WO2006076706A1 - Cinnamide and hydrocinnamide derivatives with raf-kinase inhibitory activity - Google Patents

Cinnamide and hydrocinnamide derivatives with raf-kinase inhibitory activity Download PDF

Info

Publication number
WO2006076706A1
WO2006076706A1 PCT/US2006/001490 US2006001490W WO2006076706A1 WO 2006076706 A1 WO2006076706 A1 WO 2006076706A1 US 2006001490 W US2006001490 W US 2006001490W WO 2006076706 A1 WO2006076706 A1 WO 2006076706A1
Authority
WO
WIPO (PCT)
Prior art keywords
ring
optionally substituted
alkyl
aliphatic
independently
Prior art date
Application number
PCT/US2006/001490
Other languages
French (fr)
Inventor
Ruth S. Adams
Emily F. Calderwood
Alexandra E. Gould
Paul D. Greenspan
Matthew J. Lamarche
Yuan Tian
Tricia J. Vos
Original Assignee
Millennium Pharmaceuticals, Inc.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Millennium Pharmaceuticals, Inc. filed Critical Millennium Pharmaceuticals, Inc.
Priority to JP2007551462A priority Critical patent/JP2008527007A/en
Priority to CA002594860A priority patent/CA2594860A1/en
Priority to AU2006204724A priority patent/AU2006204724A1/en
Priority to EP06718548A priority patent/EP1856053A1/en
Publication of WO2006076706A1 publication Critical patent/WO2006076706A1/en

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D213/00Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
    • C07D213/02Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
    • C07D213/04Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
    • C07D213/60Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
    • C07D213/72Nitrogen atoms
    • C07D213/73Unsubstituted amino or imino radicals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D213/00Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
    • C07D213/02Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
    • C07D213/04Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
    • C07D213/24Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with substituted hydrocarbon radicals attached to ring carbon atoms
    • C07D213/54Radicals substituted by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals
    • C07D213/56Amides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D213/00Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
    • C07D213/02Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
    • C07D213/04Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
    • C07D213/60Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
    • C07D213/62Oxygen or sulfur atoms
    • C07D213/63One oxygen atom
    • C07D213/68One oxygen atom attached in position 4
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D213/00Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
    • C07D213/02Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
    • C07D213/04Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
    • C07D213/60Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
    • C07D213/72Nitrogen atoms
    • C07D213/74Amino or imino radicals substituted by hydrocarbon or substituted hydrocarbon radicals
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D213/00Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
    • C07D213/02Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
    • C07D213/04Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
    • C07D213/60Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
    • C07D213/72Nitrogen atoms
    • C07D213/75Amino or imino radicals, acylated by carboxylic or carbonic acids, or by sulfur or nitrogen analogues thereof, e.g. carbamates
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D213/00Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
    • C07D213/02Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
    • C07D213/04Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
    • C07D213/60Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
    • C07D213/78Carbon atoms having three bonds to hetero atoms, with at the most one bond to halogen, e.g. ester or nitrile radicals
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D213/00Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
    • C07D213/02Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
    • C07D213/04Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
    • C07D213/60Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
    • C07D213/78Carbon atoms having three bonds to hetero atoms, with at the most one bond to halogen, e.g. ester or nitrile radicals
    • C07D213/79Acids; Esters
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D213/00Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
    • C07D213/02Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
    • C07D213/04Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
    • C07D213/60Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
    • C07D213/78Carbon atoms having three bonds to hetero atoms, with at the most one bond to halogen, e.g. ester or nitrile radicals
    • C07D213/81Amides; Imides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D213/00Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
    • C07D213/02Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
    • C07D213/04Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
    • C07D213/60Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
    • C07D213/78Carbon atoms having three bonds to hetero atoms, with at the most one bond to halogen, e.g. ester or nitrile radicals
    • C07D213/84Nitriles
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D231/00Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings
    • C07D231/02Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings
    • C07D231/10Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
    • C07D231/14Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
    • C07D231/18One oxygen or sulfur atom
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D233/00Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings
    • C07D233/04Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having one double bond between ring members or between a ring member and a non-ring member
    • C07D233/28Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having one double bond between ring members or between a ring member and a non-ring member with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
    • C07D233/30Oxygen or sulfur atoms
    • C07D233/32One oxygen atom
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D237/00Heterocyclic compounds containing 1,2-diazine or hydrogenated 1,2-diazine rings
    • C07D237/02Heterocyclic compounds containing 1,2-diazine or hydrogenated 1,2-diazine rings not condensed with other rings
    • C07D237/06Heterocyclic compounds containing 1,2-diazine or hydrogenated 1,2-diazine rings not condensed with other rings having three double bonds between ring members or between ring members and non-ring members
    • C07D237/10Heterocyclic compounds containing 1,2-diazine or hydrogenated 1,2-diazine rings not condensed with other rings having three double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
    • C07D237/24Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D239/00Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings
    • C07D239/02Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings
    • C07D239/24Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings having three or more double bonds between ring members or between ring members and non-ring members
    • C07D239/28Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings having three or more double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, directly attached to ring carbon atoms
    • C07D239/32One oxygen, sulfur or nitrogen atom
    • C07D239/34One oxygen atom
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D239/00Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings
    • C07D239/02Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings
    • C07D239/24Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings having three or more double bonds between ring members or between ring members and non-ring members
    • C07D239/28Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings having three or more double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, directly attached to ring carbon atoms
    • C07D239/46Two or more oxygen, sulphur or nitrogen atoms
    • C07D239/47One nitrogen atom and one oxygen or sulfur atom, e.g. cytosine
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D261/00Heterocyclic compounds containing 1,2-oxazole or hydrogenated 1,2-oxazole rings
    • C07D261/02Heterocyclic compounds containing 1,2-oxazole or hydrogenated 1,2-oxazole rings not condensed with other rings
    • C07D261/06Heterocyclic compounds containing 1,2-oxazole or hydrogenated 1,2-oxazole rings not condensed with other rings having two or more double bonds between ring members or between ring members and non-ring members
    • C07D261/10Heterocyclic compounds containing 1,2-oxazole or hydrogenated 1,2-oxazole rings not condensed with other rings having two or more double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
    • C07D261/12Oxygen atoms
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D277/00Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings
    • C07D277/60Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings condensed with carbocyclic rings or ring systems
    • C07D277/62Benzothiazoles
    • C07D277/64Benzothiazoles with only hydrocarbon or substituted hydrocarbon radicals attached in position 2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D401/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
    • C07D401/02Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings
    • C07D401/04Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings directly linked by a ring-member-to-ring-member bond
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D401/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
    • C07D401/02Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings
    • C07D401/12Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings linked by a chain containing hetero atoms as chain links
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D401/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
    • C07D401/14Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing three or more hetero rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D405/00Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom
    • C07D405/02Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings
    • C07D405/12Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings linked by a chain containing hetero atoms as chain links
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D405/00Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom
    • C07D405/14Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing three or more hetero rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D413/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/02Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
    • C07D413/04Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings directly linked by a ring-member-to-ring-member bond
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D413/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/02Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
    • C07D413/12Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D413/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/14Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing three or more hetero rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D473/00Heterocyclic compounds containing purine ring systems
    • C07D473/02Heterocyclic compounds containing purine ring systems with oxygen, sulphur, or nitrogen atoms directly attached in positions 2 and 6
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D473/00Heterocyclic compounds containing purine ring systems
    • C07D473/26Heterocyclic compounds containing purine ring systems with an oxygen, sulphur, or nitrogen atom directly attached in position 2 or 6, but not in both
    • C07D473/28Oxygen atom
    • C07D473/30Oxygen atom attached in position 6, e.g. hypoxanthine
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D487/00Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00
    • C07D487/02Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00 in which the condensed system contains two hetero rings
    • C07D487/04Ortho-condensed systems

Definitions

  • the present invention relates to protein kinase inhibitors, particularly inhibitors of Raf-kinase.
  • the invention also provides pharmaceutical compositions comprising the compounds of the invention and methods of using the compositions in the treatment of various diseases.
  • Protein kinases constitute a large family of structurally related enzymes that effect the transfer of a phosphate group from a nucleoside triphosphate to a Ser, Thr or Tyr residue on a protein acceptor.
  • Intracellular signaling pathways activated in response to growth factor/cytokine stimulation are known to control functions such as proliferation, differentiation and cell death (Chiloeches and Marais, In Targets for Cancer Therapy; Transcription Factors and Other Nuclear Proteins, 179-206 (La Thangue and Bandara, eds., Totowa, Humana Press 2002)).
  • Ras-Raf-MEK-ERK pathway which is controlled by receptor tyrosine kinase activation. Activation of Ras proteins at the cell membrane leads to phosphorylation and recruitment of accessory factors and Raf which is then activated by phosphorylation. Activation of Raf leads to downstream activation of MEK and ERK.
  • ERK has several cytoplasmic and nuclear substrates, including ELK and Ets-family transcription factor, which regulates genes involved in cell growth, survival and migration (Marais et ah, J. Biol. Cliem., 272:4378-4383 (1997); Peyssonnaux and Eychene, Biol. Cell, 93-53-62 (2001)).
  • ELK and Ets-family transcription factor which regulates genes involved in cell growth, survival and migration
  • this pathway is an important mediator of tumor cell proliferation and angiogenesis.
  • overexpression of constitutively active B-Raf can induce an oncogenic event in untransformed cells (Wellbrock et ah, Cancer Res., 64:2338-2342 (2004)).
  • B-Raf Aberrant activation of the pathway, such as by activating Ras and/or Raf mutations, is known to be associated with a malignant phenotype in a variety of tumor types (Bos, Hematol. Pathol., 2:55-63 (1988); Downward, Nature Rev. Cancer, 3:11-22 (2003); Karasarides et ah, Oncogene, 23:6292-6298 (2004); Tuveson, Cancer Cell, 4:95-98 (2003); Bos, Cancer Res, 49:4682-4689 (1989)).
  • Activating mutations in B-Raf are found in 60-70% of melanomas.
  • Raf-1 Ras-Raf
  • B-Raf B-Raf
  • C-Raf C-Raf
  • C-Raf (and possibly B-Raf and A-Raf) may signal via Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • Inhibitors of the Raf kinases may be expected to interrupt the Ras-Raf signaling cascade and thereby provide new methods for the treatment of proliferative disorders, such as cancer. There is thus a need for new inhibitors of Raf kinase activity.
  • the present invention provides compounds that are effective inhibitors of Raf- kinase. These compounds are useful for inhibiting kinase activity in vitro and in vivo, and are especially useful for the treatment of various cell proliferative diseases.
  • G 1 is -C(R d )(R e )-, -C(O)-, -O-, -S-, -S(O)-, -S(O) 2 -, or -N(R f )-, wherein G 1 is attached to Ring A at the position meta or para to L ;
  • Ring A is substituted with 0-2 occurrences of R a ;
  • Ring B is an optionally substituted mono- or bicyclic aromatic ring system having one to four ring nitrogen atoms and optionally one or two additional ring heteroatoms independently selected from oxygen and sulfur;
  • Ring C is an optionally substituted 5- or 6-membered aryl or heteroaryl ring having 0-3 ring nitrogen atoms and optionally one additional ring heteroatom selected from oxygen and sulfur;
  • R a is halo, -NO 2 , -CN, -OR 5 , -SR 6 , -S(O)R 6 , -SO 2 R 6 , -SO 2 N(R 4 ),, -N(R 4 ) 2 , -OC(O)R 5 , -CO 2 R 5 , -C(O)N(R 4 ) 2 , -N(R 4 )SO 2 R 6 , -N(R 4 )SO 2 N(R 4 ) 2 , or an optionally substituted C 14 aliphatic;
  • R is hydrogen, fluoro, C 1-4 aliphatic, C 14 fluoroaliphatic, -NH 2 , -NH(C 14 alkyl), -N(C 1. , alkyl ⁇ OH, or -0(C 1. , alkyl); Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • R e is hydrogen, fluoro, C 1 4 aliphatic, or C 1-4 fluoroaliphatic; or R and R e , taken together with the carbon atom to which they are attached, form a 3- to 6-membered cycloaliphatic or heterocyclyl ring;
  • R f is -H, -C(O)R 5 , -C(O)N(R 4 ) 2 , -CO 2 R 6 , -SO 2 R 6 , -SO 2 N(R 4 ) 2 , or an optionally substituted C j _ 6 aliphatic;
  • R ⁇ is hydrogen, fluoro, C 1-4 aliphatic, or C 114 fluoroaliphatic
  • R is hydrogen, fluoro, C 1 4 aliphatic, C 1-4 fluoroaliphatic, -OH, -0(C 1 4 alkyl), -N(R 4 ) 2 ,
  • R ⁇ and R taken together with the carbon atom to which they are attached, form a 3- to 6- membered cycloaliphatic ring;
  • R J is hydrogen, fluoro, C 1-4 aliphatic, or C 1-4 fluoroaliphatic
  • R is hydrogen, fluoro, C 1-4 aliphatic, C 1-4 fluoroaliphatic, -OH, -0(C 1. , alkyl), -C(O)(C 1. , alkyl), -CO 2 H, -CO 2 (C 1. , alkyl), or -C(O)N(R 4 ) 2 ; or
  • R and R taken together with the carbon atom to which they are attached, form a 3- to 6- membered cycloaliphatic ring; or each of R s and R' is hydrogen, fluoro, C 1-4 aliphatic, or C 1. , fluoroaliphatic; and
  • R 1 and R taken together with the intervening carbon atoms, form a 3- to 6-membered cycloaliphatic ring;
  • R m is hydrogen, fluoro, -OR 5 , -C(O)R 5 , -C(O)N(R 4 ) 2 , -CO 2 R 5 , -SO 2 R 6 , -SO 2 N(R 4 ) 2 , or an optionally substituted C 1-4 aliphatic;
  • R n is hydrogen, fluoro, -C(O)R 5 , -C(O)N(R 4 ) 2 , -CO 2 R 5 , -SO 2 R 6 , -SO 2 N(R 4 ) 2 , or an optionally substituted C 1-4 aliphatic;
  • each R independently is hydrogen or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl group; or two R on the same nitrogen atom, taken together with the nitrogen atom, form an optionally substituted 4- to 8-membered heterocyclyl ring Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • each R independently is hydrogen or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl group; each R independently is an optionally substituted aliphatic, aryl group, or heteroaryl group; and m is 1 or 2.
  • Raf and Raf kinase are used interchangeably, and unless otherwise specified refer to any member of the Raf family of kinase enzymes, including without limitation, the isoforms A-Raf, B-Raf, and C-Raf . These enzymes, and the corresponding genes, also may be referred to in the literature by variants of these terms, e.g., RAF, raf, BRAF, B-raf, b- raf.
  • the isoform C-Raf also is referred to by the terms Raf-1 and C-Raf-1.
  • aliphatic or "aliphatic group”, as used herein, means a substituted or unsubstituted straight-chain, branched, or cyclic C 1-12 hydrocarbon, which is completely saturated or which contains one or more units of unsaturation, but which is not aromatic.
  • suitable aliphatic groups include substituted or unsubstituted linear, branched or cyclic alkyl, alkenyl, or alkynyl groups and hybrids thereof, such as (cycloalkyl)alkyl, (cycloalkenyl)alkyl or (cycloalkyl)alkenyl.
  • the aliphatic group has 1 to 12, 1 to 8, 1 to 6, 1 to 4, or 1 to 3 carbons.
  • alkyl refers to a straight or branched chain aliphatic group having from 1 to 12 carbon atoms.
  • alkyl will be used when the carbon atom attaching the aliphatic group to the rest of the molecule is a saturated carbon atom.
  • an alkyl group may include unsaturation at other carbon atoms.
  • alkyl groups include, without limitation, methyl, ethyl, propyl, allyl, propargyl, butyl, pentyl, and hexyl.
  • alkenyl will be used when the carbon atom attaching the aliphatic group to the rest of the molecule forms part of a carbon- carbon double bond.
  • Alkenyl groups include, without limitation, vinyl, 1-propenyl, 1-butenyl, 1-pentenyl, and 1-hexenyl.
  • alkynyl will be used when the carbon atom attaching the aliphatic group to the rest of the molecule forms part of a carbon- carbon triple bond.
  • Alkynyl groups include, without limitation, ethynyl, 1-propynyl, 1-butynyl, 1-pentynyl, and 1-hexynyl.
  • cycloaliphatic used alone or as part of a larger moiety, refers to a saturated or partially unsaturated cyclic aliphatic ring system having from 3 to about 14 members, wherein the aliphatic ring system is optionally substituted.
  • the cycloaliphatic is a monocyclic hydrocarbon having 3-8 or 3-6 ring carbon atomsl
  • Nonlimiting examples include cyclopropyl, cyclobutyl, cyclopentyl, cyclopentenyl, cyclohexyl, cyclohexenyl, cycloheptyl, cycloheptenyl, cyclooctyl, cyclooctenyl, and cyclooctadienyl.
  • the cycloaliphatic is a bridged or fused bicyclic hydrocarbon having 6-12, 6- 10, or 6-8 ring carbon atoms, wherein any individual ring in the bicyclic ring system has 3-8 members.
  • two adjacent substituents on the cycloaliphatic ring taken together with the intervening ring atoms, form an optionally substituted fused 5- to 6- membered aromatic or 3- to 8-membered non-aromatic ring having 0-3 ring heteroatoms selected from the group consisting of O, N, and S.
  • cycloaliphatic includes aliphatic rings that are fused to one or more aryl, heteroaryl, or heterocyclyl rings.
  • NonUmiting examples include indanyl, 5,6,7,8-tetrahydroquinoxalinyl, decahydronaphthyl, or tetrahydronaphfhyl, where the radical or point of attachment is on the aliphatic ring.
  • aralkyl refers to a C 6 to C 14 aromatic hydrocarbon, comprising one to three rings, each of which is optionally substituted.
  • the aryl group is a C 6-10 aryl group.
  • Aryl groups include, without limitation, phenyl, naphthyl, and anfhracenyl.
  • aryl 8-membered non-aromatic ring having 0-3 ring heteroatoms selected from the group consisting of O, N, and S.
  • aryl includes groups in which an aryl ring is fused to one or more heteroaryl, cycloaliphatic, or heterocyclyl rings, where the radical or point of attachment is on the aromatic ring.
  • Nonlimiting examples of such fused ring systems include indolyl, isoindolyl, benzothienyl, benzofuranyl, dibenzofuranyl, indazolyl, benzimidazolyl, benzthiazolyl, quinolyl, isoquinolyl, cinnolinyl, phthalazinyl, quinazolinyl, quinoxalinyl, carbazolyl, acridinyl, phenazinyl, phenothiazinyl, phenoxazinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, fluorenyl, indanyl, phenanthridinyl, tetrahydronaphthyl, indolinyl, phenoxazinyl, benzodioxanyl, and benzodioxolyl.
  • aryl group may be mono-, bi-, tri-, or polycyclic, preferably mono-, bi-, or tricyclic, more preferably mono- or bicyclic.
  • aryl may be used interchangeably with the terms “aryl group”, “aryl moiety”, and “aryl ring”.
  • an "aralkyl” or “arylalkyl” group comprises an aryl group covalently attached to an alkyl group, either of which independently is optionally substituted.
  • the aralkyl group is C 6-10 -UyI(C 1 JaIkJrI, C 640 or C 6-10 ary ⁇ C ⁇ alkyl, including, without limitation, benzyl, phenethyl, and naphthylmethyl.
  • heteroaryl and “heteroar-”, used alone or as part of a larger moiety, e.g., heteroaralkyl, or “heteroaralkoxy”, refer to groups having 5 to 14 ring atoms, preferably 5, 6, 9, or 10 ring atoms; having 6, 10, or 14 ⁇ electrons shared in a cyclic array; and having, in addition to carbon atoms, from one to four heteroatoms.
  • heteroatom refers to nitrogen, oxygen, or sulfur, and includes any oxidized form of nitrogen or sulfur, and any quaternized form of a basic nitrogen.
  • nitrogen when used in reference to a ring atom of a heteroaryl, includes an oxidized nitrogen (as in pyridine N-oxide). Certain nitrogen atoms of 5-membered heteroaryl groups also are substitutable, as further defined below.
  • Heteroaryl groups include, without limitation, radicals derived from thiophene, furan, pyrrole, imidazole, pyrazole, triazole, tetrazole, oxazole, isoxazole, oxadiazole, thiazole, isothiazole, thiadiazole, pyridine, pyridazine, pyrrolidine, pyrazine, indolizine, naphthyridine, pteridine, pyrrolopyridine, imidazopyridine, oxazolopyridine, thiazolopyridine, triazolopyridine, pyrrolopyrimidine, purine, and triazolopyrimidine.
  • the phrase "radical derived from” means a monovalent radical produced by removal of a hydrogen radical from the parent heteroaromatic ring system.
  • the radical i.e., the point of attachment of Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • heteroaryl to the rest of the molecule may be created at any substitutable position on any ring of the parent heteroaryl ring system.
  • heteroaryl taken together with the intervening ring atoms, form an optionally substituted fused 5- to 6- membered aromatic or 4- to 8-membered non-aromatic ring having 0-3 ring heteroatoms selected from the group consisting of O, N, and S.
  • heteroaryl and “heteroar-”, as used herein, also include groups in which a heteroaromatic ring is fused to one or more aryl, cycloaliphatic, or heterocyclyl rings, where the radical or point of attachment is on the heteroaromatic ring.
  • Nonlimiting examples include indolyl, isoindolyl, benzothienyl, benzofuranyl, dibenzofuranyl, indazolyl, benzimidazolyl, benzthiazolyl, benzoxazolyl, quinolyl, isoquinolyl, cinnolinyl, phthalazinyl, quinazolinyl, quinoxalinyl, 4H-quinolizinyl, carbazolyl, acridinyl, phenazinyl, phenothiazinyl, phenoxazinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, and pyrido[2,3-b]-l,4-oxazin-3(4H)-one.
  • a heteroaryl group may be mono-, bi-, tri-, or polycyclic, preferably mono-, bi-, or tricyclic, more preferably mono- or bicyclic.
  • heteroaryl may be used interchangeably with the terms “heteroaryl ring”, or “heteroaryl group”, any of which terms include rings that are optionally substituted.
  • heteroarylkyl refers to an alkyl group substituted by a heteroaryl, wherein the alkyl and heteroaryl portions independently are optionally substituted.
  • aromatic ring and “aromatic ring system” refer to an optionally substituted mono-, bi-, or tricyclic group having 0-6, preferably 0-4 ring heteroatoms, and having 6, 10, or 14 ⁇ electrons shared in a cyclic array.
  • aromatic ring and “aromatic ring system” encompass both aryl and heteroaryl groups.
  • heterocycle As used herein, the terms “heterocycle”, “heterocyclyl”, “heterocyclic radical”, and “heterocyclic ring” are used interchangeably and refer to a stable 3- to 7-membered monocyclic, or to a fused 7- to 10-membered or bridged 6- to 10-membered bicyclic heterocyclic moiety that is either saturated or partially unsaturated, and having, in addition to carbon atoms, one or more, preferably one to four, heteroatoms, as defined above.
  • nitrogen includes a substituted nitrogen.
  • heterocyclyl ring having 1-3 heteroatoms selected from oxygen, sulfur or nitrogen
  • the nitrogen may be N (as in 3,4 ⁇ dihydro-2H-pyrrolyl), NH (as in pyrrolidinyl), or + NR (as in N- substituted pyrrolidinyl).
  • a heterocyclic ring can be attached to its pendant group at any Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • heteroatom or carbon atom that results in a stable structure and any of the ring atoms can be optionally substituted.
  • saturated or partially unsaturated heterocyclic radicals include, without limitation, tetrahydrofuranyl, tetrahydrothienyl, pyrrolidinyl, pyrrolidonyl, piperidinyl, pyrrolinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, oxazolidinyl, piperazinyl, dioxanyl, dioxolanyl, diazepinyl, oxazepinyl, thiazepinyl, morpholinyl, and quinuclidinyl.
  • two adjacent substituents on a heterocyclic ring taken together with the intervening ring atoms, form an optionally substituted fused 5- to 6- membered aromatic or 3- to 8-membered non-aromatic ring having 0-3 ring heteroatoms selected from the group consisting of O, N, and S.
  • heterocycle used interchangeably herein, and include groups in which a heterocyclyl ring is fused to one or more aryl, heteroaryl, or cycloaliphatic rings, such as indolinyl, 3H-indolyl, chromanyl, phenanfhridinyl, or tetrahydroquinolinyl, where the radical or point of attachment is on the heterocyclyl ring.
  • a heterocyclyl group may be mono-, bi-, tri-, or polycyclic, preferably mono-, bi-, or tricyclic, more preferably mono- or bicyclic.
  • heterocyclycrylalkyl refers to an alkyl group substituted by a heterocyclyl, wherein the alkyl and heterocyclyl portions independently are optionally substituted.
  • partially unsaturated refers to a ring moiety that includes at least one double or triple bond between ring atoms.
  • the term “partially unsaturated” is intended to encompass rings having multiple sites of unsaturation, but is not intended to include aryl or heteroaryl moieties, as herein defined.
  • haloaliphatic refers to an aliphatic, alkyl, alkenyl or alkoxy group, as the case maybe, which is substituted with one or more halogen atoms.
  • halogen or halo means F, Cl, Br, or I.
  • fluoroaliphatic refers to a haloaliphatic wherein the halogen is fluoro, including perfluorinated aliphatic groups.
  • fluoroaliphatic groups include, without limitation, fluoromethyl, difluoromethyl, trifluoromethyl, 2-fluoroethyl, 2,2,2-trifluoroethyl, 1,1,2-trifluoroethyl, 1,2,2-trifluoroethyl, and pentafluoroethyl.
  • linker group means an organic moiety that connects two parts of a compound.
  • Linkers typically comprise an atom such as oxygen or sulfur, a unit such as -NH-, -CH 2 -, -C(O)-, -C(O)NH-, or a chain of atoms, such as an alkylene chain.
  • the molecular mass of a linker is typically in. the range of about 14 to 200, preferably in the range of 14 to 96 with a length of up to about six atoms.
  • the linker is a C 1 6 alkylene chain.
  • alkylene refers to a bivalent alkyl group.
  • An "alkylene chain” is a polymethylene group, i.e., -(CH 2 ) n -, wherein n is a positive integer, preferably from 1 to 6, from 1 to 4, from 1 to 3, from 1 to 2, or from 2 to 3.
  • a substituted alkylene chain is a polymethylene group in which one or more methylene hydrogen atoms is replaced with a substituent. Suitable substituents include those described below for a substituted aliphatic group.
  • An alkylene chain also may be substituted at one or more positions with an aliphatic group or a substituted aliphatic group.
  • An alkylene chain also can be optionally interrupted by a functional group.
  • An alkylene chain is "interrupted" by a functional group when an internal methylene unit is replaced with the functional group.
  • Each R + independently, is hydrogen or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl group, or two R + on the same nitrogen atom, taken together with the nitrogen atom, form a 5-8 membered aromatic or non-aromatic ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms selected from N, O, and S.
  • Each R* independently is hydrogen or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl group.
  • Examples of C 3 6 alkylene chains that have been "interrupted" with -O- include -
  • alkylene chains that are "interrupted" with functional groups include -CH 2 ZCH 2 -, Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • a stable or chemically feasible compound is one in which the chemical structure is not substantially altered when kept at a temperature from about -80 0 C to about +40 0 C, preferably -20 0 C to about +40 0 C, in the absence of moisture or other chemically reactive conditions, for at least a week, or a compound which maintains its integrity long enough to be useful for therapeutic or prophylactic administration to a patient.
  • substituted means that a hydrogen radical of the designated moiety is replaced with the radical of a specified substituent, provided that the substitution results in a stable or chemically feasible compound.
  • substituted when used in reference to a designated atom, means that attached to the atom is a hydrogen radical, which can be replaced with the radical of a suitable substituent.
  • substituents refers to a number of substituents that equals from one to the maximum number of substituents possible based on the number of available bonding sites, provided that the above conditions of stability and chemical feasibility are met.
  • an optionally substituted group may have a substituent at each substitutable position of the group, and the substituents may be either the same or different.
  • the term "independently selected” means that the same or different values may be selected for multiple instances of a given variable in a single compound.
  • each substituent is selected from the group of defined values for R , and the two values selected may be the same or different.
  • An aryl (including the aryl moiety in aralkyl, aralkoxy, aryloxyalkyl and the like) or heteroaryl (including the heteroaryl moiety in heteroaralkyl and heteroaralkoxy and the like) group may contain one or more substituents.
  • An aliphatic group or a non-aromatic heterocyclic ring may be substituted with one or more substituents.
  • two substituents on the same carbon atom, taken together with the carbon atom to which they are attached may form an optionally substituted spirocyclic 3- to 6-membered cycloaliphatic ring.
  • Suitable substituents on a substitutable nitrogen atom of a heteroaryl or non- aromatic heterocyclic ring include -R*, -N(R% -C(O)R*, -CO 2 R*, -C(O)-C(O)R* Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • a ring nitrogen atom of a heteroaryl or non-aromatic heterocyclic ring also may be oxidized to form the corresponding N-hydroxy or N-oxide compound.
  • a nonlirniting example of such a heteroaryl having an oxidized ring nitrogen atom is N-oxidopyridyl.
  • structures depicted herein are also meant to include compounds which differ only in the presence of one or more isotopically enriched atoms.
  • compounds having the present structure except for the replacement of a hydrogen atom by a deuterium or tritium, or the replacement of a carbon atom by a C- or C-enriched carbon are within the scope of the invention.
  • Ring A is additionally substituted with 0, 1, or 2 substituents R a , where R a is as defined above.
  • R a is selected from the group consisting of halo, C M . aliphatic, C 1 4 fluoroaliphatic, -NO 2 , -CN, -CO 2 H, -0(C 1 4 alkyl), Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • R a is selected from the group consisting of, -F, -Cl, -NO 2 , -CH 3 , -CF 3 , -OCH 3 , -SCH 3 , -SO 2 CH 3 , -CN, -CO 2 H, -C(O)NH 2 , -C(O)NHCH 3 , and -C(O)N(CH 3 ) 2 .
  • Ring A has no substituents R ' ⁇
  • the substituents R m and R n may be in a cis or trans configuration relative to each other. In some embodiments, R m and R n are trans to each other.
  • R m and R" are each independently hydrogen, fluoro, C 1-4 fluoroaliphatic, or a C 1-4 aliphatic optionally substituted with one substituent selected from -NH 2 , -NH(C 1-4 alkyl), -N(C 1-4 alkyl) 2 , -OH, or -0(C 1-4 alkyl).
  • R m is hydrogen and R n is hydrogen, fluoro, -CH 3 , or -CH 2 OH.
  • the bivalent group L is intended to be read from left to right, with the carbon atom bearing R m attached to Ring A, and the carbon atom bearing R n attached to the amide carbonyl.
  • the linker L is a two- or three-carbon alkylene chain having the formula -[C(R s )(R h )] m -C(R j )(R k )-, where each of R ⁇ , R h/ , R j , R k , and m is as defined above.
  • R and R are each independently selected from the group consisting of hydrogen, fluoro, C 1-4 alkyl, or C 14 fluoroalkyl.
  • the carbon atoms in L are substituted with 0, 1, or 2, preferably O or 1, non-hydrogen substituents.
  • L is -CH 2 -CH 2 - or -CH 2 -CH 2 -CH 2 -.
  • the bivalent group L is intended to be read from left to right, with the carbon atom bearing R s anc R attached to Ring A, and the carbon atom bearing R' and R attached to the amide carbonyl.
  • linker G -,i i a one-atom linker selected from the group consisting of
  • the linker G is attached to Ring A at the positional meta or para to L .
  • R d and R e preferably are each independently hydrogen, fluoro, C 1-4 aliphatic, or C 1-4 fluoroaliphatic.
  • R and R e taken together with the carbon atom to which they are attached, form a 3- to 6-membered cycloaliphatic or heterocyclyl ring, preferably a cyclopropyl ring.
  • each of R and R e is hydrogen.
  • R f preferably is hydrogen, -C(O)R 5 , or an optionally substituted C 1-4 aliphatic. More preferably, R is hydrogen. Most preferably, G is -O- or -NH-.
  • the compound of formula (I) is characterized by one or more of the following features:
  • each R a independently is -F, -Cl, -CN, -NO 2 , C 1-4 alkyl, -CF 3 , -0(C 1-4 alkyl), -OCF 3 , -S(C 14 alkyl), -SO 2 (C 1-4 alkyl), -NH 2 , -NH(C 1-4 alkyl), -N(C 1-4 alkyl) 2 , -CO 2 H, -C(O)NH 2 , or -C(O)NH(C 1-4 alkyl);
  • R * and R are each independently hydrogen, fluoro, C 14 alkyl, or C 1-4 fluoroalkyl;
  • R m and R n are each independently hydrogen, fluoro, C 1-4 fluoroaliphatic, or a C 14 aliphatic optionally substituted with one substituent selected from -NH 2 , -NH(C 1-4 alkyl), -N(C 1-4 alkyl) 2 , -OH, or -0(C 1-4 alkyl);
  • L 1 is -CH 2 -CH 2 - or -CH 2 -CH 2 -CH 2 -;
  • G 1 is -O- or -NH-.
  • Ring B is an optionally substituted mono- or bicyclic heteroaryl having one to four ring nitrogen atoms and optionally one or two additional ring heteroatoms selected from oxygen and sulfur.
  • Each substitutable ring nitrogen atom in Ring B is unsubstituted or substituted, preferably with -C(O)R 5 , -C(O)N(R 4 ) 2 , -CO 2 R 6 , -SO 2 R 6 , -SO 2 N(R 4 ) 2 , C 1-4 aliphatic, an optionally substituted C 6-10 aryl, or a C 6-10 ar(C 1-4 )alkyl, the aryl portion of which is optionally substituted.
  • Ring B optionally is oxidized.
  • the substitutable ring nitrogen atoms in Ring B all are unsubstituted, and one ring nitrogen atom optionally is oxidized.
  • Ring B is a radical derived from an aromatic ring system selected from the group consisting of pyrrole, oxazole, thiazole, imidazole, pyrazole, isoxazole, isothiazole, oxadiazole, triazole, thiadiazole, pyridine, pyridazine, pyrrolidine, pyrazine, triazine, indolizine, indole, isoindole, indazole, benzimidazole, benzthiazole, benzoxazole, pyrrolopyridine, imidazopyridine, oxazolopyridine, fhiazolopyridine, triazolopyridine, pyrrolopyrimidine, purine, triazolopyrimidine, quinoline, isoquinoline, cinnoline, phthalazine, quinazoline, quinoxaline, naphthyridine, and pter
  • Any such ring system optionally is substituted on any substitutable ring carbon or ring nitrogen atom, one ring nitrogen atom optionally is oxidized, and the point of attachment connecting Ring B to G may be on either ring when Ring B is a radical derived from a bicyclic ring system.
  • Ring B is a radical derived from pyrrole, oxazole, thiazole, imidazole, pyrazole, isoxazole, pyridine, pyridazine, pyrimidine, pyrazine, pyrrolopyridine, imidazolopyridine, pyrazolopyridine, triazolopyridine, pyrrolopyrimidine, purine, pyrazolopyrimidine, triazolopyrimidine, benzimidazole, or benzthiazole, wherein Ring B optionally is substituted on any substitutable ring carbon or ring nitrogen atom, and one ring nitrogen atom optionally is oxidized. In certain preferred embodiments, Ring B is an optionally substituted pyridyl or N-oxidopyridyl.
  • Substitutable ring carbon atoms in Ring B preferably are substituted with 0-2 R and 0-2 R .
  • Each R independently is selected from the group consisting of C 1-4 aliphatic, C 1-4 fluoroaliphatic, halo, -OH, -0(C 1-4 aliphatic), -NH 2 , -NH(C 1-4 aliphatic), and -N(C 1-4 aliphatic) 2 .
  • each R independently is selected from the group consisting of C 1-6 aliphatic, C 1-6 fluoroaliphatic, halo, -R lb , -R 2b , -T ⁇ -R lb , -T ⁇ -R 2b , -vW-R lh , and -V -T -R .
  • the variables T , V , R , and R have the values described below.
  • T 1 is a C 1-4 alkylene chain optionally substituted with -F, C 1-3 alkyl, or C 1-3 fluoroalkyl.
  • V 1 is -OC-, -O-, -S-, -S(O)-, -S(O) 2 -, -SO 2 N(R 4 )-, -N(R 4 )-,
  • V 1 is -N(R 451 )-, -N(R 4x )-C(O)-, -C(O)N(R 4 ")-, Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • Each R independently is an optionally substituted aryl, heteroaryl, heterocyclyl, or cycloaliphatic ring.
  • R is an optionally substituted C 3 6 cycloaliphatic or an optionally substituted phenyl, azetidinyl, pyrrolyl, imidazolyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, pyrazolyl, triazolyl, tetrazolyl, oxadiazolyl, thiadiazolyl, pyrrolinyl, imidazolinyl, pyrazolinyl, pyrrolidinyl, imidazolidinyl, pyrazolidinyl, piperidinyl, morpholinyl, piperazinyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, or tetrahydropyrimidin
  • each R 2b independently is -N(R 4 ) 2 , -NR 4 C(O)R 5 , -C(O)N(R 4 ) 2 , -CO 2 R 5 , or -OR 5 .
