another embodiment, the present invention provides a method of reducing a size of a HPV E7 protein-expressing tumor in a subject, comprising administering to the subject a composition comprising an N-terminal fragment of an LLO protein and a nucleotide molecule encoding the HPV E7 protein or a fragment thereof, whereby the composition elicits in the subject an immune response against the HPV E7 protein-expressing tumor, thereby reducing a size of a HPV E7 protein- expressing tumor in a subject.
[00090] In another embodiment, the present invention provides a method for inducing or enhancing an MHC class II presentation of an antigen, comprising administering a composition or recombinant vector enumerated herein, thereby inducing or enhancing an MHC class II presentation of an antigen.
[00091] In another embodiment, the present invention provides a method for suppressing formation of tumors in a host, comprising administering a composition or recombinant vector enumerated herein, thereby suppressing formation of tumors in a host.
[00092] In another embodiment, the present invention provides a method of inducing formation and proliferation of human CTL, comprising administering a composition or recombinant vector enumerated herein, thereby inducing formation and proliferation of human CTL.
[00093] In another embodiment, the present invention provides a method of inducing formation of tumor infiltrating CTL, comprising administering a composition or recombinant vector enumerated herein, thereby inducing formation of tumor infiltrating CTL.
[00094] In other embodiments, the compositions and recombinant vectors of any of the methods described above have any of the characteristics of a compositions or recombinant vector of the present invention. Each characteristic represents a separate embodiment of the present invention.
[00095] In another embodiment, a method of the present invention further comprises administering a plasmid encoding a cytokine or immune-stimulating molecule to the subject. In another embodiment, the antigen-encoding plasmid or vector and cytokine/immune-stimulating molecule-encoding plasmid are administered as a mixture. In another embodiment, the antigen-encoding plasmid or vector and cytokine/immune-stimulating molecule-encoding plasmid are administered at substantially the same site in the subject. In another embodiment, the antigen-encoding plasmid or vector and cytokine/immune-stimulating molecule-encoding plasmid are administered to the subject at substantially the same time.
[00096] The CD4+ T cell-mediated immune response that is induced by methods and compositions of the present invention is, in another embodiment, predominantly a ThI CD4+ T cell-mediated response. In another embodiment, the CD4+ T cell-mediated immune response is entirely a ThI CLM+ T cell-mediated response. In another embodiment, the immune response is at least 60% ThI CD4+ T cell-mediated. In another embodiment, the immune response is at least 70% ThI CD4+ T cell- mediated. In another embodiment, the immune response is at least 80% ThI CD4+ T cell-mediated. In another embodiment, the immune response is at least 90% ThI CD4+ T cell-mediated. In another embodiment, the immune response is at least 95% ThI CD4+ T cell-mediated. In another embodiment, the immune response is more than 60% ThI CD4+ T cell-mediated. In another
embodiment, the immune response is more than 70% ThI CD4+ T cell-mediated. In another embodiment, the immune response is more than 80% ThI CD4+ T cell-mediated. In another embodiment, the immune response is more than 90% ThI CD4+ T cell-mediated. In another embodiment, the immune response is more than 95% ThI CD4+ T cell-mediated. In another embodiment, no antigen-specific Th2 CD4+ T cell response is detectable by one of the standard detection methods enumerated herein. Each possibility represents a separate embodiment of the present invention.
[00097] In another embodiment, the immune response elicited by methods and compositions of the present invention comprises a CD8+ T cell-mediated response. In another embodiment, the immune response consists predominantly of a CD8+ T cell-mediated response. In another embodiment, the immune response is at least 60% CD8+ T cell-mediated. In another embodiment, the immune response is at least 70% CD8+ T cell-mediated. In another embodiment, the immune response is at least 80% CD8+ T cell-mediated. In another embodiment, the immune response is at least 90% CD8+ T cell-mediated. In another embodiment, the immune response is at least 95% CD8+ T cell-mediated. In another embodiment, the immune response is more than 60% CD8+ T cell-mediated. In another embodiment, the immune response is more than 70% CD8+ T cell-mediated. In another embodiment, the immune response is more than 80% CD8+ T cell-mediated. In another embodiment, the immune response is more than 90% CD8+ T cell-mediated. In another embodiment, the immune response is more than 95% CD8+ T cell-mediated. In another embodiment, the only detectable component of the immune response is a CD8+ T cell-mediated response.
[00098] In another embodiment, the immune response elicited by methods and compositions of the present invention comprises a CD4+ T cell-mediated response. In another embodiment, the immune response consists primarily of a CD4+ T cell-mediated response. In another embodiment, the immune response is at least 60% CD4+ T cell-mediated. In another embodiment, the immune response is at least 70% CD4+ T cell-mediated. In another embodiment, the immune response is at least 80% CD4+ T cell-mediated. In another embodiment, the immune response is at least 90% CD4+ T cell-mediated. In another embodiment, the immune response is at least 95% CD4+ T cell-mediated. In another embodiment, the immune response is more than 60% CD4+ T cell-mediated. In another embodiment, the immune response is more than 70% CD4+ T cell-mediated. In another embodiment, the immune response is more than 80% CD4+ T cell-mediated. In another embodiment, the immune response is
more than 90% CD4+ T cell-mediated. In another embodiment, the immune response is more than 95% CD4+ T cell-mediated. In another embodiment, the only detectable component of the immune response is a CD4+ T cell-mediated response.
[00099] In another embodiment, the CD4+ T cell-mediated response is accompanied by a measurable antibody response against the antigen. In another embodiment, the CD4+ T cell-mediated response is not accompanied by a measurable antibody response against the antigen.
[00010O]In another embodiment, the immune response elicited by methods and compositions of the present invention contains both a CD8+ T cell and CD4+ T cell-mediated responses.
[000101] Each type of immune response represents a separate embodiment of the present invention.
