WO2006095166A1 - Modified pyy (3-36) peptides and their effects on feeding behaviour - Google Patents
Modified pyy (3-36) peptides and their effects on feeding behaviour Download PDFInfo
- Publication number
- WO2006095166A1 WO2006095166A1 PCT/GB2006/000822 GB2006000822W WO2006095166A1 WO 2006095166 A1 WO2006095166 A1 WO 2006095166A1 GB 2006000822 W GB2006000822 W GB 2006000822W WO 2006095166 A1 WO2006095166 A1 WO 2006095166A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- compound
- subject
- pyy
- appetite
- intake
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- obesity is complex and multi-factorial. Increasing evidence suggests that obesity is not a simple problem of self-control but is a complex disorder involving appetite regulation and energy metabolism. In addition, obesity is associated with a variety of conditions associated with increased morbidity and mortality in a population. Although the etiology of obesity is not definitively established, genetic, metabolic, biochemical, cultural and psychosocial factors are believed to contribute. In general, obesity has been described as a condition in which excess body fat puts an individual at a health risk.
- peripheral administration of peptide YY (hereinafter PYY), or an agonist thereof, to a subject results in decreased food intake, caloric intake, and appetite, and an alteration in energy metabolism.
- PYY or agonist thereof is preferably an N-terminally deleted PYY molecule PYY 3-36 .
- the present invention provides a compound of formula (I):
- the invention also provides uses of a compound of formula (I), methods that use a compound of formula (I), compositions comprising a compound of formula (I), and methods of making a compound of formula (I).
- Figure 1 shows the results of experiments in which the appetite suppressing effects in mice of a compound of the invention were compared with native PYY(3-36), saline, allo- He PYY(3-36) or D-IIeP YY(3-36).
- Figures 2A and 2B show the results of experiments in which the appetite suppressing effects in mice of 30 and 100 ⁇ g/kg of a compound of the invention were compared with the same two quantities of native PYY(3-36) and saline.
- Figures 3 A and 3B show the results of experiments in which the appetite suppressing effects in rats of 30 and 100 ⁇ g/kg of a compound of the invention were compared with the same two quantities of native PYY(3-36) and saline.
- amino acid sequences listed in the application are shown using standard letter abbreviations for amino acids.
- Animal Living multi-cellular vertebrate organisms, a category that includes, for example, mammals and birds.
- the term mammal includes both human and non-human mammals.
- the term "subject” includes both human and veterinary subjects.
- Appetite A natural desire, or longing for food. In one embodiment, appetite is measured by a survey to assess the desire for food. Increased appetite generally leads to increased feeding behavior.
- appetite suppressants Compounds that decrease the desire for food.
- Commercially available appetite suppressants include, but are not limited to, amfepramone (diethylpropion), phentermine, mazindol and phenylpropanolamine fenfluramine, dexfenfluramine, and fluoxetine.
- Body Mass Index A mathematical formula for measuring body mass, also sometimes called Quetelet's Index.
- BMI is calculated by dividing weight (in kg) by height 2 (in meters 2 ).
- the current standards for both men and women accepted as "normal” are a BMI of 20-24.9 kg/m 2 .
- a BMI of greater than 25 kg/m 2 can be used to identify an obese subject.
- Grade I obesity corresponds to a BMI of 25-29.9 kg/m .
- Grade II obesity corresponds to a BMI of 30-40 kg/m 2 ; and Grade III obesity corresponds to a BMI greater than 40 kg/m 2 (Jequier, Am. J Clin. Nutr. 45:1035-47, 1987).
- Ideal body weight will vary among species and individuals based on height, body build, bone structure, and sex.
- Conservative substitutions The replacement of an amino acid residue by another, biologically similar residue in a polypeptide.
- the term "conservative variation” also includes the use of a substituted amino acid, i.e. an amino with one or more atoms replaced with another atom or group, in place of a parent amino acid provided that antibodies raised to the substituted polypeptide also immunoreact with the unsubstituted polypeptide.
- Diabetes A failure of cells to transport endogenous glucose across their membranes either because of an endogenous deficiency of insulin and/or a defect in insulin sensitivity. Diabetes is a chronic syndrome of impaired carbohydrate, protein, and fat metabolism owing to insufficient secretion of insulin or to target tissue insulin resistance. It occurs in two major forms: insulin-dependent diabetes mellitus (IDDM, type I) and non-insulin dependent diabetes mellitus (NIDDM, type II) which differ in etiology, pathology, genetics, age of onset, and treatment. The two major forms of diabetes are both characterized by an inability to deliver insulin in an amount and with the precise timing that is needed for control of glucose homeostasis.
- IDDM insulin-dependent diabetes mellitus
- NIDDM non-insulin dependent diabetes mellitus
- Diabetes type I or insulin dependent diabetes mellitus (IDDM) is caused by the destruction of ⁇ cells, which results in insufficient levels of endogenous insulin.
- Diabetes type II or non-insulin dependent diabetes, results from a defect in both the body's sensitivity to insulin, and a relative deficiency in insulin production.
- Food intake The amount of food consumed by an individual.
- Food intake can be measured by volume or by weight.
- food intake may be the total amount of food consumed by an individual.
- food intake may be the amount of proteins, fat, carbohydrates, cholesterol, vitamins, minerals, or any other food component, of the individual.
- Protein intake refers to the amount of protein consumed by an individual.
- fat intake “carbohydrate intake,” “cholesterol intake,” “vitamin intake,” and “mineral intake” refer to the amount of proteins, fat, carbohydrates, cholesterol, vitamins, or minerals consumed by an individual.
- Hyperpolarization A decrease in the membrane potential of a cell. Inhibitory neurotransmitters inhibit the transmission of nerve impulses via hyperpolarization. This hyperpolarization is called an inhibitory postsynaptic potential (IPSP). Although the threshold voltage of the cell is unchanged, a hyperpolarized cell requires a stronger excitatory stimulus to reach threshold.
- IIPSP inhibitory postsynaptic potential
- a normal daily diet can be expressed in terms of caloric intake, protein intake, carbohydrate intake, and/or fat intake.
- a normal daily diet in humans generally comprises the following: about 2,000, about 2,400, or about 2,800 to significantly more calories.
- a normal daily diet in humans generally includes about 12 g to about 45 g of protein, about 120 g to about 61O g of carbohydrate, and about 11 g to about 90 g of fat.
- a low calorie diet would be no more than about 85%, and preferably no more than about 70%, of the normal caloric intake of a human individual.
- the caloric and nutrient requirements vary depending on the species and size of the animal.
- the total caloric intake per pound, as well as the percent distribution of protein, carbohydrate and fat varies with the age of the cat and the reproductive state.
- a general guideline for cats is 40 cal/lb/day (18.2 cal/kg/day).
- About 30% to about 40% should be protein, about 7% to about 10% should be from carbohydrate, and about 50% to about 62.5% should be derived from fat intake.
- One of skill in the art can readily identify the normal daily diet of an individual of any species.
- Obesity A condition in which excess body fat may put a person at health risk (see
- BMI Body Mass Index
- waist circumference is used to assess obesity.
- men a waist circumference of 102 cm or more is considered obese, while in women a waist circumference of 89 cm or more is considered obese.
- Strong evidence shows that obesity affects both the morbidity and mortality of individuals.
- an obese individual is at increased risk for heart disease, non-insulin dependent (type 2) diabetes, hypertension, stroke, cancer (e.g. endometrial, breast, prostate, and colon cancer), dyslipidemia, gall bladder disease, sleep apnea, reduced fertility, and osteoarthritis, amongst others (see Lyznicki et al., Am. Fam. Phys. 63:2185, 2001).
- Overweight An individual who weighs more than their ideal body weight.
- An overweight individual can be obese, but is not necessarily obese.
- an overweight individual is any individual who desires to decrease their weight.
- an overweight individual is an individual with a BMI of 25.0 kg/m to 29.9 kg/m 2
- Pegylated and pegylation the process of reacting a poly(alkylene glycol), preferably an activated poly(alkylene glycol) to form a covalent bond.
- a facilitator may be used, for example an amino acid, e.g. lysine.
- pegylation is often carried out using poly(ethylene glycol) or derivatives thereof, such as methoxy poly(ethylene glycol), the term is not limited herein to the use of methoxy poly(ethylene glycol) but also includes the use of any other useful poly(alkylene glycol), for example poly(propylene glycol).
- PYY Peptide YY
- the term PYY as used herein refers to a peptide YY polypeptide, a hormone secreted into the blood by cells lining the lower small intestine (the ileum) and the colon.