  • Each R a independently is selected from the group consisting of -F, -OH,
  • Each R independently is a C 1-3 aliphatic optionally substituted with R a or R , or two substituents R on the same carbon atom, taken together with the carbon atom to which they are attached, form a 3- to 6-membered cycloaliphatic ring.
  • Each R 4 independently is hydrogen or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl group; or two R on the same nitrogen atom, taken together with the nitrogen atom, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms selected from N, O, and S.
  • Each R independently is hydrogen or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl group.
  • Each R independently is an optionally substituted aliphatic, aryl, or heteroaryl group.
  • Each R independently is an optionally substituted aryl or heteroaryl ring.
  • the substitutable ring carbon atoms in Ring B are substituted with 0-1 R and 0-2 R . More preferably, the substitutable ring carbon atoms in Ring B are substituted with 0-1 R and 0-1 R .
  • R preferably is selected from the group consisting of C 1-4 aliphatic, C 1-4 fluoroaliphatic, halo, -R , -R , -T -R -T -R , -V'-T'-R 113 , and -V'-T'-R 2 ", where:
  • Ring C is an optionally substituted 5- or 6- membered aryl or heteroaryl ring having 0-3 ring nitrogen atoms and optionally one additional ring heteroatom selected from oxygen and sulfur.
  • Ring C is an optionally substituted furanyl, thienyl, pyrrolyl, oxazolyl, thiazolyl, imidazolyl, pyrazolyl, isoxazolyl, isothiazolyl, oxadiazolyl, triazolyl, thiadiazolyl, phenyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, or triazinyl, wherein one ring nitrogen atom in Ring C optionally is oxidized.
  • Each substitutable ring nitrogen atom in Ring C is unsubstituted or is substituted with -C(O)R 5 , -C(O)N(R 4 ) 2 , -CO 2 R 6 , -SO 2 R 6 , -SO 2 N(R 4 ) 2 , or a C 1-4 aliphatic optionally substituted with -F, -OH, -O(C 14 alkyl), -CN, -N(R 4 ) 2 , -C(O)(C 1.
  • each substitutable ring nitrogen atom in Ring C is unsubstituted, and one ring nitrogen atom optionally is oxidized.
  • Substitutable ring carbon atoms in Ring C preferably are substituted with 0-2 R c and 0-2 R c .
  • Each R c independently is selected from the group consisting of C 14 aliphatic, C 14 fluoroaliphatic, -O(C ⁇ _ 4 alkyl), -0(C 14 fluoroalkyl), and halo.
  • R c is selected from the group consisting of halo, methyl, trifluoromethyl, ethyl, isopropyl, cyclopropyl, fert-butyl, methoxy, and trifluoromethoxy.
  • -C(R 6 ) N-OR 5 , or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl; or two adjacent R c , taken together with the intervening ring atoms, form an optionally substituted fused 5- or 6-membered aromatic or non-aromatic ring having 0-3 ring heteroatoms independently selected from the group consisting of O, N, and S.
  • each R c independently is selected from the group consisting of C 1 6 aliphatic, C 1 6 fluoroaliphatic, halo, -R lc , -R 2c , -T ⁇ -R 20 , and -T ⁇ -R 10 .
  • the variables T 2 , R lc , and R 2c have the values described below.
  • T is a C 1 4 or C 14 alkylene chain optionally substituted with R a or R . In some embodiments, T is a C 1-4 alkylene chain optionally substituted with one or two groups independently selected from -F, C 1-4 aliphatic, and C 1 4 fluoroaliphatic.
  • Each R independently is an optionally substituted aryl, heteroaryl, heterocyclyl, or cycloaliphatic ring.
  • the substitutable ring carbon atoms in Ring C are substituted with 0-2 R c and 0-1 R 8c , where:
  • each R c preferably is selected from the group consisting of C 1-4 aliphatic,
  • each R c independently is selected from the group consisting of C 1-4 aliphatic, C 1-4 fluoroaliphatic, -O(C 1-4 alkyl), -O(C 1-4 fluoroaliphatic), and halo.
  • the substitutable ring carbon atoms in Ring C are substituted with 0-2 R c and 0-1 R c , where:
  • R x is hydrogen, C 1-4 alkyl, C 1-4 fluoroalkyl, or C 6-10 ar(C 1-4 )alkyl, the aryl portion of which may be optionally substituted, or two R x on the same nitrogen atom, taken together with the nitrogen atom, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S; Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • R 4y is hydrogen, C 6-10 ar(C 1-4 )alkyl, the aryl portion of which may be optionally substituted, an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring, or a C 1 4 alkyl or C 1-4 fluoroalkyl optionally substituted with one or two substituents independently selected from the group consisting of -OR Sx , -N(R 4x ) 2 , -CO 2 R 5 ", or -C(O)N(R 4x ) 2 ; or
  • R 4x and R 4y taken together with the nitrogen atom to which they are attached, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S; each R x independently is hydrogen, C 1-4 alkyl, C 1-4 fluoroalkyl, C 6-10 ar(C ⁇ 4 )alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring; each R 5y independently is hydrogen, an optionally substituted C 6-10 aryl, a the aryl portion of which may be optionally substituted, or a C 1-4 alkyl or C 1 4 fluoroalkyl optionally substituted with one or two substituents independently selected from the group consisting of -OR 5x , -N(R 4x ) 2 , -CO 2 R 5x , or
  • each R independently is C 1-4 alkyl, C 1-4 fluoroalkyl, C 6-10 ar(C M )alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring.
  • Ring C is a 5- or 6-membered heteroaryl substituted with
  • each R c independently is selected from the group consisting of -halo, C 1-4 alkyl, C 1-4 fluoroalkyl, -O(C 1-4 alkyl), and -O(C M fluoroalkyl), or two adjacent R c , taken together with the intervening ring atoms, form an optionally substituted fused 5- or 6-membered aromatic or non-aromatic ring having 0-3 ring heteroatoms selected from the group consisting of O, N, and S.
  • Ring C is selected from the group consisting of: Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • Another embodiment of the invention relates to a compound of formula (T), wherein Ring C is an optionally substituted phenyl.
  • Such compounds have the formula (II):
  • Ring C is substituted with 0-2 R c and 0-1 R ⁇ c ;
  • Ring A, Ring B, and the variables G 1 , L 1 , R a , R c , and R 8c have the values and preferred values described above for formula (T).
  • Ring B preferably is other than imidazole.
  • Ring C in formula (IT) is selected from the group consisting of:
  • each R c independently is halo, -CN, -C ⁇ C-R ? 5o y y , - nO ⁇ R> 5 y y , - cS ⁇ R> 6 ⁇ x
  • the intervening ring atoms form an optionally substituted fused 5- or 6-membered aromatic or non-aromatic ring having 0-3 ring heteroatoms independently selected from the group consisting of O, N, and S;
  • R is C 1-4 aliphatic, C 14 fluoroaliphatic, halo, -CN, -OH, -0(C 1-4 alkyl), -0(C 1. , fluoroalkyl), -S(C M alkyl), -NH 2 , -NH(C 1. , alkyl), or -N(C 1. , alkyl) 2 ;
  • R c is C 1. , aliphatic, C 1. , fluoroaliphatic, or halo;
  • Ring C is selected from the group consisting of:
  • Ring C is selected from the group consisting of:
  • the invention also relates to a subgenus of the compounds of formula (I), characterized by formula (III):
  • Ring B is substituted with 0-1 R and 0-1 R , and one nitrogen atom in Ring B optionally is oxidized;
  • Ring A, Ring C, and the variables G , L , R , and R have the values and preferred values described above for formulae (I) and (II).
  • the invention relates to a compound of formula (IV):
  • X 1 and X 2 are each independently CH or N, provided that X 1 and X 2 are not both N; g is 0 or 1; h is 0 or 1; and
  • Rings A and C, and the variables L 7 G 7 R , and R have the values and preferred values described above for formulae (I) and (II).
  • R is selected from the group consisting of halo, -N(R 4 ) 2 , -CO 2 R 5 , -C(O)-N(R 4 ) 2 , -C(O)
  • R is selected from the group consisting of halo
  • each R x independently is hydrogen, C 1 4 alkyl
  • R x and R z taken together with the nitrogen atom to which they are attached, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S.
  • R x and R taken together with the nitrogen atom to which Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • Each R 5x independently is hydrogen, C 14 alkyl, C 1-4 fluoroalkyl, C 6-10 ar(C 1-4 )alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring.
  • Each R 6x independently is C 1-4 alkyl, C 1-4 fluoroalkyl, C 6-10 ar(C ⁇ .4 )aIkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring.
  • R b is -N(R 4x )(R 4z ), -C(O)-N(R ⁇ )(R 42 ), or
  • the invention relates to a compound of formula (IV) or a pharmaceutically acceptable salt thereof, wherein R is -V -T -R or -V -T -R , where the variables V 1 , T 1 , R 1 , and R 2 have the values described below.
  • V 1 is -N(R 4 )-, -N(R 4 )-C(O)-, -N(R 4 )SO 2 R 6 , -N(R 4 )C(O)-OR 5 , -C(O)N(R 4 )-,
  • T is a C 1-4 alkylene chain optionally substituted with -F, C 13 alkyl, or
  • R ,1b i an optionally substituted C 36 cycloaliphatic or an optionally substituted phenyl, pyrrolyl, imidazolyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, pyrazolyl, triazolyl, tetrazolyl, oxadiazolyl, fhiadiazolyl, pyrrolinyl, imidazolinyl, pyrazolinyl, pyrrolidinyl, imidazolidinyl, pyrazolidinyl, piperidinyl, morpholinyl, piperazinyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, or tetrahydropyrimidinyl ring.
  • R is an Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • R 2b is -N(R 4 ) 2/ -NR 4 C(O)R 5 , -C(O)N(R 4 ) 2 , -CO 2 R 5 , or -OR 5 . b .
  • R is selected from the group consisting of:
  • the invention relates to a compound of formula
  • R lb is an optionally substituted C 3-6 cycloaliphatic or an optionally substituted phenyl, pyrrolyl, imidazolyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, pyrazolyl, triazolyl, tetrazolyl, oxadiazolyl, thiadiazolyl, pyrrolinyl, imidazolinyl, pyrazolinyl, pyrrolidinyl, imidazolidinyl, pyrazolidinyl, piperidinyl, morpholinyl, piperazinyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, or tetrahydropyrimidinyl ring.
  • R is selected from the group consisting of
  • R lx is an optionally Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • R x is -C(O)N(R 4x )(R 4z ).
  • R is hydrogen, C 1-4 alkyl, C 1 4 fluoroalkyl, or C 6-10 ar(C w )alkyl, the aryl portion of which may be optionally substituted;
  • R z is hydrogen, C 1 4 alkyl, C 1-4 fluoroalkyl, C 640 ar(C 1 4 )alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring; or R x and R z , taken together with the nitrogen atom to which they are attached, form an optionally substituted morphonnyl, piperidinyl, piperazinyl, or pyrrolidinyl ring.
  • R is hydrogen, C ⁇ _ 4 alkyl, C 1-4 fluoroalkyl, or C 6-10 a ⁇ C ⁇ alkyl, the aryl portion of which may be optionally substituted.
  • Another embodiment of the invention relates to a compound of formula (TV) wherein R is -R .
  • the compound has formula (V):
  • X and X are each independently CH or N, provided that X and X are not both N;
  • Ring D is an optionally substituted aryl, heteroaryl, heterocyclyl, or cycloaliphatic ring;
  • Ring A, Ring C, and the variables R , G , and L have the values and preferred values described above for formulae (I)-(IV); and g is 0 or 1.
  • X and X are each CH. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • Each substitutable ring nitrogen atom in Ring D preferably is unsubstituted or is substituted with -C(O)R 5 , -C(O)N(R 4 ) 2 , -CO 2 R 6 , -SO 2 R 6 , -SO 2 (NR 4 ) 2 , an optionally substituted C 6 10 aryl, or a C 1-4 aliphatic optionally substituted with R or R ; and one ring nitrogen atom in Ring D optionally is oxidized.
  • Ring D is an optionally substituted heteroaryl or heterocyclyl selected from the group consisting of azetidinyl, pyrrolyl, imidazolyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, pyrazolyl, triazolyl, tetrazolyl, oxadiazolyl, fhiadiazolyl, pyrrolinyl, imidazolinyl, pyrazolinyl, pyrrolidinyl, imidazolidinyl, pyrazolidinyl, piperidinyl, morpholinyl, piperazinyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, and tetrahydropyrimidinyl.
  • Ring D is an optionally substituted imidazolyl, oxazolyl, thiazolyl, oxadiazolyl, thiadiazolyl, tetrazolyl, imidazolinyl, or tetrahydropyrimidinyl.
  • Each substitutable unsaturated ring carbon atom in Ring D preferably is unsubstituted or is substituted with -R .
  • Ring D is substituted with 0-1 R d and 0-1 R 8d .
  • R 8d is
  • R is selected from titie group consisting of C 1-4 aliphatic, C 1-4 fluoroaliphatic, halo, -R ld , -R 2d , -T'-R 1 ' 1 , -T 3 - ⁇ , -V 3 -! 3 -*", and -V 3 -! 3 - ⁇ .
  • the variables T 3 , V 3 , R ld , and R 2d have the values described below.
  • T 3 is a C 1-4 alkylene chain optionally substituted with one or two substituents independently selected from the group consisting of C 1 3 aliphatic, C 1 3 fluoroaliphatic, -F, -OH, -0(C 1-4 alkyl), -CO 2 H, -CO 2 (C 1-4 alkyl), -C(O)NH 2 , and -C(O)NH(C 14 alkyl).
  • T 3 is -(CH 2 )- or -(CH 2 )--.
  • Each R independently is an optionally substituted aryl, heteroaryl, heterocyclyl,
  • R is an optionally substituted phenyl, pyridyl, or pyrimidinyl group.
  • each R 2d is selected from the group consisting of -OR , -N(R 4 ) 2 , -CO 2 R 5 , or -C(O)N(R 4 ) 2 .
  • Ring D is selected from the group consisting of:
  • N N t
  • R v , R w , R x , R y , and R z have the values described Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • R v is hydrogen, halo, C 1-4 aliphatic, C 14 fluoroaliphatic, -OR 5 , -N(R 4 ) 2 , -CO 2 R 5 ,
  • R v is hydrogen, halo, C 14 aliphatic, C 14 fluoroaliphatic, -(CH 2 ) p -OR 5x , -(CH 2 ) p -N(R 4x )(R 4z ), -(CH 2 ) ⁇ CO 2 R 5* , -(CH 2 ) p -C(O)N(R 4x )(R 4z ), or an optionally substituted phenyl, pyridyl, or pyrirnidinyl group.
  • Each R w independently is hydrogen, halo, C 1-4 aliphatic, C 14 fluoroaliphatic, -OR ,
  • each R w independently is hydrogen, an optionally substituted phenyl, pyridyl, or pyrirnidinyl group, halo, C 14 aliphatic, C 14 fluoroaliphatic, -(CH 2 ) p -OR 5x , -(CH 2 ) p -N(R 4x )(R 4z ), -(CH 2 ) p -CO 2 R 5x , -(CH 2 ) p -C(O)N(R 4x )(R 4z ), -(CH 2 ) ⁇ -N(R 4x )-(CH 2 ),-R lx , -(CH 2 ) r N(R 4x )-(CH 2 ) i; -R 2x , -(CH 2 ) ⁇ -N(R 4x )-(CH 2 ) s -R 2y -(CH 2 ), ; -N(
  • each R w independently is hydrogen, halo, C 14 aliphatic, C 14 fluoroaliphatic, -(CH 2 ) p -OR 5x , -(CH 2 ) p -N(R 4x )(R 4z ), -(CH 2 ) p -CO 2 R 5x , -(CH 2 ) P -C(O)N(R ⁇ )(R 42 ), or an optionally substituted phenyl, pyridyl, or pyrirnidinyl group.
  • Each R x independently is hydrogen, fluoro, C 14 aliphatic, C 14 fluoroaliphatic,
  • each R x independently is hydrogen, fluoro, C 14 aliphatic, C 14 fluoroaliphatic, -(CH 2 ) -CO 2 R x , -(CH 2 ) P -C(O)N(R ⁇ )(R 42 ), -(CH 2 ) r -N(R 4x )(R 4z ), or -(CH 2 ) r -OR 5x .
  • R y is hydrogen, halo, C 14 aliphatic, C 14 fluoroaliphatic, -OR 5 , -N(R 4 ) 2 , -CO 2 R 5 ,
  • R y is hydrogen, fluoro, C 14 aliphatic, C 14 fluoroaliphatic, -(CH ⁇ -N ⁇ XR 42 ), -(CH 2 ) p -OR 5x , -(CH 2 ) p -CO 2 R 5x , -(CH 2 ) P -C(O)N(R ⁇ )(R 42 ).
  • Each R 2 independently is hydrogen, fluoro, C 14 aliphatic, or C 14 fluoroaliphatic.
  • T 3 is a C 1-4 alkylene chain optionally substituted with one or two substituents independently selected from the group consisting of C 1 3 aliphatic, C 1-3 fluoroaliphatic, -F, -OH, -0(C 1-4 alkyl), -CO 2 H, -CO 2 (C 14 alkyl), -C(O)NH 2 , and -C(O)NH(C 14 alkyl).
  • Each R independently is an optionally substituted phenyl, piperidinyl, piperazinyl, morpholinyl, or pyrrolidinyl ring.
  • Each R 2x independently is -C (O)N(R 4 ") (R 42 ).
  • Each R 2y independently is -N(R ⁇ )(R 42 ), -NR 4x C(O)R 5x , -N(R 4x )-CO 2 R 5x ,
  • Each R independently is hydrogen, C 14 alkyl, C 14 fluoroalkyl, or
  • each R z independently is hydrogen, C 14 alkyl, C 14 fluoroalkyl, C 6-10 ar(C w )alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring; or R x and R z , taken together with the nitrogen atom to which they are attached, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S.
  • Each R independently is hydrogen, C 1-4 alkyl, C 14 fluoroalkyl, C 6-10 ar(C 1-4 )alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring.
  • variable ⁇ is 0, 1, or 2; q is 1, 2, or 3, r is 1 or 2, and s is 2 or 3.
  • Ring D is selected from the group consisting of:
  • Ring D is selected from the group consisting of: Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • the invention also relates to a compound of formula (VT):
  • G 1 is -O- or -NH-;
  • X and X are each independently CH or N, provided that X and X are not both N; one ring nitrogen atom in Ring B optionally is oxidized; g is 0 or 1; h is 0 or 1; j is 0 or 1; k is 0, 1, or 2; and
  • Ring A and the variables R , R , R m , R n , R c , and R c have the values and preferred values described above for formulae (I)-(V).
  • the invention relates to a compound of formula (VI), wherein:
  • R m is hydrogen, and R n is hydrogen, fluoro, -CH 3 , or -CH 2 OH;
  • X and X are each CH;
  • Ring A is substituted with zero occurrences of R a ; Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • R 4x is hydrogen, C 1-4 alkyl, C 1-4 fluoroalkyl, or C 6-10 ar(C 14 )alkyl, the aryl portion of which may be optionally substituted, or two R x on the same nitrogen atom, taken together with the nitrogen atom, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S;
  • R y is hydrogen, C 6-10 ar(C 14 )alkyl, the aryl portion of which may be optionally substituted, an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring, or a C 14 alkyl or C 14 fluoroalkyl optionally substituted with one or two substituents independently selected from the group consisting of -OR x , -N(R x ) 2 , -CO 2 R 5x , or -C(O)N(R 4x ) 2 ; or
  • R x and R y taken together with the nitrogen atom to which they are attached, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S; each R x independently is hydrogen, C 14 alkyl, C 14 fluoroalkyl, C 6-10 ar(C 14 )alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring; each R 5y independently is hydrogen, an optionally substituted C 6-10 aryl, a
  • each R x independently is C 1 4 alkyl, C 1 4 fluoroalkyl, C 6-10 ar(C M )alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring.
  • the invention also relates to a compound of formula (VIT):
  • the compound of formula (I) is other than:
  • B-36 4-[3-((lE)-3- ⁇ [4-chloro-3-(trifluoromethyl)phenyl]amino ⁇ -3-oxoprop-l-en-l- yl)phenoxy]-N-(cyclopropylmethyl)pyridine-2-carboxamide
  • B-37 4-[3-((lE)-3- ⁇ [4-cWoro-3-(tefluoromethyl)phenyl]amino ⁇ -3-oxoprop-l-en-l- yl)phenoxy]-N-[3-(lH-irnidazol-l-yl)propyl]pyridine-2-carboxamide
  • B-54 N-methyl-4-[3-((lE)-3-oxo-3- ⁇ [4-(3-pyrroUdin-l-ylprop-l-yn-l-yl)-3- (trifluoromett ⁇ yl)phenyl]amino ⁇ prop-l-en-l-yl)phenoxy]pyridine-2- carboxamlde
  • B-104 (2E)-N-[4-cWoro-2-hydroxy-3-(trifluoroinethyl)phenyl]-3-(3- ⁇ [2-(4 / 5-dihydro- lH-itnidazol-2-yl)pyridin-4-yl]oxy ⁇ phenyl)acrylamide
  • B-129 4-[3-((lE)-3- ⁇ [4-diloro-3-(tofluoromethyl)phenyl]amino ⁇ -3-oxoprop-l-en-l- yl)phenoxy]-N-[2-(rnefhyla ⁇ ino)-2-oxoethyl]pyridin.e-2-carboxainide
  • B-132 N-(2-morpholin-4-ylethyl)-4-[3-((l£)-3-oxo-3- ⁇ [4-
  • B-133 4-(3- ⁇ (l£)-3-[(3-methylphenyl)arnino]-3-oxoprop-l-en-l-yl ⁇ phenoxy)-N-(2- morpholin-4-yleii ⁇ yl)pyridine-2-carboxamide
  • B-135 4-(3- ⁇ (l£)-3-[(3-chloro-4-£luorophenyl)amino]-3-oxoprop-l-en-l-yl ⁇ phenoxy)- N-(2-morpholin-4-yletl ⁇ .yl)pyridine-2-carboxamide
  • B-136 4-(3- ⁇ (lE)-3-[(4-cMoro-3-fluorophenyl)ainino]-3-oxoprop-l-en-l-yl ⁇ phenoxy)- N-(2-morpholin-4-ylethyl)pyridine-2-carboxamide
  • B-138 4-(3- ⁇ (lE)-3-[(4-chloro-3-cyanophenyl)amino]-3-oxoprop-l-en-l-yl ⁇ phenoxy)- N-(2-morpholin-4-ylethyl)pyridine-2-carboxaniide
  • B-140 (2E)-N-(3-te ⁇ butylphenyl)-3-(3- ⁇ [2-(4 / 5-dniydro-lH-imidazol-2-yl)pyridin-4- yl]oxy ⁇ phenyl)-2-(hydroxymethyl)acrylamide
  • B-141 4-[3-((lE)-3- ⁇ [4-(aminomethyl)-3-(trifluoromethyl)phenyl]amino ⁇ -3-oxoprop-l- en-l-yl)phenoxy]-N-methylpyridine-2-carboxamide
  • B-142 4-[3-((lE)-3- ⁇ [3-arrmo-5-( ⁇ fluoromethyl)phenyl]arnino ⁇ -3-oxoprop-l-en-l- yl)phenoxy]-N-methylpy ⁇ idine-2-carboxamide
  • B-144 4-[3-((lE)-3- ⁇ [3-(2-aminoethyl)-5-(trlfluoromelhyl)phenyl]amino ⁇ -3-oxoprop-l- en-l-yl)phenoxy]-N-methylpyridine-2-carboxamide
  • B-149 (2£)-N-[4-chloro-3-(trifluorornethyl)phenyl]-3-(3- ⁇ [2--(4 / 5-dihydro-lH- irnidazol-2-yl)pyridin-4-yl]arr ⁇ in.o ⁇ phenyl)acrylarnide B-150- N - ⁇ 4-[3-((lE)-3- ⁇ [4-ethyl-3-(trifluoromethyl)phenyl]amino ⁇ -3-oxoprop-l-en-l- y ⁇ phenoxyjpyridin ⁇ -yljcyclopropanecarboxamide B _ 151 . N- ⁇ 4-[3-((lE)-3- ⁇ [4-[(dimethylamino)meihyl]-3-
  • the compounds of the present invention can be prepared by methods known to one of ordinary skill in the art and/or by reference to the schemes shown below and the synthetic examples that follow. Exemplary synthetic routes are set forth in Schemes below, and in the Examples.
  • the acid i is coupled under standard amide formation conditions to an aniline to provide amide ii.
  • the reaction mixture is warmed to 100 0 C for at least 4 hours to provide the desired biaryl ether iii.
  • the biaryl ether bond can be formed first by reacting acid i with a 4-chloropyridine derivative in DMF in the presence of cesium carbonate or another base. This provides acid iv, which is then treated with an aryl or heteroaryl amine in the presence of coupling agents to give the desired amides iii.
  • the required acid i is not commercially available, but the corresponding methyl ether v is.
  • acid v is converted to the amide under standard conditions and then treated with boron tribromide in methylene chloride to effect the deprotection of the phenol and provide amide vi.
  • Ether formation is then accomplished as described above to provide the biaryl ether iii.
  • Acrylic acid vii is converted to the acid chloride with oxalyl chloride, and the resulting acid chloride is reacted with an aniline in the presence of base.
  • the resulting acrylamide viii is then reacted with an appropriately substituted aryl iodide ix in the presence of a palladium catalyst and a base to give the cinnamide vi.
  • Known aniline xx can be converted to iodide xxi under standard Sandmeyer conditions. Oxidation of the pyridine nitrogen, followed by treatment with an appropriate nucleophile results in substituted pyridine xxii. Heck coupling of this iodide with an acrylamide viii results in cinnamide xxiii which can be reduced by catalytic hydrogenation to provide the desired hydrocinnamides xxiv.
  • the present invention provides compounds that are inhibitors of Raf kinases.
  • the compounds can be assayed in vitro or in vivo for their ability to bind to and/or inhibit a Raf kinase.
  • In vitro assays include assays to determine inhibition of the ability of the kinase to phosphorylate a substrate protein or peptide. Alternate in vitro assays quantitate the ability of the compound to bind to the kinase. Inhibitor binding may be measured by radiolabelling the inhibitor prior to binding, isolating the inhibitor/ kinase complex and determining the amount of radiolabel bound.
  • inhibitor binding Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • the compounds may be determined by running a competition experiment in which new inhibitors are incubated with the kinase bound to a known radioligand.
  • the compounds also can be assayed for their ability to affect cellular or physiological functions mediated by protein kinase activity. Assays for each of these activities are described in the Examples and/or are known in the art.
  • the invention provides a method for inhibiting Raf kinase activity in a cell, comprising contacting a cell in which inhibition of a Raf kinase is desired with a compound of formula (I).
  • the compound of formula (I) interacts with and reduces the activity of more than one Raf kinase enzyme in the cell.
  • some compounds of formula (I) show inhibition of both enzymes.
  • the compound of formula (I) is selective, i.e., the concentration of the compound that is required for inhibition of one Raf kinase enzymes is lower, preferably at least 2-fold, 5-fold, 10-fold, or 50-fold lower, than the concentration of the compound required for inhibition of another Raf kinase enzyme.
  • the compound of formula (I) inhibits one or more Raf kinase enzymes at a concentration that is lower than the concentration of the compound required for inhibition of other, unrelated, kinase enzymes.
  • the compound formula (I) in addition to inhibiting Raf kinase, also inhibits one or more other kinase enzymes, preferably other kinase enzymes involved in tumor cell proliferation.
  • the invention thus provides a method for inhibiting cell proliferation, comprising contacting a cell in which such inhibition is desired with a compound of formula (I).
  • a compound of formula (I) is used to denote the ability of a compound of formula (T) to inhibit cell number or cell growth in contacted cells as compared to cells not contacted with the inhibitor.
  • An assessment of cell proliferation can be made by counting cells using a cell counter or by an assay of cell viability, e.g., an MTT or WST assay.
  • such an assessment of cell proliferation can be made by measuring the growth, e.g., with calipers, and comparing the size of the growth of contacted cells with non-contacted cells.
  • the growth of cells contacted with the inhibitor is retarded by at least about 50% as compared to growth of non-contacted cells, hi various embodiments, cell proliferation of contacted cells is inhibited by at least about 75%, at least about 90%, or at least Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • the phrase "inhibiting cell proliferation" includes a reduction in the number of contacted cells, as compare to non-contacted cells.
  • a kinase inhibitor that inhibits cell proliferation in a contacted cell may induce the contacted cell to undergo growth retardation, to undergo growth arrest, to undergo programmed cell death (i.e., apoptosis), or to undergo necrotic cell death.
  • the invention provides a pharmaceutical composition
  • a pharmaceutical composition comprising a compound of formula (I) as defined above, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier.
  • the salts preferably are derived from inorganic or organic acids and bases.
  • suitable salts see, e.g., Berge et al, /. Pharm. Sd. 66:1-19 (1977) and Remington: The Science and Practice of Pharmacy, 20th Ed., ed. A. Gennaro, Lippincott Williams & Wilkins, 2000.
  • Nonlimiting examples of suitable acid addition salts include the following: acetate, adipate, alginate, aspartate, benzoate, benzene sulfonate, bisulfate, butyrate, citrate, camphorate, camphor sulfonate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, formate, fumarate, lucoheptanoate, glycerophosphate, hemisulfate, heptanoate, hexanoate, hydrochloride, hydrobromide, hydroiodide, 2-hydroxyethanesulfonate, lactate, maleate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, oxalate, pamoate, pectinate, persulfate, 3-phenyl-propionate, picrate, pivalate, propionate
  • Suitable base addition salts include, without limitation, ammonium salts, alkali metal salts, such as sodium and potassium salts, alkaline earth metal salts, such as calcium and magnesium salts, salts with organic bases, such as dicyclohexylamine salts, N-methyl-D- glucamine, and salts with amino acids such as arginine, lysine, and so forth.
  • basic nitrogen-containing groups may be quaternized with such agents as lower alkyl halides, such as methyl, ethyl, propyl, and butyl chloride, bromides and iodides; dialkyl sulfates, such as dimethyl, diethyl, dibutyl and diamyl sulfates, long chain halides such as decyl, lauryl, myristyl and stearyl chlorides, bromides and iodides, aralkyl halides, such as Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • pharmaceutically acceptable carrier refers to a material that is compatible with a recipient subject, preferably a mammal, more preferably a human, and is suitable for delivering an active agent to the target site without terminating the activity of the agent.
  • the toxicity or adverse effects, if any, associated with the carrier preferably are commensurate with a reasonable risk/benefit ratio for the intended use of the active agent.
  • compositions of the invention can be manufactured by methods well known in the art such as conventional granulating, mixing, dissolving, encapsulating, lyophilizing, or emulsifying processes, among others.
  • Compositions may be produced in various forms, including granules, precipitates, or particulates, powders, including freeze dried, rotary dried or spray dried powders, amorphous powders, tablets, capsules, syrup, suppositories, injections, emulsions, elixirs, suspensions or solutions.
  • Formulations may optionally contain stabilizers, pH modifiers, surfactants, bioavailability modifiers and combinations of these.
  • compositions may be prepared as liquid suspensions or solutions using a liquid, such as, but not limited to, an oil, water, an alcohol, and combinations of these.
  • a liquid such as, but not limited to, an oil, water, an alcohol, and combinations of these.
  • Pharmaceutically suitable surfactants, suspending agents, or emulsifying agents may be added for oral or parenteral administration.
  • Suspensions may include oils, such as but not limited to, peanut oil, sesame oil, cottonseed oil, corn oil and olive oil.
  • Suspension preparation may also contain esters of fatty acids such as ethyl oleate, isopropyl myristate, fatty acid glycerides and acetylated fatty acid glycerides.
  • Suspension formulations may include alcohols, such as, but not limited to, ethanol, isopropyl alcohol, hexadecyl alcohol, glycerol and propylene glycol.
  • Ethers such as but not limited to, poly(ethyleneglycol) , petroleum hydrocarbons such as mineral oil and petrolatum; and water may also be used in suspension formulations.
  • compositions include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • salts or electrolytes such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol and wool fat.
  • compositions of this invention are formulated for pharmaceutical administration to a mammal, preferably a human being.
  • Such pharmaceutical compositions of the present invention may be administered orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir.
  • parenteral as used herein includes subcutaneous, intravenous, intramuscular, intra-articular, intra-synovial, intrasternal, intrathecal, intrahepatic, intralesional and intracranial injection or infusion techniques.
  • the compositions are administered orally, intravenously, or subcutaneously.
  • the formulations of the invention may be designed to be short-acting, fast-releasing, or long-acting.
  • compounds can be administered in a local rather than systemic means, such as administration (e.g., by injection) at a tumor site.
  • Sterile injectable forms of the compositions of this invention may be aqueous or oleaginous suspension. These suspensions may be formulated according to techniques ⁇ known in the art using suitable dispersing or wetting agents and suspending agents.
  • the sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally acceptable diluent or solvent, for example as a solution in 1,3-butanediol.
  • the acceptable vehicles and solvents that may be employed are water, Ringer's solution and isotonic sodium chloride solution.
  • sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose, any bland fixed oil may be employed including synthetic mono- or di-glycerides.
  • Fatty acids such as oleic acid and its glyceride derivatives are useful in the preparation of injectables, as are natural pharmaceutically- acceptable oils, such as olive oil or castor oil, especially in their polyoxyethylated versions.
  • oils such as olive oil or castor oil
  • These oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, such as carboxymethyl cellulose or similar dispersing agents which are commonly used in the formulation of pharmaceutically acceptable dosage forms including emulsions and suspensions.
  • Other commonly used surfactants such as Tweens, Spans and other emulsifying agents or bioavailability enhancers which are commonly used in the manufacture of pharmaceutically Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • compositions may also be used for the purposes of formulation.
  • Compounds may be formulated for parenteral administration by injection such as by bolus injection or continuous infusion.
  • a unit dosage form for injection may be in ampoules or in multi- dose containers.
  • compositions of this invention may be orally administered in any orally acceptable dosage form including, but not limited to, capsules, tablets, aqueous suspensions or solutions.
  • carriers that are commonly used include lactose and corn starch.
  • Lubricating agents such as magnesium stearate, are also typically added.
  • useful diluents include lactose and dried cornstarch.
  • aqueous suspensions are required for oral use, the active ingredient is combined with emulsifying and suspending agents. If desired, certain sweetening, flavoring or coloring agents may also be added.
  • compositions of this invention may be administered in the form of suppositories for rectal administration.
  • suppositories may be prepared by mixing the agent with a suitable non-irritating excipient which is solid at room temperature but liquid at rectal temperature and therefore will melt in the rectum to release the drug.
  • suitable non-irritating excipient include cocoa butter, beeswax and polyethylene glycols.
  • compositions of this invention may also be administered topically, especially when the target of treatment includes areas or organs readily accessible by topical application, including diseases of the eye, the skin, or the lower intestinal tract. Suitable topical formulations are readily prepared for each of these areas or organs.
  • Topical application for the lower intestinal tract may be effected in a rectal suppository formulation (see above) or in a suitable enema formulation. Topically- transdermal patches may also be used.
  • the pharmaceutical compositions may be formulated in a suitable ointment containing the active component suspended or dissolved in one or more carriers. Carriers for topical administration of the compounds of this invention include, but are not limited to, mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene, polyoxypropylene compound, emulsifying wax and water.
  • the pharmaceutical compositions may be formulated in a suitable lotion or cream containing the active components suspended or dissolved in one or more pharmaceutically Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • Suitable carriers include, but are not limited to, mineral oil, sorbitan monostearate, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.
  • the pharmaceutical compositions may be formulated as micronized suspensions in isotonic, pH adjusted sterile saline, or, preferably, as solutions in isotonic, pH adjusted sterile saline, either with our without a preservative such as benzylalkor ⁇ um chloride.
  • the pharmaceutical compositions may be formulated in an ointment such as petrolatum.
  • compositions of this invention may also be administered by nasal aerosol or inhalation.
  • Such compositions are prepared according to techniques well known in the art of pharmaceutical formulation and may be prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, fluorocarbons, and/or other conventional solubilizing or dispersing agents.
  • the pharmaceutical compositions of the invention preferably are formulated for administration to a patient having, or at risk of developing or experiencing a recurrence of, a Raf kinase-mediated disorder.
  • patient means an animal, preferably a mammal, more preferably a human.
  • Preferred pharmaceutical compositions of the invention are those formulated for oral, intravenous, or subcutaneous administration.
  • any of the above dosage forms containing a therapeutically effective amount of a compound of the invention are well within the bounds of routine experimentation and therefore, well within the scope of the instant invention.
  • the pharmaceutical composition of the invention may further comprise another therapeutic agent.
  • such other therapeutic agent is one that is normally administered to patients with the disease or condition being treated.