[000102] Various embodiments of dosage ranges are contemplated by this invention. In another embodiment, the dosage is 1 microgram (mcg)/dose. In another embodiment, the dosage is 1.5 meg/dose. In another embodiment, the dosage is 2 meg/dose. In another embodiment, the dosage is 3 meg/dose. In another embodiment, the dosage is 4 meg/dose. In another embodiment, the dosage is 6 meg/dose. In another embodiment, the dosage is 8 meg/dose. In another embodiment, the dosage is 10 meg/dose. In another embodiment, the dosage is 15 meg/dose. In another embodiment, the dosage is 20 meg/dose. In another embodiment, the dosage is 30 meg/dose. In another embodiment, the dosage is 40 meg/dose. In another embodiment, the dosage is 60 meg/dose. In another embodiment, the dosage is 80 meg/dose. In another embodiment, the dosage is 100 meg/dose. In another embodiment, the dosage is 150 meg/dose. In another embodiment, the dosage is 200 meg/dose. In another embodiment, the dosage is 300 meg/dose. In another embodiment, the dosage is 400 meg/dose. In another embodiment, the dosage is 600 meg/dose. In another embodiment, the dosage is 800 meg/dose. In another embodiment, the dosage is 1000 meg/dose. Each possibility represents a separate embodiment of the present invention.
[000103] In another embodiment of methods and compositions of the present invention, the antigen comprises a peptide recognized by cytotoxic T lymphocytes (CTL) after vaccination. In another embodiment, the peptide is the same as an antigenic peptide recognized by an infected vertebrate. Each possibility represents a separate embodiment of the present invention.
[000104] In another embodiment, a method of the present invention comprises administration of a vaccine or compound directly to the subject that is being treated. In another embodiment, the
administration is to the cells of the subject ex vivo. In another embodiment, the administration is to the cells of a donor ex vivo. In another embodiment, the administration is to the cells of a donor in vivo, then the cells are transferred to the subject. Each possibility represents a separate embodiment of the present invention.
[000105] Methods of measuring immune responses are well known in the art, and include, e.g. measuring suppression of tumor growth (Examples 1 and 3 herein), flow cytometry (FACS; Example 2), ELISPOT (Examples 4 and 5) antibody ELISA (Example 6), target cell lysis assays (e.g. chromium release assay), the use of tetramers, and others. Each method represents a separate embodiment of the present invention.
[000106] In another embodiment, a treatment protocol of the present invention is therapeutic. In another embodiment, the protocol is prophylactic. Each possibility represents a separate embodiment of the present invention.
[000107] The terms "homology," "homologous," etc, when in reference to any protein or peptide, refer, in another embodiment, to a percentage of amino acid residues in the candidate sequence that are identical with the residues of a corresponding native polypeptide, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent homology, and not considering any conservative substitutions as part of the sequence identity. Methods and computer programs for the alignment are well known in the art.
[000108] In another embodiment, the term "homology," when in reference to any nucleic acid sequence similarly indicates a percentage of nucleotides in a candidate sequence that are identical with the nucleotides of a corresponding native nucleic acid sequence.
[000109] Homology is, in another embodiment, determined by computer algorithm for sequence alignment, by methods well described in the art. For example, computer algorithm analysis of nucleic acid sequence homology may include the utilization of any number of software packages available, such as, for example, the BLAST, DOMAIN, BEAUTY (BLAST Enhanced Alignment Utility), GENPEPT and TREMBL packages.
[000110] In another embodiment, "homology" refers to identity to a sequence selected from SEQ ID No: 1-3 of greater than 70%. In another embodiment, "homology" refers to identity to a sequence selected from SEQ ID No: 1-3 of greater than 72%. In another embodiment, "homology" refers to identity to
one of SEQ ID No: 1-3 of greater than 75%. In another embodiment, "homology" refers to identity to a sequence selected from SEQ ID No: 1-3 of greater than 78%. In another embodiment, "homology" refers to identity to one of SEQ ID No: 1-3 of greater than 80%. In another embodiment, "homology" refers to identity to one of SEQ ID No: 1-3 of greater than 82%. In another embodiment, "homology" refers to identity to a sequence selected from SEQ ID No: 1-3 of greater than 83%. In another embodiment, "homology" refers to identity to one of SEQ ID No: 1-3 of greater than 85%. In another embodiment, "homology" refers to identity to one of SEQ ID No: 1-3 of greater than 87%. In another embodiment, "homology" refers to identity to a sequence selected from SEQ ID No: 1-3 of greater than 88%. In another embodiment, "homology" refers to identity to one of SEQ ID No: 1-3 of greater than 90%. In another embodiment, "homology" refers to identity to one of SEQ ID No: 1-3 of greater than 92%. In another embodiment, "homology" refers to identity to a sequence selected from SEQ ID No: 1-3 of greater than 93%. In another embodiment, "homology" refers to identity to one of SEQ ID No: 1-3 of greater than 95%. In another embodiment, "homology" refers to identity to a sequence selected from SEQ ID No: 1-3 of greater than 96%. In another embodiment, "homology" refers to identity to one of SEQ ID No: 1-3 of greater than 97%. In another embodiment, "homology" refers to identity to one of SEQ ID No: 1-3 of greater than 98%. In another embodiment, "homology" refers to identity to one of SEQ ID No: 1-3 of greater than 99%. In another embodiment, "homology" refers to identity to one of SEQ ID No: 1-3 of 100%.
[000111] In another embodiment, homology is determined is via determination of candidate sequence hybridization, methods of which are well described in the art (See, for example, "Nucleic Acid Hybridization" Hames, B. D., and Higgins S. J., Eds. (1985); Sambrook et al., 2001, Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Press, N.Y.; and Ausubel et al., 1989, Current Protocols in Molecular Biology, Green Publishing Associates and Wiley Interscience, N. Y). For example methods of hybridization may be carried out under moderate to stringent conditions, to the complement of a DNA encoding a native caspase peptide. Hybridization conditions being, for example, overnight incubation at 420C in a solution comprising: 10-20 % formamide, 5 X SSC (150 mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH 7. 6), 5 X Denhardt's solution, 10 % dextran sulfate, and 20 μg/ml denatured, sheared salmon sperm DNA.
[000112] In another embodiment of the present invention, "nucleic acids" refers to a string of at least two base-sugar-phosphate combinations. The term includes, in another embodiment, DNA and RNA.