- Peripheral Administration Administration outside of the central nervous system. Peripheral administration does not include direct administration to the brain. Peripheral administration includes, but is not limited to intravascular, intramuscular, subcutaneous, inhalation, oral, rectal, transdermal or intra-nasal administration
- Polypeptide A polymer in which the monomers are amino acid residues which are joined together through amide bonds. When the amino acids are alpha-amino acids, either the L- optical isomer or the D-optical isomer can be used, the L-isomers being preferred.
- the terms "polypeptide” or "protein” as used herein encompass any amino acid sequence and include modified sequences such as glycoproteins.
- the term “polypeptide” specifically covers naturally occurring proteins, as well as those which are recombinantly or synthetically produced.
- polypeptide fragment refers to a portion of a polypeptide, for example a fragment which exhibits at least one useful sequence in binding a receptor.
- Biologically functional peptides refers to all fragments of a polypeptide that retain an activity of the polypeptide.
- Biologically functional peptides can also include fusion proteins, in which the peptide of interest has been fused to another peptide that does not decrease its desired activity.
- Therapeutically effective amount A dose sufficient to prevent advancement, or to cause regression of a disorder, or which is capable of relieving a sign or symptom of a disorder, or which is capable of achieving a desired result.
- a therapeutically effective amount of a compound of the invention is an amount sufficient to inhibit or halt weight gain, or an amount sufficient to decrease appetite, or an amount sufficient to reduce caloric intake or food intake or increase energy expenditure.
- the compounds of the invention as represented in formula (I) are related to PYY 3-36 and have D-allo-isoleucine at the position 3 of the PYY derivative molecule.
- the compounds can thus be named D-allo-Ile 3 PYY 3-36 .
- isoleucine is located at position 3. It has been found that administration of a particular quantity of D-allo-Ile 3 PYY 3-36 to rats results in a greater decrease in food intake than the same quantity of normal human PYY 3-36 , that is to say PYY 3-36 with isoleucine at position 3. It has further been found that found that found that administration of 30 ⁇ g/kg of D-allo-Ile 3 PYY 3-36 to rats or mice results in the same decrease in food intake as 100 ⁇ g/kg of native PYY 3-36 .
- D-allo-Ile 3 PYY 3-36 has a more sustained effect on food intake reduction.
- D-allo-Ile 3 PYY 3-36 was found to decrease food intake over the total period 0-4 hours to a greater extent than native PYY 3-36 .
- Increased duration of appetite suppression can be particularly important to avoid the effect known as "escape".
- a short duration appetite suppressant may reduce appetite for the time covered by one meal and, in that meal, the subject typically eats less food. If, however, the appetite suppressant is then metabolized or otherwise removed from the circulation of the subject, then by the time of the next mealtime, the subject can regain its "normal" appetite.
- the subject may in fact have an increased appetite by the time of the second meal. If the subject satisfies that appetite, it is possible for the food intake over the two meals, in total, to be no lower than the food intake would have been without the appetite suppressant. That is to say that the subject may have "escaped” from the effects of the appetite suppressant. "Escape” can be reduced by using additional doses of appetite suppressant, or by using an appetite suppressant with a longer duration of action. If the subject has a reduced appetite for longer, then the degree to which it can make up the missed food from one meal in the next meal is reduced as there is a practical limit to the total capacity for food in a particular meal.
- the PYY 4-36 is human PYY 4-36 .
- the human full length PYY polypeptide is shown in SEQ ID NO: 1 ; human PYY 4-36 is shown in SEQ ID NO: 2.
- the subscripts refer to the location on the full length PYY molecule in the species in question, beginning at the N-terminus.
- PYY 4-36 is a peptide PYY molecule lacking amino acids 1 to 3 at the N-terminus. Analogous numbering is used for other fragments and variants of PYY described herein.
- the PYY 4-36 in a molecule of the invention may be, or may be related to, a PYY from a species other than human.
- the sequence of PYYs of various species are included in Table 1(SEQ ID NOS: 3 to 10), including e.g. rat and pig PYY.
- the PYY 4-36 in a molecule of the invention may also be taken from any of those sequences.
- Rat YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY (SEQ ID NO: 3)
- Pig YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY (SEQ ID NO: 4) Guinea pig YPSKPEAPGSDASPEELARYYASLRHYLNLVTRQRY (SEQ ID NO: 5)
- Dogfish YPPKPENPGEDAPPEELAKYYSALRHYINLITRQRY (SEQ ID NO: 8) Lampetra FPPKPDNPGDNASPEQMARYKAAVRHYINLITRQRY (SEQ ID NO: 9)
- the compounds of the invention are typically selective for the Y2 receptor. That is, they bind with higher affinity to Y2 compared to other receptors, such as Yl, Y3, Y4, Y5 and Y6. These receptors are recognized based on binding affinities, pharmacology, and sequence (if known). Most, if not all of these receptors are G protein coupled receptors.
- the Yl receptor is generally considered to be postsynaptic and mediates many of the known actions of neuropeptide Y in the periphery.
- this receptor was described as having poor affinity for C-terminal fragments of neuropeptide Y, such as the 13-36 fragment, but interacts with the full length neuropeptide Y and peptide YY with equal affinity (e.g., see PCT publication WO 93/09227).
- the Y2 receptor is distinguished from Yl by exhibiting affinity for C- terminal fragments of neuropeptide Y.
- the Y2 receptor is most often differentiated by the affinity of neuropeptide Y(13-36), although the 3-36 fragment of neuropeptide Y and peptide YY provides improved affinity and selectivity (see Dumont et al., Society for Neuroscience Abstracts 19:726, 1993).
- Signal transmission through both the Yl and the Y2 receptors are coupled to the inhibition of adenylate cyclase. Binding to the Y2 receptor was also found to reduce the intracellular levels of calcium in the synapse by selective inhibition of N-type calcium channels.
- the Y2 receptor like the Yl receptors, exhibits differential coupling to second messengers (see U.S. Patent No. 6,355,478).
- Y2 receptors are found in a variety of brain regions, including the hippocampus, substantia nigra-lateralis, thalamus, hypothalamus, and brainstem.
- the human, murine, monkey and rat Y2 receptors have been cloned (e.g., see U.S. Patent No. 6,420,352 and U.S. Patent No. 6,355,478).
- the PYY 4-36 may be a variant of a native PYY 4 .
- 36 for example a variant of native human PYY 4- 36- Variants include PYY 4-36 molecules with deletions, insertions, inversions, repeats and substitutions, (e.g., conservative substitutions and non-conservative substitutions; see, e.g., Table 2 below) which retain at least some of the activity of a corresponding non-mutated PYY 4-36 molecule when in a molecule of the invention. More than one amino acid (e.g., 2, 3 or 4) can be deleted or inserted or substituted with another amino acid.
- More than one amino acid e.g., 2, 3 or 4
- the PYY 4- 36 as present in a compound of formula (I) preferably includes at least 29 amino acids of the native PYY 4-36 sequence.
- the C- terminal six amino acids of native PYY 4-36 are all present in a molecule of the invention.
- conservative substitutions are the replacements, for one another, among the aliphatic amino acids Ala, VaI, Leu and He; interchange of Ser and Thr containing hydroxy residues, interchange of the acidic residues Asp and GIu, interchange between the amide residues Asn and GIn, interchange of the basic residues Lys and Arg, interchange of the aromatic residues Phe and Tyr, and interchange of the small-sized amino acids Ala, Ser, Thr, Met and GIy.
- Guidance concerning how to make phenotypically silent amino acid substitutions, ie substitutions that do not alter the expressed phenotype, is provided in Bowie et al., Science 247:1306-1310, 1990.
- Variants of PYY 4-36 further include variants in which one or more amino acids (for example 2, 3 or 4) of PYY 4-36 of one species are substituted by an amino acid present at the equivalent position in PYY derived from a different species.
- the sequences of PYYs of various species are included in Table 1 above.
- variants of human PYY 4-36 include variants in which one or more amino acids (for example 2, 3 or 4) of human PYY 4- 36 are substituted by an amino acid present at the equivalent position in PYY derived from a different species.
- a compound of the invention may comprise the structure of formula (I) modified by well known processes including amidation, glycosylation, carbamylation, acylation, for example acetylation, sulfation, phosphylation, cyclization, lipidization and pegylation.
- the structure of formula (I) may be modified at random positions within the molecule, or at predetermined positions within the molecule and may include one, two, three or more attached chemical moieties.
- a compound of the invention may be a fusion protein, whereby the structure of formula (I) is fused to another protein or polypeptide (the fusion partner) using recombinant methods known in the art.
- a fusion protein may be synthetically synthesized by any known method.
- Such a fusion protein comprises the structure of formula (I).