  • terapéuticaally effective amount is meant an amount sufficient to cause a detectable decrease in protein kinase activity or the severity of a Raf kinase-mediated disorder.
  • the amount of Raf kinase inhibitor needed will depend on the effectiveness of the inhibitor for the given cell type and the length of time required to treat the disorder. It should also be understood that a specific dosage and treatment regimen for any particular patient will depend upon a variety of factors, including the activity of the specific compound employed, the age, Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • the amount of additional therapeutic agent present in a composition of this invention typically will be no more than the amount that would normally be administered in a composition comprising that therapeutic agent as the only active agent.
  • the amount of additional therapeutic agent will range from about 50% to about 100% of the amount normally present in a composition comprising that agent as the only therapeutically active agent.
  • the invention provides a method for treating a patient having, or at risk of developing or experiencing a recurrence of, a Raf kinase-mediated disorder.
  • a Raf kinase-mediated disorder includes any disorder, disease or condition which is caused or characterized by an increase in Raf kinase expression or activity, or which requires Raf kinase activity.
  • the term "Raf kinase-mediated disorder” also includes any disorder, disease or condition in which inhibition of Raf kinase activity is beneficial.
  • the Raf kinase inhibitors of the invention can be used to achieve a beneficial therapeutic or prophylactic effect, for example, in subjects with a proliferative disorder.
  • proliferative disorders include chronic inflammatory proliferative disorders, e.g., psoriasis and rheumatoid arthritis; proliferative ocular disorders, e.g., diabetic retinopathy; benign proliferative disorders, e.g., hemangiomas; and cancer.
  • cancer refers to a cellular disorder characterized by uncontrolled or disregulated cell proliferation, decreased cellular differentiation, inappropriate ability to invade surrounding tissue, and/or ability to establish new growth at ectopic sites.
  • cancer includes, but is not limited to, solid tumors and bloodborne tumors.
  • the term “cancer” encompasses diseases of skin, tissues, organs, bone, cartilage, blood, and vessels.
  • the term “cancer” further encompasses primary and metastatic cancers.
  • Non-limiting examples of solid tumors that can be treated with the disclosed Raf kinase inhibitors include pancreatic cancer; bladder cancer; colorectal cancer; breast cancer, including metastatic breast cancer; prostate cancer, including androgen-dependent and androgen-independent prostate cancer; renal cancer, including, e.g., metastatic renal cell carcinoma; hepatocellular cancer; lung cancer, including, e.g., non-small cell lung cancer (NSCLC), bronchioloalveolar carcinoma (BAC), and adenocarcinoma of the lung; ovarian Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
  • cancer including, e.g., progressive epithelial or primary peritoneal cancer; cervical cancer; gastric cancer; esophageal cancer; head and neck cancer, including, e.g., squamous cell carcinoma of the head and neck; skin cancer, including e.g., malignant melanoma; neuroendocrine cancer, including metastatic neuroendocrine tumors; brain tumors, including, e.g., glioma, anaplastic oligodendroglioma, adult glioblastoma multiforme, and adult anaplastic astrocytoma; bone cancer; soft tissue sarcoma; and thyroid carcinoma.
  • progressive epithelial or primary peritoneal cancer cervical cancer
  • gastric cancer gastric cancer
  • esophageal cancer head and neck cancer, including, e.g., squamous cell carcinoma of the head and neck
  • skin cancer including e.g., malignant melanoma
  • neuroendocrine cancer including metastatic neuro
  • Non-limiting examples of hematologic malignancies that can be treated with the disclosed Raf kinase inhibitors include acute myeloid leukemia (AML); chronic myelogenous leukemia (CML), including accelerated CML and CML blast phase (CML-BP); acute lymphoblastic leukemia (ALL); chronic lymphocytic leukemia (CLL); Hodgkin's disease (HD); non-Hodgkin's lymphoma (NHL), including follicular lymphoma and mantle cell lymphoma; B-cell lymphoma; T-cell lymphoma; multiple myeloma (MM); Waldenstrom's macroglobulinemia; myelodysplastic syndromes (MDS), including refractory anemia (RA), refractory anemia with ringed siderblasts (RARS), (refractory anemia with excess blasts (RAEB), and RAEB in transformation (RAEB-T); and myeloproliferative syndrome
  • the compounds of formula (I) are particularly useful in the treatment of cancers or cell types characterized by aberrant activation of the Ras-Raf-MEK-ERK pathway, including, without limitation, those characterized by an activating Ras and /or Raf mutation.
  • the compound or composition of the invention is used to treat a patient having or at risk of developing or experiencing a recurrence in a cancer selected from the group consisting of melanoma, colon, lung, breast, ovarian, sarcoma and thyroid cancer.
  • the cancer is a melanoma.
  • the Raf kinase inhibitor of the invention is administered in conjunction with another therapeutic agent.
  • the other therapeutic agent is one that is normally administered to patients with the disease or condition being treated.
  • the Raf kinase inhibitor of the invention may be administered with the other therapeutic agent in a single dosage form or as a separate dosage form.
  • the other therapeutic agent may be administered prior to, at the same time as, or following administration of the protein kinase inhibitor of the invention.
  • a Raf kinase inhibitor of formula (T) is administered in conjunction with an anticancer agent.
  • anticancer agent refers to any agent that is administered to a subject with cancer for purposes of treating the cancer.
  • Nonlimiting examples anticancer agents include: radiotherapy; immunotherapy; DNA damaging chemotherapeutic agents; and chemotherapeutic agents that disrupt cell replication.
  • Non-limiting examples of DNA damaging chemotherapeutic agents include topoisomerase I inhibitors (e.g., irinotecan, topotecan, camptothecin and analogs or metabolites thereof, and doxorubicin); topoisomerase II inhibitors (e.g., etoposide, teniposide, and daunorubicin); alkylating agents (e.g., melphalan, chlorambucil, busulfan, thiotepa, ifosfamide, carmustine, lomustine, semustine, streptozocin, decarbazine, methotrexate, mitomycin C, and cyclophosphamide); DNA intercalators (e.g., cisplatin, oxaliplatin, and carboplatin); DNA intercalators and free radical generators such as bleomycin; and nucleoside mimetics (e.g., 5- fluorouracil, capec
  • Chemotherapeutic agents that disrupt cell replication include: paclitaxel, docetaxel, and related analogs; vincristine, vinblastin, and related analogs; thalidomide and related analogs (e.g., CC-5013 and CC-4047); protein tyrosine kinase inhibitors (e.g., imatinib mesylate and gefitinib); proteasome inhibitors (e.g., bortezomib); NF- ⁇ B inhibitors, including inhibitors of IKB kinase; antibodies which bind to proteins overexpressed in cancers and thereby downregulate cell replication (e.g., trastuzumab, rituximab, cetuximab, and bevacizumab); and other inhibitors of proteins or enzymes known to be upregulated, over-expressed or activated in cancers, the inhibition of which downregulates cell replication.
  • paclitaxel, docetaxel, and related analogs e

Landscapes

  • Organic Chemistry (AREA)
  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Animal Behavior & Ethology (AREA)
  • Medicinal Chemistry (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Plural Heterocyclic Compounds (AREA)
  • Pyridine Compounds (AREA)

Abstract

The present invention provides novel cinnamide compounds of formula (I) useful as inhibitors of raf -protein kinases. The invention also provides pharmaceutical compositions comprising the compounds of the invention and use thereof in the treatment of various cell proliferative diseases, wherein the rings B and C, G and L are as defined herein.

Description

Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
CINNAMIDE AND HYDROCINNAMIDE DERIVATIVES WITH KINASE INHIBITORY ACTIVITY
(Attorney Docket No. MPI05-002P1RNWOM)
RELATED APPLICATIONS
[001] This application claims priority from U.S. Provisional Patent Application No.
60/643,928, filed on January 14, 2005, and U.S. Provisional Patent Application No. 60/710,635, filed on August 23, 2005, each of which is hereby incorporated by reference in its entirety.
BACKGROUND OF THE INVENTION
Field of the Invention
[002] The present invention relates to protein kinase inhibitors, particularly inhibitors of Raf-kinase. The invention also provides pharmaceutical compositions comprising the compounds of the invention and methods of using the compositions in the treatment of various diseases.
Background of the Invention
[003] Protein kinases constitute a large family of structurally related enzymes that effect the transfer of a phosphate group from a nucleoside triphosphate to a Ser, Thr or Tyr residue on a protein acceptor. A vast array of cellular functions, including DNA replication, cell cycle progression, energy metabolism, and cell growth and differentiation, are regulated by reversible protein phosphorylation events mediated by protein kinases. Additionally, protein kinase activity has been implicated in a number of disease states, including cancers. Of the >100 dominant oncogenes known to date, many encode receptor and cytoplasmic tyrosine kinases known to be mutated and/ or over expressed in human cancers (Blume-Jensen and Hunter, Nature, 411:355-365 (2001)). Accordingly, protein kinase targets have attracted substantial drug discovery efforts in recent years, with several protein kinase inhibitors achieving regulatory approval (reviewed in Fischer, Curr. Med. Chem., 11:1563 (2004); Dancey and Sausville, Nature Rev. Drug Disc, 2:296 (2003)). Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
[004] Intracellular signaling pathways activated in response to growth factor/cytokine stimulation are known to control functions such as proliferation, differentiation and cell death (Chiloeches and Marais, In Targets for Cancer Therapy; Transcription Factors and Other Nuclear Proteins, 179-206 (La Thangue and Bandara, eds., Totowa, Humana Press 2002)). One example is the Ras-Raf-MEK-ERK pathway which is controlled by receptor tyrosine kinase activation. Activation of Ras proteins at the cell membrane leads to phosphorylation and recruitment of accessory factors and Raf which is then activated by phosphorylation. Activation of Raf leads to downstream activation of MEK and ERK. ERK has several cytoplasmic and nuclear substrates, including ELK and Ets-family transcription factor, which regulates genes involved in cell growth, survival and migration (Marais et ah, J. Biol. Cliem., 272:4378-4383 (1997); Peyssonnaux and Eychene, Biol. Cell, 93-53-62 (2001)). As a result, this pathway is an important mediator of tumor cell proliferation and angiogenesis. For instance, overexpression of constitutively active B-Raf can induce an oncogenic event in untransformed cells (Wellbrock et ah, Cancer Res., 64:2338-2342 (2004)). Aberrant activation of the pathway, such as by activating Ras and/or Raf mutations, is known to be associated with a malignant phenotype in a variety of tumor types (Bos, Hematol. Pathol., 2:55-63 (1988); Downward, Nature Rev. Cancer, 3:11-22 (2003); Karasarides et ah, Oncogene, 23:6292-6298 (2004); Tuveson, Cancer Cell, 4:95-98 (2003); Bos, Cancer Res, 49:4682-4689 (1989)). Activating mutations in B-Raf are found in 60-70% of melanomas. Melanoma cells that carry mutated B-Raf- V599E are transformed, and cell growth, ERK signaling and cell viability are dependent on mutant B-Raf function (Karasarides et ah, Oncogene, 23:6292-6298 (2004)). Although this mutation historically has been referred to in the literature as V599E, the mutated valine actually is located at position 600 (Wellbrock et ah, Cancer Res., 64:2338-2342 (2004)).
[005] There are three Raf isoforms, A-Raf, B-Raf and C-Raf (Raf-1), all of which can act as downstream effectors of Ras. Although they show significant sequence similarities, they also exhibit distinct roles in development, in addition to significant biochemical and functional differences. In particular, the high basal kinase activity of B-Raf may explain why mutated forms of only this isoform have been found in human cancers. Nevertheless, the isoforms show redundant functions in facilitating oncogenic Ras-induced activation of the MEK-ERK signaling cascade (Wellbrock, Cancer Res, 64:2338-2342 (2004)). In addition to Raf signaling via the MEK- ERK pathway, there is some evidence that C-Raf (and possibly B-Raf and A-Raf) may signal via Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
alternative pathways directly involved in cell survival by interaction with the BH3 family of anti-apoptotic proteins (Wellbrock et al, Nature Rev.: MoI. Cell Biol, 5:875 (2004)).
[006] Inhibitors of the Raf kinases may be expected to interrupt the Ras-Raf signaling cascade and thereby provide new methods for the treatment of proliferative disorders, such as cancer. There is thus a need for new inhibitors of Raf kinase activity.
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
DESCRIPTION OF THE INVENTION
[007] The present invention provides compounds that are effective inhibitors of Raf- kinase. These compounds are useful for inhibiting kinase activity in vitro and in vivo, and are especially useful for the treatment of various cell proliferative diseases.
[008] Compounds useful for the methods of the invention are represented by formula
(I):
Figure imgf000005_0001
or a pharmaceutically acceptable salt thereof; wherein:
G1 is -C(Rd)(Re)-, -C(O)-, -O-, -S-, -S(O)-, -S(O)2-, or -N(Rf)-, wherein G1 is attached to Ring A at the position meta or para to L ;
L1 is -[C(Rε)(Rh)]m-C(Ri)(Rk)- or -C(Rm)=C(Rn)-;
Ring A is substituted with 0-2 occurrences of Ra;
Ring B is an optionally substituted mono- or bicyclic aromatic ring system having one to four ring nitrogen atoms and optionally one or two additional ring heteroatoms independently selected from oxygen and sulfur;
Ring C is an optionally substituted 5- or 6-membered aryl or heteroaryl ring having 0-3 ring nitrogen atoms and optionally one additional ring heteroatom selected from oxygen and sulfur;
Ra is halo, -NO2, -CN, -OR5, -SR6, -S(O)R6, -SO2R6, -SO2N(R4),, -N(R4)2, -OC(O)R5, -CO2R5, -C(O)N(R4)2, -N(R4)SO2R6, -N(R4)SO2N(R4)2, or an optionally substituted C14 aliphatic;
R is hydrogen, fluoro, C1-4 aliphatic, C14 fluoroaliphatic, -NH2, -NH(C14 alkyl), -N(C1., alkyl^ OH, or -0(C1., alkyl); Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Re is hydrogen, fluoro, C1 4 aliphatic, or C1-4 fluoroaliphatic; or R and Re, taken together with the carbon atom to which they are attached, form a 3- to 6-membered cycloaliphatic or heterocyclyl ring;
Rf is -H, -C(O)R5, -C(O)N(R4)2, -CO2R6, -SO2R6, -SO2N(R4)2, or an optionally substituted Cj_6 aliphatic;
Rε is hydrogen, fluoro, C1-4 aliphatic, or C114 fluoroaliphatic; and
R is hydrogen, fluoro, C1 4 aliphatic, C1-4 fluoroaliphatic, -OH, -0(C1 4 alkyl), -N(R4)2,
-N(R4)C(O)(C1-4 aliphatic), -C(O)(C1., alkyl), -CO2H, -CO2(C1., alkyl), or -C(O)N(R4)2; or
Rε and R , taken together with the carbon atom to which they are attached, form a 3- to 6- membered cycloaliphatic ring;
RJ is hydrogen, fluoro, C1-4 aliphatic, or C1-4 fluoroaliphatic; and
R is hydrogen, fluoro, C1-4 aliphatic, C1-4 fluoroaliphatic, -OH, -0(C1., alkyl), -C(O)(C1., alkyl), -CO2H, -CO2(C1., alkyl), or -C(O)N(R4)2; or
R and R , taken together with the carbon atom to which they are attached, form a 3- to 6- membered cycloaliphatic ring; or each of Rs and R' is hydrogen, fluoro, C1-4 aliphatic, or C1., fluoroaliphatic; and
R1 and R , taken together with the intervening carbon atoms, form a 3- to 6-membered cycloaliphatic ring;
Rm is hydrogen, fluoro, -OR5, -C(O)R5, -C(O)N(R4)2, -CO2R5, -SO2R6, -SO2N(R4)2, or an optionally substituted C1-4 aliphatic;
Rn is hydrogen, fluoro, -C(O)R5, -C(O)N(R4)2, -CO2R5, -SO2R6, -SO2N(R4)2, or an optionally substituted C1-4 aliphatic;
each R independently is hydrogen or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl group; or two R on the same nitrogen atom, taken together with the nitrogen atom, form an optionally substituted 4- to 8-membered heterocyclyl ring Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S; each R independently is hydrogen or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl group; each R independently is an optionally substituted aliphatic, aryl group, or heteroaryl group; and m is 1 or 2.
[009] Compounds of this invention include those described generally above, and are further illustrated by the classes, subclasses, and species disclosed herein. Terms used herein shall be accorded the following defined meanings, unless otherwise indicated.
[010] The terms "Raf" and "Raf kinase" are used interchangeably, and unless otherwise specified refer to any member of the Raf family of kinase enzymes, including without limitation, the isoforms A-Raf, B-Raf, and C-Raf . These enzymes, and the corresponding genes, also may be referred to in the literature by variants of these terms, e.g., RAF, raf, BRAF, B-raf, b- raf. The isoform C-Raf also is referred to by the terms Raf-1 and C-Raf-1.
[011] The term "aliphatic" or "aliphatic group", as used herein, means a substituted or unsubstituted straight-chain, branched, or cyclic C1-12 hydrocarbon, which is completely saturated or which contains one or more units of unsaturation, but which is not aromatic. For example, suitable aliphatic groups include substituted or unsubstituted linear, branched or cyclic alkyl, alkenyl, or alkynyl groups and hybrids thereof, such as (cycloalkyl)alkyl, (cycloalkenyl)alkyl or (cycloalkyl)alkenyl. In various embodiments, the aliphatic group has 1 to 12, 1 to 8, 1 to 6, 1 to 4, or 1 to 3 carbons.
[012] The terms "alkyl", "alkenyl", and "alkynyl", used alone or as part of a larger moiety, refer to a straight or branched chain aliphatic group having from 1 to 12 carbon atoms. For purposes of the present invention, the term "alkyl" will be used when the carbon atom attaching the aliphatic group to the rest of the molecule is a saturated carbon atom. However, an alkyl group may include unsaturation at other carbon atoms. Thus, alkyl groups include, without limitation, methyl, ethyl, propyl, allyl, propargyl, butyl, pentyl, and hexyl. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
[013] For purposes of the present invention, the term "alkenyl" will be used when the carbon atom attaching the aliphatic group to the rest of the molecule forms part of a carbon- carbon double bond. Alkenyl groups include, without limitation, vinyl, 1-propenyl, 1-butenyl, 1-pentenyl, and 1-hexenyl.
[014] For purposes of the present invention, the term "alkynyl" will be used when the carbon atom attaching the aliphatic group to the rest of the molecule forms part of a carbon- carbon triple bond. Alkynyl groups include, without limitation, ethynyl, 1-propynyl, 1-butynyl, 1-pentynyl, and 1-hexynyl.
[015] The term "cycloaliphatic", used alone or as part of a larger moiety, refers to a saturated or partially unsaturated cyclic aliphatic ring system having from 3 to about 14 members, wherein the aliphatic ring system is optionally substituted. In some embodiments, the cycloaliphatic is a monocyclic hydrocarbon having 3-8 or 3-6 ring carbon atomsl Nonlimiting examples include cyclopropyl, cyclobutyl, cyclopentyl, cyclopentenyl, cyclohexyl, cyclohexenyl, cycloheptyl, cycloheptenyl, cyclooctyl, cyclooctenyl, and cyclooctadienyl. In some embodiments, the cycloaliphatic is a bridged or fused bicyclic hydrocarbon having 6-12, 6- 10, or 6-8 ring carbon atoms, wherein any individual ring in the bicyclic ring system has 3-8 members.
[016] In some embodiments, two adjacent substituents on the cycloaliphatic ring, taken together with the intervening ring atoms, form an optionally substituted fused 5- to 6- membered aromatic or 3- to 8-membered non-aromatic ring having 0-3 ring heteroatoms selected from the group consisting of O, N, and S. Thus, the term "cycloaliphatic" includes aliphatic rings that are fused to one or more aryl, heteroaryl, or heterocyclyl rings. NonUmiting examples include indanyl, 5,6,7,8-tetrahydroquinoxalinyl, decahydronaphthyl, or tetrahydronaphfhyl, where the radical or point of attachment is on the aliphatic ring.
[017] The terms "aryl" and "ar~", used alone or as part of a larger moiety, e.g.,
"aralkyl", "aralkoxy", or "aryloxyalkyl", refer to a C6 to C14 aromatic hydrocarbon, comprising one to three rings, each of which is optionally substituted. Preferably, the aryl group is a C6-10 aryl group. Aryl groups include, without limitation, phenyl, naphthyl, and anfhracenyl. In some embodiments, two adjacent substituents on the aryl ring, taken together with the intervening ring atoms, form an optionally substituted fused 5- to 6-membered aromatic or 4- to Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
8-membered non-aromatic ring having 0-3 ring heteroatoms selected from the group consisting of O, N, and S. Thus, the term "aryl", as used herein, includes groups in which an aryl ring is fused to one or more heteroaryl, cycloaliphatic, or heterocyclyl rings, where the radical or point of attachment is on the aromatic ring. Nonlimiting examples of such fused ring systems include indolyl, isoindolyl, benzothienyl, benzofuranyl, dibenzofuranyl, indazolyl, benzimidazolyl, benzthiazolyl, quinolyl, isoquinolyl, cinnolinyl, phthalazinyl, quinazolinyl, quinoxalinyl, carbazolyl, acridinyl, phenazinyl, phenothiazinyl, phenoxazinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, fluorenyl, indanyl, phenanthridinyl, tetrahydronaphthyl, indolinyl, phenoxazinyl, benzodioxanyl, and benzodioxolyl. An aryl group may be mono-, bi-, tri-, or polycyclic, preferably mono-, bi-, or tricyclic, more preferably mono- or bicyclic. The term "aryl" may be used interchangeably with the terms "aryl group", "aryl moiety", and "aryl ring".
[018] An "aralkyl" or "arylalkyl" group comprises an aryl group covalently attached to an alkyl group, either of which independently is optionally substituted. Preferably, the aralkyl group is C6-10 -UyI(C1JaIkJrI, C640
Figure imgf000009_0001
or C6-10 ary^C^alkyl, including, without limitation, benzyl, phenethyl, and naphthylmethyl.
[019] The terms "heteroaryl" and "heteroar-", used alone or as part of a larger moiety, e.g., heteroaralkyl, or "heteroaralkoxy", refer to groups having 5 to 14 ring atoms, preferably 5, 6, 9, or 10 ring atoms; having 6, 10, or 14 π electrons shared in a cyclic array; and having, in addition to carbon atoms, from one to four heteroatoms. The term "heteroatom" refers to nitrogen, oxygen, or sulfur, and includes any oxidized form of nitrogen or sulfur, and any quaternized form of a basic nitrogen. Thus, when used in reference to a ring atom of a heteroaryl, the term "nitrogen" includes an oxidized nitrogen (as in pyridine N-oxide). Certain nitrogen atoms of 5-membered heteroaryl groups also are substitutable, as further defined below. Heteroaryl groups include, without limitation, radicals derived from thiophene, furan, pyrrole, imidazole, pyrazole, triazole, tetrazole, oxazole, isoxazole, oxadiazole, thiazole, isothiazole, thiadiazole, pyridine, pyridazine, pyrrolidine, pyrazine, indolizine, naphthyridine, pteridine, pyrrolopyridine, imidazopyridine, oxazolopyridine, thiazolopyridine, triazolopyridine, pyrrolopyrimidine, purine, and triazolopyrimidine. As used herein, the phrase "radical derived from" means a monovalent radical produced by removal of a hydrogen radical from the parent heteroaromatic ring system. The radical (i.e., the point of attachment of Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
the heteroaryl to the rest of the molecule) may be created at any substitutable position on any ring of the parent heteroaryl ring system.
[020] In some embodiments, two adjacent substituents on the heteroaryl, taken together with the intervening ring atoms, form an optionally substituted fused 5- to 6- membered aromatic or 4- to 8-membered non-aromatic ring having 0-3 ring heteroatoms selected from the group consisting of O, N, and S. Thus, the terms "heteroaryl" and "heteroar-", as used herein, also include groups in which a heteroaromatic ring is fused to one or more aryl, cycloaliphatic, or heterocyclyl rings, where the radical or point of attachment is on the heteroaromatic ring. Nonlimiting examples include indolyl, isoindolyl, benzothienyl, benzofuranyl, dibenzofuranyl, indazolyl, benzimidazolyl, benzthiazolyl, benzoxazolyl, quinolyl, isoquinolyl, cinnolinyl, phthalazinyl, quinazolinyl, quinoxalinyl, 4H-quinolizinyl, carbazolyl, acridinyl, phenazinyl, phenothiazinyl, phenoxazinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, and pyrido[2,3-b]-l,4-oxazin-3(4H)-one. A heteroaryl group may be mono-, bi-, tri-, or polycyclic, preferably mono-, bi-, or tricyclic, more preferably mono- or bicyclic. The term "heteroaryl" may be used interchangeably with the terms "heteroaryl ring", or "heteroaryl group", any of which terms include rings that are optionally substituted. The term "heteroaralkyl" refers to an alkyl group substituted by a heteroaryl, wherein the alkyl and heteroaryl portions independently are optionally substituted.
[021] As used herein, the terms "aromatic ring" and "aromatic ring system" refer to an optionally substituted mono-, bi-, or tricyclic group having 0-6, preferably 0-4 ring heteroatoms, and having 6, 10, or 14 π electrons shared in a cyclic array. Thus, the terms "aromatic ring" and "aromatic ring system" encompass both aryl and heteroaryl groups.
[022] As used herein, the terms "heterocycle", "heterocyclyl", "heterocyclic radical", and "heterocyclic ring" are used interchangeably and refer to a stable 3- to 7-membered monocyclic, or to a fused 7- to 10-membered or bridged 6- to 10-membered bicyclic heterocyclic moiety that is either saturated or partially unsaturated, and having, in addition to carbon atoms, one or more, preferably one to four, heteroatoms, as defined above. When used in reference to a ring atom of a heterocycle, the term "nitrogen" includes a substituted nitrogen. As an example, in a heterocyclyl ring having 1-3 heteroatoms selected from oxygen, sulfur or nitrogen, the nitrogen may be N (as in 3,4~dihydro-2H-pyrrolyl), NH (as in pyrrolidinyl), or +NR (as in N- substituted pyrrolidinyl). A heterocyclic ring can be attached to its pendant group at any Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
heteroatom or carbon atom that results in a stable structure, and any of the ring atoms can be optionally substituted. Examples of such saturated or partially unsaturated heterocyclic radicals include, without limitation, tetrahydrofuranyl, tetrahydrothienyl, pyrrolidinyl, pyrrolidonyl, piperidinyl, pyrrolinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, oxazolidinyl, piperazinyl, dioxanyl, dioxolanyl, diazepinyl, oxazepinyl, thiazepinyl, morpholinyl, and quinuclidinyl.
[023] In some embodiments, two adjacent substituents on a heterocyclic ring, taken together with the intervening ring atoms, form an optionally substituted fused 5- to 6- membered aromatic or 3- to 8-membered non-aromatic ring having 0-3 ring heteroatoms selected from the group consisting of O, N, and S. Thus, the terms "heterocycle", "heterocyclyl", "heterocyclyl ring", "heterocyclic group", "heterocyclic moiety", and "heterocyclic radical", are used interchangeably herein, and include groups in which a heterocyclyl ring is fused to one or more aryl, heteroaryl, or cycloaliphatic rings, such as indolinyl, 3H-indolyl, chromanyl, phenanfhridinyl, or tetrahydroquinolinyl, where the radical or point of attachment is on the heterocyclyl ring. A heterocyclyl group may be mono-, bi-, tri-, or polycyclic, preferably mono-, bi-, or tricyclic, more preferably mono- or bicyclic. The term "heterocycrylalkyl" refers to an alkyl group substituted by a heterocyclyl, wherein the alkyl and heterocyclyl portions independently are optionally substituted.
[024] As used herein, the term "partially unsaturated" refers to a ring moiety that includes at least one double or triple bond between ring atoms. The term "partially unsaturated" is intended to encompass rings having multiple sites of unsaturation, but is not intended to include aryl or heteroaryl moieties, as herein defined.
[025] The terms "haloaliphatic", "haloalkyl", "haloalkenyl" and "haloalkoxy" refer to an aliphatic, alkyl, alkenyl or alkoxy group, as the case maybe, which is substituted with one or more halogen atoms. As used herein, the term "halogen" or "halo" means F, Cl, Br, or I. The term "fluoroaliphatic" refers to a haloaliphatic wherein the halogen is fluoro, including perfluorinated aliphatic groups. Examples of fluoroaliphatic groups include, without limitation, fluoromethyl, difluoromethyl, trifluoromethyl, 2-fluoroethyl, 2,2,2-trifluoroethyl, 1,1,2-trifluoroethyl, 1,2,2-trifluoroethyl, and pentafluoroethyl. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
[026] The term "linker group" or "linker" means an organic moiety that connects two parts of a compound. Linkers typically comprise an atom such as oxygen or sulfur, a unit such as -NH-, -CH2-, -C(O)-, -C(O)NH-, or a chain of atoms, such as an alkylene chain. The molecular mass of a linker is typically in. the range of about 14 to 200, preferably in the range of 14 to 96 with a length of up to about six atoms. In some embodiments, the linker is a C1 6 alkylene chain.
[027] The term "alkylene" refers to a bivalent alkyl group. An "alkylene chain" is a polymethylene group, i.e., -(CH2)n-, wherein n is a positive integer, preferably from 1 to 6, from 1 to 4, from 1 to 3, from 1 to 2, or from 2 to 3. A substituted alkylene chain is a polymethylene group in which one or more methylene hydrogen atoms is replaced with a substituent. Suitable substituents include those described below for a substituted aliphatic group. An alkylene chain also may be substituted at one or more positions with an aliphatic group or a substituted aliphatic group.
[028] An alkylene chain also can be optionally interrupted by a functional group. An alkylene chain is "interrupted" by a functional group when an internal methylene unit is replaced with the functional group. Examples of suitable "interrupting functional groups" include -C(R*)=C(R*)-, -OC-, -O-, -S-, -S(O)-, -S(O)2-, -S(O)2N(R+)-, -N(R*)-, -N(R+)CO-, -N(R+)C(O)N(R+)-, -N(R+)C(=NR+)-N(R+)-, -N(R+)-C(=NR+)-, -N(R+)CO2-, -N(R+)SO2-, -N(R+)SO2N(R+)-, -OC(O)-, -OC(O)O-, -OC(O)N(R+)-, -C(O)-, -CO2-, -C(O)N(R+)-, -C(O)-C(O)-, -C(=NR+)-N(R+)-, -C(NR+)^N-, -C(=NR+)-O-, -C(ORO=N-, -C(R0J=N-O-, or -N(R+)-N(R+)-. Each R+, independently, is hydrogen or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl group, or two R+ on the same nitrogen atom, taken together with the nitrogen atom, form a 5-8 membered aromatic or non-aromatic ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms selected from N, O, and S. Each R* independently is hydrogen or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl group.
[029] Examples of C3 6 alkylene chains that have been "interrupted" with -O- include -
CH2OCH2-, -CH2O(CH2)2-, -CH2O(CH2)3-, -CH2O(CH2)4-, -(CH2)2OCH2-, -(CH2)2O(CH2)2-, -(CH2)2O(CH2)3-, -(CH2)P(CH2)-, -(CH2)3O(CH2)2- , and -(CHj)4O(CH2)-. Other examples of alkylene chains that are "interrupted" with functional groups include -CH2ZCH2-, Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
-CH2Z(Oy2-, -CH2Z(CH2)3-, -CH2Z(CHQ4-, -(CH2)2ZCH2-, -(CH2)2Z(CH2)2-/ -(CH2)2Z(CH2)3-, -(CH2)3Z(CH2)-, -(CH2)3Z(CH2)2- , and -(CH2)4Z(CH2)-, wherein Z is one of the "interrupting functional groups" listed above.
[030] For purposes of clarity, all bivalent groups described herein, including, e.g., the alkylene chain linkers described above and the variables G , L , T , T , i , V , and v , are intended to be read from left to right, with a corresponding left-to-right reading of the formula or structure in which the variable appears.
[031] One of ordinary skill in the art will recognize that when an alkylene chain having an interruption is attached to a functional group, certain combinations are not sufficiently stable for pharmaceutical use. Similarly, certain combinations of V , T and R , and certain combinations of V , T , and R would not be sufficiently stable for pharmaceutical use. Only stable or chemically feasible compounds are within the scope of the present invention. A stable or chemically feasible compound is one in which the chemical structure is not substantially altered when kept at a temperature from about -80 0C to about +40 0C, preferably -20 0C to about +40 0C, in the absence of moisture or other chemically reactive conditions, for at least a week, or a compound which maintains its integrity long enough to be useful for therapeutic or prophylactic administration to a patient.
[032] The term "substituted", as used herein, means that a hydrogen radical of the designated moiety is replaced with the radical of a specified substituent, provided that the substitution results in a stable or chemically feasible compound. The term "substitutable", when used in reference to a designated atom, means that attached to the atom is a hydrogen radical, which can be replaced with the radical of a suitable substituent.
[033] The phrase "one or more substituents", as used herein, refers to a number of substituents that equals from one to the maximum number of substituents possible based on the number of available bonding sites, provided that the above conditions of stability and chemical feasibility are met. Unless otherwise indicated, an optionally substituted group may have a substituent at each substitutable position of the group, and the substituents may be either the same or different. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
[034] As used herein, the term "independently selected" means that the same or different values may be selected for multiple instances of a given variable in a single compound. By way of example, in a compound of formula (T), if Ring B is substituted with two substituents -Rb, each substituent is selected from the group of defined values for R , and the two values selected may be the same or different.
[035] An aryl (including the aryl moiety in aralkyl, aralkoxy, aryloxyalkyl and the like) or heteroaryl (including the heteroaryl moiety in heteroaralkyl and heteroaralkoxy and the like) group may contain one or more substituents. Examples of suitable substituents on the unsaturated carbon atom of an aryl or heteroaryl group include -halo, -NO2, -CN, -R*, -C(R*)=C(R*)2, -CsC-R*, -OR*, -SR0, -S(O)R0, -SO2R0, -SO3R*, -SO2N(R+),, -N(R+)2, -NR+C(O)R*, -NR+C(O)N(R+),, -N(R+)C(=NR+)-N(R+)2, -N(R+)C(=NR+)-R°, -NR+CO2R0, -NR+SO2R0, -NR+SO2N(R+),, -OC(O)R*, -O-CO2R*, -OC(O)N(R+),, -C(O)R*, -CO2R*, -C(O)-C(O)R*, -C(O)N(R+)2, -C(O)N(R+)-OR*, -C(O)N(R+)C(=NR+)-N(R+)2, -N(R+)C(=NR+)-N(R+)-C(O)R*, -C(=NR+)-N(R+)2, -C(=NR+)-OR*, -N(R+)-N(R+)2, -N(R+)-OR*, -C(=NR+)-N(R+)-OR*, -C(R°)=N-OR*, -P(O)(R% -P(O)(OR*)2, -0-P(O)-OR*, and -P(O)(NR+)-N(R+)2, wherein R° is an optionally substituted aliphatic, aryl, or heteroaryl group, and R+ and R* are as defined above, or two adjacent substituents, taken together with their intervening atoms, form a 5-6 membered unsaturated or partially unsaturated ring having 0-3 ring atoms selected from the group consisting of N, O, and S.
[036] An aliphatic group or a non-aromatic heterocyclic ring may be substituted with one or more substituents. Examples of suitable substituents on the saturated carbon of an aliphatic group or of a non-aromatic heterocyclic ring include, without limitation, those listed above for the unsaturated carbon of an aryl or heteroaryl group and the following: =O, =S, =C(R% =N-N(R% =N-OR*, =N-NHC(O)R*, =N-NHCO2R°, =N-NHSO2R°, or =N-R*, where each R* and R° is as defined above. Additionally, two substituents on the same carbon atom, taken together with the carbon atom to which they are attached may form an optionally substituted spirocyclic 3- to 6-membered cycloaliphatic ring.
[037] Suitable substituents on a substitutable nitrogen atom of a heteroaryl or non- aromatic heterocyclic ring include -R*, -N(R% -C(O)R*, -CO2R*, -C(O)-C(O)R* Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
-C(O)CH2C(O)R*, -SO2R*, -SO2N(R*)2, -C(=S)N(R*)2, -C(=NH)-N(R*)2, and -NR*SO2R*; wherein each R* is as defined above. A ring nitrogen atom of a heteroaryl or non-aromatic heterocyclic ring also may be oxidized to form the corresponding N-hydroxy or N-oxide compound. A nonlirniting example of such a heteroaryl having an oxidized ring nitrogen atom is N-oxidopyridyl.
[038] The term "about" is used herein to mean approximately, in the region of, roughly, or around. When the term "about" is used in conjunction with a numerical range, it modifies that range by extending the boundaries above and below the numerical values set forth. In general, the term "about" is used herein to modify a numerical value above and below the stated value by a variance of 10%.
[039] As used herein, the term "comprises" means "includes, but is not limited to."