"Nucleotides" refers, in another embodiment, to the monomeric units of nucleic acid polymers. RNA may be, in another embodiment, in the form of a tRNA (transfer RNA), snRNA (small nuclear RNA), rRNA (ribosomal RNA), mRNA (messenger RNA), anti-sense RNA, small inhibitory RNA (siRNA), micro RNA (miRNA) and ribozymes. The use of siRNA and miRNA has been described (Caudy AA et al, Genes & Devel 16: 2491-96 and references cited therein). DNA may be in form of plasmid DNA, viral DNA, linear DNA, or chromosomal DNA or derivatives of these groups. In addition, these forms of DNA and RNA may be single, double, triple, or quadruple stranded. The term also includes, in another embodiment, artificial nucleic acids that may contain other types of backbones but the same bases. In another embodiment, the artificial nucleic acid is aPNA (peptide nucleic acid). PNA contain peptide backbones and nucleotide bases and are able to bind, in another embodiment, to both DNA and RNA molecules. In another embodiment, the nucleotide is oxetane modified. In another embodiment, the nucleotide is modified by replacement of one or more phosphodiester bonds with a phosphorothioate bond. In another embodiment, the artificial nucleic acid contains any other variant of the phosphate backbone of native nucleic acids known in the art. The use of phosphothiorate nucleic acids and PNA are known to those skilled in the art, and are described in, for example, Neilsen PE, Curr Opin Struct Biol 9:353-57; and Raz NK et al Biochem Biophys Res Commun. 297 : 1075-84. The production and use of nucleic acids is known to those skilled in art and is described, for example, in Molecular Cloning, (2001), Sambrook and Russell, eds. and Methods in Enzymology: Methods for molecular cloning in eukaryotic cells (2003) Purchio and G. C. Fareed. Each nucleic acid derivative represents a separate embodiment of the present invention.
[000113] Protein and/or peptide homology for any amino acid sequence listed herein is determined, in another embodiment, by methods well described in the art, including immunoblot analysis, or via computer algorithm analysis of amino acid sequences, utilizing any of a number of software packages available, via established methods. Some of these packages may include the FASTA, BLAST, MPsrch or Scanps packages, and may employ the use of the Smith and Waterman algorithms, and/or global/local or BLOCKS alignments for analysis, for example. Each method of determining homology represents a separate embodiment of the present invention.
[000114] The promoter used to express the antigen peptides, cytokines, and immune-stimulating molecules can be, in other embodiments, any promoter known in art (e.g. the CMV promoter, the ubiquitin promoter, etc). Each promoter represents a separate embodiment of the present invention.
[000115] In another embodiment, the present invention provides a kit comprising a reagent utilized in performing a method of the present invention. In another embodiment, the present invention provides a kit comprising a composition, tool, or instrument of the present invention.
Pharmaceutical Compositions
[000116] The vaccine, recombinant vector, or composition of the present invention can be, in other embodiments, administered to a subject by any method known to a person skilled in the art, such as parenterally, paracancerally, transmucosally, transdermally, intramuscularly, intravenously, intra- dermally, subcutaneously, intra-peritonealy, intra-ventricularly, intra-cranially, intra-vaginally or intra-tumorally.
[000117] In another embodiment of methods and compositions of the present invention, the vaccine, recombinant vector, or composition is administered orally, and is thus formulated in a form suitable for oral administration, i.e. as a solid or a liquid preparation. Suitable solid oral formulations include tablets, capsules, pills, granules, pellets and the like. Suitable liquid oral formulations include solutions, suspensions, dispersions, emulsions, oils and the like. In another embodiment of the present invention, the active ingredient is formulated in a capsule. In accordance with this embodiment, the compositions of the present invention comprise, in addition to the active compound and the inert carrier or diluent, a hard gelating capsule.
[000118] In another embodiment, the vaccine, recombinant vector, or composition is administered by intravenous, intra-arterial, or intra-muscular injection of a liquid preparation. Suitable liquid formulations include solutions, suspensions, dispersions, emulsions, oils and the like. In another embodiment, the vaccine, recombinant vector, or composition is administered intravenously and are thus formulated in a form suitable for intravenous administration. In another embodiment, the vaccine, recombinant vector, or composition is administered intra- arterially and is thus formulated in a form suitable for intra-arterial administration. In another embodiment, the vaccine, recombinant vector, or composition is administered intra-muscularly and is thus formulated in a form suitable for intra-muscular administration.
[000119] In another embodiment, the vaccine, recombinant vector, or composition is administered as a suppository, for example a rectal suppository or a urethral suppository.
[00012O]In another embodiment, the vaccine, recombinant vector, or composition is delivered in a vesicle, e.g. a liposome.
[000121] In another embodiment, solid carriers/diluents include, but are not limited to, a gum, a starch (e.g. corn starch, pregeletanized starch), a sugar (e.g., lactose, mannitol, sucrose, dextrose), a cellulosic material (e.g. microcrystalline cellulose), an acrylate (e.g. polymethylacrylate), calcium carbonate, magnesium oxide, talc, or mixtures thereof.
[000122] In other embodiments, pharmaceutically acceptable carriers for liquid formulations can be aqueous or non- aqueous solutions, suspensions, emulsions or oils. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, and injectable organic esters such as ethyl oleate. Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media. Examples of oils are those of petroleum, animal, vegetable, or synthetic origin, for example, peanut oil, soybean oil, mineral oil, olive oil, sunflower oil, and fish-liver oil.
[000123] Parenteral vehicles (for subcutaneous, intravenous, intraarterial, or intramuscular injection) include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's and fixed oils. Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers such as those based on Ringer's dextrose, and the like. Examples are sterile liquids such as water and oils, with or without the addition of a surfactant and other pharmaceutically acceptable adjuvants. In general, water, saline, aqueous dextrose and related sugar solutions, and glycols such as propylene glycols or polyethylene glycol are preferred liquid carriers, particularly for injectable solutions. Examples of oils are those of petroleum, animal, vegetable, or synthetic origin, for example, peanut oil, soybean oil, mineral oil, olive oil, sunflower oil, and fish-liver oil.