- Any suitable peptide or protein can be used as the fusion partner (e.g., serum albumin, carbonic anhydrase, glutathione-S-transferase or thioredoxin, etc.).
- Preferred fusion partners will not have an adverse biological activity in vivo.
- Such fusion proteins may be made by linking the carboxy-terminus of the fusion partner to the amino-terminus of the structure of formula (I) or vice versa.
- a cleavable linker may be used to link the structure of formula (I) to the fusion partner.
- a resulting cleavable fusion protein may be cleaved in vivo such that an active form of a compound of the invention is released.
- cleavable linkers include, but are not limited to, the linkers D-D-D-D-Y, G-P-R, A-G- G and H-P-F-H-L, which can be cleaved by enterokinase, thrombin, ubiquitin cleaving enzyme and renin, respectively. See, e.g., U.S. Patent No. 6,410,707.
- a compound of the invention may be a physiologically functional derivative of the structure of formula (I).
- physiologically functional derivative is used herein to denote a chemical derivative of a compound of formula (I) having the same physiological function as the corresponding unmodified compound of formula (I).
- a physiologically functionally derivative may be convertible in the body to a compound of formula (I).
- examples of physiologically functional derivatives include esters, amides, and carbamates; preferably esters and amides.
- esters and amides of the compounds of the invention may comprise a C 1-6 alkyl-, C 5-10 aryl-, C 5-10 ar-C 1-6 alkyl-, or amino acid-ester or -amide attached at an appropriate site, for example at an acid group.
- Acyl side chains may be advantageous, for example, by their lipophilic nature causing the moiety to bind with albumin, thus causing a greatly reduced rate of clearance from a subject and so increasing half life and duration of effect.
- the acyl side chains may be lower acyl, for example C 1 - Cg acyl, especially C 1-6 acyl, they are preferred to be C 4-40 , in particular C 8-25 acyl, especially C 16 or C 18 acyl. Palmitoyl is especially preferred as an acyl side chain as is lauroyl.
- Acyl side chains may be added at any position on the peptide back bone.
- an acyl substituent may be attached to an amino acid residue in such a way that a carboxyl group of the acyl substituent forms an amide bond with an amino group of the amino acid residue.
- an acyl substituent may be attached to an amino acid residue in such a way that an amino group of the acyl substituent forms an amide bond with a carboxyl group of the amino acid residue.
- the present invention relates to an PYY derivative wherein an acyl substituent is attached to the parent peptide by means of a spacer.
- the acyl substituent may be attached to the PYY moiety by means of a spacer in such a way that a carboxyl group of the spacer forms an amide bond with an amino group of the PYY moiety. It is especially preferred to add an acyl side chain (optionally via a spacer) at a position in the peptide back bone where a lysine residue is found. This is because lysine, having a four carbon atom side chain terminating at an epsilon-amino group, is particularly suitable for easily adding an acyl side chain. It may be necessary to introduce lysine residue into the sequence solely for the purpose of providing a convenient site at which to add an acyl side chain.
- the acyl side chain may be added to the lysine residue in advance of the synthesis of the peptide, whereupon its incorporation at the relevant synthetic step will result directly in acylation.
- This methodology is advantageous if the peptide sequence contains more than one lysine residue as it avoids the necessity of using selective conditions that acylate only the particular lysine of interest.
- the peptide derivatives have three, more preferably two, and most preferably one acyl side chain substituent. Examples of acyl (and other lipophilic substituents), approaches and specific synthetic methods of attaching such to peptides (with and without the use of spacers) are described in U.S. Patent No. 6,268,343; and U.S. Patent Number 6,458,924.
- Pharmaceutically acceptable amides and carbonates of the compounds of formula (I) may comprise a C 1-6 alkyl-, C 5-10 aryl-, C 5-10 ar-C 1-6 alkyl-, or amino acid-ester or -amide, or - carbamate attached at an appropriate site, for example at an amino group.
- the disulfide linkage in lipidised derivative is relatively labile in the cells and thus facilitates intracellular release of the molecule from the fatty acid moieties.
- Suitable lipid-containing moieties are hydrophobic substituents with 4 to 26 carbon atoms, preferably 5 to 19 carbon atoms.
- Suitable lipid groups include, but are not limited to, the following: palmityl (C 15 H 31 ,), oleyl (C 15 H 29 ), stearyl (C 17 H 35 ), cholate; and deoxycholate.
- Cyclization methods include cyclization through the formation of a disulfide bridge and head-to-tail cyclization using a cyclization resin.
- Cyclized peptides may have enhanced stability, including increased resistance to enzymatic degradation, as a result of their conformational constraints. Cyclization may in particular be expedient where the uncyclized peptide includes an N-terminal cysteine group. Suitable cyclized peptides include monomeric and dimeric head-to-tail cyclized structures. Cyclized peptides may include one or more additional residues, especially an additional cysteine incorporated for the purpose of formation of a disulfide bond or a side chain incorporated for the purpose of resin-based cyclization.
- a compound of the invention may be a pegylated structure of formula (I).
- Pegylated compounds of the invention may provide additional advantages such as increased solubility, stability and circulating time of the polypeptide, or decreased immunogenicity (see U.S. Patent No. 4,179,337).
- Chemical moieties for derivitization of a compound of the invention may also be selected from water soluble polymers such as polyethylene glycol, ethylene glycol/propylene glycol copolymers, carboxymethylcellulose, dextran, polyvinyl alcohol and the like.
- a polymer moiety for derivatisation of a compound of the invention may be of any molecular weight, and may be branched or unbranched.
- the preferred molecular weight of a polyethylene glycol for derivatisation of a compound of the invention is from about 1 kDa to about 100 kDa, the term "about" indicating that in preparations of polyethylene glycol, some molecules will weigh more, some less, than the stated molecular weight.
- Polymers of other molecular weights may be used, depending on the desired therapeutic profile, for example the duration of sustained release desired, the effects, if any on biological activity, the ease in handling, the degree or lack of antigenicity and other known effects of the polyethylene glycol to a therapeutic protein or analog.
- the polyethylene glycol may have an average molecular weight of about 200, 500, 1000, 1500, 2000, 2500, 3000, 3500, 4000, 4500, 5000, 5500, 6000, 6500, 7000, 7500, 8000, 8500, 9000, 9500, 10,000, 10,500, 11,000, 11,500, 12,000, 12,500, 13,000, 13,500, 14,000, 14,500, 15,000, 15,500, 16,000, 16,500, 17,000, 17,500, 18,000, 18,500, 19,000, 19,500, 20,000, 25,000, 30,000, 35,00O 5 40,000, 50,000, 55,000, 60,000, 65,000, 70,000, 75,000, 80,000, 85,000, 90,000, 95,000, or 100,000 kDa.
- Salts and solvates of compounds of the invention that are suitable for use in a medicament are those wherein a counterion or associated solvent is pharmaceutically acceptable.
- salts and solvates having non-pharmaceutically acceptable counterions or associated solvents are within the scope of the present invention, for example, for use as intermediates in the preparation of the compounds of formula (I) and their pharmaceutically acceptable salts or solvates.
- Suitable salts according to the invention include those formed with organic or inorganic acids or bases.
- Pharmaceutically acceptable acid addition salts include those formed with hydrochloric, hydrobromic, sulphuric, nitric, citric, tartaric, acetic, phosphoric, lactic, pyruvic, acetic, trifluoroacetic, succinic, perchloric, fumaric, maleic, glycollic, lactic, salicylic, oxaloacetic, methanesulfonic, ethanesulfonic, p-toluenesulfonic, formic, benzoic, malonic, naphthalene-2 -sulfonic, benzenesulfonic, and isethionic acids.
- compositions of the invention include ammonium salts, alkali metal salts, for example potassium and sodium salts, alkaline earth metal salts, for example calcium and magnesium salts, and salts with organic bases, for example dicyclohexylamine and N-methyl-D-gluc ⁇ mine.
- the invention provides a pharmaceutical composition comprising a compound of formula (I).
- the invention further provides the compound of formula (I) for use as a medicament.
- the invention also provides a compound of formula (I) for use in the treatment of obesity or diabetes.
- the invention further provides a compound of formula (I) for use in reduction of appetite in a subject, for use in reduction of food intake in a subject, or for use in reduction of calorie intake in a subject.
- the invention further provides the use of a compound of formula (I) for the manufacture of a medicament for the treatment of obesity or diabetes.
- the invention also provides the use of a compound of formula (I) for the manufacture of a medicament for reducing appetite in a subject, reducing food intake in a subject, or reducing calorie intake in a subject.
- the invention further provides a method of treating obesity or diabetes in a subject in need thereof comprising administering to the subject an effective amount of a compound of formula (I).