[040] It will be apparent to one skilled in the art that certain compounds of this invention may exist in tautomeric forms, all such tautomeric forms of the compounds being within the scope of the invention. Unless otherwise stated, structures depicted herein are also meant to include all geometric (or conformational) isomers, i.e., (Z) and (E) double bond isomers and (Z) and (E) conformational isomers, as well as all stereochemical forms of the structure; i.e., the R and S configurations for each asymmetric center. Therefore, single stereochemical isomers as well as enantiomeric and diastereomeric mixtures of the present compounds are within the scope of the invention. When a mixture is enriched in one stereoisomer relative to another stereoisomer, the mixture may contain, for example, an enantiomeric excess of at least 50%, 75%, 90%, 99%, or 99.5%.
[041] Unless otherwise stated, structures depicted herein are also meant to include compounds which differ only in the presence of one or more isotopically enriched atoms. For example, compounds having the present structure except for the replacement of a hydrogen atom by a deuterium or tritium, or the replacement of a carbon atom by a C- or C-enriched carbon are within the scope of the invention.
[042] In the compounds of formula (I), Ring A is additionally substituted with 0, 1, or 2 substituents Ra, where Ra is as defined above. Preferably, Ra is selected from the group consisting of halo, CM. aliphatic, C1 4 fluoroaliphatic, -NO2, -CN, -CO2H, -0(C1 4 alkyl), Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
-0(C1., fluoroalkyl), -S(C1-4 alkyl), -SO2(C1-4 alkyl), -NH2, -NH(C1-4 alkyl), -N(C1-4 alkyl)2/ -C(O)NH2, -C(O)NH(C1-4 alkyl), and -C(O)N(C1-4 alkyl)2. More preferably, Ra is selected from the group consisting of, -F, -Cl, -NO2, -CH3, -CF3, -OCH3, -SCH3, -SO2CH3, -CN, -CO2H, -C(O)NH2, -C(O)NHCH3, and -C(O)N(CH3)2. In certain preferred embodiments Ring A has no substituents R'\
[043] In one embodiment, the linker L is a two-carbon alkenylene chain having the formula -C(Rm)=C(Rn)-, where Rm and Rn are as defined above. The substituents Rm and Rn may be in a cis or trans configuration relative to each other. In some embodiments, Rm and Rn are trans to each other. In some embodiments, Rm and R" are each independently hydrogen, fluoro, C1-4 fluoroaliphatic, or a C1-4 aliphatic optionally substituted with one substituent selected from -NH2, -NH(C1-4 alkyl), -N(C1-4 alkyl)2, -OH, or -0(C1-4 alkyl). In certain embodiments, Rm is hydrogen and Rn is hydrogen, fluoro, -CH3, or -CH2OH. As mentioned above, the bivalent group L is intended to be read from left to right, with the carbon atom bearing Rm attached to Ring A, and the carbon atom bearing Rn attached to the amide carbonyl.
[044] In another embodiment, the linker L is a two- or three-carbon alkylene chain having the formula -[C(Rs)(Rh)]m-C(Rj)(Rk)-, where each of Rε, Rh/, Rj, Rk, and m is as defined above. In some embodiments, R and R are each independently selected from the group consisting of hydrogen, fluoro, C1-4 alkyl, or C14 fluoroalkyl. In some embodiments, the carbon atoms in L are substituted with 0, 1, or 2, preferably O or 1, non-hydrogen substituents. In
. 1 . certain preferred embodiments, L is -CH2-CH2- or -CH2-CH2-CH2-. As mentioned above, the bivalent group L is intended to be read from left to right, with the carbon atom bearing Rs anc R attached to Ring A, and the carbon atom bearing R' and R attached to the amide carbonyl.
[045] The linker G -,i i .s a one-atom linker selected from the group consisting of
-C(Rd)(Re)-, -C(O)-, -O-, -S-, -S(O)-, -S(O)2-, or -N(Rf)-, where each of Rd, Re, and Rf is as defined above. The linker G is attached to Ring A at the positional meta or para to L . When L is -C(Rm)=C(Rn)-, G preferably is attached to Ring A at the position meta to L . Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
[046] When G1 is a carbon linker, Rd and Re preferably are each independently hydrogen, fluoro, C1-4 aliphatic, or C1-4 fluoroaliphatic. Alternatively, R and Re, taken together with the carbon atom to which they are attached, form a 3- to 6-membered cycloaliphatic or heterocyclyl ring, preferably a cyclopropyl ring. In some embodiments, each of R and Re is hydrogen. When G1 is a nitrogen linker, Rf preferably is hydrogen, -C(O)R5, or an optionally substituted C1-4 aliphatic. More preferably, R is hydrogen. Most preferably, G is -O- or -NH-.
[047] In some embodiments of the present invention, the compound of formula (I) is characterized by one or more of the following features:
(a) each Ra independently is -F, -Cl, -CN, -NO2, C1-4 alkyl, -CF3, -0(C1-4 alkyl), -OCF3, -S(C14 alkyl), -SO2(C1-4 alkyl), -NH2, -NH(C1-4 alkyl), -N(C1-4 alkyl)2, -CO2H, -C(O)NH2, or -C(O)NH(C1-4 alkyl);
(b) R* and R are each independently hydrogen, fluoro, C14 alkyl, or C1-4 fluoroalkyl;
(c) L is -C(Rm)=C(Rn)-, and Rm and Rn are trans to each other;
(d) Rm and Rn are each independently hydrogen, fluoro, C1-4 fluoroaliphatic, or a C14 aliphatic optionally substituted with one substituent selected from -NH2, -NH(C1-4 alkyl), -N(C1-4 alkyl)2, -OH, or -0(C1-4 alkyl);
(e) L1 is -CH2-CH2- or -CH2-CH2-CH2-; and
(f) G1 is -O- or -NH-.
[048] In the compounds of formula (I), Ring B is an optionally substituted mono- or bicyclic heteroaryl having one to four ring nitrogen atoms and optionally one or two additional ring heteroatoms selected from oxygen and sulfur. Each substitutable ring nitrogen atom in Ring B is unsubstituted or substituted, preferably with -C(O)R5, -C(O)N(R4)2, -CO2R6, -SO2R6, -SO2N(R4)2, C1-4 aliphatic, an optionally substituted C6-10 aryl, or a C6-10 ar(C1-4)alkyl, the aryl portion of which is optionally substituted. One ring nitrogen atom in Ring B optionally is oxidized. In some embodiments, the substitutable ring nitrogen atoms in Ring B all are unsubstituted, and one ring nitrogen atom optionally is oxidized. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
[049] In some embodiments, Ring B is a radical derived from an aromatic ring system selected from the group consisting of pyrrole, oxazole, thiazole, imidazole, pyrazole, isoxazole, isothiazole, oxadiazole, triazole, thiadiazole, pyridine, pyridazine, pyrrolidine, pyrazine, triazine, indolizine, indole, isoindole, indazole, benzimidazole, benzthiazole, benzoxazole, pyrrolopyridine, imidazopyridine, oxazolopyridine, fhiazolopyridine, triazolopyridine, pyrrolopyrimidine, purine, triazolopyrimidine, quinoline, isoquinoline, cinnoline, phthalazine, quinazoline, quinoxaline, naphthyridine, and pteridine. Any such ring system optionally is substituted on any substitutable ring carbon or ring nitrogen atom, one ring nitrogen atom optionally is oxidized, and the point of attachment connecting Ring B to G may be on either ring when Ring B is a radical derived from a bicyclic ring system.
[050] Preferably, Ring B is a radical derived from pyrrole, oxazole, thiazole, imidazole, pyrazole, isoxazole, pyridine, pyridazine, pyrimidine, pyrazine, pyrrolopyridine, imidazolopyridine, pyrazolopyridine, triazolopyridine, pyrrolopyrimidine, purine, pyrazolopyrimidine, triazolopyrimidine, benzimidazole, or benzthiazole, wherein Ring B optionally is substituted on any substitutable ring carbon or ring nitrogen atom, and one ring nitrogen atom optionally is oxidized. In certain preferred embodiments, Ring B is an optionally substituted pyridyl or N-oxidopyridyl.
[051] Substitutable ring carbon atoms in Ring B preferably are substituted with 0-2 R and 0-2 R . Each R independently is selected from the group consisting of C1-4 aliphatic, C1-4 fluoroaliphatic, halo, -OH, -0(C1-4 aliphatic), -NH2, -NH(C1-4 aliphatic), and -N(C1-4 aliphatic)2. Each Rb independently is halo, -NO2, -CN, -C(R5)=C(R5)2, -C≡C-R5, -OR5, -SR6, -S(O)R6, -SO2R6, -SO2N(R4)2, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4),, -N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-R6, -NR4CO2R6, -N(R4)SO2R6, -N(R4)SO2N(R4)2, -O-C(O)R5, -OC(O)N(R4)2, -C(O)R5, -CO2R5, -C(O)N(R4)2, -C(O)N(R4)-OR5, -C(O)N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-N(R4)-C(O)R5, -C(=NR4)-N(R4)2, -C(=NR4)-OR5, -C(=NR4)-N(R4)-OR5, -C(R )=N-OR , or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
[052] In some embodiments, each R independently is selected from the group consisting of C1-6 aliphatic, C1-6 fluoroaliphatic, halo, -Rlb, -R2b, -Tα-Rlb, -Tα-R2b, -vW-Rlh, and -V -T -R . The variables T , V , R , and R have the values described below.
[053] T is a C1-6 alkylene chain optionally substituted with R a or R , wherein the alkylene chain optionally is interrupted by -C(R5)=C(R5)-/ -OC-, -O-, -S-, -S(O)-, -S(O)2-, -SO2N(R4)-, -N(R4)-, -N(R4)C(O)-, -NR4C(O)N(R4)-, -N(R4)C(=NR4)-N(R4)-, -N(R4)-C(=NR4)-, -N(R4)CO2-, -N(R4)SO2-, -N(R4)SO2N(R4)-, -OC(O)-, -OC(O)N(R4)-, -C(O)-, -CO2-, -C(O)N(R4)-, -C(=NR4)-N(R4)-, -C(NR4)=N(R4)-, -C(=NR4)-O-, or -C(R6)=N-O-, and wherein T1 or a portion thereof optionally forms part of a 3-7 membered ring. In some embodiments, T is a C1-4 alkylene chain optionally substituted with one or two substituents independently selected from the group consisting of C1-3 aliphatic, C13 fluoroaliphatic, -F, -OH, -0(C1-4 alkyl), -CO2H, -CO2(C1-4 alkyl), -C(O)NH2, and -C(O)NH(C1-4 alkyl), wherein the alkylene chain optionally is interrupted with -N(R4)-, -C(=NR4)-N(R4)-, -C(NR4)=N(R4)-, -N(R4)-C(=NR4)-, -N(R4)-C(O)-, or -C(O)N(R4)-. In some particular embodiments, T1 is a C1-6 or C1-4 alkylene chain optionally substituted with -F, C1-3 alkyl, or C1-3 fluoroalkyl, wherein the alkylene chain optionally is interrupted by -N(R4)-, -C(O)-N(R4)-, -C(=NR4)-N(R4)-, -C(NR4)=N(R4)-, -N(R4)-C(O)-, or -N(R4)-C(=NR4)-. In certain particular embodiments, T1 is a C1-4 alkylene chain optionally substituted with -F, C1-3 alkyl, or C1-3 fluoroalkyl.
[054] V1 is
Figure imgf000019_0001
-OC-, -O-, -S-, -S(O)-, -S(O)2-, -SO2N(R4)-, -N(R4)-,
-N(R4)C(O)-, -NR4C(O)N(R4)-, -N(R4)C(=NR4)-N(R4)-, -N(R4)C(=NR4)-, -N(R4)CO2-, -N(R4)SO2-, -N(R4)SO2N(R4)-, -OC(O)-, -OC(O)N(R4)-, -C(O)-, -CO2-, -C(O)N(R4)-, -C(O)N(R4)-O-, -C(O)N(R4)C(=NR4)-N(R4)-, -N(R4)C(=NR4)-N(R4)-C(O)-, -C(=NR4)-N(R4)-, -C(NR4)=N(R4)-, -C(=NR4)-O-, or -C(R6)=N-O-. In some embodiments, V1 is -C(R5)=QR5)-, -GO, -O-, -N(R4)-, -N(R4)C(O)-, -C(O)N(R4)-, -C(=NR4)-N(R4)-, -C(NR4)=N(R4)-, or -N(R4)-C(=NR4)-. In certain preferred embodiments, V1 is -N(R4)-, -N(R4)-C(O)-, -C(O)N(R4)-, -C(=NR4)N(R4)-, or -N(R4)-C(=NR4)-. In certain particular embodiments, V1 is -N(R451)-, -N(R4x)-C(O)-, -C(O)N(R4")-, Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
-C(=NR4x)N(R4x)-, or -N(R4x)-C(=NR4x)-, where R4x is hydrogen, C1-4 alkyl, C1-4 fluoroalkyl, or C6-10 ar(C1 4)alkyl, the aryl portion of which may be optionally substituted. In some embodiments, V1 is -C(O)NH-, -NH-C(O)-, or -Q=NH)NH-.
[055] Each R independently is an optionally substituted aryl, heteroaryl, heterocyclyl, or cycloaliphatic ring. In some embodiments, R is an optionally substituted C3 6 cycloaliphatic or an optionally substituted phenyl, azetidinyl, pyrrolyl, imidazolyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, pyrazolyl, triazolyl, tetrazolyl, oxadiazolyl, thiadiazolyl, pyrrolinyl, imidazolinyl, pyrazolinyl, pyrrolidinyl, imidazolidinyl, pyrazolidinyl, piperidinyl, morpholinyl, piperazinyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, or tetrahydropyrimidinyl. In certain preferred embodiments, R is an optionally substituted C3-6 cycloaliphatic or an optionally substituted pyrrolidinyl, piperidinyl, morpholinyl, or piperazinyl ring.
[056] Each R2b independently is -NO2, -CN, -C(R5)=C(R5)2, -C≡C-R5, -OR5, -SR6, -S(O)R6,
-SO2R6, -SO2N(R4)2, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4)2, -N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-R6, -NR4CO2R6, -N(R4)SO2R6, -N(R4)SO2N(R4)2, -O-C(O)R5, -OC(O)N(R4)2, -C(O)R5, -CO2R5, -C(O)N(R4)2, -C(O)N(RVOR5, -C(O)N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-N(R4)-C(O)R5, -C(=NR4)-N(R4)2, -C(=NR4)-OR5, -C(=NR4)-N(R4)-OR5, or -C(R6)=N-OR5. In some embodiments, each R2b independently is -OR5, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4),, -C(O)N(R4)-OR5, -C(O)N(R4)2, -N(R4)-CO2R5, ~N(R4)-C(=NR4)-R5 or -C(=NR4)-N(R4)2. In some embodiments, each R2b independently is -N(R4)2, -NR4C(O)R5, -C(O)N(R4)2, -CO2R5, or -OR5.
[057] Each R a independently is selected from the group consisting of -F, -OH,
-0(C1-4 alkyl), -CN, -N(R4)2, -C(O)(C1-4 alkyl), -CO2H, -CO2(C1-4 alkyl), -C(O)NH2, and -C(O)NH(C1-4 alkyl).
[058] Each R independently is a C1-3 aliphatic optionally substituted with R a or R , or two substituents R on the same carbon atom, taken together with the carbon atom to which they are attached, form a 3- to 6-membered cycloaliphatic ring. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
[059] Each R4 independently is hydrogen or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl group; or two R on the same nitrogen atom, taken together with the nitrogen atom, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms selected from N, O, and S.
[060] Each R independently is hydrogen or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl group.
[061] Each R independently is an optionally substituted aliphatic, aryl, or heteroaryl group.
[062] Each R independently is an optionally substituted aryl or heteroaryl ring.
[063] In some embodiments, the substitutable ring carbon atoms in Ring B are substituted with 0-1 R and 0-2 R . More preferably, the substitutable ring carbon atoms in Ring B are substituted with 0-1 R and 0-1 R . In such embodiments, R preferably is selected from the group consisting of C1-4 aliphatic, C1-4 fluoroaliphatic, halo, -R , -R , -T -R -T -R , -V'-T'-R113, and -V'-T'-R2", where:
T is a C1-4 alkylene chain optionally substituted with one or two substituents independently selected from the group consisting of C13 aliphatic, C13 fluoroaliphatic, -F, -OH, -0(C1-4 alkyl), -CO2H, -CO2(C1-4 alkyl), -C(O)NH2, and -C(O)NH(C1-4 alkyl), wherein the alkylene chain optionally is interrupted with -N(R4)-, -C(=NR4)-N(R4)-, -C(NR4)=N(R4)-, -N(R4)-C(=NR4)-, -N(R4)-C(O)-, or -C(O)N(R4)-;
V1 is -C(R5)=C(R5)-, -CsC-, -O-, -N(R4)-, -N(R4)C(O)-, -C(O)N(R4)-, -C(=NR4)-N(R4)-, -C(NR4)=N(R4)-, or-N(R4)-C(=NR4)-;
each R independently is an optionally substituted aryl, heteroaryl, heterocyclyl, or cycloaliphatic ring; and each R2b independently is -NO2, -CN, -C(R5)=C(R5)2, -C≡C-R5, -OR5, -SO2R6, -SO2N(R4),, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4),, -N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-R6, -NR4CO2R6, -N(R4)SO2R6, -N(R4)SO2N(R4)2, -O-C(O)R5, -OC(O)N(R4)2, -C(O)R5, -CO2R5, -C(O)N(R4)2, Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
-C(O)N(RVOR5, -C(O)N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-N(R4)-C(O)R5, -C(=NR4)-N(R4)2, -C(=NR4)-OR5, -C(=NR4)-N(R4)-OR5,or -C(R6)=N-OR5.
[064] In the compounds of formula (I), Ring C is an optionally substituted 5- or 6- membered aryl or heteroaryl ring having 0-3 ring nitrogen atoms and optionally one additional ring heteroatom selected from oxygen and sulfur. In some embodiments, two adjacent substituents on Ring C, taken together with the intervening ring atoms, form an optionally substituted fused 5- or 6-membered aromatic or non-aromatic ring having 0-3 ring heteroatoms selected from the group consisting of O, N, and S.
[065] In some embodiments, Ring C is an optionally substituted furanyl, thienyl, pyrrolyl, oxazolyl, thiazolyl, imidazolyl, pyrazolyl, isoxazolyl, isothiazolyl, oxadiazolyl, triazolyl, thiadiazolyl, phenyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, or triazinyl, wherein one ring nitrogen atom in Ring C optionally is oxidized.
[066] Each substitutable ring nitrogen atom in Ring C is unsubstituted or is substituted with -C(O)R5, -C(O)N(R4)2, -CO2R6, -SO2R6, -SO2N(R4)2, or a C1-4 aliphatic optionally substituted with -F, -OH, -O(C14 alkyl), -CN, -N(R4)2, -C(O)(C1., alkyl), -CO2H, -CO2(CM alkyl), -C(O)NH2, -C(O)NH(C1-4 alkyl), or an optionally substituted C6-10 aryl ring. One ring nitrogen atom in Ring C optionally is oxidized. In some embodiments, each substitutable ring nitrogen atom in Ring C is unsubstituted, and one ring nitrogen atom optionally is oxidized.
[067] Substitutable ring carbon atoms in Ring C preferably are substituted with 0-2 Rc and 0-2 R c. Each R c independently is selected from the group consisting of C14 aliphatic, C14 fluoroaliphatic, -O(Cα_4 alkyl), -0(C14 fluoroalkyl), and halo. In some embodiments, R c is selected from the group consisting of halo, methyl, trifluoromethyl, ethyl, isopropyl, cyclopropyl, fert-butyl, methoxy, and trifluoromethoxy.
[068] Each Rc independently is halo, -NO2, -CN, -C(R5)=C(R5)2, -C≡C-R5, -OR5, -SR6,
-S(O)R6, -SO2R6, -SO2N(R4)2, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4J2,
Figure imgf000022_0001
-N(R4)C(=NR4)-R6, -NR4CO2R6, -N(R4)SO2R6, -N(R4)SO2N(R4)2, -O-C(O)R5, -OC(O)N(R4)2, -C(O)R5, -CO2R5, -C(O)N(R4)2, -C(O)N(RVOR5, -C(O)N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-N(R4)-C(O)R5, -C(=NR4)-N(R4)2, -C(=NR4)-OR5, -C(=NR4)-N(R4)-OR5, Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
-C(R6)=N-OR5, or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl; or two adjacent Rc, taken together with the intervening ring atoms, form an optionally substituted fused 5- or 6-membered aromatic or non-aromatic ring having 0-3 ring heteroatoms independently selected from the group consisting of O, N, and S.
[069] In some embodiments, each Rc independently is selected from the group consisting of C1 6 aliphatic, C1 6 fluoroaliphatic, halo, -Rlc, -R2c, -T^-R20, and -T^-R10. The variables T2, Rlc, and R2c have the values described below.
[070] T2 is a C1-6 alkylene chain optionally substituted with R3a or R , wherein the alkylene chain optionally is interrupted by -C(R5)=C(R5)-, -G≡C-, -O-, -S-, -S(O)-, -S(O)2-, -SO2N(R4)-/ -N(R4)-, -N(R4)C(O)-, -NR4C(O)N(R4)-, -N(R4)CO2-, -N(R4)SO2-, -C(O)N(R4)-, -C(O)-, -CO2-, -OC(O)-, or -OC(O)N(R4)-, and wherein T2 or a portion thereof optionally forms part of a 3-7 membered ring. In some embodiments, T is a C1 4 or C14 alkylene chain optionally substituted with R a or R . In some embodiments, T is a C1-4 alkylene chain optionally substituted with one or two groups independently selected from -F, C1-4 aliphatic, and C1 4 fluoroaliphatic.
,1c .
[071] Each R independently is an optionally substituted aryl, heteroaryl, heterocyclyl, or cycloaliphatic ring.
[072] Each R2c independently is -NO2, -CN, -C(R5)=C(R5)2, -C≡C-R5, -OR5, -SR6, -S(O)R6,
-SO2R6, -SO2N(R4)2, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4),, -N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-R6, -NR4CO2R6, -N(R4)SO2R6, -N(R4)SO2N(R4)2, -O-C(O)R5, -OC(O)N(R4)2, -C(O)R5, -CO2R5, -C(O)N(R4)2, -C(O)N(R4)-OR5, -C(O)N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-N(R4)-C(O)R5, -C(=NR4)-N(R4)2, -C(=NR4)-OR5, -C(=NR4)-N(R4)-OR5, or -C(R6)=N-OR5. In some embodiments, each R2c independently is -CN, -C(R5)=C(R5)2, -C≡C-R5, -OR5, -SR6, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4),, -NR4CO2R6, -CO2R5, or -C(O)N(R4)2.
[073] The variables R a, R , R , R , R , and R have the values described above for Ring
B. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
[074] In some embodiments, the substitutable ring carbon atoms in Ring C are substituted with 0-2 Rc and 0-1 R8c, where:
each Rc preferably is selected from the group consisting of C1-4 aliphatic,
C14 fluoroaliphatic, halo, -R2c and -T2-R2c; or two adjacent Rc, taken together with the intervening ring atoms, form an optionally substituted fused 5- or 6-membered aromatic or non-aromatic ring having 0-3 ring heteroatoms independently selected from the group consisting of O, N, and S; l is a C1-4 alkylene chain optionally substituted with one or two groups independently selected from -F, C1-4 aliphatic, and C1-4 fluoroaliphatic;
each R2c independently is -CN, -C(R5)=C(R5)2, -C≡C-R5, -OR5, -SR6, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4)2, -NR4CO2R6, -CO2R5, and -C(O)N(R4)2; and
each R c independently is selected from the group consisting of C1-4 aliphatic, C1-4 fluoroaliphatic, -O(C1-4 alkyl), -O(C1-4 fluoroaliphatic), and halo.
[075] In some embodiments, the substitutable ring carbon atoms in Ring C are substituted with 0-2 Rc and 0-1 R c, where:
each Rc independently is halo, -CN, -C(R5x)=C(R5x)(R5y), -C≡C-R5y, -OR5y, -SR6", -N(R4x)(R4y), -CO2R5", -C(O)N(R4x)(R4y), or a C1-4 aliphatic or C1-4 fluoroaliphatic optionally substituted with one or two substituents independently selected from the group consisting of -OR5x, -N(R4x)(R4y), -SR6x, -CO2R5x, or -C(O)N(R4x)(R4y); or two adjacent Rc, taken together with the intervening ring atoms, form an optionally substituted fused 5- or 6-membered aromatic or non-aromatic ring having 0-3 ring heteroatoms independently selected from the group consisting of O, N, and S;
R x is hydrogen, C1-4 alkyl, C1-4 fluoroalkyl, or C6-10 ar(C1-4)alkyl, the aryl portion of which may be optionally substituted, or two R x on the same nitrogen atom, taken together with the nitrogen atom, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S; Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
R4y is hydrogen, C6-10 ar(C1-4)alkyl, the aryl portion of which may be optionally substituted, an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring, or a C1 4 alkyl or C1-4 fluoroalkyl optionally substituted with one or two substituents independently selected from the group consisting of -ORSx, -N(R4x)2, -CO2R5", or -C(O)N(R4x)2; or
R4x and R4y, taken together with the nitrogen atom to which they are attached, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S; each R x independently is hydrogen, C1-4 alkyl, C1-4 fluoroalkyl, C6-10 ar(Cα 4)alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring; each R5y independently is hydrogen, an optionally substituted C6-10 aryl, a
Figure imgf000025_0001
the aryl portion of which may be optionally substituted, or a C1-4 alkyl or C1 4 fluoroalkyl optionally substituted with one or two substituents independently selected from the group consisting of -OR5x, -N(R4x)2, -CO2R5x, or -C(O)N(R4x)2; and
each R independently is C1-4 alkyl, C1-4 fluoroalkyl, C6-10 ar(CM)alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring.
[076] In some embodiments, Ring C is a 5- or 6-membered heteroaryl substituted with
0-2 Rc. In some such embodiments, each Rc independently is selected from the group consisting of -halo, C1-4 alkyl, C1-4 fluoroalkyl, -O(C1-4 alkyl), and -O(CM fluoroalkyl), or two adjacent Rc, taken together with the intervening ring atoms, form an optionally substituted fused 5- or 6-membered aromatic or non-aromatic ring having 0-3 ring heteroatoms selected from the group consisting of O, N, and S.
[077] In certain such embodiments, Ring C is selected from the group consisting of: Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000026_0001
[078] Another embodiment of the invention relates to a compound of formula (T), wherein Ring C is an optionally substituted phenyl. Such compounds have the formula (II):
Figure imgf000026_0002
or a pharmaceutically acceptable salt thereof, wherein: Ring C is substituted with 0-2 Rc and 0-1 Rδc; and
Ring A, Ring B, and the variables G1, L1, Ra, Rc, and R8c have the values and preferred values described above for formula (T).
[079] In the compounds of formula (IT), when L1 is -[C(R8XR1X-C(R5XRY, and G1 is
-CH2- in the para position, Ring B preferably is other than imidazole.
[080] In some embodiments, Ring C in formula (IT) is selected from the group consisting of:
Figure imgf000026_0003
and
Figure imgf000026_0004
; where each Rc independently is halo, -CN,
Figure imgf000026_0005
-C≡C-R ?5oyy, - nOτR>5y y, - cSτR>6αx
-N(R J4X\ )/(TR>4Λ y), -CO2R , -C(O)N(R ?4x\ )/(-Rπ>4yy'), or a C14 aUphatic or C1^ fluoroaUphatic optionally substituted with one or two substituents independently selected from the group consisting of
-OR ,5x , -N(R >4x\ )/("Ro4y y'), -SR ,6x , -CO2R ,5x , or -C(O)N(R •4x\ )(/"-Rπ>4Λy); or two adjacent R , taken together with Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
the intervening ring atoms, form an optionally substituted fused 5- or 6-membered aromatic or non-aromatic ring having 0-3 ring heteroatoms independently selected from the group consisting of O, N, and S;
R is C1-4 aliphatic, C14 fluoroaliphatic, halo, -CN, -OH, -0(C1-4 alkyl), -0(C1., fluoroalkyl), -S(CM alkyl), -NH2, -NH(C1., alkyl), or -N(C1., alkyl)2;
R c is C1., aliphatic, C1., fluoroaliphatic, or halo; and
the variables R4x, R y, R ", R y, and R x have the values described above for formula (I). [081] hi certain embodiments, Ring C is selected from the group consisting of:
Figure imgf000027_0001
[082] hi certain other embodiments, Ring C is selected from the group consisting of:
Figure imgf000027_0002
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000028_0001
[083] The invention also relates to a subgenus of the compounds of formula (I), characterized by formula (III):
Figure imgf000028_0002
or a pharmaceutically acceptable salt thereof, wherein: X is CH or N;
Ring B is substituted with 0-1 R and 0-1 R , and one nitrogen atom in Ring B optionally is oxidized; and
Ring A, Ring C, and the variables G , L , R , and R have the values and preferred values described above for formulae (I) and (II).
[084] In a more particular embodiment, the invention relates to a compound of formula (IV):
Figure imgf000028_0003
or a pharmaceutically acceptable salt thereof; Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
wherein:
X1 and X2 are each independently CH or N, provided that X1 and X2 are not both N; g is 0 or 1; h is 0 or 1; and
Rings A and C, and the variables L 7 G 7 R , and R have the values and preferred values described above for formulae (I) and (II).
[085] In some embodiments, the invention relates to a compound of formula (IV) or a pharmaceutically acceptable salt thereof, wherein R is selected from the group consisting of halo, -N(R4)2, -CO2R5, -C(O)-N(R4)2, -C(O)-N(R4)-OR5, -N(R4)C(O)R5, -N(R4)C(O)-OR5, -N(R4)C(O)-N(R4)2, -N(R4)SO2R6, -C(=NR4)N(R4)2, and -C(=NR4)N(R4)-OR5. In some embodiments, Rb is -N(R4)2, -C(O)-N(R4),, -N(R4)C(O)R5, -C(=NR4)N(R4)2, or -C(=NR4)N(R4)-OR5.
[086] In some embodiments, R is selected from the group consisting of halo,
-N(R^)(R42), -CO2R5", -C(O)-N(R^)(R42), -C(O)-N(R4x)-OR5x, -N(R4x)C(O)R5x, -N(R4x)C(O)-OR5x, -N(R4x)C(O)-N(R4x)(R4z), -N(R^)SO2R6", -C(=NR4x)N(R4x)(R4z), and -C(=NR4x)N(R4x)-OR5x. In certain such embodiments, R is selected from the group consisting of halo, -NH(R z), -N(R4x)(R4z), -CO2R5x, -C(O)-NH(R42), -C(O)-N(R4x)(R4z), -C(O)-NH-OR5", -NHC(O)R5x, -NHC(O)-OR5x, -NHC(O)-N(R^)(R42), -NHSO2R6", -C(=NH)N(R4x)(R4z), -C(=NH)N(R4x)(R4z), and -C(=NH)NH-OR5x.
[087] In these embodiments, each R x independently is hydrogen, C1 4 alkyl,
C1-4 fluoroalkyl, or C6-10 ar(Ca Jalkyl, the aryl portion of which may be optionally substituted, and each R independently is hydrogen, C1-4 alkyl, C1-4 fluoroalkyl, C6-10 ar(C1-4)alkyl7 the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring; or R x and R z, taken together with the nitrogen atom to which they are attached, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S. In some embodiments, R x and R , taken together with the nitrogen atom to which Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
they are attached, form an optionally substituted morpholinyl, piperidinyl, piperazinyl, or pyrrolidinyl ring.
[088] Each R5x independently is hydrogen, C14 alkyl, C1-4 fluoroalkyl, C6-10 ar(C1-4)alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring.
[089] Each R6x independently is C1-4 alkyl, C1-4 fluoroalkyl, C6-10 ar(Cα.4)aIkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring.
[090] In some embodiments, Rb is -N(R4x)(R4z), -C(O)-N(R^)(R42), or
-C(=NH)N(R x)(R4z), where R x and R4z, taken together with the nitrogen atom to which they are attached, forma morpholinyl, piperidinyl, piperazinyl, or pyrrolidinyl ring.
[091] In other embodiments, the invention relates to a compound of formula (IV) or a pharmaceutically acceptable salt thereof, wherein R is -V -T -R or -V -T -R , where the variables V1, T1, R1 , and R2 have the values described below.
[092] V1 is -N(R4)-, -N(R4)-C(O)-, -N(R4)SO2R6, -N(R4)C(O)-OR5, -C(O)N(R4)-,
-C(=NR4)N(R4)-, or -N(R4)-C(=NR4)-. In some embodiments, V1 is -N(R4")-, -N(R^)-C(O)-, -C(O)N(R4")-, -C(=NR4x)N(R4x)-, or -N(R4x)-C(=NR4x)-, where R4x has the values described above in connection with formula (IV). In some embodiments, V is -C(O)-NH-, -NH-C(O)-, or -C(=NH)NH-.
[093] T is a C1-4 alkylene chain optionally substituted with -F, C13 alkyl, or
C13 fluoroalkyl.
[094] R ,1b i .s an optionally substituted C36 cycloaliphatic or an optionally substituted phenyl, pyrrolyl, imidazolyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, pyrazolyl, triazolyl, tetrazolyl, oxadiazolyl, fhiadiazolyl, pyrrolinyl, imidazolinyl, pyrazolinyl, pyrrolidinyl, imidazolidinyl, pyrazolidinyl, piperidinyl, morpholinyl, piperazinyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, or tetrahydropyrimidinyl ring. In some embodiments, R is an Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
optionally substituted C3-6 cycloaliphatic or an optionally substituted pyrrolidinyl, piperidinyl, morpholinyl, or piperazinyl.
[095] R2b is -N(R4)2/ -NR4C(O)R5, -C(O)N(R4)2, -CO2R5, or -OR5. b .
[096] In certain such embodiments, R is selected from the group consisting of:
Figure imgf000031_0001
-C(O)N(R^)(R42), s is 2 or 3, and t is 1, 2, or 3.
[097] In some other embodiments, the invention relates to a compound of formula
(IV), wherein R is -T -R or -T -R . T1 is a C1 6 alkylene chain optionally substituted with -F, C13 alkyl, or C1-3 fluoroalkyl, wherein the alkylene chain optionally is interrupted by -N(R )-, -C(O)-N(R4)-, -C(=NR4)-N(R4)-, -C(NR4)=N(R4)-, -N(R4)-C(O)-, or -N(R4)-C(=NR4)-. Rlb is an optionally substituted C3-6 cycloaliphatic or an optionally substituted phenyl, pyrrolyl, imidazolyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, pyrazolyl, triazolyl, tetrazolyl, oxadiazolyl, thiadiazolyl, pyrrolinyl, imidazolinyl, pyrazolinyl, pyrrolidinyl, imidazolidinyl, pyrazolidinyl, piperidinyl, morpholinyl, piperazinyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, or tetrahydropyrimidinyl ring. R2b is -OR5, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4)2, -C(O)N(R4)-OR5, -C(O)N(R4)2, -N(R4)-CO2R5, -N(R4)-C(=NR4)-R5 or -C(=NR4)-N(R4)2.
[098] In some such embodiments, R is selected from the group consisting of
-(CH2) -Rlx, -(CH2) -R2X, -(CH2) -R2y -(CH2) -N(R4x)-(CH2) -Rlx, -(CH2) -N(R4x)-(CH2) -R2x,
-(CH2) -N(R4x)-(CH2)s-R2y -(CH2) -N(R4x)C^NR4x)-(CH2) -Rlx, -(CH2) -N(R4x)C(=NR4x)-(CH2) -R^,
-(CH2) -N(R4x)C(=NR4x)-(CH2) -R2y, wherein q is 1, 2, or 3, and s is 2 or 3. Rlx is an optionally Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
substituted phenyl, piperidinyl, piperazinyl, morpholinyl, or pyrrolidinyl ring. R x is -C(O)N(R4x)(R4z). R2y is -N(R4x)(R4z), -NR4xC(O)R5x, -N(R4x)-CO2R5x, -N(R4x)-C(=NR4x)-R5x or -OR5x. R is hydrogen, C1-4 alkyl, C1 4 fluoroalkyl, or C6-10 ar(Cw)alkyl, the aryl portion of which may be optionally substituted; R z is hydrogen, C1 4 alkyl, C1-4 fluoroalkyl, C640 ar(C1 4)alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring; or R x and R z, taken together with the nitrogen atom to which they are attached, form an optionally substituted morphonnyl, piperidinyl, piperazinyl, or pyrrolidinyl ring. R is hydrogen, Cα_4 alkyl, C1-4 fluoroalkyl, or C6-10 a^C^alkyl, the aryl portion of which may be optionally substituted.
[099] Another embodiment of the invention relates to a compound of formula (TV) wherein R is -R . In such embodiments, the compound has formula (V):
Figure imgf000032_0001
or a pharmaceutically acceptable salt thereof; wherein:
X and X are each independently CH or N, provided that X and X are not both N; Ring D is an optionally substituted aryl, heteroaryl, heterocyclyl, or cycloaliphatic ring;
Ring A, Ring C, and the variables R , G , and L have the values and preferred values described above for formulae (I)-(IV); and g is 0 or 1.