[000124] In another embodiment, the compositions further comprise binders (e.g. acacia, cornstarch, gelatin, carbomer, ethyl cellulose, guar gum, hydroxypropyl cellulose, hydroxypropyl methyl cellulose, povidone), disintegrating agents (e.g. cornstarch, potato starch, alginic acid, silicon dioxide, croscarmelose sodium, crospovidone, guar gum, sodium starch glycolate), buffers (e.g., Tris-HCL, acetate, phosphate) of various pH and ionic strength, additives such as albumin or gelatin to prevent absorption to surfaces, detergents (e.g., Tween 20, Tween 80, Pluronic F68, bile acid salts), protease inhibitors, surfactants (e.g. sodium lauryl sulfate), permeation enhancers, solubilizing agents (e.g., glycerol, polyethylene glycerol), anti-oxidants (e.g., ascorbic acid, sodium metabisulfite, butylated hydroxy anisole), stabilizers (e.g. hydroxypropyl cellulose, hyroxypropylmethyl cellulose), viscosity
increasing agents(e.g. carbomer, colloidal silicon dioxide, ethyl cellulose, guar gum), sweeteners (e.g. aspartame, citric acid), preservatives (e.g., Thimerosal, benzyl alcohol, parabens), lubricants (e.g. stearic acid, magnesium stearate, polyethylene glycol, sodium lauryl sulfate), flow-aids (e.g. colloidal silicon dioxide), plasticizers (e.g. diethyl phthalate, triethyl citrate), emulsifiers (e.g. carbomer, hydroxypropyl cellulose, sodium lauryl sulfate), polymer coatings (e.g., poloxamers or poloxamines), coating and film forming agents (e.g. ethyl cellulose, acrylates, polymethacrylates) and/or adjuvants. Each of the above excipients represents a separate embodiment of the present invention.
[000125] In another embodiment, the pharmaceutical compositions provided herein are controlled- release compositions, i.e. compositions in which the vaccine, recombinant vector, or composition compound is released over a period of time after administration. Controlled- or sustained-release compositions include formulation in lipophilic depots (e.g. fatty acids, waxes, oils). In another embodiment, the composition is an immediate-release composition, i.e. a composition in which all of the vaccine, recombinant vector, or composition compound is released immediately after administration.
[000126] The compositions also include, in another embodiment, incorporation of the active material into or onto particulate preparations of polymeric compounds such as polylactic acid, polglycolic acid, hydrogels, etc, or onto liposomes, microemulsions, micelles, unilamellar or multilamellar vesicles, erythrocyte ghosts, or spheroplasts.) Such compositions will influence the physical state, solubility, stability, rate of in vivo release, and rate of in vivo clearance.
[000127] Also comprehended by the invention are particulate compositions coated with polymers (e.g. poloxamers or poloxamines) and the compound coupled to antibodies directed against tissue-specific receptors, ligands or antigens or coupled to ligands of tissue-specific receptors.
[000128]Each of the above additives, excipients, formulations andmethods of administration represents a separate embodiment of the present invention.
[000129] In another embodiment, the term "administering" refers to bringing a subject in contact with a vaccine, recombinant vector, or composition compound of the present invention. In another embodiment, administration is accomplished in vitro, i.e. in a test tube. In another embodiment, administration is accomplished in vivo, i.e. in cells or tissues of a living organism. Each possibility represents a separate embodiment of the present invention.
[00013O]In another embodiment, the methods of the present invention comprise administering a vaccine, recombinant vector, or composition of the present invention as the sole active ingredient. However, also encompassed within the scope of the present invention are methods that comprise administering the vaccine, recombinant vector, or composition in combination with one or more therapeutic agents. Each possibility represents a separate embodiment of the present invention.
EXPERIMENTAL DETAILS SECTION
EXAMPLE 1: FUSION OF ALLO TO E7 AND ADDITION OF CYTOKINE EXPRESSING PLASMIDS ENHANCE IMMUNITY ELICITED BY E7-EXPRESSING
PLASMIDS
MATERIALS AND EXPERIMENTAL METHODS
Mice
[000131] 6-8 week-old C57BL/6 mice were obtained from Charles River Laboratories (Wilmington,
MA).
Subcloning
[000132] pGG-55, the source of the ΔLLO-E7 gene for the constructs, contains an hly- HPV 16 E7 fusion gene (including the hly promoter and the portion of hly encoding the first 441 amino acids of LLO; referred to below as "ΔLLO") fused to E7. To generate the ΔLLO-E7-expressing plasmid (pcDNA3.1-ΔLLO-E7), ΔLLO-E7 DNA (encoding a fusion of ΔLLO to E7) was amplified from pGG55 by PCR using primers that introduced Nhe I and Not I restriction sites at the 5' and 3' ends of the amplified fragments, respectively. Amplified ΔLLO-E7 DNA was then cloned into the unique Nhe I and Not I cloning sites of the pcDNA3.1 (-) expression vector (Invitrogen, Carlsbad, CA) downstream of the cytomegalovirus promoter. pcDNA3.1-ΔLLO-IRES-E7, expressing ΔLLO and E7 as separate proteins, was generated from the ΔLLO-E7 -expressing parent plasmid by inserting a PCR-amplified IRES element into a unique Xho I site located between the ΔLLO and E7 elements. The IRES element was amplified from MIGRl, obtained from Dr. W. Pear (University of Pennsylvania). pcDNA3.1-ΔLLO, expressing ΔLLO alone was generated from the same parent plasmid by excising the E7 element and inserting a linker encoding a stop codon (Figure 3A). Ability of these vectors to mediate transcription of the appropriate DNA elements was tested by transient transfection in 293FT cells and RT-PCR, which demonstrated recovery of mRNA specific for these
constructs (Figure 3B). Expression was also verified by Western blot, which showed the presence of ΔLLO protein of the appropriate molecular weight in cell Iy sates. pcDNA-E7 was obtained from Dr. T-C. Wu, The Johns Hopkins Medical Institutes, Baltimore, Maryland. The resulting plasmid expressed the proteins under control of the CMV promoter. E7 DNA was cloned into the unique BamHI and HindIII cloning sites of the pcDNA3.1(-).
[000133] pcDNA-GM-CSF and pcDNA-MIP-lα were obtained from Dr. David Weiner, University of Pennsylvania, Philadelphia, Pennsylvania. Murine GM-CSF DNA was cloned into the unique EcoRI and Xbal cloning sites of the pcDNA3.1. Human MIP- 1 α DNA was cloned into the unique Kpnl and BamHI cloning sites of the pcDNA3.1.
[000134] ΔLLO-E7 and E7 plasmids were purified by Puresin Inc. (Malvern, Pennsylvania). Plasmids ΔLLO-IRES-E7, ΔLLO, GM-CSF and MEP-lα were purified using Qiagen plasmid mega kits (Qiagen Sciences, Maryland). DNA concentration was determined by the A260. The presence of the insert was confirmed by restriction enzyme digestion and gel electrophoresis.