- the invention also provides a method of reducing appetite in a subject, reducing food intake in a subject, or reducing calorie intake in a subject, comprising administering to the subject an effective amount of a compound of formula (I).
- the subject to whom the compound is administered may be overweight, for example, obese.
- the subject may be diabetic, for example having insulin resistance or glucose intolerance, or both.
- the subject may have diabetes mellitus, for example, the subject may have Type II diabetes.
- the subject may be overweight, for example, obese and have diabetes mellitus, for example, Type II diabetes.
- the subject may have, or may be at risk of having, a disorder in which obesity or being overweight is a risk factor.
- disorders include, but are not limited to, cardiovascular disease, for example hypertension, atherosclerosis, congestive heart failure, and dyslipidemia; stroke; gallbladder disease; osteoarthritis; sleep apnea; reproductive disorders for example, polycystic ovarian syndrome; cancers, for example breast, prostate, colon, endometrial, kidney, and esophagus cancer; varicose veins; acnthosis nigricans; eczema; exercise intolerance; insulin resistance; hypertension hypercholesterolemia; cholithiasis; osteoarthritis; orthopedic injury; insulin resistance, for example, type 2 diabetes and syndrome X; and thromboembolic disease (see Kopelman, Nature 404:635-43; Rissanen et al., British Med.
- obesity is a recognized risk factor for increased incidence of complications of general anesthesia. (See e.g., Kopelman, Nature 404:635-43, 2000). In general, obesity reduces life span and carries a serious risk of co-morbidities such as those listed above.
- CTS carpal tunnel syndrome
- CVI chronic venous insufficiency
- daytime sleepiness deep vein thrombosis
- DVT end stage renal disease
- ESRD end stage renal disease
- pancreatititis pancreatititis; as well as abdominal hernias; acanthosis nigricans; endocrine abnormalities; chronic hypoxia and hypercapnia; dermatological effects; elephantitis; gastroesophageal reflux; heel spurs; lower extremity edema; mammegaly which causes considerable problems such as bra strap pain, skin damage, cervical pain, chronic odors and infections in the skin folds under the breasts, etc.; large anterior abdominal wall masses, for example abdominal panniculitis with frequent panniculitis, impeding walking, causing frequent infections, odors, clothing difficulties, low back pain; musculoskeletal disease; pseudo tumor cerebri (or benign intracranial hypertension), and sliding hiatil hernia.
- the present invention further provides a method for increasing energy expenditure in a subject.
- the method includes, for example, peripherally administering a therapeutically effective amount of a compound of the invention to the subject, thereby altering energy expenditure.
- Energy is burned in all physiological processes.
- the body can alter the rate of energy expenditure directly, by modulating the efficiency of those processes, or changing the number and nature of processes that are occurring. For example, during digestion the body expends energy moving food through the bowel, and digesting food, and within cells, the efficiency of cellular metabolism can be altered to produce more or less heat.
- the method of the invention involves manipulation of the arcuate circuitry, that alter food intake coordinately and reciprocally alter energy expenditure. Energy expenditure is a result of cellular metabolism, protein synthesis, metabolic rate, and calorie utilization.
- administration of a compound of formula (I) results in increased energy expenditure, and decreased efficiency of calorie utilization
- the invention also provides a method for improving a lipid profile in a subject.
- the invention also provides a method for alleviating a condition or disorder that can be alleviated by reducing nutrient availability.
- Appetite can be measured by any means known to one of skill in the art.
- decreased appetite can be assessed by a psychological assessment.
- administration of a compound of the invention results in a change in perceived hunger, satiety, and/or fullness.
- Hunger can be assessed by any means known to one of skill in the art.
- hunger is assessed using psychological assays, such as by an assessment of hunger feelings and sensory perception using a questionnaire, such as, but not limited to, a Visual Analog Score (VAS) questionnaire.
- hunger is assessed by answering questions relating to desire for food, drink, prospective food consumption, nausea, and perceptions relating to smell or taste.
- a compound of the invention may be used for weight control and treatment, for example reduction or prevention of obesity, in particular any one or more of the following: preventing and reducing weight gain; inducing and promoting weight loss; and reducing obesity as measured by the Body Mass Index.
- a compound of the invention may be used in the control of any one or more of appetite, satiety and hunger, in particular any one or more of the following: reducing, suppressing and inhibiting appetite; inducing, increasing, enhancing and promoting satiety and sensations of satiety; and reducing, inhibiting and suppressing hunger and sensations of hunger.
- a compound of the invention may be used in maintaining any one or more of a desired body weight, a desired Body Mass Index, a desired appearance and good health.
- a subject may be a subject who desires weight loss, for example female and male subjects who desire a change in their appearance.
- a subject may desire decreased feelings of hunger, for example the subject may be a person involved in a lengthy task that requires a high level of concentration, for example soldiers on active duty, air traffic controllers, or truck drivers on long distance routes, etc..
- the present invention may also be used in treating, prevention, ameliorating or alleviating conditions or disorders caused by, complicated by, or aggravated by a relatively high nutrient availability.
- condition or disorder which can be alleviated by reducing caloric (or nutrient) availability is used herein to denote any condition or disorder in a subject that is either caused by, complicated by, or aggravated by a relatively high nutrient availability, or that can be alleviated by reducing nutrient availability, for example by decreasing food intake.
- Subjects who are insulin resistant, glucose intolerant; or have any form of diabetes mellitus, for example, type 1, 2 or gestational diabetes can also benefit from methods in accordance with the present invention.
- Conditions or disorders associated with increased caloric intake include, but are not limited to, insulin resistance, glucose intolerance, obesity, diabetes, including type 2 diabetes, eating disorders, insulin-resistance syndromes, and Alzheimer's disease.
- a compound of formula (I) is preferably used in the treatment of a human.
- the compounds of the invention will typically be used to treat human subjects they may also be used to treat similar or identical conditions in other vertebrates for example other primates; farm animals for example swine, cattle and poultry; sport animals for example horses; companion animals for example dogs and cats.
- the invention provides a pharmaceutical formulation comprising a compound of formula (I), or a variant or derivative thereof, or a salt or solvate thereof, as defined above and a pharmaceutically acceptable excipient.
- Pharmaceutical compositions of the invention may take the form of a pharmaceutical formulation as described below.
- the pharmaceutical formulations according to the invention include those suitable for oral, parenteral (including subcutaneous, intradermal, intramuscular, intravenous, and intraarticular), inhalation (including fine particle dusts or mists which may be generated by means of various types of metered does pressurized aerosols, nebulizers or insufflators), rectal and topical (including dermal, transdermal, transmucosal, buccal, sublingual, and intraocular) administration, although the most suitable route may depend upon, for example, the condition and disorder of the recipient.
- the formulations may conveniently be presented in unit dosage form and may be prepared by any of the methods well known in the art of pharmacy. All methods include the step of bringing the active ingredient into association with the carrier which constitutes one or more accessory ingredients. In general the formulations are prepared by uniformly and intimately bringing into association the active ingredient with liquid carriers or finely divided solid carriers or both and then, if necessary, shaping the product into the desired formulation.
- Formulations of the present invention suitable for oral administration may be presented as discrete units such as capsules, cachets or tablets each containing a predetermined amount of the active ingredient; as a powder or granules; as a solution or a suspension in an aqueous liquid or a non-aqueous liquid; or as an oil-in- water liquid emulsion or a water-in- oil liquid emulsion.
- the active ingredient may also be presented as a bolus, electuary or paste.
- Various pharmaceutically acceptable carriers and their formulation are described in standard formulation treatises, e.g., Remington's Pharmaceutical Sciences by E. W. Martin. See also Wang, Y. J. and Hanson, M. A., Journal of Parenteral Science and Technology, Technical Report No. 10, Supp. 42:2S, 1988.
- a tablet may be made by compression or moulding, optionally with one or more accessory ingredients.
- Compressed tablets may be prepared by compressing in a suitable machine the active ingredient in a free-flowing form such as a powder or granules, optionally mixed with a binder, lubricant, inert diluent, lubricating, surface active or dispersing agent.
- Moulded tablets may be made by moulding in a suitable machine a mixture of the powdered compound moistened with an inert liquid diluent.
- the tablets may optionally be coated or scored and may be formulated so as to provide slow or controlled release of the active ingredient therein.
- the present compounds can, for example, be administered in a form suitable for immediate release or extended release.
- Immediate release or extended release can be achieved by the use of suitable pharmaceutical compositions comprising the present compounds, or, particularly in the case of extended release, by the use of devices such as subcutaneous implants or osmotic pumps.
- the present compounds can also be administered liposomally.