1 2
[0100] hi some embodiments, X and X are each CH. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
[0101] Each substitutable ring nitrogen atom in Ring D preferably is unsubstituted or is substituted with -C(O)R5, -C(O)N(R4)2, -CO2R6, -SO2R6, -SO2(NR4)2, an optionally substituted C6 10 aryl, or a C1-4 aliphatic optionally substituted with R or R ; and one ring nitrogen atom in Ring D optionally is oxidized.
[0102] In some embodiments, Ring D is an optionally substituted heteroaryl or heterocyclyl selected from the group consisting of azetidinyl, pyrrolyl, imidazolyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, pyrazolyl, triazolyl, tetrazolyl, oxadiazolyl, fhiadiazolyl, pyrrolinyl, imidazolinyl, pyrazolinyl, pyrrolidinyl, imidazolidinyl, pyrazolidinyl, piperidinyl, morpholinyl, piperazinyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, and tetrahydropyrimidinyl. In certain embodiments, Ring D is an optionally substituted imidazolyl, oxazolyl, thiazolyl, oxadiazolyl, thiadiazolyl, tetrazolyl, imidazolinyl, or tetrahydropyrimidinyl.
[0103] Each substitutable saturated ring carbon atom in Ring D preferably is unsubstituted or is substituted with =O, =S, =C(R5)2, =N-OR5, =N-R5, or -Rd.
[0104] Each substitutable unsaturated ring carbon atom in Ring D preferably is unsubstituted or is substituted with -R .
[0105] Each Rd independently is halo, -NO2, -CN, -C(R5)=C(R5)2, -CsC-R5, -OR5, -SR6,
-S(O)R6, -SO2R6, -SO2N(R4),, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4),, -N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-R6, -NR4CO2R6, -N(R4)SO2R6, -N(R4)SO2N(R4)2, -O-C(O)R5, -OC(O)N(R4)2, -C(O)R5, -CO2R5, -C(O)N(R4)2, -C(O)N(R4)-OR5, -C(O)N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-N(R4)-C(O)R5, -C(=NR4)-N(R4)2, -C(=NR4)-OR5, -C(=NR4)-N(R4)-OR5, -C(R )=N-OR , or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl.
[0106] In some embodiments, Ring D is substituted with 0-1 Rd and 0-1 R8d. R8d is
C1-4 aliphatic, C1-4 fluoroaliphatic, halo, -OH, -0(C1-4 aliphatic), -NH2, -NH(C1-4 aliphatic), or -N(C1-4 aliphatic),. R is selected from titie group consisting of C1-4 aliphatic, C1-4 fluoroaliphatic, halo, -Rld, -R2d, -T'-R1'1, -T3-^, -V3-!3-*", and -V3-!3-^. The variables T3, V3, Rld, and R2d have the values described below. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
[0107] T3 is a C1-4 alkylene chain optionally substituted with one or two substituents independently selected from the group consisting of C1 3 aliphatic, C1 3 fluoroaliphatic, -F, -OH, -0(C1-4 alkyl), -CO2H, -CO2(C1-4 alkyl), -C(O)NH2, and -C(O)NH(C14 alkyl). In some embodiments, T3 is -(CH2)- or -(CH2)--.
[0108] V3 is -O-, -N(R4)-, -N(R4)C(O)-, -C(O)N(R4)-, -C(=NR4)-N(R4)-, -C(NR4)=N(R4)-, or
-N(R4)C(=NR4)-.
,ld .
[0109] Each R independently is an optionally substituted aryl, heteroaryl, heterocyclyl,
,ld . or cycloaliphatic ring. In some embodiments, R is an optionally substituted phenyl, pyridyl, or pyrimidinyl group.
[0110] Each R2d independently is -NO2, -CN, -C(R5)=C(R5)2, -C≡C-R5, -OR5, -SO2R6,
-SO2N(R4)2, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4),, ~N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-R6, -NR4CO2R6, -N(R4)SO2R6, -N(R4)SO2N(R4)2, -O-C(O)R5, -OC(O)N(R4)2, -C(O)R5, -CO2R5, -C(O)N(R4)2, -C(O)N(R4)-OR5, -C(O)N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-N(R4)-C(O)R5, -C(=NR4)-N(R4)2, -C(=NR4)-OR5, -C(=NR4)-N(R4)-OR5,or -C(R6)=N-OR5. In some embodiments, each R independently is selected from the group consisting of -OR , -N(R )2, -NR C(O)R , -NR4C(O)N(R4),, -O-C(O)R5, -CO2R5, -C(O)R5, -C(O)N(R4)2, -C(O)N(R4)-OR5, and -C(=NR4)-N(R4)2. In some embodiments, each R2d is selected from the group consisting of -OR , -N(R4)2, -CO2R5, or -C(O)N(R4)2.
[0111] In some embodiments, Ring D is selected from the group consisting of:
Figure imgf000034_0001
N=N t where Rv, Rw, Rx, Ry, and Rz have the values described Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
[0112] Rv is hydrogen, halo, C1-4 aliphatic, C14 fluoroaliphatic, -OR5, -N(R4)2, -CO2R5,
-C(O)N(R4)2, -T^-OR5, -'f-NCR4)^ -T^-CO2R5, -T3-C(O)N(R4)2, or an optionally substituted 5- or 6- membered aryl or heteroaryl. In certain embodiments, Rv is hydrogen, halo, C14 aliphatic, C14 fluoroaliphatic, -(CH2)p-OR5x, -(CH2)p-N(R4x)(R4z), -(CH2)^CO2R5*, -(CH2)p-C(O)N(R4x)(R4z), or an optionally substituted phenyl, pyridyl, or pyrirnidinyl group.
[0113] Each Rw independently is hydrogen, halo, C1-4 aliphatic, C14 fluoroaliphatic, -OR ,
-N(R4)2, -CO2R5, -C(O)N(R4)2, -T'-OR5, -T3-N(R4)2, -T3-CO2R5, -T3-C(O)N(R4)2, or an optionaUy substituted 5- or 6-membered aryl or heteroaryl. In some embodiments, each Rw independently is hydrogen, an optionally substituted phenyl, pyridyl, or pyrirnidinyl group, halo, C14 aliphatic, C14 fluoroaliphatic, -(CH2)p-OR5x, -(CH2)p-N(R4x)(R4z), -(CH2)p-CO2R5x, -(CH2)p-C(O)N(R4x)(R4z), -(CH2)ϊ-N(R4x)-(CH2),-Rlx, -(CH2)rN(R4x)-(CH2)i;-R2x, -(CH2)ϊ-N(R4x)-(CH2)s-R2y -(CH2),;-N(R4x)C(=NR4x)-(CH2)rRlx, -(CH2)fN(R4x)C(=NR4x)-(CH2)9-R2x, or -(CH2)?-N(R4x)C(=NR4x)-(CH2)ιj-R2y. In certain embodiments, each Rw independently is hydrogen, halo, C14 aliphatic, C14 fluoroaliphatic, -(CH2)p-OR5x, -(CH2)p-N(R4x)(R4z), -(CH2)p-CO2R5x, -(CH2)P-C(O)N(R^)(R42), or an optionally substituted phenyl, pyridyl, or pyrirnidinyl group.
[0114] Each Rx independently is hydrogen, fluoro, C14 aliphatic, C14 fluoroaliphatic,
-CO2R5, -C(O)N(R4)2, -T3-N(R4)2, -T'-OR5, -T^-CO2R5, or -T3-C(O)N(R4)2. In certain embodiments, each Rx independently is hydrogen, fluoro, C14 aliphatic, C14 fluoroaliphatic, -(CH2) -CO2R x, -(CH2)P-C(O)N(R^)(R42), -(CH2)r-N(R4x)(R4z), or -(CH2)r-OR5x.
[0115] Ry is hydrogen, halo, C14 aliphatic, C14 fluoroaliphatic, -OR5, -N(R4)2, -CO2R5,
-C(O)N(R4)2, -T'-OR5, -T^-N(R4),, -T^-CO2R5, or -T3-C(O)N(R4)2. In certain embodiments, Ry is hydrogen, fluoro, C14 aliphatic, C14 fluoroaliphatic, -(CH^-N^XR42), -(CH2)p-OR5x, -(CH2)p-CO2R5x, -(CH2)P-C(O)N(R^)(R42).
[0116] Each R2 independently is hydrogen, fluoro, C14 aliphatic, or C14 fluoroaliphatic. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
[0117] T3 is a C1-4 alkylene chain optionally substituted with one or two substituents independently selected from the group consisting of C1 3 aliphatic, C1-3 fluoroaliphatic, -F, -OH, -0(C1-4 alkyl), -CO2H, -CO2(C14 alkyl), -C(O)NH2, and -C(O)NH(C14 alkyl).
[0118] Each R independently is an optionally substituted phenyl, piperidinyl, piperazinyl, morpholinyl, or pyrrolidinyl ring.
[0119] Each R2x independently is -C (O)N(R4") (R42).
[0120] Each R2y independently is -N(R^)(R42), -NR4xC(O)R5x, -N(R4x)-CO2R5x,
-N(R4x)-C(=NR4x)-R5x or -OR5x.
[0121] Each R independently is hydrogen, C14 alkyl, C14 fluoroalkyl, or
C6-10 ar(C14)alkyl, the aryl portion of which may be optionally substituted, and each R z independently is hydrogen, C14 alkyl, C14 fluoroalkyl, C6-10 ar(Cw)alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring; or R x and R z, taken together with the nitrogen atom to which they are attached, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S.
[0122] Each R independently is hydrogen, C1-4 alkyl, C14 fluoroalkyl, C6-10 ar(C1-4)alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring.
[0123] The variable γ is 0, 1, or 2; q is 1, 2, or 3, r is 1 or 2, and s is 2 or 3.
[0124] In more particular embodiments, Ring D is selected from the group consisting of:
Figure imgf000036_0001
[0125] In still more particular embodiments, Ring D is selected from the group consisting of: Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000037_0001
[0126] The invention also relates to a compound of formula (VT):
Figure imgf000037_0002
or a pharmaceutically acceptable salt thereof; wherein: G1 is -O- or -NH-;
X and X are each independently CH or N, provided that X and X are not both N; one ring nitrogen atom in Ring B optionally is oxidized; g is 0 or 1; h is 0 or 1; j is 0 or 1; k is 0, 1, or 2; and
Ring A and the variables R , R , Rm, Rn, Rc, and R c have the values and preferred values described above for formulae (I)-(V).
[0127] In some embodiments, the invention relates to a compound of formula (VI), wherein:
Rm is hydrogen, and Rn is hydrogen, fluoro, -CH3, or -CH2OH;
1 2
X and X are each CH;
Ring A is substituted with zero occurrences of Ra; Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
each Rc independently is halo, -CN, -C(R5x)=C(RSx)(R5y), -C≡C-R5y, -OR5y, -SR6x, -CO2R5x,
-C(O)N(R4x)(R4y), or a C14 aliphatic or C1-4 fluoroaliphatic optionally substituted with one or two substituents independently selected from the group consisting of -OR , -N(R4x)(R4y), -SR6x, -CO2R5", or -C(O)N(R4x)(R4y); or two adjacent Rc, taken together with the intervening ring atoms, form an optionally substituted fused 5- or 6-membered aromatic or non-aromatic ring having 0-3 ring heteroatoms independently selected from the group consisting of O, N, and S;
R4x is hydrogen, C1-4 alkyl, C1-4 fluoroalkyl, or C6-10 ar(C14)alkyl, the aryl portion of which may be optionally substituted, or two R x on the same nitrogen atom, taken together with the nitrogen atom, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S;
R y is hydrogen, C6-10 ar(C14)alkyl, the aryl portion of which may be optionally substituted, an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring, or a C14 alkyl or C14 fluoroalkyl optionally substituted with one or two substituents independently selected from the group consisting of -OR x, -N(R x)2, -CO2R5x, or -C(O)N(R4x)2; or
R x and R y, taken together with the nitrogen atom to which they are attached, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S; each R x independently is hydrogen, C14 alkyl, C14 fluoroalkyl, C6-10 ar(C14)alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring; each R5y independently is hydrogen, an optionally substituted C6-10 aryl, a
CHOar(C14)alkyl, the aryl portion of which may be optionally substituted, or a C14 alkyl or C14 fluoroalkyl optionally substituted with one or two substituents Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
independently selected from the group consisting of -OR5", -N(R4x)2, -CO2R5", or -C(O)N(R4x)2; and
each R x independently is C1 4 alkyl, C1 4 fluoroalkyl, C6-10 ar(CM)alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring.
[0128] The invention also relates to a compound of formula (VIT):
Figure imgf000039_0001
or a pharmaceutically acceptable salt thereof; wherein: g is 0 or 1; j is 0 or 1; fc is 0, 1, or 2; and the variables L , R , R , Rc, and R c have the values and preferred values described above for formulae (I)-(VI).
[0129] In preferred embodiments, the compound of formula (I) is other than:
N-(3-cWoro-2-emyl-4-pyridinyl)-4-[[5-(trifluorornethyl)-2-pyridinyl]oxy]- benzenepropanamide;
4-[[3-cyano-6-(l-m.emylethyl)2-pyridinyl]oxy]-]V-(2,6-diefhylphenyl)benzenepropanamide;
4-[[5-brorno-4-(2-propynyloxy)-2-pyrirmdmyl]amino-N-(4-hydroxyphenyl)- benzenebutanamide;
4-[(4,5-dmydro-2-miazolyl)arnino]-N-phenyl-benzenebutanarnide; Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
N-(3-cMoro-2-ethyl-4-pyτidinyl)-4-[[5-(trifluoromethyl)-2-pyridinyl]oxy]- benzenebutanamide; or
4-[[4,6-bis-(3/5-diamino-l-piperidinyl)-l/3/5-triazin-2-yl]amino]-β-hydroxy-N-[2- (trifluoromethyl)phenyl]benzenebutanamide.
[0130] Specific examples of compounds of formula (I) are shown below in Table 1.
Table 1. Raf Kinase Inhibitors
Figure imgf000040_0001
A-I A-2 A-3
Figure imgf000040_0002
A-4 A-5 A-6
Figure imgf000040_0003
A-10 A-Il A-12 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000041_0001
A-13 A-14 A-15
Figure imgf000041_0002
A-16 A-17 A-18
Figure imgf000041_0003
A-19 A-20 A-21
Figure imgf000041_0004
A-22 A-23 A-24
Figure imgf000041_0005
A-25 A-26 A-27 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000042_0001
A-28 A-29 A-30
Figure imgf000042_0002
A-31 A-32 A-33
Figure imgf000042_0003
A-34 A-35 A-36
Figure imgf000042_0004
A-37 A-38 A-39
Figure imgf000042_0005
A-40 A-41 A-42
Figure imgf000042_0006
A-43 A-44 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000043_0001
A-45 A-46
Figure imgf000043_0002
A-47 A-48
Figure imgf000043_0003
A-50 A-51
Figure imgf000043_0004
A-52 A-53 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000044_0001
A-54 A-55
Figure imgf000044_0002
A-56 A-57
Figure imgf000044_0003
A-58 A-59
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000045_0001
A-60 A-61
Figure imgf000045_0002
A-62 A-63
Figure imgf000045_0003
A-64 A-65
Figure imgf000045_0004
A-66 A-67 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000046_0001
A-68 A-69
Figure imgf000046_0002
A-70 A-71
Figure imgf000046_0003
A-72 A-73 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000047_0001
A-74 A-75
Figure imgf000047_0002
A-76 A-77
Figure imgf000047_0003
A-78 A-79 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000048_0001
A-80 A-81
Figure imgf000048_0002
A-82 A-83
Figure imgf000048_0003
A-84 A-85
Figure imgf000048_0004
A-86 A-87 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000049_0001
A-88 A-89
Figure imgf000049_0002
A-90 A-91
A-92 A-93
Figure imgf000049_0004
A-94 A-95 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000050_0001
A-96 A-97
Figure imgf000050_0002
A-98 A-99
Figure imgf000050_0003
A-100 A-IOl
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000051_0001
A-102 A-103
Figure imgf000051_0002
A-104 A-105
Figure imgf000051_0003
A-106 A-107
Figure imgf000051_0004
A-108 A-109 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000052_0001
A-IlO A-Hl
Figure imgf000052_0002
A-112 A-113
Figure imgf000052_0003
A-114 A-115
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000053_0001
A-116 A-117
Figure imgf000053_0002
A-118 A-119
Figure imgf000053_0003
A-120 A-121
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000054_0001
A-122 A-123
Figure imgf000054_0002
A-124 A-125
Figure imgf000054_0003
A-126 A-127
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000055_0001
A-128 A-129
Figure imgf000055_0002
A-130 A-131
Figure imgf000055_0003
A-132 A-133
Figure imgf000055_0004
A-134 A-135 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000056_0001
A-136 A-137
Figure imgf000056_0002
A-138 A-139
Figure imgf000056_0003
A-140 A-141
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000057_0001
Figure imgf000057_0002
Hooσ
A-142 A-143
Figure imgf000057_0003
A-144 A-145
Figure imgf000057_0004
A-146 A-147
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000058_0001
A-148 A-149
Figure imgf000058_0002
A-150 A-151
Figure imgf000058_0003
A-152 A-153
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000059_0001
A-154 A-155
Figure imgf000059_0002
A-156 A-157
Figure imgf000059_0003
A-158 A-159
Figure imgf000059_0004
A-160 A-161 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000060_0001
A-162 A-163
Figure imgf000060_0002
A-164 A-165
Figure imgf000060_0003
A-166 A-167
Figure imgf000060_0004
A-168 A-169 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000061_0001
A-170 A-171
Figure imgf000061_0002
A-172 A-173
Figure imgf000061_0003
A-174 A-175 Attorney Docket No. MPI05-002P1ENWOM January 12, 2006
Figure imgf000062_0001
A-176 A-177
Figure imgf000062_0002
A-178 A-179
Figure imgf000062_0003
A-180 A-181
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000063_0001
A-182 A-183
Figure imgf000063_0002
A-184 A-185
Figure imgf000063_0003
A-186 A-187 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000064_0001
A-188 A-189
Figure imgf000064_0002
A-190 A-191
Figure imgf000064_0003
A-192 A-193 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000065_0001
A-194 A-195
Figure imgf000065_0002
A-196 A-197
Figure imgf000065_0003
A-198 A-199
Figure imgf000065_0004
A-200 A-201 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000066_0001
A-202 A-203
Figure imgf000066_0002
A-204 A-205
Figure imgf000066_0003
A-206 A-207
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000067_0001
A-208 A-209
Figure imgf000067_0002
A-210 A-211
Figure imgf000067_0003
A-212 A-213
Figure imgf000067_0004
A-214 A-215 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000068_0001
A-216 A-217
Figure imgf000068_0002
A-218 A-219
Figure imgf000068_0003
A-220 A-221
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000069_0001
A-222 A-223
Figure imgf000069_0002
A-224 A-225
Figure imgf000069_0003
A-226 A-227 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000070_0001
A-228 A-229
Figure imgf000070_0002
A-230 A-231
Figure imgf000070_0003
A-232 A-233
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000071_0001
A-234 A-235
Figure imgf000071_0002
A-236 A-237
Figure imgf000071_0003
A-238 A-239
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000072_0001
A-240 A-241
Figure imgf000072_0002
A-242 A-243
Figure imgf000072_0003
A-244 A-245
Figure imgf000072_0004
A-246 A-247 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000073_0001
A-248 A-249
A-250 A-251
Figure imgf000073_0003
A-252 A-253
Figure imgf000073_0004
A-254 A-255 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000074_0001
A-256 A-257
Figure imgf000074_0002
A-258 A-259
Figure imgf000074_0003
A-260 A-261
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000075_0001
A-262 A-263
Figure imgf000075_0002
A-264 A-265
Figure imgf000075_0003
A-266 A-267
Figure imgf000075_0004
A-268 A-269 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000076_0001
A-270 A-271
The compounds in Table 1 above also may be identified by the following chemical names:
Figure imgf000076_0002
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000077_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000078_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000079_0001
Attorney Docket No. MPI05-002P1RNWOM Janitary 12, 2006
Figure imgf000080_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000081_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000082_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000083_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000084_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000085_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000086_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000087_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000088_0001
[0131] Additional specific examples of compounds of formula (I) are shown below in
Table 2: Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000089_0001
B-I B-2
Figure imgf000089_0002
B-3
Figure imgf000089_0003
B-5 B-6
Figure imgf000089_0004
B-7 B-8 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000090_0001
B-9 B-IO
Figure imgf000090_0002
B-Il B-12
Figure imgf000090_0003
B-13 B-14
Figure imgf000090_0004
B-15 B-16 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000091_0001
B-17 B-18
Figure imgf000091_0002
B-19 B-20
Figure imgf000091_0003
B-21 B-22 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
B-23 B-24
Figure imgf000092_0002
B-25 B-26
Figure imgf000092_0003
B-27 B-28
Figure imgf000092_0004
B-29 B-30 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000093_0001
B-31 B-32
Figure imgf000093_0002
B-33 B-34
Figure imgf000093_0003
B-35 B-36
Figure imgf000093_0004
B-37 B-38 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000094_0001
B-39 B-40
B-41 B-42
Figure imgf000094_0003
B-43 B-44
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000095_0001
B-45 B-46
Figure imgf000095_0002
B-47 B-48
Figure imgf000095_0003
B-49 B-50
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000096_0001
B-51 B-52
Figure imgf000096_0002
B-53 B-54
Figure imgf000096_0003
B-55 B-56 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000097_0001
B-57 B-58
Figure imgf000097_0002
B-59 B-60
Figure imgf000097_0003
B-61 B-62
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000098_0001
B-63 B-64
Figure imgf000098_0002
B-65 B-66
Figure imgf000098_0003
B-67 B-68
Figure imgf000098_0004
B-69 B-70 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000099_0001
B-71 B-72
Figure imgf000099_0002
B-73 B-74
Figure imgf000099_0003
B-75 B-76
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000100_0001
B-77 B-78
Figure imgf000100_0002
B-79 B-80
Figure imgf000100_0003
B-81 B-82 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000101_0001
B-83 B-84
Figure imgf000101_0002
B-85 B-86
Figure imgf000101_0003
B-87 B-88
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000102_0001
B-89 B-90
Figure imgf000102_0002
B-91 B-92
Figure imgf000102_0003
B-93 B-94
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000103_0001
B-95 B-96
Figure imgf000103_0002
B-97 B-98
Figure imgf000103_0003
B-99 B-100
Figure imgf000103_0004
B-IOl B-102 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000104_0001
B-103 B-104
Figure imgf000104_0002
B-105 B-106
Figure imgf000104_0003
B-107 B-108
Attorney Docket No. MPI05-002P1KNWOM January 12, 2006
Figure imgf000105_0001
B-109 B-IlO
Figure imgf000105_0002
B-lll B-112
Figure imgf000105_0003
B-113 B-114 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000106_0001
B-115 B-116
Figure imgf000106_0002
B-117 B-118
Figure imgf000106_0003
B-119 B-120
Figure imgf000106_0004
B-121 B-122 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000107_0001
B-123 B-124
Figure imgf000107_0002
B-125 B-126
Figure imgf000107_0003
B-127 B-128 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000108_0001
B-129 B-130
Figure imgf000108_0002
B-131 B-132
Figure imgf000108_0003
B-133 B-134 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000109_0001
B-135 B-136
Figure imgf000109_0002
B-137 B-138
Figure imgf000109_0003
B-139 B-140 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000110_0001
B-141 B-142
Figure imgf000110_0002
B-143 B-144
Figure imgf000110_0003
B-145 B-146 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000111_0001
B-147 B-148
Figure imgf000111_0002
B-149
Figure imgf000111_0003
B-150 B-151
Figure imgf000111_0004
B-152 B-153 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000112_0001
B-154 B-155
Figure imgf000112_0002
B-156 B-157
Figure imgf000112_0003
B-158 B-159
[0132] The compounds in Table 2 above also may be identified by the following chemical names:
Chemical Name
B-I: (2E)-N-[4-chloro-3-(trifluoromethyl)phenyl]-3-(3-{[2-(4/5-dihydro-lH- imidazol-2-yl)pyridin-4-yl]oxy}phenyl)but-2-enamide
B-2: (2E)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-IV-(3- isopropylphenyl)acrylamide Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
B-3: (2£)-N-[4-chloro-3-(trifluoromethyl)phenyl]-3-[3-(9H-ptirin-6-yloxy)phenyl]- acrylamide
B-5: (2£)-N-(3-ier^butylphenyl)-3-(3-{[2-(4,5-dihydro-lH-imidazol-2-yl)pyridin-4- yl]oxy}phenyl)acrylamide
B-6: 4-(3-{(lE)-3-[(3-terf-buiylphenyl)aπuno]-2-inethyl-3-oxoprop-l-en-l- yl}phenoxy)-N-methylpyridine-2-carboxamide
B-7: (2£)-3-(3-{[2-(4,5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-N-[3- (trifluoromethyl)phenyl]acrylamide
B-8: . (2E)-JV-[4-chloro-3-(trifluoromethyl)phenyl]-2-(3-{[2-(4/5-dihydro-lH- imidazol-2-yl)pyridin-4-yl]oxy}benzylidene)butanamide
B-9: (2E)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}ρhenyl)-N-[3- fluoro-5-(trifluoromethyl)phenyl]acrylamide
B-IO: (2E)-N-(3-chlorophenyl)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4- yl]oxy}phenyl)acrylamide
B-Il: (2Z)-N-[4-chloro-3-(trifluoromethyl)phenyl]-3-(3-{[2-(4/5-dihydro-lH- imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-2-fluoroacrylarnide
B-12: (2E)-N-[4-chloro-3-(trifluoromethyl)phenyl]-3-(3-{[2-(4/5-dihydro-lH- irnidazol-2-yl)pyridin-4-yl]oxy}phenyl)-2-rnethylacrylainide
B-13: (2E)-N-(4-chlorophenyl)-3-(3-{[2-(4/5-dihydro-lH-iiiiidazol-2-yl)pyridin-4- yl]oxy}phenyl)acrylamide
B-14: (2E)-N-[4-chloro-3-(trifluoromethyl)phenyl]-3-(3-{[2-(4/5-dihydro-lH- imidazol-2-yl)pyridin-4-yl]oxy}pnenyl)acrylamide
B-15: (2E)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-N-[4-(3- pyrrolidin-l-ylpropyl)-3-(trifluoromethyl)phenyl]acrylamide
B-16: (2E)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-N-[4-[3- (dirnethylamino)propyl]-3-(trifluorornethyl)phenyl]acrylarnide
B-17: (2E)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-JV-[4-(3- hydroxypropyl)-3-(trifluoromethyl)phenyl]acrylamide
B-18: (2E)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-N-[4-(3- pyrrolidin-l-ylprop-l-yn-l-yl)-3-(trifluoroniethyl)phenyl]acrylarnide
B-19: (2E)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-N-[4-[3- (dinie&ylarnino)prop-l-yn-l-yl]-3-(trifluorornethyl)phenyl]acrylamide
B-20: (2E)-3-(3-{[2-(4/5-dihydro-lH-iπύdazol-2-yl)pyridin-4-yl]oxy}phenyl)-N-[4-(3- hydroxyprop-l-yn-l-yl)-3-(trifluoromethyl)phenyl]acrylamide
B-21: (2£)-N-[4-(±loro-3-(tofluoromethyl)phenyl]-3-(3-{[2-(5-meftyl-lH-irnidazol-2- yl)pyτidin-4-yl]oxy}phenyl)acrylamide
B-22: (2E)-N-[4-bromo-3-(trifluoromethyl)phenyl]-3-(3-{[2-(4/5-dihydro-lH- imidazol-2-yl)pyridin-4-yl]oxy}phenyl)acrylamide Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
B-23: (2E)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-N-[4- ethynyl-3-(trifluoromethyl)phenyl]acrylamide
B-24: (2E)-N-(3-terf-butylphenyl)-3-{3-[(2-{[(4-eth.ylpiperazin-l- yl)acetyl]arnino}pyridin-4-yl)oxy]phenyl}acrylamide
B-25: 4-(3-{(lE)-3-[(3-fer^butylphenyl)amino]-3-oxoprop-l-en-l-yl}phenoxy)-N- methylpyridine-2-carboxamide
B-26: 4-[3-((lE)-3-{[4-chloro-3-(tofluorornethyl)phenyl]amino}-3-oxoprop-l-en-l- yl)phenoxy]-N-methylpyridine-2-carboxamide
B-27: (2E)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-N-(3/3- dirnethyl-l-oxo-2/3-dihydro-lH-isoindol-5-yl)acrylamide
B-28: (2E)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-N-(3,3- dixnethyl-l-oxo-l/S-dihydro^-benzofurari-S-y^acrylarnide
B-29: (2E)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-N-[2- (trifluoromethyl)pyridin-4-yl]acrylamide
B-30: (2E)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-N-[4- (trifluoromethyl)pyridin-2-yl]acrylamide
B-31: (2E)-N-(3-ter^butyKsoxazol-5-yl)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2- yl)pyridin-4-yl]oxy}phenyl)acrylamide
B-32: (2E)-IV-(5-ferf-butyHsoxazol-3-yl)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2- yl)pyridin-4-yl]oxy}phenyl)acrylamide
B-33: 4-[3-((lE)-3-{[4-dιloro-3-(trifluoromethyl)phenyl]arnino}-3-oxoprop-l-en-l- yl)phenoxy]-N-(2-methoxyethyl)pyridine-2-carboxamide
B-34: 4-[3-((lE)-3-{[4-chloro-3-(tofluoromeib-yl)phenyl]arriino}-3-oxoprop-l-en-l- yl)phenoxy]-N-(2-piperazin-l-ylethyl)pyridine-2-carboxamide
B-35: 4-[3-((lE)-3-{[4-dύoro-3-(trifluoromethyl)phenyl]arnino}-3-oxoprop-l-en-l- yl)phenoxy]-N-(2-piperidin-l-ylethyl)pyridine-2-carboxamide
B-36: 4-[3-((lE)-3-{[4-chloro-3-(trifluoromethyl)phenyl]amino}-3-oxoprop-l-en-l- yl)phenoxy]-N-(cyclopropylmethyl)pyridine-2-carboxamide
B-37: 4-[3-((lE)-3-{[4-cWoro-3-(tefluoromethyl)phenyl]amino}-3-oxoprop-l-en-l- yl)phenoxy]-N-[3-(lH-irnidazol-l-yl)propyl]pyridine-2-carboxamide
B-38: 4-[3-((lE)-3-{[4-chloro-3-(tofluoromethyl)phenyl]amino}-3-oxoprop-l-en-l- yl)phenoxy]-N-(2-pyrrolidin-l-ylethyl)pyridine-2-carboxamide
B-39: 3-{[(2E)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)prop- 2-enoyl]arru^o}-N-[2-(methylamino)eΛyl]-5-(trifluorornethyl)benzarnide
B-40: 3-{[(2E)-3-(3-{[2-(4/5-dihydro-lH-irnidazol-2-yl)pyridin-4-yl]oxy}phenyl)prop- 2-enoyl]amino}-N-[2-(dirnethylamino)eihyl]-5-(trifluorornethyl)benzar^
B-41: (2E)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-N-[3- (rnethylarnino)-5-(trifluorornethyl)phenyl]acrylatnide Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
B-42: 3-{[(2£)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)prop- 2-enoyl]amino}-N-inethyl-5-(trifluoroinethyl)benzainide
B-43: (2E)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-N-[3- [(methylarnino)methyl]-5-(trifluorornethyl)phenyl]acrylarnide
B-44: (2E)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-N-[3-(2- pyrrolidin-l-ylethyl)-5-(trifluorornethyl)phenyl]acrylamide
B-45: (2E)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-N-[3-[3- (dirneihylarnino)propyl]-5-(trifluoroniethyl)pheriyl]acrylarnide
B-46: (2E)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-N-[3-[2- (diinethylarnino)ethoxy]-5-(trifluoromethyl)phenyl]acrylarrιide
B-47: (2E)-N-[4-bromo-3-(tofluoromethyl)phenyl]-3-(3-{[2-(5-methyl-lH-imidazol-2- yl)pyridin-4-yl]oxy}phenyl)acrylamide
B-48: (2E)-N-[4-bromo-3-(trifluoromethyl)phenyl]-3-(3-{[2-(5-methyl-4/5-dihydro- lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)acrylamide
B-49: (2E)-N-[4-brorno-3-(trifluoromethyl)phenyl]-3-[3-({2-[5-(hydroxymetihyl)-lH- imidazol-2-yl]pyridin-4-yl}oxy)phenyl]acrylamide
B-50: (2E)-N-[4-bromo-3-(trifluoromethyl)phenyl]-3-[3-({2-[5-(hydroxymethyl)-4/5- dihydro-lH-irnidazol-2-yl]pyridin-4-yl}oxy)phenyl]acrylamide
B-51: N-methyl-4-[3-((lE)-3-oxo-3-{[4-(3-pyrrolidin-l-ylpropyl)-3-(trifluoromethyl)- phenyl]arnin.o}prop-l-en-l-yl)phenoxy]pyridine-2-carboxarnide
B-52: 4-[3-((l£)-3-{[4-[3-(dimetirLylarrtino)propyl]-3-(trifluoromethyl)phenyl]amino}- 3-oxoprop-l-en-l-yl)phenoxy]-N-methylpyridine-2-carboxamide
B-53: 4-[3-((lE)-3-{[4-(3-hydroxypropyl)-3-(trifluorome1iιyl)phenyl]arnino}-3- oxoprop-l-en-l-yl)pheπoxy]-N-methylpyridine-2-carboxamide
B-54: N-methyl-4-[3-((lE)-3-oxo-3-{[4-(3-pyrroUdin-l-ylprop-l-yn-l-yl)-3- (trifluoromettιyl)phenyl]amino}prop-l-en-l-yl)phenoxy]pyridine-2- carboxamlde
B-55: 4-[3-((lE)-3-{[4-[3-(dimethylarruno)prop-l-yn-l-yl]-3-(trifluoromethyl)- phenyl]arnino}-3-oxoprop-l-en-l-yl)phenoxy]-N-methylpyridine-2- carboxamide
B-56: 4-[3-((lE)-3-{[4-(3-hydroxyprop-l-yn-l-yl)-3-(trifluoromethyl)phenyl]amino}- 3-oxoprop-l-en-l-yl)phenoxy]-N-methylpyridine-2-carboxamide
B-57: (2E)-N-[4-chloro-3-(trifluoromethyl)phenyl]-3-(3-{[2-(lΛ5/6- tetrahydropyrimidin-2-yl)pyridin-4-yl]oxy}phenyl)acrylamide
B-58: (2E)-3-(3-{[2-(5-hydroxy-lΛ5/6-tetrahydropyrimidin-2-yl)pyridin-4- yl]oxy}phenyl)-N-[3-(trifluorornethyl)phenyl]acrylarnide
B-59: (2E)-3-(3-{[2-(lΛ5,6-tetrahydropyrirnidin-2-yl)pyridin-4-yl]oxy}phenyl)-IV-[3- (trifluoromethyl)phenyl]acrylamide Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
B-60: 5-{4-[3-((lE)-3-oxo-3-{[3-(1τifluoromethyl)phenyl]amino}prop-l-en-l- yl)phenoxy]pyridin-2-yl}-l/3/4-oxadiazole-2-carboxamide
B-61: 2-{4-[3-((lE)-3-oxo-3-{[3-(trifluorome1iιyl)phenyl]amino}prop-l-en-l- yl)phenoxy]pyridin-2-yl}-lH-irrιidazole-5-carboxamide
B-62: 4-[3-((l£)-3-{[3-rnethoxy-5-(trifluoromethyl)phenyl]arnino}-3-oxoprop-l-en-l- yl)phenoxy]-N-methylpyridine-2-carboxamide
B-63: (2E)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-N-[3- methoxy-5-(trifluoromethyl)phenyl]acrylainide
B-64: 2-{4-[3-((l£)-3-oxo-3-{[3-(trifluoromethyl)phenyl]amino}prop-l-en-l- yl)phenoxy]pyridin-2-yl}-4/5-dihydro-lH-imidazole-5-carboxylic acid
B-65: (2£)-N-(3/5-di-teri-butylphenyl)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2- yl)pyridin-4-yl]oxy}pherιyl)acrylamide
B-66: (2£)-3-(3-{[2-(4,5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-N'-(3- iodophenyl)acrylamide
B-67: (2£)-N-[4-Aloro-3-(1xifluorometiιyl)phenyl]-3-[3-({2-[(e%lamino)- (knino)rnethyl]pyridin-4-yl}oxy)phenyl]acrylamide
B-68: (2£)-3-[3-({2-[arruno(iiiuno)meihyl]pyridin-4-yl}oxy)phenyl]-N-[4-bromo-3- (trifluoromethyl)phenyl]acrylamide
B-69: (2£)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-N-[4- rnethyl-3-(trifluoromethyl)phenyl]acrylamide
B-70: (2£)-N-[4-fluoro-3-(trifluoromethyl)phenyl]-3-[3-({2-[(5S)-5-methyl-4/5- dihydro-lH-imidazol-2-yl]pyridin-4-yl}oxy)phenyl]acrylamide
B-71: (2£)-N-[4-fluoro-3-(trifluoromethyl)phenyl]-3-[3-({2-[(5R)-5-methyl-4/5- dihydro-lH-irnidazol-2-yl]pyridin-4-yl}oxy)phenyl]acrylamide
B-72: (2£)-N-[4-cWoro-3-(tofluoromethyl)phenyl]-3-[3-({2-[imino(rnorpholin-4- yl)methyl]pyτidin-4-yl} oxy)phenyl] acrylamide
B-73: (2E)-N-[4-cWoro-3-(trifluoromethyl)phenyl]-3-{3-[(2-{irnino[(2-moφholin-4^ yle&yl)airdno]nαethyl}pyτidin-4-yl)oxy]phenyl}acrylarnide
B-74: 4-(3-{(l£)-3-[(3-isopropylphenyl)amino]-3-oxoprop-l-en-l- yl}phenoxy)pyridine-2-carboxamide
B-75: (2E)-3-[3-({2-[(benzylarrmo)(irnino)methyl]pyxidin-4-yl}oxy)phenyl]-IV-[4- iodo-3-(trifluoromethyl)phenyl]acrylamide
B-76: (2E)-3-(2-chloro-3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)- N-[4-chloro-3-(trifluoromethyl)phenyl]acrylamide