Experimental setup
[000135] TC-I cells were injected into C57BL/6 mice subcutaneously at a dose of 2 x 104 cells/mouse in the left flank. 3 and 10 days later, mice were injected intramuscularly with 50 μg each of plasmid(s). The shortest and longest surface diameters of the tumors were measured every 3 days with calipers. Mice were sacrificed if mean tumor diameter reached 20 mm; tumor diameters are shown only for the surviving mice. Splenocytes were harvested 7 or 9 days after the booster injection.
Statistical analyses
[000136] Statistical analyses were performed using Student's t-test throughout the Examples.
RESULTS
[000137] The anti-tumor efficacy of E7-expressing DNA vaccines was examined. C57BL/6 mice immunized with ΔLLO-E7 together with GM-CSF- and MIP-lα-expressing plasmids. While the E7 DNA did not halt tumor growth in 7/8 mice, ΔLLO-E7 induced complete regression of the tumors in 5/8 mice (Figure 1).
[000138] Thus, a DNA vaccine expressing a fusion of E7 to a fragment of LLO is efficacious at
inducing an immune response.
EXAMPLE 2: LLO-E7 PLASMIDS ELICIT E7-SPECIFIC CD8+ T CELLS
MATERIALS AND EXPERIMENTAL METHODS
[000139] 3-color flow cytometry for CD8 (53-6.7, FITC conjugated), CD62 ligand (CD62L; MEL-14, APC conjugated), and PE conjugated-E7 H-2Db tetramer was performed using a FACSCalibur® flow cytometer with CellQuest® software (Becton Dickinson, Mountain View, CA). Splenocytes were stained at room temperature with H-2Db tetramers loaded with the E7 peptide (RAHYNIVTF; SEQ ID No: 4). Tetramers were provided by the National Institute of Allergy and Infectious Diseases Tetramer Core Facility and were used at a 1 :200 dilution. The CD8+, CD62Llow subset was selected, and percentages of tetramer"1" cells were compared using Flow Jo® software (Tree Star, Inc, Ashland, OR).
RESULTS
[000140] Next, abilities of the E7 DNA vaccines to induce E7-specific CD8+ T cells were determined.9 days after the second immunization with E7 or ΔLLO-E7 plasmid plus the plasmids encoding GM- CSF and MIP- lα, splenocytes were isolated and stained with H-2Db tetramers loaded with the E7 peptide. The ΔLLO-E7 plasmid induced a response of 3.9% of tetramer-positive CD8+ T cells, while the E7 plasmid did not induce detectable numbers of tetramer-positive CD8+ T cells over background levels (Figure 2). These results confirm the ability of E7 DNA vaccines to elicit anti-E7 CD8+ T cell responses.
EXAMPLE 3: LLO GENES NEED NOT BE ON THE SAME PLASMID AS ANTIGEN
GENES TO ENHANCE ANTIGEN-SPECIFIC IMMUNE RESPONSES
[000141] The pcDNA3.1 -ΔLLO-E7 plasmid was modified to create constructs expressing either ΔLLO alone or ΔLLO and E7 from the same mRNA transcript, but in different open reading frames (using an internal ribosomal entry site (IRES). Ability of these constructs to induce anti-tumor immunity was compared with the ΔLLO-E7 plasmid. C57BL/6 mice (n=8) were injected with TC-I cells as described in Example 1, then vaccinated 3 and 10 days later with 50 μg of various ΔLLO and E7 plasmids mixed with the GM-CSF and MIP- lα plasmids. ΔLLO-E7 induced complete tumor
regression in 5/8 mice (62.5%), while both ΔLLO-IRES-E7 and the ΔLLO and E7 plasmids, administered together as a mixture, induced complete tumor regression in 3/8 mice (37.5%). Tumor regression was not observed in the other 5 groups ((a) no treatment (b) empty vector, (c) E7 alone, (d) ΔLLO alone and (e) ΔLLO + E7 plasmids, injected at separate sites [the opposite quadriceps muscles]; Figure 4).
[000142] These findings show that LLO-encoding DNA injected at the same site as the gene encoding the antigen enhances the immunogenicity of DNA vaccines, even when it is not on the same plasmid/nucleotide molecule, or not in the same open reading frame, as the antigen gene.
EXAMPLE 4; FUSION OF THE LLO GENE TO THE ANTIGEN GENE
SIGNIFICANTLY ENHANCES ANTIGEN-SPECIFIC CD8+ T CELL RESPONSES
MATERIALS AND EXPERIMENTAL METHODS
ELISPOT assays
[000143] 96-well filtration plates (Millipore, Bedford, MA) were coated with 15 μg/ml rat anti-mouse IFN-γ antibody (clone ANl 8, MABTECH, Mariemont, OH) in 100 μl of PBS. After overnight incubation at 4° C, the wells were washed and blocked with culture medium containing 10% fetal bovine serum. Splenocytes (I x 105/well) were added to the wells along with 5 μg/ml of E7 protein or E7-specific H-2Db CTL epitope plus IL-2 (5 units (U)/ml) and were incubated at 37° C for 24 hrs. Plates were washed, incubated with 1 μg/ml biotinylated IFN-γ antibody (clone R4-6A2, MABTECH, Mariemont, OH) in 100 μl PBS, 4° C, overnight, washed again, and incubated with 1:100 streptavidin-horseradish peroxidase in 100 μl PBS for 2 hrs at room temperature (rt). Plates were washed and incubated with 100 μl of substrate for 15 min, rt. Color development was stopped by washing extensively, and spots were counted on an ELISPOT reader.
Depletion of CD8+ cells and CD4+ cells
[000144] CD8+ cells (this Example) and CD4+ cells (following Example) were depleted using magnetic beads coated with magnetic beads coated with anti-CD8 or anti-CD4 monoclonal antibodies (Miltenyi Biotec, Auburn CA), respectively.