- compositions for oral administration include suspensions which can contain, for example, microcrystalline cellulose for imparting bulk, alginic acid or sodium alginate as a suspending agent, methylcellulose as a viscosity enhancer, and sweeteners or flavoring agents such as those known in the art; and immediate release tablets which can contain, for example, microcrystalline cellulose, dicalcium phosphate, starch, magnesium stearate and/or lactose and/or other excipients, binders, extenders, disintegrants, diluents and lubricants such as those known in the art.
- the compounds of formula (I) can also be delivered through the oral cavity by sublingual and/or buccal administration.
- Molded tablets, compressed tablets or freeze-dried tablets are exemplary forms which may be used.
- Exemplary compositions include those formulating the present compound(s) with fast dissolving diluents such as mannitol, lactose, sucrose and/or cyclodextrins. Also included in such formulations may be high molecular weight excipients such as celluloses (avicel) or polyethylene glycols (PEG).
- Such formulations can also include an excipient to aid mucosal adhesion such as hydroxy propyl cellulose (HPC), hydroxy propyl methyl cellulose (HPMC), sodium carboxy methyl cellulose (SCMC), maleic anhydride copolymer (e.g., Gantrez), and agents to control release such as polyacrylic copolymer (e.g. Carbopol 934).
- HPC hydroxy propyl cellulose
- HPMC hydroxy propyl methyl cellulose
- SCMC sodium carboxy methyl cellulose
- maleic anhydride copolymer e.g., Gantrez
- agents to control release such as polyacrylic copolymer (e.g. Carbopol 934).
- Lubricants, glidants, flavors, coloring agents and stabilizers may also be added for ease of fabrication and use.
- Formulations for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents.
- the formulations may be presented in unit-dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze-dried (lyophilised) condition requiring only the addition of the sterile liquid carrier, for example saline or water-for-injection, immediately prior to use.
- compositions for parenteral administration include injectable solutions or suspensions which can contain, for example, suitable non- toxic, parenterally acceptable diluents or solvents, such as mannitol, 1,3-butanediol, water, Ringer's solution, an isotonic sodium chloride solution, or other suitable dispersing or wetting and suspending agents, including synthetic mono- or diglycerides, and fatty acids, including oleic acid, or Cremaphor.
- suitable non- toxic, parenterally acceptable diluents or solvents such as mannitol, 1,3-butanediol, water, Ringer's solution, an isotonic sodium chloride solution, or other suitable dispersing or wetting and suspending agents, including synthetic mono- or diglycerides, and fatty acids, including oleic acid, or Cremaphor.
- An aqueous carrier may be, for example, an isotonic buffer solution at a pH of from about 3.0 to about 8.0, preferably at a pH of from about 3.5 to about 7.4, for example from 3.5 to 6.0, for example from 3.5 to about 5.0.
- Useful buffers include sodium citrate-citric acid and sodium phosphate-phosphoric acid, and sodium acetate/acetic acid buffers.
- the composition preferably does not include oxidizing agents and other compounds that are known to be deleterious to PYY and PYY agonists. Excipients that can be included are, for instance, other proteins, such as human serum albumin or plasma preparations.
- the pharmaceutical composition may also contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.
- compositions for nasal aerosol or inhalation administration include solutions in saline, which can contain, for example, benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, and/or other solubilizing or dispersing agents such as those known in the art.
- a compositions for nasal aerosol or inhalation administration the compound of the invention is delivered in the form of an aerosol spray presentation from a pressurized pack or a nebulizer, with the use of a suitable propellant, e.g., dichlorodifluoro-methane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
- a suitable propellant e.g., dichlorodifluoro-methane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
- the dosage unit can be determined by providing a valve to deliver a metered amount.
- Capsules and cartridges of e.g., gelatin for use in an inhaler or insufflator can be formulated to contain a powder mix of the compound and a suitable powder base, for example lactose or starch.
- a compound of the invention is administered as an aerosol from a metered dose valve, through an aerosol adapter also known as an actuator.
- a stabilizer is also included, and/or porous particles for deep lung delivery are included (e.g., see U.S. Patent No. 6,447,743).
- Formulations for rectal administration may be presented as a retention enema or a suppository with the usual carriers such as cocoa butter, synthetic glyceride esters or polyethylene glycol. Such carriers are typically solid at ordinary temperatures, but liquefy and/or dissolve in the rectal cavity to release the drug.
- Formulations for topical administration in the mouth include lozenges comprising the active ingredient in a flavoured basis such as sucrose and acacia or tragacanth, and pastilles comprising the active ingredient in a basis such as gelatin and glycerine or sucrose and acacia.
- exemplary compositions for topical administration include a topical carrier such as Plastibase (mineral oil gelled with polyethylene).
- Preferred unit dosage formulations are those containing an effective dose, as hereinbefore recited, or an appropriate fraction thereof, of the active ingredient.
- formulations of this invention may include other agents conventional in the art having regard to the type of formulation in question, for example those suitable for oral administration may include flavouring agents.
- sustained-release systems include suitable polymeric materials, for example semi-permeable polymer matrices in the form of shaped articles, e.g., films, or mirocapsules; suitable hydrophobic materials, for example as an emulsion in an acceptable oil; or ion exchange resins; and sparingly soluble derivatives of the compound of the invention, for example, a sparingly soluble salt.
- Sustained-release systems may be administered orally; rectally; parenterally; intracistemally; intravaginally; intraperitoneally; topically, for example as a powder, ointment, gel, drop or transdermal patch; bucally; or as an oral or nasal spray.
- compositions for administration can be suitably formulated to give controlled release of compounds of the invention.
- the pharmaceutical compositions may be in the form of particles comprising one or more of biodegradable polymers, polysaccharide jellifying and/or bioadhesive polymers, amphiphilic polymers, agents capable of modifying the interface properties of the particles of the compound of formula (I). These compositions exhibit certain biocompatibility features which allow a controlled release of the active substance. See U.S. Patent No. 5,700,486.
- a compound of the invention may be delivered by way of a pump (see Langer, supra;
- compounds of the invention are delivered by way of an implanted pump, described, for example, in U.S. Patent No. 6,436,091; U.S. Patent No. 5,939,380; U.S. Patent No. 5,993,414.
- Implantable drug infusion devices are used to provide patients with a constant and long term dosage or infusion of a drug or any other therapeutic agent. Essentially such device may be categorized as either active or passive.
- a compound of the present invention may be formulated as a depot preparation. Such a long acting depot formulation can be administered by implantation, for example subcutaneously or intramuscularly; or by intramuscular injection.
- the compounds can be formulated with suitable polymeric or hydrophobic materials, for example as an emulsion in an acceptable oil; or ion exchange resins; or as a sparingly soluble derivatives, for example, as a sparingly soluble salt.
- a therapeutically effective amount of a compound of the invention may be administered as a single pulse dose, as a bolus dose, or as pulse doses administered over time.
- a bolus administration of a compound of the invention is provided, followed by a time period wherein no a compound of the invention is administered to the subject, followed by a second bolus administration.
- pulse doses of a compound of the invention are administered during the course of a day, during the course of a week, or during the course of a month.
- a therapeutically effective amount of a compound of the invention is administered with a therapeutically effective amount of another agent, for example an additional appetite suppressant, a food-intake-reducing, plasma glucose-lowering or plasma lipid-altering agent.
- an additional appetite suppressant include amfepramone (diethylpropion), phentermine, mazindol and phenylpropanolamine, fenfluramine, dexfenfluramine, and fluoxetine.
- the compound of the invention can be administered simultaneously with the additional appetite suppressant, or it may be administered sequentially.
- the compound of the invention is formulated and administered with an appetite suppressant as a single dose.
- a compound of the invention may be administered whenever the effect, e.g., appetite suppression, decreased food intake, or decreased caloric intake, is desired, or slightly before to whenever the effect is desired, such as, but not limited to about 10 minutes, about 15 minutes, about 30 minutes, about 60 minutes, about 90 minutes, or about 120 minutes, before the time the effect is desired.
- the effect e.g., appetite suppression, decreased food intake, or decreased caloric intake
- slightly before to whenever the effect is desired such as, but not limited to about 10 minutes, about 15 minutes, about 30 minutes, about 60 minutes, about 90 minutes, or about 120 minutes, before the time the effect is desired.
- the therapeutically effective amount of a compound of the invention will be dependent on the molecule utilized, the subject being treated, the severity and type of the affliction, and the manner and route of administration.
- a therapeutically effective amount of a compound of the invention may vary from about 0.01 ⁇ g per kilogram (kg) body weight to about 1 g per kg body weight, for example about 1 ⁇ g to about 5 mg per kg body weight, or about 5 ⁇ g to about 1 mg per kg body weight.