B-77: N-[2-(dimethylaπiino)ethyl]-2-{4-[3-((l£)-3-oxo-3-{[3-(1xifluoromethyl)phenyl]- arϊύno}prop-l-en-l-yl)phenoxy]pyridin-2-yl}-lH-irnidazole-5-carboxamide Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
B-78: N-[2-(dime%lamino)ethyl]-2-{4-[3-((lE)-3-oxo-3-{[3-(trifluoromethyl)- phenyl]anτino}prop-l-en-l-yl)phenoxy]pyridin-2-yl}-4,5-dihydro-lH- imidazole-5-carboxamide
B-79: (2E)-N-[4-cyano-3-(trifluoromethyl)phenyl]-3-(3-{[2-(4/5-dihydro-lH-iinidazol- 2-yl)pyridin-4-yl]oxy}phenyl)acrylamide
B-80: (2E)-N-(3-ter^butylphenyl)-3-(3-{[2-(lΛ5/6-tetrahydropyrirnidin-2-yl)pyridin- 4-yl]oxy}phenyl)acrylamide
B-81: 2-{4-[3-((lE)-3-{[4-fluoro-3-(trifluorome&yl)phenyl]amino}-3-oxoprop-l-en-l- yl)phenoxy]pyridin-2-yl}-N-πιethyl-lH-iniidazole-5-carboxamide
B-82: (2E)-3-(3-{[2-(5-feri-butyl-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-N-[4- fluoro-3-(trifluoromethyl)phenyl]acrylamide
B-83: (2E)-N-(3-ethylphenyl)-3-(3-{[2-(lH-tetrazol-5-yl)pyridin-4-yl]oxy}- phenyl)acrylamide
B-84: methyl 2-{4-[3-((lE)-3-{[4-fluoro-3-(trifluoromeihyl)phenyl]anτino}-3-oxoprop- l-en-l-yl)phenoxy]pyridin-2-yl}-lH-imidazole-5-carboxylate
B-85: methyl 2-{4-[3-((lE)-3-{[4-fluoro-3-(taifluoromethyl)phenyl]aniino}-3-oxoprop- l-en-l-yl)phenoxy]pyridin-2-yl}-4/5-dihydro-lH-imidazole-5-carboxylate
B-86: (2E)-N-[4-bromo-3-(1xifluoromethyl)phenyl]-3-[3-({2-[(hydroxyarnirιo)- (itnino)methyl]pyridin-4-yl}oxy)phenyl]acrylamide
B-87: (2E)-N-[4-cWoro-3-(Mfluoromemyl)phenyl]-3-[3-({2-[inuno(methoxyamino)- methyl]pyridin-4-yl}oxy)phenyl]acrylamide
B-88: 2-[4-(3-{(lE)-3-[(3-fer^butylphenyl)arnino]-3-oxoprop-l-en-l-yl}phenoxy)- pyridin^-ylJ-lAS/β-tetrahydropyrimidine^-carboxylic acid
B-89: (2E)-N-[4-fluoro-3-(trifluorometh.yl)phenyl]-3-[3-({2-[(5S)-5-(methoxymethyl)- 4/5-dihydro-lH-irnidazol-2-yl]pyridin-4-yl}oxy)phenyl]acrylainide
B-90: (2E)-N-(2/3-dihydro-lH-inden-5-yl)-3-(3-{[2-(5/5-dimethyl-4/5-dihydro-lH- imidazol-2-yl)pyridin-4-yl]oxy}phenyl)acrylamide
B-91: (2E)-N-(3-cUorophenyl)-3-[3-({2-[(emarιirnidoylamino)methyl]pyridin-4- yl}oxy)phenyl]acrylamide
B-92: (2E)-3-(3-{[2-(4,5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-N-[3- (methylsulfanyl)phenyl]acrylamide
B-93: 2-{4-[3-((lE)-3-{[4-fluoro-3-(trifluoromethyl)phenyl]amino}-3-oxoprop-l-en-l- yl)phenoxy]pyridin-2-yl}-N/N-dirnethyl-4/5-dihydro-lH-irnidazole-5- carboxamide
B-94: 2-{4-[3-((lE)-3-{[4-fluoro-3-(trifluoromemyl)phenyl]amino}-3-oxoprop-l-en-l- y^phenoxyJpyridin^-ylJ-N/N-dirnethyl-lH-iinidazole-S-carboxamide
B-95: (2E)-N-(2/3-dihydro-lH-inden-5-yl)-3-(3-{[2-
({[irnino(phenyl)rneΛyl]arnino}methyl)pyridin-4-yl]oxy}phenyl)acrylarrιide Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
B-96: (2E)-N-[4-chloro-3-(trifluoromethyl)phenyl]-3-(3-{[2-(4/5-dihydro-lH- imidazol-2-yl)-3-rnethylpyridin-4-yl]oxy}phenyl)acrylamide
B-97: (2E)-N-[4-chloro-2-methoxy-3-(trifluoromethyl)phenyl]-3-(3-{[2-(4/5-dihydro- lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)acrylarrύde
B-98: 4-{3-[(lE)-3-(2/3-dihydro-lH-inden-5-ylamino)-3-oxoprop-l-en-l-yl]phenoxy}- N-[2-(dirnethylamino)ethyl]pyridine-2-carboxamide
B-99: fer^butyl [(4-{3-[(lE)-3-(2/3-dihydro-lH-inden-5-ylamino)-3-oxoprop-l-en-l- yl]phenoxy}pyridin-2-yl)methyl]carbamate
B-100: (2E)-3-(3-{[2-(arrunomethyl)pyridin-4-yl]oxy}phenyl)-N-(2/3-dihydro-lH- inden-5-yl)acrylamide
B-IOl: (2E)-N-[4-cWoro-2-hydroxy-5-(trifluoromethyl)phenyl]-3-(3-{[2-(4/5-dihydro- lH-iiϊiidazol-2-yl)pyridin-4-yl]oxy}phenyl)acrylarnide
B-102: 4-[3-((lE)-3-{[4-chloro-2-hydroxy-5-(trifluoromethyl)phenyl]arnino}-3- oxoprop-l-en-l-yl)phenoxy]-N-methylpyridine-2-carboxamide
B-103: 4-[3-((lE)-3-{[4-Aloro-2-hydroxy-3-(ωfluoromethyl)phenyl]amino}-3- oxoprop-l-en-l-yl)phenoxy]-N-methylpyridine-2-carboxamide
B-104: (2E)-N-[4-cWoro-2-hydroxy-3-(trifluoroinethyl)phenyl]-3-(3-{[2-(4/5-dihydro- lH-itnidazol-2-yl)pyridin-4-yl]oxy}phenyl)acrylamide
B-105: (2E)-N-[4-chloro-3-(trifluoromethyl)phenyl]-3-(3-{[2-(dieihylarrύno)pyrirrύdin- 4-yl]oxy}phenyl)acrylamide
B-106: (2E)-N-[4-chloro-3-(trifluoromethyl)phenyl]-3-{3-[(2-{[3-
(dirnethylaiΩino)propyl]aEnino}pyrirnidin-4-yl)oxy]phenyl}acrylarrύde
B-107: (2E)-N-[4-chloro-3-(tritluoromethyl)phenyl]-3-(3-{[2-
(isopropylarrmo)pyrirnidin-4-yl]oxy}phenyl)acrylarnide
B-108: (2E)-N-[4-chloro-3-(trifluoromethyl)phenyl]-3-{3-[(2-{[2-
(dirnethylanπino)ethyl]arrmo}pyrirrddin-4-yl)oxy]phenyl}acrylarrύd
B-109: (2E)-N-[4-(.hloro-3-(tofluoromethyl)phenyl]-3-{3-[(2-piperazin-l-ylpyrirnidin- 4-yl)oxy]phenyl}acrylamide
B-IlO: (2E)-N-[4-cWoro-3-(trifluoromethyl)phenyl]-3-{3-[(2-morpholin-4-ylpyrirrud^ 4-yl)oxy]phenyl}acrylamide
B-lll: (2E)-N-[4-Aloro-3-(trifluoromethyl)phenyl]-3-{3-[(2-piperidin-l-ylpyrixnidin- 4-yl)oxy]phenyl}acrylamide
B-112: (2E)-N-[4-chloro-3-(trifluoromethyl)phenyl]-3-[3-({2-[(4-methoxybenzyl)- amino]pyτirnidin-4-yl}oxy)phenyl]acrylarnide
B-113: (2E)-3-(3-{[2-(benzylamino)pyritnidin-4-yl]oxy}phenyl)-N-[4-fluoro-3- (trifluoromethyl)phenyl]acrylamide
B-114: (2E)-3-{3-[(2-aminopyrimidin-4-yl)oxy]phenyl}-N-[4-fluoro-3- (trifluorom.ethyl)phenyl]acrylamide Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
B-115: (2E)-N-[4-fluoro-3-(Mfluorome&yl)phenyl]-3-(3-{[2-(l-me%l-lH-imidazol-2- yl)pyridin-4-yl]oxy}phenyl)acrylamide
B-116: (2E)-3-(4-chloro-3-{[2-(l-methyl-4/5-dihydro-lH-imidazol-2-yl)pyridin-4- yl]oxy}phenyl)-N-[4-fluoro-3-(trifluorornethyl)phenyl]acrylairύde
B-117: (2E)-N-[4-cWoro-3-(trifluoromethyl)phenyl]-3-(3-{[2-(diethylamino)pyriiϊύdin- 4-yl]oxy}phenyl)acrylamide
B-118: (2E)-3-[3-({2-[(l-methylpiperidin-4-yl)airuno]pyrirnidin-4-yl}oxy)phenyl]-N-[3- (trifluoromethyl)phenyl]acrylamide
B-119: (2E)-N-[4-chloro-3-(trifluoromethyl)phenyl]-3-[3-({2-[[3- (dirnethylarrano)propyl](iτιe1hyl)amino]pyrirnidin-4- yl}oxy)phenyl]acrylamide
B-120: (2E)-3-[3-({2-[[2-(dimeΛylamino)ethyl](mefhyl)amino]pyrimidin-4- yl}oxy)phenyl]-N-[3-(trifluorornethyl)phenyl]acrylamide
B-121: (2E)-N-[4-cMoro-3-(trifluoromethyl)phenyl]-3-{3-[(2-pyrroHdin-l-ylpyriniidin^ 4-yl)oxy]phenyl}acrylamide
B-122: (2E)-3-(3-{[2-(4-me&ylpiperazin-l-yl)pyrimidin-4-yl]oxy}phenyl)-N-[3- (trifluoromethyl)phenyl]acrylamide
B-123: (2E)-N-[4-chloro-3-(trifluoromeihyl)phenyl]-3-[3-({2-[(2-inorpholiα-4- ylethyl)arnino]pyrimidin-4-yl}oxy)phenyl]acrylamide
B-124: (2E)-N-[4-chloro-3-(trifluoromethyl)phenyl]-3-[3-({2-[(4- rnethoxyphenyl)armno]pyrirnidin-4-yl}oxy)phenyl]acrylarnide
B-125: tert-butyϊ (l-{4-[3-((lE)-3-{ [4-chloro-3-(trifluoromethyl)phenyl]aπiino}-3- oxoprop-l-en-l-yl)phenoxy]pyrirnidin-2-yl}piperidin-3-yl)carbarnate
B-126: (2E)-3-(3-{[2-(3-aminopiperidin-l-yl)pyriinidin-4-yl]oxy}phenyl)-N-[4-chloro- 3-(trifluoromethyl)phenyl]acrylamide
B-127: (2E)-N-[4-chloro-3-(trifluoromethyl)phenyl]-3-{3-[(2-{[2-
(diinethylairιino)e&yl]amino}pyriniidin-4-yl)oxy]phenyl}acrylarrύ
B-128: (2E)-N-[4-chloro-3-(trifluoromethyl)phenyl]-3-{3-[(2-{[3-(2-oxopyrroHdin-l- yl)propyl]amino}pyrimidin-4-yl)oxy]phenyl}acrylamide
B-129: 4-[3-((lE)-3-{[4-diloro-3-(tofluoromethyl)phenyl]amino}-3-oxoprop-l-en-l- yl)phenoxy]-N-[2-(rnefhylaπιino)-2-oxoethyl]pyridin.e-2-carboxainide
B-130: methyl [({4-[3-((lE)-3-{[4-cMoro-3-(trifluoromethyl)phenyl]arnino}-3-oxoprop- l-en-l-yl)phenoxy]pyridin.-2-yl}carbonyl)amino]acetate
B-131: [({4-[3-((lE)-3-{[4-cWoro-3-(trifluoromethyl)phenyl]amino}-3-oxoprop-l-en-l- yl)phenoxy]pyridin-2-yl}carbonyl)amino]acetic acid
B-132: N-(2-morpholin-4-ylethyl)-4-[3-((l£)-3-oxo-3-{[4-
(trifluoroinethyl)phenyl]ainino}prop-l-en-l-yl)phenoxy]pyridine-2- carboxamide Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
B-133: 4-(3-{(l£)-3-[(3-methylphenyl)arnino]-3-oxoprop-l-en-l-yl}phenoxy)-N-(2- morpholin-4-yleiiιyl)pyridine-2-carboxamide
B-134: 4-(3-{(l£)-3-[(3-ethylphenyl)amino]-3-oxoprop-l-en-l-yl}phenoxy)-N-(2- morpholin-4-ylethyl)pyridine-2-carboxamide
B-135: 4-(3-{(l£)-3-[(3-chloro-4-£luorophenyl)amino]-3-oxoprop-l-en-l-yl}phenoxy)- N-(2-morpholin-4-yletlτ.yl)pyridine-2-carboxamide
B-136: 4-(3-{(lE)-3-[(4-cMoro-3-fluorophenyl)ainino]-3-oxoprop-l-en-l-yl}phenoxy)- N-(2-morpholin-4-ylethyl)pyridine-2-carboxamide
B-137: 4-(3-{(lE)-3-[(3-brornophenyl)arnino]-3-oxoprop-l-en-l-yl}phenoxy)-IV-(2- morpholin-4-yleihyl)pyridine-2-carboxamide
B-138: 4-(3-{(lE)-3-[(4-chloro-3-cyanophenyl)amino]-3-oxoprop-l-en-l-yl}phenoxy)- N-(2-morpholin-4-ylethyl)pyridine-2-carboxaniide
B-139: (2E)-N-(3-ferrtutylphenyl)-3-(3-{[2-(4/5-dihydro-lH-imidazol-2-yl)pyridin-4- yl]oxy}phenyl)-2-methylacrylamide
B-140: (2E)-N-(3-te^butylphenyl)-3-(3-{[2-(4/5-dniydro-lH-imidazol-2-yl)pyridin-4- yl]oxy}phenyl)-2-(hydroxymethyl)acrylamide
B-141: 4-[3-((lE)-3-{[4-(aminomethyl)-3-(trifluoromethyl)phenyl]amino}-3-oxoprop-l- en-l-yl)phenoxy]-N-methylpyridine-2-carboxamide
B-142: 4-[3-((lE)-3-{[3-arrmo-5-(ωfluoromethyl)phenyl]arnino}-3-oxoprop-l-en-l- yl)phenoxy]-N-methylpyτidine-2-carboxamide
B-143: (2E)-N-[3-amino-5-(tτifluoromethyl)phenyl]-3-(3-{[2-(4/5-dihydro-lH- imidazol-2-yl)pyridin-4-yl]oxy}phenyl)acrylamide
B-144: 4-[3-((lE)-3-{[3-(2-aminoethyl)-5-(trlfluoromelhyl)phenyl]amino}-3-oxoprop-l- en-l-yl)phenoxy]-N-methylpyridine-2-carboxamide
B-145: (2E)-N-[3-(2-aminoethyl)-5-(trifluoromethyl)phenyl]-3-(3-{[2-(4,5-dihydro-lH- imidazol-2-yl)pyridin-4-yl]oxy}phenyl)acrylamide
B-146: (2E)-N-[4-(aminomethyl)-3-(trifluorornethyl)phenyl]-3-(3-{[2-(4/5-dihydro-lH- knidazol-2-yl)pyridin-4-yl]oxy}phenyl)acrylamide
B-147: (2E)-N-[4-chloro-3-(trifluoromethyl)phenyl]-3-(3-{[2-(4/5-dihydro-lH- irnidazol-2-yl)pyridin-4-yl]rnethyl}phenyl)acrylamide
B-148: (2E)-N-[4-chloro-3-(trifluoromethyl)phenyl]-3-(3-{[2-(4/5-dihydro-lH- iirύdazol-2-yl)pyridin-4-yl]stdfanyl}phenyl)acrylamide
B-149: (2£)-N-[4-chloro-3-(trifluorornethyl)phenyl]-3-(3-{[2--(4/5-dihydro-lH- irnidazol-2-yl)pyridin-4-yl]arrιin.o}phenyl)acrylarnide B-150- N-{4-[3-((lE)-3-{[4-ethyl-3-(trifluoromethyl)phenyl]amino}-3-oxoprop-l-en-l- y^phenoxyjpyridin^-yljcyclopropanecarboxamide B_151. N-{4-[3-((lE)-3-{[4-[(dimethylamino)meihyl]-3-
(Mfluororneihyl)phenyl]amino}-3-oxoprop-l-en-l-yl)phenoxy]pyridin-2- yljcyclopropanecarboxamide Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
B- N-{4-[3-((lE)-3-{[3-(2-arninoethyl)-5-(trifluorome&yl)phenyl]amino}-3- oxoprop-l-en-l-yl)phenoxy]pyridm-2-yl}cydopropanecarboxa:mide B-153- NΛM3A(^E)-3-[(3-tert-buty\ph.enyϊ)aτmno]-3-oxoprop-l-en-l- yl}phenoxy)pyridin-2-yl]cyclopropanecarboxamide B-154- w-{4-[3-((l£)-3-{[4-ddoro-3-(trifluoromethyl)phenyl]arriino}-3-oxoprop-l-en-l- yl)phenoxy]pyτidm-2-yl}cyclopropanecarboxamide B_155. (2E)-3-(3-{[2-(acetylamino)pyridin-4-yl]oxy}phenyl)-iV-[4-ethyl-3-
(trifluoromethyl)phenyl]acrylamide B_156. (2£)-3-(3-{[2-(acetylamino)pyridin-4-yl]oxy}phenyl)-N-[4-
[(dirnethylarrmo)rnethyl]-3-(1xifluoromethyl)phenyl]acrylamide B-157- (2E)-3-(3-{[2-(acetylaπ^°)pyridin-4-yl]oxy}phenyl)-N-[3-(2-arninoethyl)-5-
(trifluoromethyl)phenyl]acrylamide B-158 (2E)-3-(3-{[2-(acetylarnino)pyridin-4-yl]oxy}phenyl)-N-(3-terf-butylphenyl)- acrylamide B_159 (2E)-3-(3-{[2-(acetylamino)pyridin-4-yl]oxy}phenyl)-N-[4-chloro-3-
(trifluoromethyl)phenyl]acrylamide
General Synthetic Methodology
[0133] The compounds of the present invention can be prepared by methods known to one of ordinary skill in the art and/or by reference to the schemes shown below and the synthetic examples that follow. Exemplary synthetic routes are set forth in Schemes below, and in the Examples.
[0134] Compounds of formula (I) wherein G is -O-, -S-, or -NH- may be prepared as outlined in Scheme 1 below:
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Scheme 1
Figure imgf000122_0001
NaH DMF
w I
Figure imgf000122_0002
Mβo
Figure imgf000122_0003
[0135] Acids i (W = SH, NH2 or OH) are commercially available, or are synthesized by procedures known in the art. The acid i is coupled under standard amide formation conditions to an aniline to provide amide ii. Amide ii (W = OH or SH) and a 4-chloropyridine derivative are then dissolved in DMPU and DMF, and the resultant solution is treated with potassium tβrt- butoxide. The reaction mixture is warmed to 1000C for at least 4 hours to provide the desired biaryl ether iii. Compounds iii wherein G is -NH- are prepared by irradiating a solution of BOC protected aniline ii (W = NH2) and a 4-chloropyridine derivative in NMP at elevated temperatures.
[0136] In an alternative approach, the biaryl ether bond can be formed first by reacting acid i with a 4-chloropyridine derivative in DMF in the presence of cesium carbonate or another base. This provides acid iv, which is then treated with an aryl or heteroaryl amine in the presence of coupling agents to give the desired amides iii. In some cases, the required acid i is not commercially available, but the corresponding methyl ether v is. For these cases acid v is converted to the amide under standard conditions and then treated with boron tribromide in methylene chloride to effect the deprotection of the phenol and provide amide vi. Ether formation is then accomplished as described above to provide the biaryl ether iii. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
[0137] When the desired cinnamic amide is not commercially available, it can be prepared as shown in Scheme 2.
Scheme 2:
1) Pd(PPh3)4, Et3N
O O 221) AArrNNHH,2 E Ett,3NN δ n
Figure imgf000123_0001
[0138] Acrylic acid vii is converted to the acid chloride with oxalyl chloride, and the resulting acid chloride is reacted with an aniline in the presence of base. The resulting acrylamide viii is then reacted with an appropriately substituted aryl iodide ix in the presence of a palladium catalyst and a base to give the cinnamide vi.
[0139] Compounds of formula (J) wherein L is saturated and ring B is a heteroaromatic ring represented by Ar' can be prepared from the cinnamic amide iii by reduction in the presence of palladium and hydrogen as shown in Scheme 3.
Scheme 3
Figure imgf000123_0002
iii . x
[0140] Compounds of formula (I) wherein L is substituted with nitrogen can be prepared as shown in Scheme 4. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Scheme 4:
Figure imgf000124_0001
xii xiϊi
Rm, Rn = NH2, H
Figure imgf000124_0002
XlV
[0141] An appropriately substituted β-amino acid xii is treated with di-t- butoxycarbonyl anhydride to protect the amine. This protected amine is then dissolved in DMF and treated with a 4-chloropyridine in the presence of Cs2CO3 as described above to provide biaryl ether xiv. Amide coupling and BOC deprotection afford β-amino amides xv which are further elaborated using standard amide formation conditions, reductive amination, or sulfonamide formation conditions to provide N-substituted derivatives of xv.
[0142] Compounds of formula (I) wherein G is -CH2- may be prepared as shown in
Scheme 5.
Scheme 5:
Figure imgf000124_0003
[0143] Commercially available nitrobenzyl pyridine xvi is reduced to the aniline in the presence of hydrogen and catalytic palladium on carbon. The resulting aniline is then converted Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
to the iodide. Heck coupling of xvii with an acrylamide viii provides cinnamide xviii, which can be reduced by catalytic hydrogenation to provide the desired hydrocinnamides xix.
[0144] Compounds of formula (I) wherein G -,i i .s -CH2- may also be prepared as depicted in Scheme 6.
Scheme 6:
Figure imgf000125_0001
XXII
Figure imgf000125_0002
xxiii XXlV
[0145] Known aniline xx can be converted to iodide xxi under standard Sandmeyer conditions. Oxidation of the pyridine nitrogen, followed by treatment with an appropriate nucleophile results in substituted pyridine xxii. Heck coupling of this iodide with an acrylamide viii results in cinnamide xxiii which can be reduced by catalytic hydrogenation to provide the desired hydrocinnamides xxiv.
[0146] One of ordinary skill in the art will recognize that additional compounds of formula (T) may be prepared by methods analogous to those depicted in Schemes 1-6 by changing the starting materials or reagents.
Uses, Formulation, and Administration
[0147] As discussed above, the present invention provides compounds that are inhibitors of Raf kinases. The compounds can be assayed in vitro or in vivo for their ability to bind to and/or inhibit a Raf kinase. In vitro assays include assays to determine inhibition of the ability of the kinase to phosphorylate a substrate protein or peptide. Alternate in vitro assays quantitate the ability of the compound to bind to the kinase. Inhibitor binding may be measured by radiolabelling the inhibitor prior to binding, isolating the inhibitor/ kinase complex and determining the amount of radiolabel bound. Alternatively, inhibitor binding Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
may be determined by running a competition experiment in which new inhibitors are incubated with the kinase bound to a known radioligand. The compounds also can be assayed for their ability to affect cellular or physiological functions mediated by protein kinase activity. Assays for each of these activities are described in the Examples and/or are known in the art.
[0148] In another aspect, therefore, the invention provides a method for inhibiting Raf kinase activity in a cell, comprising contacting a cell in which inhibition of a Raf kinase is desired with a compound of formula (I). In some embodiments, the compound of formula (I) interacts with and reduces the activity of more than one Raf kinase enzyme in the cell. By way of example, when assayed against B-Raf and C-Raf, some compounds of formula (I) show inhibition of both enzymes. In some embodiments, the compound of formula (I) is selective, i.e., the concentration of the compound that is required for inhibition of one Raf kinase enzymes is lower, preferably at least 2-fold, 5-fold, 10-fold, or 50-fold lower, than the concentration of the compound required for inhibition of another Raf kinase enzyme.
[0149] In some embodiments, the compound of formula (I) inhibits one or more Raf kinase enzymes at a concentration that is lower than the concentration of the compound required for inhibition of other, unrelated, kinase enzymes. In some other embodiments, in addition to inhibiting Raf kinase, the compound formula (I) also inhibits one or more other kinase enzymes, preferably other kinase enzymes involved in tumor cell proliferation.
[0150] The invention thus provides a method for inhibiting cell proliferation, comprising contacting a cell in which such inhibition is desired with a compound of formula (I). The phrase "inhibiting cell proliferation" is used to denote the ability of a compound of formula (T) to inhibit cell number or cell growth in contacted cells as compared to cells not contacted with the inhibitor. An assessment of cell proliferation can be made by counting cells using a cell counter or by an assay of cell viability, e.g., an MTT or WST assay. Where the cells are in a solid growth (e.g., a solid tumor or organ), such an assessment of cell proliferation can be made by measuring the growth, e.g., with calipers, and comparing the size of the growth of contacted cells with non-contacted cells.
[0151] Preferably, the growth of cells contacted with the inhibitor is retarded by at least about 50% as compared to growth of non-contacted cells, hi various embodiments, cell proliferation of contacted cells is inhibited by at least about 75%, at least about 90%, or at least Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
about 95% as compared to non-contacted cells. In some embodiments, the phrase "inhibiting cell proliferation" includes a reduction in the number of contacted cells, as compare to non- contacted cells. Thus, a kinase inhibitor that inhibits cell proliferation in a contacted cell may induce the contacted cell to undergo growth retardation, to undergo growth arrest, to undergo programmed cell death (i.e., apoptosis), or to undergo necrotic cell death.
[0152] In another aspect, the invention provides a pharmaceutical composition comprising a compound of formula (I) as defined above, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier.
[0153] If pharmaceutically acceptable salts of the compounds of the invention are utilized in these compositions, the salts preferably are derived from inorganic or organic acids and bases. For reviews of suitable salts, see, e.g., Berge et al, /. Pharm. Sd. 66:1-19 (1977) and Remington: The Science and Practice of Pharmacy, 20th Ed., ed. A. Gennaro, Lippincott Williams & Wilkins, 2000.
[0154] Nonlimiting examples of suitable acid addition salts include the following: acetate, adipate, alginate, aspartate, benzoate, benzene sulfonate, bisulfate, butyrate, citrate, camphorate, camphor sulfonate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, formate, fumarate, lucoheptanoate, glycerophosphate, hemisulfate, heptanoate, hexanoate, hydrochloride, hydrobromide, hydroiodide, 2-hydroxyethanesulfonate, lactate, maleate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, oxalate, pamoate, pectinate, persulfate, 3-phenyl-propionate, picrate, pivalate, propionate, succinate, tartrate, thiocyanate, tosylate and undecanoate.
[0155] Suitable base addition salts include, without limitation, ammonium salts, alkali metal salts, such as sodium and potassium salts, alkaline earth metal salts, such as calcium and magnesium salts, salts with organic bases, such as dicyclohexylamine salts, N-methyl-D- glucamine, and salts with amino acids such as arginine, lysine, and so forth.
[0156] Also, basic nitrogen-containing groups may be quaternized with such agents as lower alkyl halides, such as methyl, ethyl, propyl, and butyl chloride, bromides and iodides; dialkyl sulfates, such as dimethyl, diethyl, dibutyl and diamyl sulfates, long chain halides such as decyl, lauryl, myristyl and stearyl chlorides, bromides and iodides, aralkyl halides, such as Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
benzyl and phenethyl bromides and others. Water or oil-soluble or dispersible products are thereby obtained.
[0157] The term "pharmaceutically acceptable carrier" is used herein, to refer to a material that is compatible with a recipient subject, preferably a mammal, more preferably a human, and is suitable for delivering an active agent to the target site without terminating the activity of the agent. The toxicity or adverse effects, if any, associated with the carrier preferably are commensurate with a reasonable risk/benefit ratio for the intended use of the active agent.
[0158] The pharmaceutical compositions of the invention can be manufactured by methods well known in the art such as conventional granulating, mixing, dissolving, encapsulating, lyophilizing, or emulsifying processes, among others. Compositions may be produced in various forms, including granules, precipitates, or particulates, powders, including freeze dried, rotary dried or spray dried powders, amorphous powders, tablets, capsules, syrup, suppositories, injections, emulsions, elixirs, suspensions or solutions. Formulations may optionally contain stabilizers, pH modifiers, surfactants, bioavailability modifiers and combinations of these.
[0159] Pharmaceutical formulations may be prepared as liquid suspensions or solutions using a liquid, such as, but not limited to, an oil, water, an alcohol, and combinations of these. Pharmaceutically suitable surfactants, suspending agents, or emulsifying agents, may be added for oral or parenteral administration. Suspensions may include oils, such as but not limited to, peanut oil, sesame oil, cottonseed oil, corn oil and olive oil. Suspension preparation may also contain esters of fatty acids such as ethyl oleate, isopropyl myristate, fatty acid glycerides and acetylated fatty acid glycerides. Suspension formulations may include alcohols, such as, but not limited to, ethanol, isopropyl alcohol, hexadecyl alcohol, glycerol and propylene glycol. Ethers, such as but not limited to, poly(ethyleneglycol) , petroleum hydrocarbons such as mineral oil and petrolatum; and water may also be used in suspension formulations.
[0160] Pharmaceutically acceptable carriers that may be used in these compositions include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol and wool fat.
[0161] According to a preferred embodiment, the compositions of this invention are formulated for pharmaceutical administration to a mammal, preferably a human being. Such pharmaceutical compositions of the present invention may be administered orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir. The term "parenteral" as used herein includes subcutaneous, intravenous, intramuscular, intra-articular, intra-synovial, intrasternal, intrathecal, intrahepatic, intralesional and intracranial injection or infusion techniques. Preferably, the compositions are administered orally, intravenously, or subcutaneously. The formulations of the invention may be designed to be short-acting, fast-releasing, or long-acting. Still further, compounds can be administered in a local rather than systemic means, such as administration (e.g., by injection) at a tumor site.
[0162] Sterile injectable forms of the compositions of this invention may be aqueous or oleaginous suspension. These suspensions may be formulated according to techniques^known in the art using suitable dispersing or wetting agents and suspending agents. The sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally acceptable diluent or solvent, for example as a solution in 1,3-butanediol. Among the acceptable vehicles and solvents that may be employed are water, Ringer's solution and isotonic sodium chloride solution. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose, any bland fixed oil may be employed including synthetic mono- or di-glycerides. Fatty acids, such as oleic acid and its glyceride derivatives are useful in the preparation of injectables, as are natural pharmaceutically- acceptable oils, such as olive oil or castor oil, especially in their polyoxyethylated versions. These oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, such as carboxymethyl cellulose or similar dispersing agents which are commonly used in the formulation of pharmaceutically acceptable dosage forms including emulsions and suspensions. Other commonly used surfactants, such as Tweens, Spans and other emulsifying agents or bioavailability enhancers which are commonly used in the manufacture of pharmaceutically Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
acceptable solid, liquid, or other dosage forms may also be used for the purposes of formulation. Compounds may be formulated for parenteral administration by injection such as by bolus injection or continuous infusion. A unit dosage form for injection may be in ampoules or in multi- dose containers.
[0163] The pharmaceutical compositions of this invention may be orally administered in any orally acceptable dosage form including, but not limited to, capsules, tablets, aqueous suspensions or solutions. In the case of tablets for oral use, carriers that are commonly used include lactose and corn starch. Lubricating agents, such as magnesium stearate, are also typically added. For oral administration in a capsule form, useful diluents include lactose and dried cornstarch. When aqueous suspensions are required for oral use, the active ingredient is combined with emulsifying and suspending agents. If desired, certain sweetening, flavoring or coloring agents may also be added.
[0164] Alternatively, the pharmaceutical compositions of this invention may be administered in the form of suppositories for rectal administration. These may be prepared by mixing the agent with a suitable non-irritating excipient which is solid at room temperature but liquid at rectal temperature and therefore will melt in the rectum to release the drug. Such materials include cocoa butter, beeswax and polyethylene glycols.
[0165] The pharmaceutical compositions of this invention may also be administered topically, especially when the target of treatment includes areas or organs readily accessible by topical application, including diseases of the eye, the skin, or the lower intestinal tract. Suitable topical formulations are readily prepared for each of these areas or organs.
[0166] Topical application for the lower intestinal tract may be effected in a rectal suppository formulation (see above) or in a suitable enema formulation. Topically- transdermal patches may also be used. For topical applications, the pharmaceutical compositions may be formulated in a suitable ointment containing the active component suspended or dissolved in one or more carriers. Carriers for topical administration of the compounds of this invention include, but are not limited to, mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene, polyoxypropylene compound, emulsifying wax and water. Alternatively, the pharmaceutical compositions may be formulated in a suitable lotion or cream containing the active components suspended or dissolved in one or more pharmaceutically Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
acceptable carriers. Suitable carriers include, but are not limited to, mineral oil, sorbitan monostearate, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.
[0167] For ophthalmic use, the pharmaceutical compositions may be formulated as micronized suspensions in isotonic, pH adjusted sterile saline, or, preferably, as solutions in isotonic, pH adjusted sterile saline, either with our without a preservative such as benzylalkorύum chloride. Alternatively, for ophthalmic uses, the pharmaceutical compositions may be formulated in an ointment such as petrolatum.
[0168] The pharmaceutical compositions of this invention may also be administered by nasal aerosol or inhalation. Such compositions are prepared according to techniques well known in the art of pharmaceutical formulation and may be prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, fluorocarbons, and/or other conventional solubilizing or dispersing agents.
[0169] The pharmaceutical compositions of the invention preferably are formulated for administration to a patient having, or at risk of developing or experiencing a recurrence of, a Raf kinase-mediated disorder. The term "patient", as used herein, means an animal, preferably a mammal, more preferably a human. Preferred pharmaceutical compositions of the invention are those formulated for oral, intravenous, or subcutaneous administration. However, any of the above dosage forms containing a therapeutically effective amount of a compound of the invention are well within the bounds of routine experimentation and therefore, well within the scope of the instant invention. In some embodiments, the pharmaceutical composition of the invention may further comprise another therapeutic agent. In some embodiments, such other therapeutic agent is one that is normally administered to patients with the disease or condition being treated.
[0170] By "therapeutically effective amount" is meant an amount sufficient to cause a detectable decrease in protein kinase activity or the severity of a Raf kinase-mediated disorder. The amount of Raf kinase inhibitor needed will depend on the effectiveness of the inhibitor for the given cell type and the length of time required to treat the disorder. It should also be understood that a specific dosage and treatment regimen for any particular patient will depend upon a variety of factors, including the activity of the specific compound employed, the age, Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
body weight, general health, sex, and diet of the patient, time of administration, rate of excretion, drug combinations, the judgment of the treating physician, and the severity of the particular disease being treated. The amount of additional therapeutic agent present in a composition of this invention typically will be no more than the amount that would normally be administered in a composition comprising that therapeutic agent as the only active agent. Preferably, the amount of additional therapeutic agent will range from about 50% to about 100% of the amount normally present in a composition comprising that agent as the only therapeutically active agent.