RESULTS
[000145] To compare CD8+ T cell responses induced by the various E7 DNA vaccines, mice were immunized and boosted 7 days later with 50 μg of the constructs described in the previous Example, mixed with GM-CSF and MIP-lα-expressing plasmids before injection. Splenocytes were harvested 7 days after boosting, were cultured with the E7-specific H-2Db CTL epitope peptide, RAHYNIVTF and EL-2 (5 U/rnl), and the number of E7-specific, IFN-γ-producing CD8+ T cells was determined by ELISPOT. ΔLLO-E7 fusion DNA significantly enhanced IFN-γ-producing CD8+ T cells (p < 0.01 compared to each of the other groups), while the other vaccines (E7, ΔLLO-IRES-E7 or a mixture of ΔLLO and E7) did not induce detectable numbers of IFN-γ-producing CD8+ T cells compared to the ΔLLO control (Figure 5). When CD8+ cells were depleted, using magnetic beads coated with anti- CD8 monoclonal antibodies, the numbers of IFN-γ-secreting CD8+ T cells were significantly diminished in the ΔLLO-E7 mice, but were unchanged in the other groups. Thus, the IFN-γ producing-cells induced by ΔLLO-E7 were CD8+ T cells.
EXAMPLE 5: LLO GENES NEED NOT BE ON THE SAME PLASMID AS ANTIGEN GENES TO INDUCE FORMATION OF ANTIGEN-SPECIFIC CD4+ T CELLS
[000146] To determine the ability of the DNA vaccines to elicit E7-specific CD4+ T cell responses, ELISPOT analyses were performed as described in Example 4, in this case using 5 μg/ml exogenous E7 protein instead of the CTL epitope peptide in order to stimulate CD4+ as well as CD8+ T cells. While all the E7-containing interventions induced IFN-γ secreting CD4+ T cells, the numbers induced by ΔLLO-IRES-E7, ΔLLO + E7 (mixed) and ΔLLO-E7 were significantly greater than E7 DNA alone or ΔLLO+E7 (separate) (P < 0.05). In addition, induction by ΔLLO-E7 was significantly greater than ΔLLO-IRES-E7 and ΔLLO+E7 (mixed) (p<0.05). As expected, the negative controls (empty vector and ΔLLO) did not induce IFN-γ secreting cells. E7 and ΔLLO + E7 (separate) induced 575 ± 62 and 396 + 31 SFC (spot forming cells) per 105 spleen cells, respectively; these numbers were significantly greater (p < 0.01) relative to the negative controls (Figure 6).
[000147] To determine the composition of the IFN-γ secreting cells in the above assay, CD4+ and CD8+ T cells were depleted in separate samples prior to the assay. Depletion of CD8+ cells, leaving only the CD4+ antigen-specific cells, resulted in equal numbers of IFN-γ secreting-cells between the three groups with the highest responses (ΔLLO-IRES-E7, ΔLLO + E7 (mixed) and ΔLLO-E7). These
results show that LLO fragments need not be fused to an antigen for elicitation of CD4+ T cell responses; rather, the LLO fragments may be either in the form of bicistronic message or administered on a separate plasmid/nucleotide molecule at the same site as the antigen.
[000148] Depletion of CD4+ cells resulted in a reduction of the number of IFN-γ secreting-cells to background levels for each vaccine group, indicating that the E7-specific EFN-γ secreting-cells were CD4+ T cells.
EXAMPLE 6: CD4+ T CELLS INDUCED BY ΔLLO-E7 DNA VACCINES ARE ThI CD4+
CELLS
[000149] To determine levels of HPV 16 E7-specific antibody in the sera, mice were immunized twice with empty vector, E7 or ΔLLO-E7 DNA, together with the GM-CSF and MIP-Ia plasmids. Blood was collected at day 14 after the boost and subjected to anti-E7 ELISA using 96-well plates coated with E7 protein. No anti-E7 IgG was detected in the sera of any vaccinated mice, while the positive control (a commercial anti-E7 monoclonal antibody) was well detected by the ELISA. Thus, the CD4+ T cells induced by ΔLLO-E7 were ThI CD4+ cells.
Claims
1. A DNA vaccine, comprising a nucleotide molecule that encodes a fusion protein, comprising
an N-terminal fragment of a listeriolysin (LLO) protein and an antigen.
2. The DNA vaccine of claim 1, wherein said antigen is a tumor antigen.
3. The DNA vaccine of claim 1 , wherein said antigen is an infectious disease antigen.
4. The DNA vaccine of claim 1, wherein said antigen is an HPV E7 protein or a fragment
thereof.
5. The DNA vaccine of claim 1, wherein said antigen is Her-2, bcr/abl, HPV E6, MZ2-E,
MAGE-I and MUC-I, NY/ESO-1, Wilms tumor antigen, telomerase, Proteinase 3, or
Tyrosinase related protein 2; or a fragment thereof.
6. A method of impeding a growth of a tumor in a subject, said method comprising administering
to said subject the DNA vaccine of claim 2, wherein said tumor expresses the tumor antigen of claim 2, whereby said composition elicits in said subject an immune response against said
tumor antigen, thereby impeding a growth of a tumor in a subject.
7. The method of claim 6, wherein said immune response is a CD4+ T cell response.
8. The method of claim 6, wherein said immune response is a CD8+ T cell response.
9. A method of reducing a size of a tumor in a subject, said method comprising administering to
said subject the DNA vaccine of claim 2, wherein said tumor expresses the tumor antigen of
claim 2, whereby said composition elicits in said subject an immune response against said
tumor, thereby reducing a size of a tumor in a subject.
10. The method of claim 9, wherein said immune response is a CD4+ T cell response.
11. The method of claim 9, wherein said immune response is a CD8+ T cell response.
12. A method of invoking a CD4+ T cell-mediated immune response in a subject against a tumor
antigen, said method comprising administering to said subject the DNA vaccine of claim 2,
. wherein said tumor expresses the tumor antigen of claim 2, whereby said composition elicits
in said subject an immune response against said tumor, thereby invoking a CD4+ T cell-
mediated immune response in a subject against a tumor antigen.
13. A method of reducing an incidence or severity of an infectious disease in a subject, said
method comprising administering to said subject the DNA vaccine of claim 3, wherein said
tumor expresses the infectious disease antigen of claim 3, whereby said composition elicits in
said subject an immune response against said tumor antigen, thereby reducing an incidence or
severity of an infectious disease in a subject.
14. The method of claim 13, wherein said immune response is a CD4+ T cell response.
15. The method of claim 13, wherein said immune response is a CD8+ T cell response.
16. A method of invoking a CD4+ T cell-mediated immune response in a subject against an
infectious disease antigen, said method comprising administering to said subject the DNA
vaccine of claim 3, wherein said tumor expresses the infectious disease antigen of claim 3,
thereby invoking a CD4+ T cell-mediated immune response in a subject against an infectious
disease.