- a compound of the invention may be administered to a subject at 0.5 to 135 picomole (pmol) per kg body weight, or about 72 pmol per kg body weight.
- a compound of the invention is administered in a dose of about 1 nmol or more, 2 nmol or more, or 5 nmol or more.
- the dose of the compound of the invention is generally not more than 100 nmol, for example, the dose is 90 nmols or less, 80 nmols or less, 70 nmols or less, 60 nmols or less, 50 nmols or less, 40 nmols or less, 30 nmols or less, 20 nmols or less, 10 nmols.
- a dosage range may comprise any combination of any of the specified lower dose limits with any of the specified upper dose limits.
- examples of non-limiting dose ranges of compounds of the invention are within the range of from 1 to 100 nmols, from 1 to 90 nmols, from 1 to 80 nmols.
- nmol of a compound of the invention is administered, for example about 2 to about 20 nmol, for example about 10 nmol is administered as a subcutaneous injection.
- the exact dose is readily determined by one of skill in the art based on the potency of the specific compound utilized, the age, weight, sex and physiological condition of the subject.
- Suitable doses of compounds of the invention also include those that result in a reduction in calorie intake, food intake, or appetite, or increase in energy expenditure that is equivalent to the reduction in calorie intake, food intake, or appetite, or to increase the energy expenditure, caused by the normal postprandial level of PYY3-36.
- Examples of doses include, but are not limited to doses that produce the effect demonstrated when the serum levels of PYY are from about 40 pM to about 60 pM, or from about 40 pM to about 45 pM, or about 43 pM.
- mice Male C57BL/6 mice (20-30 g) were used for all mouse experiments. Male Wistar rats were used for the rat experiments. Mice or rats were individually housed in IVC cages. Animals were randomised by weight and fasted overnight for 16 hrs before intraperitoneal injection at 9am. Food intake was measured at 1, 2, 4, 6 and 24 hours post injection. All peptide solutions were prepared freshly the morning of the study and injected as 100 ⁇ l. All statistics are calculated using the student's paired t-test.
- Peptide synthesis of alloJLeu 3 PYY(3-36) and D_allo_ILeu 3 PYY(3-36) was carried out on a tryclic amide linker resin.
- the sequences were the human PYY sequences.
- Amino acids were attached using the Fmoc strategy. Each amino acid was added sequentially from the C- to the N-termini.
- Peptide couplings were mediated by the reagent TBTU. Peptide cleavage from the resin was achieved with trifluoracetic acid in the presence of scavengers.
- Native PYY(3-36) is obtained as described previously (WO03/026591); de novo synthesis using tryclic amide resin and Fmoc chemistry is also possible.
- Peptides were purified by reverse phase HPLC. Full quality control was performed on all purified peptides and peptides were shown to be greater than 95% pure by HPLC in two buffer systems. Amino acid analysis following acid hydrolysis confirmed the amino acid composition. MALDI-MS showed the expected molecular ion.
- the results are shown in Figure 1.
- alloJLeu 3 PYY(3-36) and DJLeu 3 PYY(3-36) showed essentially the same effect as PYY(3-36).
- a dose response experiment was carried out in order to determine to what degree D_allo_ILeu 3 PYY(3-36) was more effective than PYY(3-36) at decreasing food intake after peripheral injection in rats.
- the experiment was identical to Example 2, except that Wistar rats were used instead of C57BL/6 mice.
- 30 ⁇ g/kg or 100 ⁇ g/kg of PYY(3-36) or D_allo_ILeu 3 PYY(3-36) was injected after an overnight fast and food intake was measured at time intervals over a period of 24 hours.
- the results for the 0 to 4 hr time period are shown in Figure 3A.
- the results for the 0 to 24 hr time period are shown in Figure 3B.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Diabetes (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Endocrinology (AREA)
- Hematology (AREA)
- Veterinary Medicine (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Toxicology (AREA)
- Biophysics (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Obesity (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Child & Adolescent Psychology (AREA)
- Emergency Medicine (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Coloring Foods And Improving Nutritive Qualities (AREA)
- Immobilizing And Processing Of Enzymes And Microorganisms (AREA)
- Materials For Medical Uses (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Nitrogen And Oxygen Or Sulfur-Condensed Heterocyclic Ring Systems (AREA)
Abstract
Description
Claims
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2008500260A JP2008532989A (en) | 2005-03-09 | 2006-03-09 | Modified PYY (3-36) peptide and effects on feeding behavior |
| AT06710037T ATE471339T1 (en) | 2005-03-09 | 2006-03-09 | MODIFIED PYY(3-36) PEPTIDES AND THEIR EFFECTS ON FEEDING BEHAVIOR |
| CA002601133A CA2601133A1 (en) | 2005-03-09 | 2006-03-09 | Modified pyy (3-36) peptides and their effects on feeding behaviour |
| DE602006014953T DE602006014953D1 (en) | 2005-03-09 | 2006-03-09 | MODIFIED PYY (3-36) PEPTIDES AND ITS EFFECTS ON THE FRESE BEHAVIOR |
| US11/908,283 US8202836B2 (en) | 2005-03-09 | 2006-03-09 | Modified PYY (3-36) peptides and their effects on feeding behavior |
| EP06710037A EP1871794B1 (en) | 2005-03-09 | 2006-03-09 | Modified pyy(3-36) peptides and their effects on feeding behavior |
| AU2006221861A AU2006221861A1 (en) | 2005-03-09 | 2006-03-09 | Modified PYY (3-36) peptides and their effects on feeding behaviour |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GBGB0504857.4A GB0504857D0 (en) | 2005-03-09 | 2005-03-09 | Novel compounds and their effects on feeding behaviour |
| GB0504857.4 | 2005-03-09 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2006095166A1 true WO2006095166A1 (en) | 2006-09-14 |
Family
ID=34452079
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/GB2006/000822 Ceased WO2006095166A1 (en) | 2005-03-09 | 2006-03-09 | Modified pyy (3-36) peptides and their effects on feeding behaviour |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US8202836B2 (en) |
| EP (1) | EP1871794B1 (en) |
| JP (1) | JP2008532989A (en) |
| CN (1) | CN101203531A (en) |
| AT (1) | ATE471339T1 (en) |
| AU (1) | AU2006221861A1 (en) |
| CA (1) | CA2601133A1 (en) |
| DE (1) | DE602006014953D1 (en) |
| GB (1) | GB0504857D0 (en) |
| WO (1) | WO2006095166A1 (en) |
Cited By (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2008003947A1 (en) * | 2006-07-03 | 2008-01-10 | Imperial Innovations Limited | Novel compounds and their effects on feeding behaviour |
| WO2008017381A1 (en) | 2006-08-08 | 2008-02-14 | Sanofi-Aventis | Arylaminoaryl-alkyl-substituted imidazolidine-2,4-diones, processes for preparing them, medicaments comprising these compounds, and their use |
| WO2009021740A2 (en) | 2007-08-15 | 2009-02-19 | Sanofis-Aventis | Substituted tetrahydronaphthalenes, process for the preparation thereof and the use thereof as medicaments |
| WO2010003624A2 (en) | 2008-07-09 | 2010-01-14 | Sanofi-Aventis | Heterocyclic compounds, processes for their preparation, medicaments comprising these compounds, and the use thereof |
| WO2010068601A1 (en) | 2008-12-08 | 2010-06-17 | Sanofi-Aventis | A crystalline heteroaromatic fluoroglycoside hydrate, processes for making, methods of use and pharmaceutical compositions thereof |
| US7825091B2 (en) | 2003-01-10 | 2010-11-02 | Imperial Innovations Limited | Modification of feeding behaviour |
| WO2011023754A1 (en) | 2009-08-26 | 2011-03-03 | Sanofi-Aventis | Novel crystalline heteroaromatic fluoroglycoside hydrates, pharmaceuticals comprising these compounds and their use |