[0171] In another aspect, the invention provides a method for treating a patient having, or at risk of developing or experiencing a recurrence of, a Raf kinase-mediated disorder. As used herein, the term "Raf kinase-mediated disorder" includes any disorder, disease or condition which is caused or characterized by an increase in Raf kinase expression or activity, or which requires Raf kinase activity. The term "Raf kinase-mediated disorder" also includes any disorder, disease or condition in which inhibition of Raf kinase activity is beneficial.
[0172] The Raf kinase inhibitors of the invention can be used to achieve a beneficial therapeutic or prophylactic effect, for example, in subjects with a proliferative disorder. Non- limiting examples of proliferative disorders include chronic inflammatory proliferative disorders, e.g., psoriasis and rheumatoid arthritis; proliferative ocular disorders, e.g., diabetic retinopathy; benign proliferative disorders, e.g., hemangiomas; and cancer. As used herein, the term "cancer" refers to a cellular disorder characterized by uncontrolled or disregulated cell proliferation, decreased cellular differentiation, inappropriate ability to invade surrounding tissue, and/or ability to establish new growth at ectopic sites. The term "cancer" includes, but is not limited to, solid tumors and bloodborne tumors. The term "cancer" encompasses diseases of skin, tissues, organs, bone, cartilage, blood, and vessels. The term "cancer" further encompasses primary and metastatic cancers.
[0173] Non-limiting examples of solid tumors that can be treated with the disclosed Raf kinase inhibitors include pancreatic cancer; bladder cancer; colorectal cancer; breast cancer, including metastatic breast cancer; prostate cancer, including androgen-dependent and androgen-independent prostate cancer; renal cancer, including, e.g., metastatic renal cell carcinoma; hepatocellular cancer; lung cancer, including, e.g., non-small cell lung cancer (NSCLC), bronchioloalveolar carcinoma (BAC), and adenocarcinoma of the lung; ovarian Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
cancer, including, e.g., progressive epithelial or primary peritoneal cancer; cervical cancer; gastric cancer; esophageal cancer; head and neck cancer, including, e.g., squamous cell carcinoma of the head and neck; skin cancer, including e.g., malignant melanoma; neuroendocrine cancer, including metastatic neuroendocrine tumors; brain tumors, including, e.g., glioma, anaplastic oligodendroglioma, adult glioblastoma multiforme, and adult anaplastic astrocytoma; bone cancer; soft tissue sarcoma; and thyroid carcinoma.
[0174] Non-limiting examples of hematologic malignancies that can be treated with the disclosed Raf kinase inhibitors include acute myeloid leukemia (AML); chronic myelogenous leukemia (CML), including accelerated CML and CML blast phase (CML-BP); acute lymphoblastic leukemia (ALL); chronic lymphocytic leukemia (CLL); Hodgkin's disease (HD); non-Hodgkin's lymphoma (NHL), including follicular lymphoma and mantle cell lymphoma; B-cell lymphoma; T-cell lymphoma; multiple myeloma (MM); Waldenstrom's macroglobulinemia; myelodysplastic syndromes (MDS), including refractory anemia (RA), refractory anemia with ringed siderblasts (RARS), (refractory anemia with excess blasts (RAEB), and RAEB in transformation (RAEB-T); and myeloproliferative syndromes.
[0175] The compounds of formula (I) are particularly useful in the treatment of cancers or cell types characterized by aberrant activation of the Ras-Raf-MEK-ERK pathway, including, without limitation, those characterized by an activating Ras and /or Raf mutation. In some embodiments, the compound or composition of the invention is used to treat a patient having or at risk of developing or experiencing a recurrence in a cancer selected from the group consisting of melanoma, colon, lung, breast, ovarian, sarcoma and thyroid cancer. In certain embodiments, the cancer is a melanoma.
[0176] In some embodiments, the Raf kinase inhibitor of the invention is administered in conjunction with another therapeutic agent. In some embodiments, the other therapeutic agent is one that is normally administered to patients with the disease or condition being treated. The Raf kinase inhibitor of the invention may be administered with the other therapeutic agent in a single dosage form or as a separate dosage form. When administered as a separate dosage form, the other therapeutic agent may be administered prior to, at the same time as, or following administration of the protein kinase inhibitor of the invention. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
[0177] In some embodiments, a Raf kinase inhibitor of formula (T) is administered in conjunction with an anticancer agent. As used herein, the term "anticancer agent" refers to any agent that is administered to a subject with cancer for purposes of treating the cancer. Nonlimiting examples anticancer agents include: radiotherapy; immunotherapy; DNA damaging chemotherapeutic agents; and chemotherapeutic agents that disrupt cell replication.
[0178] Non-limiting examples of DNA damaging chemotherapeutic agents include topoisomerase I inhibitors (e.g., irinotecan, topotecan, camptothecin and analogs or metabolites thereof, and doxorubicin); topoisomerase II inhibitors (e.g., etoposide, teniposide, and daunorubicin); alkylating agents (e.g., melphalan, chlorambucil, busulfan, thiotepa, ifosfamide, carmustine, lomustine, semustine, streptozocin, decarbazine, methotrexate, mitomycin C, and cyclophosphamide); DNA intercalators (e.g., cisplatin, oxaliplatin, and carboplatin); DNA intercalators and free radical generators such as bleomycin; and nucleoside mimetics (e.g., 5- fluorouracil, capecitibine, gemcitabine, fludarabine, cytarabine, mercaptopurine, thioguanine, pentostatin, and hydroxyurea).
[0179] Chemotherapeutic agents that disrupt cell replication include: paclitaxel, docetaxel, and related analogs; vincristine, vinblastin, and related analogs; thalidomide and related analogs (e.g., CC-5013 and CC-4047); protein tyrosine kinase inhibitors (e.g., imatinib mesylate and gefitinib); proteasome inhibitors (e.g., bortezomib); NF-κB inhibitors, including inhibitors of IKB kinase; antibodies which bind to proteins overexpressed in cancers and thereby downregulate cell replication (e.g., trastuzumab, rituximab, cetuximab, and bevacizumab); and other inhibitors of proteins or enzymes known to be upregulated, over-expressed or activated in cancers, the inhibition of which downregulates cell replication.
[0180] In order that this invention be more fully understood, the following preparative and testing examples are set forth. These examples illustrate how to make or test specific compounds, and are not to be construed as limiting the scope of the invention in any way. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
EXAMPLES
Definitions
AcOH acetic acid
ACN acetonitrile
ATP adenosine triphosphate
BCA bicinchoninic acid
BSA bovine serum albumin
Boc ferf-butoxycarbonyl
DABCO l,4-diazabicyclo[2.2.2]octane
DCE dichloroethane
DCM dichloromethane
DIPEA dϋsopropyl ethyl amine
DMEM Dulbecco's Modified Eagle's Medium
DMF dimethylformamide
DMPU l/3-dirnetiiyl-3,4/5/6-tetrahydro-2(lH)-pyrirnidinone
DTT dithiothreitol
EDTA ethylenediaminetetraacetic acid
EtOAc ethyl acetate
FA formic acid
FBS fetal bovine serum
HATU ©-(Z-Azabenzotriazol-l-y^-N^N^N'-tetramethyluronium hexafluorophosphate
HEPES N-(2-Hydroxyethyl)piperazine-JV'-(2-ethanesulfonic acid)
KHMDS potassium bis(trimethylsilyl)amide
KOi-Bu potassium ferf-butoxide
LDA lithium diisopropyl amide
Me methyl
MeOH methanol
MTT methylthiazoletetrazolium
MWI microwave irradiation
NMP l-Methyl-2-pyrrolidinone
PBS phosphate buffered saline Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
PKA cAMP-dependent protein kinase p-TSA • pαrø-toluene sulfonic acid
TBS tørt-butyldimethyl silyl
TBTU O-ClH-benzotriazol-l-y^-N^N'/N'-tetramethyluronium tetrafluoroborate
TEA trietlαylamine
TFFH Fluoro-N^N'-tetramemylformamidimiim hexafluorophosphate
THF tetrahydrofuran
TMB 3,3',5,5 -Tetramethylbenzidine
WST (4-[3-(4-iodophenyl)-2-(4-nitrophenyl)-2H-5-tetrazolio]-l,3- benzene disulfonate sodium salt) h hours min minutes rt room temperature m/z mass to charge
MS mass spectrum
LCMS liquid chromatography mass spectrum
HRMS high resolution mass spectrum
Analytical LC-MS Methods
LCMS conditions
[0181] Spectra were run on a Phenominex Luna 5μm C1850 x 4.6 mm column on a
Hewlett-Packard HPIlOO at 2.5 ml/min for a 3 minute run using the following gradients:
Method Formic Acid (FA): Acetonitrile containing zero to 100 percent 0.1 % formic acid in water.
Method Polar Ammonium Acetate (PAA): Acetonitrile containing zero to 50 percent 10 mM ammonium acetate in water.
Method Ammonium Acetate (AA): Acetonitrile containing zero to 100 percent 10 mM ammonium acetate in water. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Example 1: Preparation of phenols and phenol equivalents S-fS-chloro-^hydroxyphenyB-N-r^cMoro-S-ftrifluorornethyDphenyll-propanamide
soci,
Figure imgf000137_0001
Figure imgf000137_0002
[0182] To a solution of N-[4-chloro-3-(trifluoromemyl)phenyl]-3-(4- hydroxyphenyl)propanamide (1.33 g, 3.89 mmol) in DCE was added sulfuryl chloride (4.28 mL, 4.28 mmol) slowly over 45 min. The reaction mixture was heated at 840C overnight and then additional sulfuryl chloride was added. After heating for 2 h, the reaction mixture was cooled to rt and diluted with EtOAc. The combined organic solutions were washed with water and brine, dried over MgSO4, filtered and concentrated. The residue was purified by column chromatography to give the title compound (0.66 g, 45%).
2-(3-methoxyphenyl)cyclopropanecarboxylic acid
Figure imgf000137_0003
Step 1: Preparation of ethyl 2-(3-methoxyphenyl)cyclopropanecarboxylate
[0183] To a mixture of l-methoxy-3-vinylbenzene (3.10 g, 23.1 mmol) and dioxomethane
- diheptyhrhodium (4:2) (0.090 g, 0.12 mmol) in DCM (100 mL) under an atmosphere of argon at rt was added a solution of ethyl diazoacetate (1.22 mL, 11.6 mmol) in DCM (6 mL) dropwise via syringe. The reaction mixture as allowed to stir at rt for 2 h and then concentrated. The residue was purified by column chromatography to give the desired product (1.63 g) as a mixture of cis and trans isomers, along with recovered starting material (1.50 g). LCMS: (FA) ES+ 221.2 (M+l).
Step 2: Preparation of 2-(3~methoxyphenyl)cyclopropanecarboxylic acid
[0184] A solution of ethyl 2-(3-methoxyphenyl)cyclopropanecarboxylate (1.63 g, 7.4 mmol) in 3N NaOH (35 mL) and MeOH (35 mL) was heated at 600C for 1 h. After cooling to rt, the reaction mixture was concentrated. The residue was dissolved in IN HCl and extracted with DCM. The organic solutions were dried over Na2SO4, filtered, and concentrated to give the Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
desired product (1.23 g, 87%) which was used without further purification. The cis and trans isomers were separated at a later stage of analog synthesis. LCMS: (FA) ES- 191.3 (M+l).
2-(4-memoxyphenyl)cyclopropanecarboxy lie acid
[0185] The title compound was prepared from the appropriate starting materials in a manner analogous to that described for 2-(3-methoxyphenyl)cyclopropanecarboxylic acid. LCMS: (FA) ES- 191.3 (M-I).
3-(4-chloro-3-methoxyphenyl)-N-[3-chloro-4-(trifluoromethyl)phenyn-propanamide
Figure imgf000138_0001
Step 1: Preparation of N-[3-chloro-4-(trifluoromethyl)phenyl]acrylamide
[0186] To a stirred solution of the aniline (0.655 g, 3.3 mmol) in DCM (35 mL) was added TEA (0.604 mL, 4.4 mmol) and acryloyl chloride (0.286 mL, 3.5 mmol) at rt. After 20 min, the reaction was quenched by the addition of water and the mixture was extracted with DCM. The combined organic solutions were washed with water, dried over Na2SO4, filtered, and concentrated. The residue was purified by column chromatography to give the desired amide (0.535 g, 65%) as a white solid. LCMS: (FA) ES+ 250.2 (M+l), ES- 248.4 (M-I).
Step 2: Preparation of (2E)-3-(4-chloro-3-mefhoxyphenyl)-N-[3-chloro-4-
(trifluoromethyl)phenyl]acrylamide
[0187] To a suspension of K2CO3 (0.936 g, 6.77 mmol) and 7J-Bu4NCl (0.753 g, 2.71 mmol) in DMF under an atmosphere of argon were added 4~bromo-l-chloro-2-methoxybenzene (0.600 g, 2.71 mmol), the amide from Step 1 (0.809 g, 3.25 mmol), and molecular sieves. The mixture was stirred for 10 min at rt before adding PPh3 (0.071 g, 0.271 mmol) and Pd(O Ac)2 (0.0304 g, 0.135 mmol). The reaction mixture was heated at 80 0C overnight and then cooled to rt and Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
filtered through Celite. The filtrate was diluted with EtOAc and washed with sat. NaHCO3 solution, water, and brine. The organic solution was dried over MgSO4, filtered, and concentrated. The residue was purified by column chromatography to give the desired acrylamide (0-.755 g, 72 %).
Step 3: Preparation of 3-(4-chloro-3-methoxyphenyl)-N-[3-chloro-4-
(trifluoromethyl)phenyl]propanamide
[0188] The alkene from Step 2 (0.755 g, 1.80 mmol) was suspended in MeOH. To this suspension was added Pd/C (10 Wt %). The reaction was placed under an atmosphere of hydrogen gas and allowed to stir at rt for 3 h. The mixture was filtered through Celite and concentrated. The residue was purified by column chromatography to give the desired product (0.546 g, 72 %). LCMS: (FA) ES+ 392.0 (M+l), ES- 390.0 (M-I).
N-r4-chloro-3-(trifluoromethyl)phenyn-3-(4-hydroxy-3-methylphenyl)-propanamide
[0189] The title compound was prepared from the appropriate starting materials in a manner analogous to that described for N-[3-chloro-4-(trifluoromethyl)phenyl]acrylamide. LCMS: (FA) ES+ 358.2 (M+l), ES- 356.3 (M-I).
Example 2: Preparation of pyridines 4-chloro-N<3-dimethylpyridine-2-carboxamide
Figure imgf000139_0001
[0190] To a solution of 4-chloro-IV-methylpyridine-2-carboxamide (0.700 g, 4.12 mmol) in THF was added LDA (4.12 mL, 2M in THF, 8.24 mmol) dropwise at -78 °C under an atmosphere of argon. The mixture was allowed to stir for 90 min at -780C and then methyl iodide (1.51 mL, 24.71 mmol) was added. After stirring for 90 min, the solution was allowed to warm to 00C. The reaction was quenched at 0 °C with sat. sodium hydrogen sulfite and extracted with EtOAc. The combined organic solutions were washed with water, dried over MgSO4, filtered and concentrated. The residue was purified by column chromatography to give the desired product (0.070 g, 23%). Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
4-chloro-2-(4,5-dmydro-lH-imidazol-2-yl)pyridine
Figure imgf000140_0001
[0191] To a solution of 4-chloropyridine-2-carbonitrile (20.0 g, 121 mmol, prepared as described by Sakamoto et al. Chem. Pharm. Bull. 1985, 33, 565-571) in MeOH (240 mL), was added sodium methoxide (0.655 g, 12.1 mmol). The reaction mixture was stirred at rt under an atmosphere of argon for 2 h. Ethylene diamine (40.0 mL, 597 mmol) was added to the reaction mixture was stirred at 50 0C for 20 h. The solution was allowed to cool to rt and concentrated. The residue was partitioned between water and DCM. The organic layer was separated, dried over MgSO4, filtered and concentrated to give the desired product as a light brown solid (21.9 g, >99%). LCMS: (FA) ES+ 182.09 (M+l).
4-chloro-N-f2-(dirnemylamino)ethyl1pyridine-2-carboxarnide
Figure imgf000140_0002
[0192] To a solution of thionyl chloride (7.4 mL, 101 mmol) in DMF was added pyridine-2-carboxylic acid (2.5 g, 20.3 mmol). The reaction mixture was heated at 950C for 12 h and then concentrated. The residue was redissolved in DMF (7 mL) and N/N-dimethylethane-
1,2-diamine (11 mL, 101.5 mmol) was added. After stirring for 15 min, the mixture was concentrated and the residue was purified by column chromatography (0-10 % methanol/ dichloromefhane) to yield 2.11 g of the title compound (46 %). LCMS: (FA) ES+ 227.9
(M+l)
4-chloro-N-[3-(diniethylarnino)propyl1pyridine-2-carboxarrLide
[0193] The title compound was prepared from the appropriate starting materials in a manner analogous to that described for 4-chloro-N-[2-(diniethylarnino)ethyl]pyridine-2- carboxamide. LCMS: (FA) ES+ 241.9 (M+l) Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
4-chloro-N-(2-moφholin-4-ylethyl)pyridine-2-carboxarnide
[0194] The title compound was prepared from the appropriate starting materials in a manner analogous to that described for 4-chloro-N-[2-(dirnethylamino)ethyl]pyridine-2- carboxamide. LCMS: (FA) ES+ 270.0 (M+l).
Example 3: Synthesis of Anilines
2-{2-r3-ammo-5-(trifluoromethyl)phenyl1ethyl}-lH-isoindole-13(2H)-dione
Figure imgf000141_0001
Step 1: Preparation of 2-{(E)-2-[3-arnino-5-(trifluoromethyl)phenyl]vinyl}-lH-isoindole- l,3(2H)-dione
[0195] To a degassed solution of 3-brorno-5-(trifluorornethyl)aniline (1.00 g, 4.17 mmol) and ACN (40 mL) was added Pd(OAc)2 (0.46 g, 0.20 mmol), bis(2-methylphenyl)(3- methylphenyl)phosphine (0.13 g, 0.40 mmol), and TEA (1.15 mL, 8.25 mmol). After stirring for 1 h, 2-vinyl-lH-isoindole-l,3(2H)-dione (0.72 g, 4.17 mmol) was added. The solution was heated at reflux for 20 h and then allowed to cool to rt and filtered through Celite. The filtrate was washed with water and brine. The organic layer was dried over Na2SO4, filtered and concentrated. The residue was purified by column chromatography to yield the title compound as a yellow solid (0.90 g, 62 %). LCMS: (FA) ES+ 333.2 (M+l).
Step 2: Preparation of 2-{2-[3-amino-5-(trifluorornethyl)phenyl]ethyl}-lH-isoindole- l,3(2H)-dione
[0196] Pd/C (10 % by wt, 0.090 g) was added to a degassed solution of 2-{(E)-2-[3- amino-5-(trifluoromethyl)phenyl]vinyl}-lH-isoindole-l,3(2ff)-dione (0.900 g, 2.71 mmol) in EtOH (56 mL) and THF (40 mL). The mixture was hydrogenated (50 psi) at rt until LC/MS indicated reaction was complete. The mixture was filtered through Celite and the filtrate was Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
concentrated. The residue was purified by column chromatography (SiO2, 1:1 EtOAc:hexanes) to afford the desired product as a white solid (0.371 g, 40 %). LCMS: (FA) ES+ 335.3 (M+l).
3-f-er^-butyl-4-chloroaniline
Figure imgf000142_0001
Figure imgf000142_0002
Step 1: Preparation of IV-(2-ferf-butylphenyl)acetamide
[0197] A solution of 2-feri-butylaniline (2.0 g, 2.1 mL, 13.4 rnrnol) and TEA (2.8 mL, 20.1 mmol) in DCM (100 mL) was cooled to 00C. Acetyl chloride (1.0 mL, 14.7 mmol) was added dropwise. The resulting solution was allowed to stir and warm to rt over 2 h. The reaction mixture was diluted with water and DCM. The organic phase was washed with IN HCl and brine, dried over Na2SO4, filtered and concentrated to give the title compound as a white solid (2.73 g, >100%). 1H NMR (400 MHz, CDCl3) δ: 7.51 - 7.53 (m, IH), 7.39 - 7.41 (m, IH), 7.14 - 7.24 (m, 2H), 2.21 (s, 2.2H), 1.92 (s, 0.9H), and 1.41 (s, 9H).
Step 2: Preparation of ]V-(2-£er^butyl-4-iύtroρhenyl)acetamide
[0198] Concentrated sulfuric acid (30 mL) was cooled to 0 0C and solid N-(2-tert- butylphenyl)acetamide (1.0 g, 5.2 mmol) was added in several portions. To the resulting solution was added KNO3 (578 mg, 5.7 mmol). The reaction mixture was allowed to warm to rt over 2 h and then stirred at rt overnight. The reaction mixture was poured over ice and a white precipitate formed. The precipitate was isolated by filtration (1.04 g, 84%). LCMS: (FA) ES+ 237.2 (M+l), ES- 235.1 (M-I). Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Step 3: Preparation of 2-fer£-butyl-4-nitroaniline
[0199] N-(2-feri-butyl-4-nitrophenyl)acetamide (840 mg, 3.57 rnrnol) was dissolved in concentrated HBr (48%, 20 mL). The resulting solution was heated at 1100C for 3 h. The reaction mixture was cooled to rt, diluted with EtOAc, and poured into sat. NaHCO3 solution. The organic phase was extracted with sat. NaHCO3 solution and brine, dried over Na2SO4, filtered and concentrated to give the desired product as a yellow-green oil (710 mg, >100%). H NMR (400 MHz, CD3OD) δ: 7.52 (d, IH), 7.40 (dd, IH), 7.33 (d, IH), and 1.42 (s, 9H).
Step 4: Preparation of 2-ferf-butyl-l-chloro-4-nitrobenzene
[0200] The title compound was prepared as described by Nguyen, P. et al. J. Org. Chem.
2003, 68, 10195.
Step 5: Preparation of 3-terf-butyl-4-chloroaniline
[0201] To a solution of 2-/-ert-butyl-l-chloro-4-nitrobenzene (505 mg, 2.36 mmol) in
EtOAc (25 mL) was added SnCl2 hydrate (906 mg, 3.55 mmol). This mixture was heated at reflux and the solids dissolved. After 2 h, additional SnCl2 hydrate (906 mg, 3.55 mmol) was added and the solution was heated at reflux for another 2 h. The reaction mixture was purified by column chromatography (SiO2, 20% EtOAc/Hex) to give 210 mg of the title compound as a yellow oil (48%). 1H NMR (400 MHz, CD3OD) δ: 6.68 (d, IH), 6.16 (d, IH), 6.02 (dd, IH), and 0.92 (s, 9H).
3-ferf-butyl-4-bromoaniline
[0202] The title compound was prepared from the appropriate starting materials in a manner analogous to that described for 3-^ert-butyl-4-chloroaniline. 1H NMR (300 MHz7 CDCl3) δ: 7.25 (d, IH), 7.01-7.06 (m, IH), 7.60-7.67 (m, IH), and 1.46 (s, 9H). Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
3-r2-(dimethylamino)ethoxy1-5-(rrifluoromethyl)aniline
Figure imgf000144_0001
Step 1: Preparation of 3-nitro-5-(trifluoromethyl)phenol
[0203] A solution of 3-nitro-5-(trifluoromethyl)phenyl ether (20.0 g, 0.090 mol) in HBr
(74.7 mL, 1.38 rnmol) and HOAc (279.8 mL, 4.92 mol) was heated at reflux until reaction was judged to be complete by LCMS. The reaction was concentrated to tan solid to yield the desired product (18.7 g, 96 % yield). LCMS: (FA) ES- 206.2 (M-I).
Step 2: Preparation of N,N-diniemyl-2-[3-nitro-5-trifluoroniethyl)phenoxy]-ethananune
[0204] A mixture of 2-(Moro-N,N-dimemylemanamine (0.355 g, 2.66 mmol), 3-nitro-5-
(trifluoromethyl)phenol (0.500 g, 2.41 mmol) and Cs2CO3 (2.36 g, 7.24 mmol) in DMF (19 mL) was stirred at rt until reaction complete by TLC (1:1 EtOAeHexane). The mixture was diluted with EtOAc and washed with water. The organic solution was dried over Na2SO4, filtered, and concentrated to give the desired product as a brown oil (0.490 g, 63%). LCMS: (FA) ES+ 304.3 (M+l).
Step 3: Preparation of 3-[2-(dmiemylammo)emoxy]-5-(trifluorornethyl)aniline
[0205] A mixture of N,N-dimemyl-2-[3-mtro-5-(trifluoromemyl)phenoxy]-ethanamine
(490 mg, 1.61 mmol) and Pd/C (10 wt %, 49 mg) in EtOAc (15 mL) was stirred under an atmosphere of hydrogen until reaction complete was judged to be complete by LCMS. The mixture was filtered through Celite and rinsed with EtOAc. The filtrate was concentrated to yield the desired product as a brown solid (329 mg, 71%). LCMS: (FA) ES+ 275.2 (M+l). Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
3-(2-morpholin-4-ylethoxy)-5-(trifluoromethyl)artiline
[0206] The title compound was prepared from the appropriate starting materials in a manner analogous to that described for 3-[2-(dimemylammo)emoxy]-5-(trifluoromethyl)aniline. LCMS: (FA) ES+ 291.2 (M+l).
3-(2-pyrrolidin-l-ylethoxy)-5-(trifluoromethyl)aniline
[0207] The title compound was prepared from the appropriate starting materials in a manner analogous to that described for 3-[2-(dinaethylamino)ethoxy]-5-(trifluorornetliyl)aniline. LCMS: (FA) ES+ 275.2 (M+l).
2-(3-aminophenyl)propan-2-ol
Figure imgf000145_0001
Step 1: Preparation of l-(3-bromophenyl)-2,5-dimethyHH-pyrrole
[0208] A solution of 3-bromoaniline (2.50 mL, 23.0 mmol) in acetonylacetone (3.00 mL,
25.6 mmol) containing a small amount of p-TSA was heated at reflux in a round bottom flask fitted with a Dean Stark trap and a reflux condenser for 5 h. The reaction mixture was allowed to cool to rt and diluted with EtOAc. The solution was washed with IN HCl and sat. NaHCO3 solution. The organic solutions were dried over Na2SO4, filtered, and concentrated to give the desired product as a light brown solid (5.5 g, 96%) which was used without further purification. LCMS: (FA) ES+ 260.0 (M+l).
Step 2: Preparation of 2-[3-(2/5-dimethyl-lH-pyrrol-l-yl)phenyl]propan-2-ol
[0209] A solution of l-(3-bromophenyl)-2,5-dimethyl-lH-pyrrole (1.50 g, 6.00 mmol) in
THF (25 mL) was cooled to -78 0C under an atmosphere of argon. To this solution was added n- BuLi (2.50 M in hexane, 2.76 mL, 6.90 mmol) dropwise via syringe. After 30 min, acetone (0.572 mL, 7.8 mmol) was added to the cold solution dropwise via syringe. After 10 min, the cold bath was removed and the reaction mixture was allowed to warm to rt. After 5.5 h, the reaction was Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
quenched by the addition of water. The mixture was extracted with EtOAc and the organic solutions dried over Na2SO4, filtered, and concentrated. The residue was purified by column chromatography to give the desired product (0.84 g, 61%). LCMS: (FA) ES+ 230.1 (M+l).
Step 3: Preparation of 2-(3-aminophenyl)propan-2-ol
[0210] To a solution of hydroxylamine hydrochloride (7.42 g, 107 mmol) and potassium hydroxide (5.41 g, 82.0 mmol) in ethanol (65 mL) and water (30 mL) was added 2-[3-(2,5- dimethyl-lH-pyrrol-l-yl)phenyl]propan-2-ol (0.840 g, 3.66 mmol). The heterogeneous mixture was heated at 120 0C overnight and then concentrated. The residue was purified by column chromatography to give the desired product (0.55 g, 65%). 1H NMR (400 MHz, CDCl3) δ: 7.11- 7.15 (m, IH), 6.85-6.87 (m, IH), 6.84 (ddd, IH), 6.58 (ddd, IH), and 1.55 (s, 6H). LCMS: (FA) ES+ 152.0 (M+l).
3-amino-N-(2-m.ethoxyethyl)-5-(trifluoromethyl)-benzamide
Figure imgf000146_0001
Step 1: Preparation of N-(2-methoxyethyl)-3-nitro-5-(trifluoromethyl)benzamide
[0211] To a stirred solution of 3-nitro-5-(trifluoromethyl)benzoic acid (1.00 g, 0.42 mmol) in DCM (20 mL), were added 2-methoxyethanamine (0.41 mL, 0.47 mmol), DMAP (620 mg, 0.51 mmol) and EDCI (900mg, 0.47 mmol). The reaction mixture was allowed to stir at rt overnight and then concentrated. The residue was diluted with EtOAc and washed with water. The organic solution was dried (MgSO4) and evaporated. The residue was purified by chromatography (SiO2, MeOH/DCM) to yield the title compound as a white solid (780 mg, 63%). LCMS: (FA) ES+ 293.2 (M+l), ES" 291.2 (M-I).
Step 2: Preparation of 3-amino-N-(2-methoxyethyl)-5-(rrifluoromethyl)-benzamide
[0212] To a stirred solution of N-(2-methoxyethyl)-3-nitro-5-(trifluoromethyl)benzamide
(760 mg, 0.26 mmol) in EtOAc (20 mL) was added Pd on carbon (10 % wt, 76 mg). The mixture Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
was allowed to stir at rt overnight under an atmosphere of hydrogen . The mixture was diluted with EtOAc and filtered through Celite. The filtrate was evaporated and the residue was purified by column chromatography (SiO2, MeOH/DCM) to yield the title compound as a white solid (630 mg, 92%). LCMS: (FA) ES+ 263.2 (M+l)
3-airimo-N-[2-(dinie1hylammo)ethyl1-5-(trifluoromethyl)benzamide
[0213] The title compound was prepared from the appropriate starting materials in a manner analogous to that described for 3-arnino-N-(2-methoxyethyl)-5-(trifluoromethyl)- benzamide. LCMS: (FA) ES+ 276.23 (M+l).
4-chloro-2-memoxy-3-(trifluoromethyl)aniline
Figure imgf000147_0001
Step 1: Preparation of l-chloro-3-methoxy-4-nitro-2-(trifluoromethyl)benzene
[0214] A mixture of 3-chloro-6-nitro-2-(trifluoromethyl)phenol (1.00 g, 4.14 mmol), cesium carbonate (4.05 g, 12.4 mmol), and iodomethane (465 μL, 7.45 mmol) in DMF (20 mL) was allowed to stir at rt overnight. The reaction mixture was diluted with EtOAc and poured into water. The mixture was extracted 3 times with EtOAc and the organic solution was dried over Na2SO4, filtered and concentrated. The residue was purified by column chromatography (SiO2, EtOAc in hexanes) provided the title compound. 1H NMR (300 MHz, CDC13) δ: 7.90 (d, IH), 7.40 (d, IH), and 3.97 (s, 3H).
Step 2: Preparation of 4-chloro-2-methoxy-3-(trifluoromethyl)aniline
[0215] To a solution of l-chloro-3-methoxy-4-nitro-2-(trifluoromethyl)benzene (1.73 g,
6.74 mmol) in EtOAc (40 mL) was added tin chloride dihydrate (3.04 g, 13.5 mmol). The reaction mixture was heated at reflux for 3 h. The crude reaction mixture was purified by column chromatography (SiO2, EtOAc in hexanes) to give the title compound. LCMS: (FA) ES 226.0 (M+l). Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
6-amino-3-chloro-2-(trifluoromethyl)phenol
[0216] The title compound was prepared from the appropriate starting materials in a manner analogous to that described 4-chloro-2-methoxy-3-(trifluoromethyl)aniline (step 2). LCMS: (FA) ES- 210.3 (M-I).
4-chloro-2-methoxy-5-(trifluoromethyl)aniline
[0217] The title compound was prepared from the appropriate starting materials in a manner analogous to that described 4-chloro-2-methoxy-3-(trifluoromethyl)aniline (step 2). H NMR (300 MHz, CDCl3) δ: 8.25 (s, IH), 7.23 (s, IH), 4.04 (s, 3H), and 1.55 (s, IH).
[4-amino-2-(trifluoromethyl)phenynmethanol
Figure imgf000148_0001
Step 1: Preparation of methyl 4-nitro-2-(rrifluoromethyl)benzoate
[0218] A solution of 4-amino-2-(trifluoromethyl)benzoic acid (5.00 g, 21.6 mmol) in
MeOH (30 mL) was cooled to 00C. Trimethylsilyl diazomethane (2.0 M in Et20, 31.9 mL, 63.8 mmol) was slowly added and the reaction mixture was allowed to warm to rt. The solvent was removed and the white powder redissolved in EtOAc. The organic solution was washed with sat. NaHCO3 solution, dried over Na2SO4, filtered, and concentrated to give the title compound. LCMS: (FA) ES' 249.1 (M-I).
Step 2: Preparation of methyl 4-amino-2-(trifluoromethyl)benzoate
[0219] Methyl 4-nitro-2-(trifluoromethyl)beri2;oate (5.20 g, 20.9 mmol) was dissolved in
EtOAc (100 mL) and tin chloride dihydrate (9.41 g, 41.7 mmol) was added to the reaction mixture. The reaction was heated at reflux for 2 h. The crude reaction mixture was purified by column chromatography (SiO2, EtOAc /hexanes) to give the title compound. LCMS: (FA) ES 218.4 (M-I). Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Step 3: Preparation of [4-anτino-2-(trifluorornethyl)phenyl]rnethanol (AN-13)
[0220] The title compound was synthesized from methyl 4-amino-2-
(trifluoromethyl)benzoate as described by /. Med. Chem. 2002, 45(15), 3280-3285. LCMS: (FA) ES+ 192.2 (M+l).
Example 4: Synthesis of additional reactants (2S)-3-methoxypropane-l ,2-diamine dihydrochloride
Figure imgf000149_0001
Step 1: Preparation of methyl (2S)-2,3-bis[(fert-butoxycarbonyl)amino]-propanoate
[0221] To a solution of methyl (2S)-2-arnino-3-[(ferf-butoxycarbonyl)arnino]-propanoate hydrochloride (3.00 g, 11.8 mmol) and TEA ( 3.30 mL, 23.6 mmol) in DCM (60 mL), was added (Boc)2O (3.08 g, 14.1 mmol). The reaction was stirred for 18 h then diluted with DCM and washed with IN HCl and brine. The organic phase was dried (Na2SO4) and evaporated to yield the title compound as a white solid (4.10 g, 100 %). 1H NMR (400 MHz, CDCl3) δ: 5.42 (s, IH), 4.83 (s, IH), 4.35 (s, IH), 3.75 (s, 3H), 3.54-3.48 (m, 2H), and 1.44 (s, 18H).
Step 2: Preparation of di-fert-butyl [(2S)-3-hydroxypropane-l,2-diyl]biscarbamate
[0222] To a solution of methyl (2S)-2,3-bis[(ierf-butoxycarbonyl)amino]-propanoate
(3.57 g, 11.2 mmol) in THF (60 mL) at 00C was added lithium chloride (523 mg, 12.3 mmol) and then sodium borohydride (467 mg, 12.3 mmol) portionwise. Ethanol (30 mL) was added slowly. The reaction mixture was allowed to warm to rt and stirred for 18 h. Acetic acid (0.707 mL, 12.3 mmol) was added and the solvents were evaporated. The residue was purified by chromatography (SiO2, EtOAc/hexane) to yield the title compound as a white solid ( 2.35 g, 72.2 %). LCMS: (FA) ES+ 291.2 (M+l). Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Step 3: Preparation of di-førf-butyl [(2S)-3-memoxypropane-l,2-diyl]-biscarbarnate
[0223] To a solution of di-terf-butyl [(2S)-3-hydroxypropane-l,2-diyl]biscarbamate ( 2.45 g, 8.10 mmol) in THF (80 mL) at 00C, was added NaH (60 %, 357 mg, 8.91 mmol). The reaction was allowed to stir at 0 °C for 30 min, and then methyl iodide (0.556 mL, 8.91 mmol) was added dropwise. The reaction was stirred at 0 °C for 1 h and then allowed to warm to rt and stirred for 3 h. Water was added and the reaction was extracted into EtOAc. The combined organic solutions were washed with brine, dried (Na2SO4) and evaporated. The residue was purified by chromatography (SiO2, EtOAc /hexane) to yield the title compound as a white solid (895 mg, 36 %). LCMS: (FA) ES+ 305.2 (M+l).
Step 4: Preparation of (2S)-3-methoxypropane-l,2-diamine dihydrochloride
[0224] To a solution of di-ierf-butyl [(2S)-3-methoxypropane-l,2-diyl]biscarbamate (895 mg, 2.94 mmol) in MeOH (30 mL), was added 2N HCl in Et2O (15 mL, 29.4 mmol). The reaction was stirred at rt for 18 h and the solvents evaporated to yield the title compound as a white solid (478 mg, 92 %). LCMS: (FA) ES+ 105.0 (M+l).