17. A composition comprising a first plasmid encoding a fusion of an N-terminal fragment of a
listeriolysin (LLO) protein to an antigen and a second plasmid encoding a cytokine or immune-stimulating molecule.
18. The composition of claim 17, wherein said antigen is a tumor antigen.
19. The composition of claim 17, wherein said antigen is an infectious disease antigen.
20. The composition of claim 17, wherein said antigen is an HPV E7 protein or a fragment
thereof.
21. The composition of claim 17, wherein said antigen is Her-2, bcr/abl, HPV E6, MZ2-E,
MAGE-I and MUC-I, NY/ESO-1, Wilms tumor antigen, telomerase, Proteinase 3, or
Tyrosinase related protein; or a fragment thereof.
22. The composition of claim 17, wherein said cytokine is granulocyte macrophage colony
stimulating factor (GM-CSF).
23. The composition of claim 17, wherein said cytokine is MIP-Ia.
24. A method of impeding a growth of a tumor in a subject, said method comprising administering
to said subject the composition of claim 17, wherein said tumor expresses the antigen of claim
17, whereby said composition elicits in said subject an immune response against said tumor
antigen, thereby impeding a growth of a tumor in a subject.
25. The method of claim 24, wherein said immune response comprises a CD4+ T cell response.
26. The method of claim 24, wherein said immune response comprises a CD8+ T cell response.
27. A method of reducing a size of a tumor in a subject, said method comprising administering to
said subject the composition of claim 17, wherein said tumor expresses the antigen of claim
17, whereby said composition elicits in said subject an immune response against said tumor, thereby reducing a size of a tumor in a subject.
28. The method of claim 27, wherein said immune response comprises a CD4+ T cell response.
29. The method of claim 27, wherein said immune response comprises a CD8+ T cell response.
30. A method of invoking a CD4+ T cell-mediated immune response in a subject against a tumor
antigen, said method comprising administering to said subject the composition of claim 17,
wherein said tumor expresses the antigen of claim 17, thereby invoking a CD4+ T cell-
mediated immune response in a subject against a tumor antigen.
31. A recombinant vector, comprising a gene encoding an N- terminal fragment of a listeriolysin
(LLO) protein and a gene encoding an antigen, wherein said gene encoding an N-terminal
fragment of an LLO protein and said gene encoding an antigen are in separate open reading
frames.
32. The recombinant vector of claim 31 , wherein said antigen is a tumor antigen.
33. The recombinant vector of claim 31, wherein said antigen is an infectious disease antigen.
34. A method of invoking a CD4+ T cell-mediated immune response in a subject against an
antigen, said method comprising administering to said subject a recombinant vector, said
recombinant vector comprising a first gene encoding an N-terminal fragment of a listeriolysin
(LLO) protein and a second gene encoding a peptide comprising said antigen, wherein said
first gene and said second gene are in separate open reading frames, thereby invoking a CD4+
T cell-mediated immune response in a subject against an antigen.
35. The method of claim 34, wherein said antigen is a tumor antigen.
36. The method of claim 34, wherein said antigen is an infectious disease antigen.
37. The method of claim 34, wherein said antigen is an HPV E7 protein or a fragment thereof.
38. The method of claim 34, wherein said antigen is Her-2, bcr/abl, HPV E6, MZ2-E, MAGE- 1
and MUC-I, NY/ESO-1, Wilms tumor antigen, telomerase, Proteinase 3, or Tyrosinase
related protein 2; or a fragment thereof.
39. The method of claim 34, wherein said CD4+ T cell-mediated immune response is
predominantly or entirely a ThI CD4+ T cell-mediated immune response.
40. The method of claim 34, further comprising administering a plasmid to said subject, wherein
said plasmid encodes a cytokine or immune-stimulating molecule.
41. A method of invoking a CD4+ T cell-mediated immune response in a subject against an
antigen, said method comprising administering to said subject a composition comprising a first
nucleotide molecule encoding an N-terminal fragment of a listeriolysin (LLO) protein and a
second nucleotide molecule encoding a peptide comprising said antigen, thereby invoking a
CD4+ T cell-mediated immune response in a subject against an antigen.
42. The method of claim 41, wherein said antigen is a tumor antigen.
43. The method of claim 41, wherein said antigen is an infectious disease antigen.
44. The method of claim 41 , wherein first nucleotide molecule or said second nucleotide molecule
is a recombinant plasmid or recombinant vector.
45. The method of claim 41, wherein said CD4+ T cell-mediated immune response is
predominantly or entirely a ThI CD4+ T cell-mediated immune response.
46. The method of claim 41 , further comprising administering a plasmid to said subject, wherein
said plasmid encodes a cytokine or immune-stimulating molecule.
47. A method of invoking a CD4+ T cell-mediated immune response in a subject against an
antigen, said method comprising administering to said subject composition comprising an N-
terminal fragment of a listeriolysin (LLO) protein and a nucleotide molecule encoding a
peptide comprising said antigen, thereby invoking a CD4+ T cell-mediated immune response
in a subject against an antigen.
48. The method of claim 47, wherein said antigen is a tumor antigen.
49. The method of claim 47, wherein said antigen is an infectious disease antigen.
50. The method of claim 47, wherein nucleotide molecule is a recombinant plasmid or
recombinant vector.
51. The method of claim 47, wherein said CD4+ T cell-mediated immune response is
predominantly or entirely a ThI CD4+ T cell-mediated immune response.
52. The method of claim 47 , further comprising administering a plasmid to said subject, wherein
said plasmid encodes a cytokine or immune-stimulating molecule.
53. A method of impeding a growth of an antigen-expressing tumor in a subject, said method
comprising administering to said subject a recombinant vector, said recombinant vector
comprising a first gene encoding an N-terminal fragment of a listeriolysin (LLO) protein and a
second gene encoding a peptide comprising said antigen, wherein said first gene and said
second gene are in separate open reading frames, thereby impeding a growth of an antigen-
expressing tumor in a subject.
54. The method of claim 54, wherein said antigen is a tumor antigen.
55. The method of claim 54, wherein said antigen is an infectious disease antigen.
56. The method of claim 54, wherein said CD4+ T cell-mediated immune response is
predominantly or entirely a ThI CD4+ T cell-mediated immune response.