| WO2011157827A1 (en) | 2010-06-18 | 2011-12-22 | Sanofi | Azolopyridin-3-one derivatives as inhibitors of lipases and phospholipases |
| US8101576B2 (en) | 2006-12-13 | 2012-01-24 | Imperial Innovations Limited | Compounds and their effects on feeding behaviour |
| US8217001B2 (en) | 2001-09-24 | 2012-07-10 | Imperial Innovations Limited | Modification of feeding behavior |
| WO2012093068A1 (en) | 2011-01-03 | 2012-07-12 | F. Hoffmann-La Roche Ag | A pharmaceutical composition of a complex of an anti-dig antibody and digoxigenin that is conjugated to a peptide |
| WO2012120052A1 (en) | 2011-03-08 | 2012-09-13 | Sanofi | Oxathiazine derivatives substituted with carbocycles or heterocycles, method for producing same, drugs containing said compounds, and use thereof |
| WO2012120054A1 (en) | 2011-03-08 | 2012-09-13 | Sanofi | Di- and tri-substituted oxathiazine derivates, method for the production thereof, use thereof as medicine and drug containing said derivatives and use thereof |
| WO2012120056A1 (en) | 2011-03-08 | 2012-09-13 | Sanofi | Tetrasubstituted oxathiazine derivatives, method for producing them, their use as medicine and drug containing said derivatives and the use thereof |
| WO2012120055A1 (en) | 2011-03-08 | 2012-09-13 | Sanofi | Di- and tri-substituted oxathiazine derivates, method for the production thereof, use thereof as medicine and drug containing said derivatives and use thereof |
| WO2012120053A1 (en) | 2011-03-08 | 2012-09-13 | Sanofi | Branched oxathiazine derivatives, method for the production thereof, use thereof as medicine and drug containing said derivatives and use thereof |
| EP2567959A1 (en) | 2011-09-12 | 2013-03-13 | Sanofi | 6-(4-Hydroxy-phenyl)-3-styryl-1H-pyrazolo[3,4-b]pyridine-4-carboxylic acid amide derivatives as kinase inhibitors |
| CN103834643A (en) * | 2014-02-24 | 2014-06-04 | 华中农业大学 | Genetic marker of peptide tyrosine-tyrosine gene PYY3' UTR for regulating and controlling feed intake of pigs and application thereof |
| WO2020033919A1 (en) | 2018-08-10 | 2020-02-13 | Diapin Therapeutics, Llc | Tri-peptides and treatment of metabolic, cardiovascular and inflammatory disorders |
Families Citing this family (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11246913B2 (en) | 2005-02-03 | 2022-02-15 | Intarcia Therapeutics, Inc. | Suspension formulation comprising an insulinotropic peptide |
| CA2670821C (en) | 2006-08-09 | 2012-05-15 | Intarcia Therapeutics, Inc. | Osmotic delivery systems and piston assemblies |
| CA2683610C (en) | 2007-04-23 | 2013-01-08 | Intarcia Therapeutics, Inc. | Suspension formulations of insulinotropic peptides and uses thereof |
| CN101970475A (en) * | 2007-07-09 | 2011-02-09 | 帝国改革有限公司 | Human pancreatic polypeptide (hpp) analogues and their effects on feeding behaviour |
| WO2009102467A2 (en) | 2008-02-13 | 2009-08-20 | Intarcia Therapeutics, Inc. | Devices, formulations, and methods for delivery of multiple beneficial agents |
| WO2010090876A2 (en) | 2009-01-21 | 2010-08-12 | University Of Florida Research Foundation, Inc. | Satiation peptide administration |
| MX378797B (en) | 2009-09-28 | 2025-03-10 | Intarcia Therapeutics Inc | RAPID ESTABLISHMENT AND/OR TERMINATION OF SUBSTANTIAL STEADY STATE DRUG SUPPLY. |
| GB201001333D0 (en) | 2010-01-27 | 2010-03-17 | Imp Innovations Ltd | Novel compounds and their effects on feeding behaviour |
| PL2651398T3 (en) | 2010-12-16 | 2018-05-30 | Novo Nordisk A/S | Solid compositions comprising a glp-1 agonist and a salt of n-(8-(2-hydroxybenzoyl)amino)caprylic acid |
| GB201101459D0 (en) | 2011-01-27 | 2011-03-16 | Imp Innovations Ltd | Novel compounds and thier effects on fedding behaviour |
| US20120208755A1 (en) | 2011-02-16 | 2012-08-16 | Intarcia Therapeutics, Inc. | Compositions, Devices and Methods of Use Thereof for the Treatment of Cancers |
| EP4324475A1 (en) | 2012-03-22 | 2024-02-21 | Novo Nordisk A/S | Compositions of glp-1 peptides and preparation thereof |
| KR20210086717A (en) | 2013-05-02 | 2021-07-08 | 노보 노르디스크 에이/에스 | Oral dosing of glp-1 compounds |
| SG11201508469YA (en) * | 2013-05-02 | 2015-11-27 | Glaxosmithkline Ip Dev Ltd | Therapeutic peptides |
| CN103211764A (en) * | 2013-05-07 | 2013-07-24 | 上海艾韦特医药科技有限公司 | Lipidosome combined with PYY analogue and preparation method thereof |
| US10246497B2 (en) | 2013-11-15 | 2019-04-02 | Novo Nordisk A/S | Selective PYY compounds and uses thereof |
| JP6629198B2 (en) | 2013-11-15 | 2020-01-15 | ノヴォ ノルディスク アー/エス | HPYY (1-36) having a β-homoarginine substitution at position 35 |
| US9889085B1 (en) | 2014-09-30 | 2018-02-13 | Intarcia Therapeutics, Inc. | Therapeutic methods for the treatment of diabetes and related conditions for patients with high baseline HbA1c |
| CN113598842A (en) | 2015-06-03 | 2021-11-05 | 因塔西亚制药公司 | Implant placement and removal system |
| CA2988500A1 (en) | 2015-06-12 | 2016-12-15 | Novo Nordisk A/S | Selective pyy compounds and uses thereof |
| US11311633B2 (en) | 2016-04-16 | 2022-04-26 | University Of Florida Research Foundation, Incorporated | Satiation peptides for weight loss and altered taste sensitivity |
| KR102574993B1 (en) | 2016-05-16 | 2023-09-06 | 인타르시아 세라퓨틱스 인코포레이티드 | Glucagon-receptor selective polypeptides and methods of use thereof |
| USD860451S1 (en) | 2016-06-02 | 2019-09-17 | Intarcia Therapeutics, Inc. | Implant removal tool |
| USD840030S1 (en) | 2016-06-02 | 2019-02-05 | Intarcia Therapeutics, Inc. | Implant placement guide |
| WO2018129058A1 (en) | 2017-01-03 | 2018-07-12 | Intarcia Therapeutics, Inc. | Methods comprising continuous administration of a glp-1 receptor agonist and co-adminstration of a drug |
| GB201720188D0 (en) | 2017-12-04 | 2018-01-17 | Imperial Innovations Ltd | Analogues of PYY |
| MX2020007410A (en) | 2018-01-23 | 2020-11-09 | Gila Therapeutics Inc | Peptide yy pharmaceutical formulations, compositions, and methods. |
| WO2019149880A1 (en) | 2018-02-02 | 2019-08-08 | Novo Nordisk A/S | Solid compositions comprising a glp-1 agonist, a salt of n-(8-(2-hydroxybenzoyl)amino)caprylic acid and a lubricant |
| GB2573145A (en) * | 2018-04-26 | 2019-10-30 | Univ Ulster | Peptides for metabolic disease |
| CN114206375A (en) * | 2019-08-07 | 2022-03-18 | 诺和诺德股份有限公司 | Solid compositions comprising a PYY compound and a salt of N- (8- (2-hydroxybenzoyl) amino) octanoic acid |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5328899A (en) * | 1988-07-15 | 1994-07-12 | The Salk Institute For Biological Studies | NPY peptide analogs |
| US5604203A (en) * | 1993-03-29 | 1997-02-18 | University Of Cincinnati | Analogs of peptide YY and uses thereof |
| US20030219879A1 (en) * | 2002-05-24 | 2003-11-27 | Rozzell J. David | Method for producing D-allo -isoleucine |
| WO2004066966A2 (en) * | 2003-01-17 | 2004-08-12 | Societe De Conseils De Recherches Et D'applications Scientifiques S.A.S. | Peptide yy analogs |
Family Cites Families (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| WO1993009227A1 (en) | 1991-11-06 | 1993-05-13 | Garvan Institute Of Medical Research | Human neuropeptide y-y1 receptor |
| US5907030A (en) | 1995-01-25 | 1999-05-25 | University Of Southern California | Method and compositions for lipidization of hydrophilic molecules |
| US5962270A (en) | 1996-02-06 | 1999-10-05 | Bionebraska, Inc. | Recombinant preparation of calcitonin fragments and use thereof in the preparation of calcitonin and related analogs |
| US6355478B1 (en) | 1996-06-17 | 2002-03-12 | Eli Lilly And Company | Rhesus monkey neuropeptide Y Y2 receptor |
| US6458924B2 (en) | 1996-08-30 | 2002-10-01 | Novo Nordisk A/S | Derivatives of GLP-1 analogs |
| US6268343B1 (en) | 1996-08-30 | 2001-07-31 | Novo Nordisk A/S | Derivatives of GLP-1 analogs |
| US6093692A (en) | 1997-09-25 | 2000-07-25 | The University Of Southern California | Method and compositions for lipidization of hydrophilic molecules |
| US6420352B1 (en) | 2000-07-19 | 2002-07-16 | W. Roy Knowles | Hair loss prevention |
| PL205971B1 (en) | 2001-09-24 | 2010-06-30 | Imp Innovations Ltd | Modification of feeding behavior |
| AU2003201998C1 (en) * | 2002-01-10 | 2012-10-25 | Imperial Innovations Limited | Modification of feeding behavior |
-
2005
- 2005-03-09 GB GBGB0504857.4A patent/GB0504857D0/en not_active Ceased
-
2006
- 2006-03-09 EP EP06710037A patent/EP1871794B1/en not_active Expired - Lifetime
- 2006-03-09 CA CA002601133A patent/CA2601133A1/en not_active Abandoned
- 2006-03-09 AU AU2006221861A patent/AU2006221861A1/en not_active Abandoned
- 2006-03-09 DE DE602006014953T patent/DE602006014953D1/en not_active Expired - Lifetime
- 2006-03-09 JP JP2008500260A patent/JP2008532989A/en active Pending
- 2006-03-09 WO PCT/GB2006/000822 patent/WO2006095166A1/en not_active Ceased
- 2006-03-09 AT AT06710037T patent/ATE471339T1/en not_active IP Right Cessation
- 2006-03-09 US US11/908,283 patent/US8202836B2/en not_active Expired - Fee Related
- 2006-03-09 CN CNA2006800076146A patent/CN101203531A/en active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5328899A (en) * | 1988-07-15 | 1994-07-12 | The Salk Institute For Biological Studies | NPY peptide analogs |
| US5604203A (en) * | 1993-03-29 | 1997-02-18 | University Of Cincinnati | Analogs of peptide YY and uses thereof |
| US20030219879A1 (en) * | 2002-05-24 | 2003-11-27 | Rozzell J. David | Method for producing D-allo -isoleucine |
| WO2004066966A2 (en) * | 2003-01-17 | 2004-08-12 | Societe De Conseils De Recherches Et D'applications Scientifiques S.A.S. | Peptide yy analogs |
Non-Patent Citations (1)
| Title |
|---|
| EBERLEIN G A ET AL: "A NEW MOLECULAR FORM OF PYY: STRUCTURAL CHARACTERIZATION OF HUMAN PYY(3-36) AND PYY(1-36)", PEPTIDES, ELSEVIER, AMSTERDAM, US, vol. 10, no. 4, 1989, pages 797 - 803, XP001079678, ISSN: 0196-9781 * |
Cited By (20)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8217001B2 (en) | 2001-09-24 | 2012-07-10 | Imperial Innovations Limited | Modification of feeding behavior |
| US7825091B2 (en) | 2003-01-10 | 2010-11-02 | Imperial Innovations Limited | Modification of feeding behaviour |
| US8263736B2 (en) | 2006-07-03 | 2012-09-11 | Imperial Innovations Limited | Compounds and their effects on feeding behaviour |
| WO2008003947A1 (en) * | 2006-07-03 | 2008-01-10 | Imperial Innovations Limited | Novel compounds and their effects on feeding behaviour |
| WO2008017381A1 (en) | 2006-08-08 | 2008-02-14 | Sanofi-Aventis | Arylaminoaryl-alkyl-substituted imidazolidine-2,4-diones, processes for preparing them, medicaments comprising these compounds, and their use |
| US8101576B2 (en) | 2006-12-13 | 2012-01-24 | Imperial Innovations Limited | Compounds and their effects on feeding behaviour |
| WO2009021740A2 (en) | 2007-08-15 | 2009-02-19 | Sanofis-Aventis | Substituted tetrahydronaphthalenes, process for the preparation thereof and the use thereof as medicaments |
| WO2010003624A2 (en) | 2008-07-09 | 2010-01-14 | Sanofi-Aventis | Heterocyclic compounds, processes for their preparation, medicaments comprising these compounds, and the use thereof |
| WO2010068601A1 (en) | 2008-12-08 | 2010-06-17 | Sanofi-Aventis | A crystalline heteroaromatic fluoroglycoside hydrate, processes for making, methods of use and pharmaceutical compositions thereof |
| WO2011023754A1 (en) | 2009-08-26 | 2011-03-03 | Sanofi-Aventis | Novel crystalline heteroaromatic fluoroglycoside hydrates, pharmaceuticals comprising these compounds and their use |
| WO2011157827A1 (en) | 2010-06-18 | 2011-12-22 | Sanofi | Azolopyridin-3-one derivatives as inhibitors of lipases and phospholipases |
| WO2012093068A1 (en) | 2011-01-03 | 2012-07-12 | F. Hoffmann-La Roche Ag | A pharmaceutical composition of a complex of an anti-dig antibody and digoxigenin that is conjugated to a peptide |
| WO2012120052A1 (en) | 2011-03-08 | 2012-09-13 | Sanofi | Oxathiazine derivatives substituted with carbocycles or heterocycles, method for producing same, drugs containing said compounds, and use thereof |
| WO2012120054A1 (en) | 2011-03-08 | 2012-09-13 | Sanofi | Di- and tri-substituted oxathiazine derivates, method for the production thereof, use thereof as medicine and drug containing said derivatives and use thereof |
| WO2012120056A1 (en) | 2011-03-08 | 2012-09-13 | Sanofi | Tetrasubstituted oxathiazine derivatives, method for producing them, their use as medicine and drug containing said derivatives and the use thereof |
| WO2012120055A1 (en) | 2011-03-08 | 2012-09-13 | Sanofi | Di- and tri-substituted oxathiazine derivates, method for the production thereof, use thereof as medicine and drug containing said derivatives and use thereof |
| WO2012120053A1 (en) | 2011-03-08 | 2012-09-13 | Sanofi | Branched oxathiazine derivatives, method for the production thereof, use thereof as medicine and drug containing said derivatives and use thereof |
| EP2567959A1 (en) | 2011-09-12 | 2013-03-13 | Sanofi | 6-(4-Hydroxy-phenyl)-3-styryl-1H-pyrazolo[3,4-b]pyridine-4-carboxylic acid amide derivatives as kinase inhibitors |
| CN103834643A (en) * | 2014-02-24 | 2014-06-04 | 华中农业大学 | Genetic marker of peptide tyrosine-tyrosine gene PYY3' UTR for regulating and controlling feed intake of pigs and application thereof |
| WO2020033919A1 (en) | 2018-08-10 | 2020-02-13 | Diapin Therapeutics, Llc | Tri-peptides and treatment of metabolic, cardiovascular and inflammatory disorders |
Also Published As
| Publication number | Publication date |
|---|---|
| EP1871794B1 (en) | 2010-06-16 |
| ATE471339T1 (en) | 2010-07-15 |
| CA2601133A1 (en) | 2006-09-14 |
| US8202836B2 (en) | 2012-06-19 |
| AU2006221861A1 (en) | 2006-09-14 |
| CN101203531A (en) | 2008-06-18 |
| US20090215682A1 (en) | 2009-08-27 |
| DE602006014953D1 (en) | 2010-07-29 |
| JP2008532989A (en) | 2008-08-21 |
| EP1871794A1 (en) | 2008-01-02 |
| GB0504857D0 (en) | 2005-04-13 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP1871794B1 (en) | Modified pyy(3-36) peptides and their effects on feeding behavior | |
| US8263736B2 (en) | Compounds and their effects on feeding behaviour | |
| US8901073B2 (en) | Compounds and their effects on feeding behaviour | |
| AU2008273941B2 (en) | Human pancreatic polypeptide (HPP) analogues and their effects on feeding behaviour | |
| AU2011210165B2 (en) | Novel compounds and their effects on feeding behaviour | |
| US12617830B2 (en) | Analogues of PYY | |
| US20170137486A1 (en) | Peptide yy (pyy) analogues | |
| WO2015177573A1 (en) | Peptide yy (pyy) analogues |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 2006221861 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 6907/DELNP/2007 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2008500260 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 200680007614.6 Country of ref document: CN Ref document number: 2601133 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006710037 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2006221861 Country of ref document: AU Date of ref document: 20060309 Kind code of ref document: A |
|
| WWP | Wipo information: published in national office |
Ref document number: 2006221861 Country of ref document: AU |
|
| NENP | Non-entry into the national phase |
Ref country code: RU |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: RU |
|
| WWP | Wipo information: published in national office |
Ref document number: 2006710037 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11908283 Country of ref document: US |