57. The method of claim 54, further comprising administering a plasmid to said subject, wherein
said plasmid encodes a cytokine or immune-stimulating molecule.
58. A method of impeding a growth of an antigen-expressing tumor in a subject, said method
comprising administering to said subject a composition comprising a first nucleotide molecule
encoding an N-terminal fragment of a listeriolysin (LLO) protein and a second nucleotide molecule encoding a peptide comprising said antigen, thereby impeding a growth of an
antigen-expressing tumor in a subject.
59. The method of claim 58, wherein said antigen is a tumor antigen.
60. The method of claim 58, wherein said antigen is an infectious disease antigen.
61. The method of claim 58, wherein first nucleotide molecule or said second nucleotide molecule
is a recombinant plasmid or recombinant vector.
62. The method of claim 58, wherein said CD4+ T cell-mediated immune response is
predominantly or entirely a ThI CD4+ T cell-mediated immune response.
63. The method of claim 58, further comprising administering a plasmid to said subject, wherein
said plasmid encodes a cytokine or immune- stimulating molecule.
64. A method of reducing a size of an antigen-expressing tumor in a subject, said method comprising administering to said subject a recombinant vector, said recombinant vector
comprising a first gene encoding an N-terminal fragment of a listeriolysin (LLO) protein and a
second gene encoding a peptide comprising said antigen, wherein said first gene and said
second gene are in separate open reading frames, thereby reducing a size of an antigen-
expressing tumor in a subject.
65. The method of claim 64, wherein said antigen is a tumor antigen.
66. The method of claim 64, wherein said antigen is an infectious disease antigen.
67. The method of claim 64, wherein said CD4+ T cell-mediated immune response is
predominantly or entirely a ThI CD4+ T cell-mediated immune response.
68. The method of claim 64, further comprising administering a plasmid to said subject, wherein
said plasmid encodes a cytokine or immune-stimulating molecule.
69. A method of reducing a size of an antigen-expressing tumor in a subject, said method
comprising administering to said subject a composition comprising a first nucleotide molecule
encoding an N-terminal fragment of a listeriolysin (LLO) protein and a second nucleotide
molecule encoding a peptide comprising said antigen, thereby reducing a size of an antigen-
expressing tumor in a subject.
70. The method of claim 69, wherein said antigen is a tumor antigen.
71. The method of claim 69, wherein said antigen is an infectious disease antigen.
72. The method of claim 69, wherein first nucleotide molecule or said second nucleotide molecule
is a recombinant plasmid or recombinant vector.
73. The method of claim 69, wherein said CD4+ T cell-mediated immune response is
predominantly or entirely a ThI CD4+ T cell-mediated immune response.
74. The method of claim 69, further comprising administering a plasmid to said subject, wherein
said plasmid encodes a cytokine or immune-stimulating molecule.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US73518405P | 2005-11-10 | 2005-11-10 | |
US60/735,184 | 2005-11-10 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2007059030A2 true WO2007059030A2 (en) | 2007-05-24 |
WO2007059030A3 WO2007059030A3 (en) | 2007-11-29 |
Family
ID=38049194
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2006/043987 WO2007059030A2 (en) | 2005-11-10 | 2006-11-13 | Llo-encoding dna/nucleic acid vaccines and methods comprising same |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2007059030A2 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2016061182A1 (en) * | 2014-10-14 | 2016-04-21 | The Trustees Of The University Of Pennsylvania | Combination therapy for use in cancer therapy |
-
2006
- 2006-11-13 WO PCT/US2006/043987 patent/WO2007059030A2/en active Application Filing
Non-Patent Citations (4)
Title |
---|
BU Z.: 'Enhancement of immune response to an HIV env DNA vaccine by a c-terminal segement of listeriolysin O' AIDS RESEARCH AND HUMAN RETROVIRUSES vol. 19, 2003, pages 409 - 420 * |
RADFORD K.J. ET AL.: 'A recombinant e. coli vaccine to promote MHC class I-dependent antigen presentation: application to cancer immunotherapy' GENE THERAPY vol. 9, 2002, pages 1455 - 1463 * |
SAFLEY S.A. ET AL.: 'Role of listeriolysin in the T lymphocyte response to infection with listeria monocytogenes' J. OF IMMUNOLOGY vol. 146, 1991, pages 3604 - 3616 * |
YE L.: 'Enhanced immunogenicity of SIV Gag DNA vaccines encoding chimeric proteins containing a C-terminal segment of Listeriolysin O' VIRUS RESEARCH vol. 97, 2003, pages 7 - 16 * |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2016061182A1 (en) * | 2014-10-14 | 2016-04-21 | The Trustees Of The University Of Pennsylvania | Combination therapy for use in cancer therapy |
Also Published As
Publication number | Publication date |
---|---|
WO2007059030A3 (en) | 2007-11-29 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
JP7252180B2 (en) | Methods and compositions for intranasal immunization with recombinant MVA encoding flagellin | |
US20230357781A1 (en) | Listeria-based compositions comprising a peptide minigene expression system and methods of use thereof | |
US20060093582A1 (en) | Listeria-based and LLO-based vaccines | |
US9549973B2 (en) | Compositions and methods comprising KLK3 or FOLH1 antigen | |
US8241636B2 (en) | Compositions comprising HMW-MAA and fragments thereof, and methods of use thereof | |
US20190032064A1 (en) | Personalized Delivery Vector-Based Immunotherapy and Uses Thereof | |
US20160220652A1 (en) | Methods of using recombinant listeria vaccine strains in disease immunotherapy | |
US20080124354A1 (en) | Methods for administering tumor vaccines | |
JP2017522322A (en) | Listeria-based immunogenic compositions for eliciting anti-tumor responses | |
WO2011100754A1 (en) | Live listeria-based vaccines for central nervous system therapy | |
US20080241069A1 (en) | Methods and compositions for treating IgE-mediated diseases | |
WO2016126878A2 (en) | Listeria-based immunomodulation | |
De Marco et al. | DNA vaccines against HPV-16 E7-expressing tumour cells | |
WO2007059030A2 (en) | Llo-encoding dna/nucleic acid vaccines and methods comprising same |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
NENP | Non-entry into the national phase |
Ref country code: DE |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 06837441 Country of ref document: EP Kind code of ref document: A2 |