Example 5: 4-[4-(3-{[4-chloro-3-(trifluoromethyl)phenyl]amino}-3-oxopropyl)phenoxy]-N- methylpyridine-2-carboxamide (A-9)
HATU DIPEA MWI
Figure imgf000150_0001
Figure imgf000150_0003
Figure imgf000150_0002
Figure imgf000150_0004
Step 1: Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-(4- hydroxyphenyl)propanamide
[0225] A mixture of 3-(4-hydroxyphenyl)propanoic acid (4 x 250 mg, 24.1 mmol total),
4-chloro-3-(trifluoromethyl)aniline (4 x 190 mg, 15.5 mmol total) and HATU (4 x 0.58 g, 24.1 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
mmol total) were added to four microwave-safe vials. To each vial, NMP (5 mL) and DIPEA (0.425 mL, 9.7 mmol) were added. The vials were then sealed and subjected to MWI at 2200C for 15 min. The reaction vessels were unsealed and the mixtures were combined and diluted with EtOAc. The organic solution was extracted with IN HCl and brine, dried over Na2SO4, filtered, and concentrated to give a brown oil. Purification by column chromatography (SiO2, EtOAc /hexane) provided 960 mg of a yellow oil that solidified upon exposure to DCM (47%, <95% pure). 1H NMR (300 MHz, CDCl3) δ: 7.74 (br d J = 2.4 Hz, IH), 7.65 (br dd, J1 = 8.5 Hz, J2 = 2.3 Hz, IH), 7.42 (d, / = 8.7 Hz, IH), 7.16 (br s, IH), 7.10 (d, / = 8.5 Hz, 2H), 6.79 (d, / = 8.5 Hz, 2H), 2.99 (t, / = 7.4 Hz), and 2.65 (t, / = 7.4 Hz).
Step 2: Preparation of 4-[4-(3-{[4-chloro-3-(trifluoromethyl)phenyl]amino}-3- oxopropyl)phenoxy]-]V-methylpyridine-2-carboxamide ( A-9) .
[0226] To a mixture of DMPU (0.7 mL) and DMF (2.8 mL) was added N-[4-chloro-3-
(trifluoromethyl)phenyl]-3-(4-hydroxyphenyl)propanamide (600 mg, 1.75 mmol) and 4-chloro- N-methylpyridine-2-carboxamide (prepared as described in Bankston, D. et al. Organic Process Research and Development 2002, 6, 777-781; 328 mg, 1.92 mmol). To this solution was added KOi- Bu (590 mg, 5.25 mmol). The reaction mixture was stirred at 100 °C for 18 h and then cooled to rt, diluted with water and extracted with EtOAc and DCM. The combined organic solutions were washed with water and brine, dried over Na2SO4, filtered and concentrated to give a brown oil. Purification by column chromatography provided 100 mg of a colorless solid. H NMR (300 MHz, CD3OD) δ: 10.11 (br s, 0.34H), 8.41 (d, / = 5.6 Hz, IH), 8.07 (br d, / = 2.2 Hz, IH), 7.74 (br dd, J1 = 8.7 Hz, J2 = 2.1 Hz, IH), 7.48-7.51 (m, 2H), 7.36 (d, / = 8.5 Hz, IH), 7.05 (d, / = 8.5 Hz, 2H), 6.98 (dd, Jl = 5.6 Hz, Jl = 2.5 Hz, IH), 3.34 (s, 0.84H), 3.04 (t, / = 7.5 Hz), 2.92 (s, 3H), and 2.71 (t, / = 7.5 Hz).
[0227] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 5:
2H), Hz, J2 =
Figure imgf000151_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
6.94-
Figure imgf000152_0001
Example 6: Preparation of 4-[3-(3-{[4-cWoro-3-(trifluoromethyl)phenyl]amino}-3- oxopropyl)phenoxy]-N-methylpyridine-2-carboxamide (A-7)
Figure imgf000152_0002
[0228] A mixture of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-(3- hydroxyphenyl)propanamide (585 mg, 1.70 mmol), 4-chloro-N-rnethylpyridine-2-carboxarnide (318 mg, 1.87 mmol), and Cs2CO3 (7.76 g, 8.5 mmol) in DMF (3.4 mL) was heated at 1000C overnight. . The reaction mixture was concentrated and diluted with EtOAc. The organic solution was washed with brine, dried over MgSO4, filtered, and concentrated. The residue was purified by column chromatography (SiO2, 0-30% EtOAc in hexanes) to give the product as a white solid. 1H NMR (400 MHz, CD3OD) δ: 8.62 (d, 1 H), 8.26 (m, 1 H), 7.89-7.96 (m, 1 H), 7.71- 7.74 (m, 1 H), 7.63 (t , 1 H), 7.41-7.47 (m, 1 H), 7.28 (br s, 1 H), 7.17-7.24 (m, 2 H), 2.58 (t, 2 H), 3.15 (s, 3 H), and 2.93 (t, 2 H). LCMS, AA: Rt= 2.05 min, [MH+ 478.3].
[0229] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 6:
A-202 1H NMR (400 MHz, CD3OD) δ: 8.40 (s, IH), 8.32 (s, IH), 8.03 (d, IH), 7.69 (dd, IH), 7.45 (d, IH), 7.36 (t, IH), 7.15-7.20 (m, 2H), 7.09 (dd, IH), 3.04 (t, 2H), and 2.71 (t, 2H). LCMS, FA: Rt = 1.66 min, [MH+ 462.1].
A-214 1H NMR (300 MHz, d6 DMSO) δ: 9 (s, IH), 8.58 (s, 2H), 7.81-7.85 (m, IH), 7.65- 7.76 (m, 2H), 7.32-7.45 (m, 2H), 7.14 (d, IH), 6.91-7.01 (m, 2H), 3.07 (t, 2H), 2.7 (t, 2H), and 3.07 (t, 2H). LCMS, FA: Rt = 1.91 min, [MH+ 422.0]. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000153_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
A-260 1H NMR (400 MHz, CD3OD) δ: 8.38 (d, IH), 8.03 (d, IH), 7.69 (dd, IH); 7.52 (d, IH), 7.49 (d, IH), 7.41 (dd, IH), 7.23 (d, IH), 7.05 (dd, IH), 6.99 (d, IH), 6.98 (d, IH), 3.46 (dd, 2H), 2.93 (dd, 2H), 2.71 (dd, 2H), 2.69 (s, 6H), and 1.94 (dddd, 2H). LCMS: (FA) ES+ 549.1 (M+l), ES- 547.1 (M-I).
A-79 1H NMR (400 MHz, CD3OD; HCOOH salt) δ: 10.36 (s, IH), 8.69 (dd, IH), 8.46 (d , IH), 8.13 (d, IH), 7.77 (dd, IH), 7.62 (dd, IH), 7.43 (dd, IH), 7.22 (d, IH), 7.10- 7.13 (m, 2H), 7.04 (dd, IH), 3.55 (dd, 4H), 3.37 (ddd, 2H), 2.96 (dd, 2H), 2.68 (dd, 2H), 2.51 (dd, 2H), 2.44 (dd, 2H), and 2.38 (dd, 2H). LCMS: (FA) ES+ 577.1 (M+l), ES- 575.0 (M-I).
Example 7: Preparation of 4-[4-(4-{[4-cWoro-3-(trifluoromethyl)phenyl]arnino}-4- oxobutyl)phenoxy]-N-methylpyridine-2-carboxamide (A-8)
HATU DIPEA MWI
Figure imgf000154_0002
Figure imgf000154_0001
Figure imgf000154_0003
Figure imgf000154_0004
Step 1. Preparation of N-[4-chloro-3-(tri-luoromethyl)phenyl]-4-(4- methoxyphenyl)butanamide
[0230] N-[4-cWoro-3-(trifluoromethyl)phenyl]-4-(4-rnethoxyphenyl)butanamide was prepared as described in Example 5, Step 1 using 4-(4-methoxyphenyl)butyric acid and 4- chloro-3-(trifluoromethyl)aniline. LCMS, AA: Rt=2.17 min, [MH" 370.1].
Step 2. Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-4-(4- hydroxyphenyl)butanarnide
[0231] To a solution of JV-[4-chloro-3-(trifluoromethyl)phenyl]-4-(4- methoxyphenyl)butanamide (460 mg, 1.23 mmol) in DCM (6 mL) at 0 °C was added BBr3 (1.0 M in DCM, 0.40 mL, 0.4 mmol) dropwise. The solution was allowed to warm to rt. Upon reaction Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
completion, the solution was poured onto ice and neutralized with NH4OH. The yellow solid was filtered off and rinsed with hexanes and Et2O to give the product as a white solid (356 mg, 81%). LCMS, AA: R=1.94 min, [MH" 356.1].
Step 3. Preparation of 4-[4-(4-{[4-chloro-3-(trifluorornethyl)phenyl]amino}-4- oxobutyl)phenoxy]-N-methylpyridine-2-carboxamide (A-8)
[0232] The title compound was prepared as described in Example 6. H NMR (400 MHz,
CD3OD) δ: 8.38 (d, 1 H), 8.03 (d, 1 H), 7.66-7.73 (m, 1 H), 7.41-7.48 (m, 2 H), 7.23-7.32 (m, 2 H), 6.92-7.03 (m, 3 H), 2.85 (s, 3 H), 2.68 (t, 2 H), 2.37 (t, 2 H), and 1.91-2.04 (m, 2 H). LCMS, AA: Rt = 2.10 min, [MH+ 492.1].
Example 8: Preparation of 4-[4-(3-anilino-3-oxopropyl)phenoxy]-N-methylpyridine-2- carboxamide (A-12)
Figure imgf000155_0001
Figure imgf000155_0002
TBTU, DIPEA
Figure imgf000155_0003
Step 1. Preparation of 3-(4-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)propanoic acid
[0233] A mixture of 3-(4-hydroxyphenyl)propanoic acid (10.7 g, 64.5 mmol), 4-chloro-N- methylpicolinamide (10.0 g, 58.6 mmol) and cesium carbonate (57.3 g, 175.8 mmol) was stirred in DMF and heated at 100 0C overnight. After cooling to rt, the mixture was filtered and washed with EtOAc to remove cesium carbonate. The remaining solid was dissolved in a minimal amount of water and the pH of the solution was adjusted to 4 by the dropwise addition of a sat. oxalic acid solution. The solution was extracted with DCM, the organic solutions washed with water and brine, dried over MgSO4, filtered, and concentrated. The resulting solid was recrystallized from EtOAc to give the desired product as a pale cream solid Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
(5.07 g, 37%). 1H NMR (400 MHz, 6-DMSO) δ: 12.13 (s, IH), 8.70-8.78 (m, IH), 8.49 (d, / = 5.6 Hz, IH), 7.34-7.39 (m, 3H), 7.11-7.14 (m, 3H), 2.87 (br t, / = 7.6 Hz, 2H), 2.77 (d, / = 4.8 Hz, 3H), and 2.57 (br t, / = 7.6 Hz, 2H).
Step 2. Preparation of 4-[4-(3-anilino-3-oxopropyl)phenoxy]-N-methylpyridine-2- carboxamide (A-12)
[0234] A mixture of 3-(4-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)-propanoic acid
(100 mg, 0.33 mmol), aniline (0.033 mL, 0.36 mmol), and TBTU (117 mg, 0.36 rnmol) in DCM (5 mL) was stirred at rt. To this slurry was added DIPEA (0.20 mL, 1.16 mmol). The mixture was allowed to stir at rt overnight and then diluted with water. The aqueous phase was separated and extracted with DCM. The organic solutions were combined, washed with brine, dried over MgSO4, filtered, and concentrated. The resulting solid was treated with MeOH and filtered to give 45 mg of a white solid. 1H NMR (400 MHz, ^6-DMSO) δ: 9.90 (br s, IH), 8.71-8.78 (m, IH), 8.48 (d, / = 5.6 Hz, IH), 7.55-7.60 (m, 2H), 7.36-7.40 (m, 2H), 7.36 (d, / = 2.4 Hz, IH), 7.25-7.31 (m, 2H), 7.12-7.16 (m, 2H), 7.11 (dd, / = 5.2, 2.4 Hz, IH), 6.99-7.04 (m, IH), 2.93-2.98 (m, 2H), 2.77 (d, / = 4.8 Hz, 3H), and 2.64-2.69 (m, 2H).
[0235] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 8:
J = 5.6 (m, Hz, 2H),
Figure imgf000156_0001
Figure imgf000156_0002
Example 9: Preparation of N-methyl-4-[4-(3-oxo-3-{[3-(trifluorornethyl)phenyl]amino}- propyl)phenoxy]pyridine-2-carboxamide (A-4)
[0236] A solution of 3-[4-({2-[(niemylarnino)carbonyl]pyridin-4-yl}oxy)phenyl]- propanoic acid (270 mg, 0.90 mmol), 3-(trifluoromethyl)aniline (158 mg, 0.98 mmol), HATU (409 mg, 1.07 mmol), and DIPEA (348 mg, 2.69 mmol) in DMF (5 mL) was stirred at rt for 16 h. The Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
reaction mixture was diluted with EtOAc and washed with IN HCl and brine. The organic solution was dried over MgSO4, filtered, and concentrated to give A-4 as a white solid (127 mg, 32%). 1H NMR (300 MHz, ^6-DMSO) δ: 10.28 (s, 1 H), 8.76 (m, 1 H), 8.47 (d, 1 H), 8.08 (br s, 1 H), 7.75 (br d, 1 H), 7.53 (t, 1 H), 7.31-7.42 (m, 4 H), 7.08-7.19 (m, 3 H), 2.97 (t, 2 H), 2.76 (d, 3 H), and 2.71 (d, 2 H). LCMS, FA: Rt= 1.89min, [MH+ 444.1].
[0237] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 9:
Figure imgf000157_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000158_0002
Example 10: Preparation of 4-[4-(3-{[4-chloro-3-(trifluoromethyl)phenyl]amino}-3- oxopropyl)phenoxy]pyridine-2-carboxarnide (A-3)
Figure imgf000158_0001
DIPEA
A-3 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Step 1. Preparation of 4-cMoropyridine-2-carbonitrile
[0238] To a solution of 4-chloropyridine N-oxide (5.0 g, 38.6 rnmol) in CAN (100 mL) was added trimethylsilyl cyanide (7.7 g, 77.2 rnmol) and TEA (8.1 mL, 57.9 mmol). The solution was heated at reflux for 48 h. The reaction was then concentrated and diluted with DCM and water before adding IN HCl (caution!). The mixture was extracted with DCM and the organic solutions were combined and washed with brine, dried over Na2SO4 and concentrated to yield the title compound as a brown solid (4.62 g, 87%). 1H NMR (300 MHz, ^6-DMSO) δ: 8.67 (dd, J1 = 0.57 Hz, J2 = 5.5 Hz, IH), 8.29 (dd, J1 = 0.75 Hz, J2 = 2.1, IH), and 7.88 (dd, J1 = 0.2.1 Hz, J2 = 5.5 m, IH).
Step 2. Preparation of 3-(4-{[2-(aminocarbonyl)pyridin-4-yl]oxy}phenyl)-propanoic acid
[0239] To a suspension of 4-cliloropyridine-2-carbonitrile (2.0 g, 14.5 mmol) in DMF (70 mL) was added cesium carbonate (14.0 g, 43.5 mmol) and 3-(4-hydroxyphenyl)propanoic acid (2.6 g, 15.9 mmol). The reaction mixture was heated at reflux overnight. The mixture was cooled to rt, concentrated, and then taken up in 300 mL of water. The pH was adjusted to 3 by the dropwise addition of oxalic acid and a precipitate formed. The precipitate was filtered to yield the title compound as a brown solid (1.2 g, 28%). LCMS: Method FA, Rt = 1.27 min, [MH+ = 287].
Step 3. Preparation 4-[4-(3-{[4-cWoro-3-(Wfluoromethyl)phenyl]arnino}-3- oxopropyl)phenoxy]pyridine-2-carboxamide (A-3)
[0240] A solution of 3-(4-{[2-(aminocarbonyl)pyridin-4-yl]oxy}phenyl)-propanoic acid
(200 mg, 0.70 mmol), HATU (319 mg, 0.84 mmol), DIPEA (0.24 mL, 1.4 mmol), and 4-chloro-3- (trifluoromethyl)aniline (136 mg, 0.70 mmol) in DMF (5 mL) was stirred overnight at rt. EtOAc was added to the reaction and the mixture was washed with IN HCl, IN NaOH, and brine, dried over Na2SO4 and concentrated. Purification by column chromatography (SiO2, 20-100% EtOAc in hexane) followed by recrystallization in EtOAc/hexane provided A-3 ( 37 mg, 11%). 1H NMR (300 MHz, ^6-DMSO) δ: 10.36 (s, IH), 8.48 (d, / = 5.7 Hz, IH), 8.18 (d, / = 2.5 Hz, IH), 8.09 (bs, IH), 7.81 (dd, J1 = 2.5 Hz, J2 = 8.8, IH), 7.7 (bs, IH), 7.64 (d, / = 8.8 Hz, IH), 7.35-7.40 (m, 3H), 7.12-7.16 (m, 3H), 2.97 (t, J = 7.3 Hz, 2H), and 2.70 (t, /= 7.8 Hz, 2H). Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
[0241] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 10:
A-2 1H NMR (300 MHz, ^6-DMSO): δ 10.26 (s, IH), 8.48 (d, / = 5.7 Hz, IH), 8.10 (bs, 2H), 7.75 (d, / = 8.5 Hz, IH), 7.67 (bs, IH), 7.53 (t, J = 7.8 Hz, IH), 7.36-7.41 (m, 4H), 7.11-7.16 (m, 3H), 2.97 (t, / = 7.5 Hz, 2H), and 2.70 (t, / = 8.0 Hz, 2H).
A-I 1H NMR (300 MHz, ^6-DMSO): δ 10.04 (s, IH), 8.48 (d, / = 5.8 Hz, IH), 8.09 (bd, / = 1.8 Hz, IH), 7.67 (bd, / = 1.8 Hz), 7.58-7.62 (m, 2H), 7.31-7.40 (m, 5H), 7.11-7.76 (m, 3H), 2.96 (t, / = 7.3 Hz, 2H), and 2.66 (t, J = 8.0 Hz, 2H).
Example 11: Preparation of N-(4-chlorophenyl)-3-{4-[(2-cyanopyridin-4- yl)oxy]phenyl}propanamide (A-21)
Figure imgf000160_0001
Figure imgf000160_0002
HATU, DIPEA
Figure imgf000160_0003
A-21
Step 1. Preparation of 3-{4-[(2-cyanopyridin-4-yl)oxy]phenyl}propanoic acid
[0242] To a suspension of 4-chloropyridine-2-carbonitrile (2.3 g, 16.6 mmol) in DMF
(100 mL) was added cesium carbonate (16.3 g, 50.0 mmol) and 3-(4-hydroxy-phenyl)propanoic acid (3.03 g, 18.3 mmol). The reaction was heated to 500C for 3 days. The mixture was cooled to rt, concentrated, and then taken up in 300 mL of water. The pH was adjusted to 3 by the dropwise addition of oxalic acid and a precipitate formed. The precipitate was filtered to give the title compound as a cream solid (4.17 g, 95%). LCMS: Method FA, Rt = 1.49 min, [MH+ = 269].
Step 2. Preparation of N-(4-chlorophenyl)-3-{4-[(2-cyanopyridin-4-yl)oxy]- phenyljpropanamide (A-21)
[0243] A solution of 3-{4-[(2-cyanopyridin-4-yl)oxy]phenyl}propanoic acid (400 mg, 1.49 mmol), HATU (681 mg, 1.79 mmol), DIPEA (0.5 mL, 2.98 mmol), and 4-chloroaniline (209 mg, Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
1.63 mmol) in DMF (5 mL) was stirred overnight at rt. The reaction mixture was diluted with EtOAc and washed with IN HCl, IN NaOH and brine, dried over Na2SO4 and concentrated. The resulting solid was triturated with DCM and filtered to give A-21 (187 mg, 33%). 1H NMR (300 MHz, ^6-DMSO): δ 10.02 (s, IH), 8.56 (dd, J1 = 0.50 Hz, J2 = 5.8 Hz, IH), 7.57-7.63 (m, 3H), 7.31-7.40 (m, 4H), 7.10-7.17 (m, 3H), 2.95 (t, / = 7.5 Hz, 2H), and 2.65 (t, / = 7.8 Hz, 2H).
Figure imgf000161_0001
A-23
A-36
A-30
Figure imgf000161_0002
Example 12: Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-[4-({2-
[(niethylarnino)rnethyl]pyridin-4-yl}oxy)phenyl]propanamide (A-30)
Step 1. Preparation of 3-(4-{[2-(aminornethyl)pyridin-4-yl]oxy}phenyl)-N-[4-chloro-3-
(trifluoromethyl)phenyl]propanamide (A-36)
[0244] A solution of A-23 (65 mg, 0.17 mmol) in 7N ammonia in MeOH (10 mL) was treated with 5% Rainey Nickel and exposed to a hydrogen atmosphere at rt for 2 h. The reaction mixture was diluted with water, and MeOH was removed in vacuo. The mixture was acidified with 2M HCl in dioxane and taken up in MeOH and DMF, filtered through a pad of Celite® and concentrated. The mixture is taken up in water and treated with TEA to form a precipitate that is filtered, treated with 2M HCl in ether, and recrystallized from MeOH and ether to yield A-36.
Step 2. Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-[4-({2-
[(m.ethylamino)rnethyl]pyridin-4-yl}oxy)phenyl]propanamide (A-30)
[0245] To A-36 (1.0 eq) in ACN at rt was added formaldehyde (1.5 eq) followed by sodium cyanoborohydride (3.1 eq), and a few drops of acetic acid. The mixture was allowed to stir for 5 h and then concentrated. The residue was dissolved in sat. sodium carbonate solution and the mixture was extracted into EtOAc. The organic solutions were combined, washed with Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
brine, dried over Na2SO4, and concentrated. Purification by column chromatography gave A- 30.
Example 13: Preparation of l-(4-Chloro-3-trifluoromethyl-phenyl)-4-{4-[2-(4,5-dihydro-lH- imidazol-2-yl)-pyridin-4-yloxy]-phenyl}-butan-2-one (A-27)
Figure imgf000162_0001
[0246] H2S was bubbled into a solution of A-23 (107 mg, 0.2 mmol) in ethylenediamine
(1 mL) for 15 min. The solution stirred for 72 hr at 600C and then diluted with water. The solution was extracted with DCM and the organic solution was washed with brine, dried over MgSO4, filtered, and concentrated. The residue was purified by flash chromatography (MeOH/DCM) and then crystallized with IN HCl/Et2O to give A-27 (46 mg, 44%). 1H NMR (300 MHz, 6-CD3OD): δ 8.62 (d, / = 5.0 Hz, IH), 8.10 (s, IH), 7.75 (d, / = 8.3 Hz, IH), 7.65 (s, IH), 7.52 (d, / = 8.3 Hz, IH), 7.42 (d, / = 7.5 Hz, 2H), 7.07-7.13 (m, 3H), 4.12 (s, 4H), 3.07 (t, / = 7.0 Hz), and 2.76 (t, J = 7.0 Hz). LCMS FA: R1 = 1.09 min, [MH+498.3].
[0247] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 13:
A-35 1K NMR (300 MHz, CD3OD, HCl salt): δ 8.59 (d, / = 5.5Hz, IH), 8.12 (s, IH), 7.77 (d, / =5.0 Hz, IH), 7.65 (s, IH), 7.54 (d, / = 8.5 Hz, IH), 7.42 (d, / = 7.5 Hz, IH), 7.12 (d, / = 7.8 Hz, 3H), 3.63 (br t, / = 5.3 Hz, 4H), 3.08 (t, / = 7.0 Hz, 2H), 2.77 (t, / = 7.0, 2H), and 2.12 (t, / = 4.0 Hz, 2H). LCMS FA: Rt = 1.53 min, [MH+ 503.0].
A-103 1H NMR (400 MHz, d6 DMSO; HCl salt) δ: 10.82 (s, IH), 10.09 (s, IH), 8.63 (d, IH), 8.38-8.33 (m, IH), 7.91-7.89 (m, IH), 7.53-7.42 (m, 3H), 7.27-7.23 (m, IH), 7.21-7.18 (m, IH), 7.15-7.13 (m, IH), 7.09-7.05 (m, IH), 3.99 (s, 4H), 2.97 (t, 2H), and 2.79 (t, 2H); LCMS: (FA) ES+ 473.3 (M+l), ES" 471.3 (M-I).
A-182 1H NMR (400 MHz, d6 DMSO; HCl salt) δ: 10.87-10.77 (m, 2H), 10.14-10.06 (m, IH), 8.67-8.57 (m, IH), 7.94-7.86 (m, IH), 7.44 (t, IH), 7.29-7.14 (m, 2H), 7.15-6.86 (m, 3H), 6.53-6.41 (m, IH), 4.05-3.93 (m, 4H), 3.77-3.65 (m, 4H), 3.10-2.99 (m, 4H), 2.95 (t, 2H), and 2.65 (t, 2H). LCMS: (FA) ES+ 490.3 (M+l), ES" 488.2 (M-I). Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000163_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000164_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000165_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000166_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000167_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000168_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000169_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000170_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000171_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Example 14: Preparation of 4-{4-[4-(4-chloro-3-trifluoromethyl-phenyl)-3-oxo-butyl]- phenoxy}-pyridine-2-carboxylic acid (2-pyrrolidin-l-yl-ethyl)-amide (A-26)
Figure imgf000172_0001
Step 1. Preparation of 4-[4-(3-{[4-chloro-3-(trifluoromethyl)phenyl]arrιrno}-3- oxopropyl)phenoxy]pyridine-2-carboxylic acid (A-37).
[0248] To a solution of A-23 (570 mg, 1.3 mmol) in ethanol (2.6 mL) was added IN KOH
(2.6 mL, 2.6 mmol). The solution was stirred overnight at 850C and then concentrated. The residue was taken up in water and extracted with EtOAc, washed with IN HCl and brine, dried over MgSO4, filtered and concentrated to give A-37 as a yellow solid (159 mg, 27 %). LCMS FA: Rt = 1.48 min, [MH+ 465.3]. 1H NMR (300 MHz, CD3OD): δ 8.59 (d, / = 5.5 Hz, IH), 8.1 (d, / = 4.5 Hz, IH), 7.28-7.35 (m, 3H), 7.16 (d, / = 2.4 Hz, IH), 6.88 (d, / = 8.7 Hz, IH), 3.71 (s, 3H), 3.14 (br t, / = 7.5 Hz, 2H), and 2.75 (br t, / = 7.5 Hz, 2H).
Step 2. Preparation of 4-{4-[4-(4-Chloro-3-trifluoromethyl-phenyl)-3-oxo-butyl]- phenoxy}-pyridine-2-carboxylic acid (2-pyrrolidin-l-yl-ethyl)-amide (A-26).
[0249] To a solution A-37 (52 mg, 0.1 mmol) in DMF (1.1 mL) were added TFFH (41 mg,
0.1 mmol) and DIPEA (280 μL, 0.2 mmol). After stirring for 1 h at rt, 2-pyrrolidin-l-yl- ethylamine (71 μL, 0.6 mmol) was added and the solution was stirred for 12 h. The reaction mixture was diluted with water and extracted with EtOAc, washed with brine, dried over MgSO4, filtered and concentrated. The residue was purified by column chromatography to give A-26.
[0250] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 14: Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000173_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Example 15: Preparation of 3-{3-[(2-aminopyrirnidin-4-yl)oxy]phenyl}-N-[4-chloro-3- (Mfluoromethyl)phenyl]propanamide (A-82)
Figure imgf000174_0001
Step 1. Preparation of 3-{3-[(2-chloropyrirnidin-4-yl)oxy]phenyl}-N-[4-chloro-3-
(trifluoromethyl)phenyl]propanamide
[0251] A solution of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-(3- hydroxyphenyl)propanamide (1.63 g, 4.70 mmol), 2,4-dichloropyrimidine (0.883 g, 5.90 mmol) and cesium carbonate (2.32 g, 7.10 mmol) in THF (60 mL) containing a drop of DMF was heated at reflux overnight. After cooling to rt, the reaction mixture was diluted with water and extracted with EtOAc. The combined organic solutions were washed with brine, dried over Na2SO4, filtered, and concentrated. The residue was purified by column chromatography to give the title compound (1.60 g, 77%). LCMS7 FA: Rt = 1.28 min, [MH+ 520.2].
Step 2. Preparation of Wr-[4-chloro-3-(trifluoromethyl)phenyl]-3-[3-({2-[(4- memoxybenzyl)anπmo]pyrirnidin-4-yl}oxy)phenyl]propanarnide (A-224)
[0252] To a solution of 3-{3-[(2-chloropyrimidin-4-yl)oxy]phenyl}-N-[4-chloro-3-
(trifluoromethyl)phenyl]propanamide (0.200 g, 0.44 mmol) in DMSO (1 mL) were added l-(4- methoxyphenyl)methanamine (0.056 mL, 0.44 mmol) and TEA (0.061 mL, 0.44 mmol). The reaction mixture was heated at 95 °C overnight and then cooled to rt, diluted with water and extracted with EtOAc. The combined organic solutions were washed with brine, dried over Na2SO4, filtered, and concentrated. The residue was purified by column chromatography to Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
give A-224. 1H NMR (400 MHz, d6 DMSO) δ: 10.35 (s, IH), 8.11-8.15 (m, IH), 8.05-8.11 (m, IH), 7.75-7.81 (m, IH), 7.62 (d, IH), 7.30-7.39 (m, IH), 7.09-7.26 (m, 2H), 7.04-7.07 (m, IH), 6.67-7.00 (m, 4H), 6.05 (d, IH), 4.25-4.43 (br m, IH), 3.96-4.10 (br m, IH), 3.67 (s, 3H), 2.93 (t, 2H), and 2.67 (t, 2H). LCMS, FA: R1= 1.88 min, [MH+ 557.3].
Step 3. Preparation of 3-{3-[(2-ammopyrmiidm-4-yl)oxy]phenyl}-N-[4~dxloro-3-
(trifluoromethyl)phenyl]propanamide (A-82)
[0253] A solution of A-224 (0.060 g, 0.11 mmol) in TFA (1 mL) was heated at 800C for 4 h. The mixture was allowed to cool to rt, quenched with sat. aqueous NaHCO3 and extracted with EtOAc. The combined organic solutions were washed with brine, dried over Na2SO4, filtered, and concentrated. The residue was purified by column chromatography to give A-82. 1H NMR (400 MHz, d6 DMSO) δ: 10.41 (s, IH), 8.2 (d, IH), 8.16 (d, IH), 7.89 (br s, IH), 7.8 (d, IH), 7.63 (d, IH), 7.37 (t, IH), 7.18 (d, IH), 7.11-7.13 (m, IH), 7.06 (dd, IH), 6.41 (d, IH), 2.94 (t, 2H), and 2.68 (t, 2H). LCMS, FA: R1= 1.40 min, [MH+ 437.1].
[0254] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 15:
A-87 1H NMR (400 MHz, CDCl3) δ: 8.12 (d, IH), 7.75 (d, IH), 7.65 (dd, IH), 7.42 (d, IH), 7.29-7.34 (m, IH), 7.17 (br s, IH), 7.09 (d, IH), 7.01-7.06 (m, 2H), 5.9 (d, IH), 3.63-3.69 (m, 4H), 3.07 (t, 2H), 2.68 (t, 2H), 1.52-1.64 (m, 6H), and 2.68 (t, 2H). LCMS, FA: R1= 2.09 min, [MH+ 505.2].
A-167 1H NMR (300 MHz, CDCl3) δ: 8.12 (dd, IH), 7.75 (d, IH), 7.64 (dd, IH), 7.37-7 A3 (m, 2H), 7.26-7.34 (m, IH), 6.98-7.09 (m, 3H), 5.93 (dd, IH), 3.37-3.51 (m, 4H), 3.05 (t, 2H), 2.67 (t, 2H), 0.99-1.12 (m, 6H), and 2.67 (t, 2H). LCMS, FA: Rt = 1.90 min, [MH+ 493.3].
A-124 LCMS, FA: R1= 1.28 min, [MH+ 520.2].
A-217 1H NMR (300 MHz, CDCl3) δ: 9.8 (br s, IH), 8.49 (br s, IH), 8.09 (d, IH), 7.84 (br s, 2H), 7.36 (d, IH), 7.22-7.30 (m, IH), 7.02-7.12 (m, 2H), 6.88-6.98 (m, IH), 6.16 (d, IH), 3.46-3.65 (m, 2H), 3.03 (t, 2H), 2.75-7.92 (m, 2H), 2.7 (t, 2H), 2.45 (br s, 6H), and 2.7 (t, 2H). LCMS, FA: Rt= 1.21 min, [MH+ 508.3].
A-70 1H NMR (400 MHz, CDCl3) δ: 8.13 (d, IH), 7.75 (d, IH), 7.64 (dd, IH), 7.41 (d, IH), 7.30-7.34 (m, IH), 7.23 (br s, IH), 7.08 (d, IH), 7.02-7.07 (m, 2H), 5.89 (d, IH), 3.46 (br s, 4H), 3.07 (t, 2H), and 2.68 (t, 2H). LCMS, FA: Rt= 1.66 min, [MH+ 492.3]. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
A-250 1H NMR (400 MHz, CDCl3) δ: 8.08 (d, IH), 7.73 (d, IH), 7.63 (dd, IH), 7.4 (d, IH), 7.29-7.35 (mm, 2H), 7.08 (dm, IH), 6.98-7.03 (mm, 2H), 5.99 (d, IH), 4.93 (br s, IH), 3.91-4.03 (mm, IH), 3.06 (t, 2H), 2.68 (t, 2H), and 1.13 (d, 6H). LCMS, FA: R1= 1.68 min, [MH+ 438.2].
A-207 1H NMR (400 MHz, ^6-DMSO) δ: 10.34 (s, IH), 8.2 (d, IH), 8.12-8.16 (d, IH), 7.78 (d, IH), 7.62 (d, IH), 7.38 (t, IH), 7.13 (d, IH), 7.06-7.10 (m, IH), 7 (dm, IH), 6.09 (d, IH), 3.46-3.58 (m, 8H), 2.93 (t, 2H), and 2.66 (t, 2H). LCMS, FA: R1 = 2.05 min, [MH+ 508.1].
A-164 1H NMR (400 MHz, CDCl3) δ: 9.61 (br s, IH), 8.1 (d, IH), 7.93 (d, IH), 7.75 (br s, IH), 7.38 (d, IH), 7.24-7.31 (m, IH), 7.06-7.17 (m, 2H), 6.88-6.95 (m, IH), 6.19 (d, IH), 5.62 (br s, IH), 3.36 (t, 2H), 3.22 (br s, 2H), 3.05 (t, 2H), 2.75 (t, 2H), 2.33 (t, 2H), 2.13 (br s, 2H), 2.01 (quint, 2H), and 1.67 (br s, 2H). LCMS, FA: Rt= 1.50 min, [MH+ 563.3].
A-68 LCMS, FA: Rt= 2.24 min, [MH+ 621.3].
A-116 LCMS, FA: Rt= 1.25 min, [MH+ 535.1].
Example 16: Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-(4-{[2-(2H-tetrazol-5- yl)pyridin-4-yl]oxy}phenyl)propanamide (A-57)
Figure imgf000176_0001
[0255] A solution of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-{4-[(2-cyanopyridin-4- yl)oxy]phenyl}propanamide (0.300 g, 0.67 mmol), aluminum trichloride (1.0 M in hexanes, 2.0 mL, 2.0 mmol), and sodium azide (0.131 g, 2.0 mmol) in DMF was heated at 1000C for 3 days. The mixture was concentrated and purified by column chromatography to give A-57 which was converted to the bishydrochloride salt (29 mg). 1H NMR (400 MHz, CD3OD; bisHCl salt) δ: 8.66 (d, IH), 8.03 (d, IH), 7.93 (d, IH), 7.66 (dd, IH), 7.52 (t, IH), 7.45 (d, IH), 7.41 (dd, IH), 7.37 (d, IH), 7.21-7.24 (m, IH), 7.12-7.17 (m, IH), 3.10 (t, 2H), and 2.75 (t, 2H). LCMS, FA: Rt= 1.48 min, [MH+ 489.3].
[0256] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 16:
A-236 H NMR (300 MHz, J6-DMSO; bisHCl salt) δ: 10.37 (s, IH), 8.60 (d, IH), 8.12 (d, Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
IH), 7.76 (dd, IH), 7.59 (d, IH), 7.55 (d, IH)77.45 (t, IH), 7.25 (d, IH), 7.15-7.18 (m, IH), 7.08-7.14 (m, 2H), 2.97 (t, 2H), and 2.69 (t, 2H). LCMS, FA: Rt = 1.52 min, [MH+ 489.3].
Example 17: Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-[4-({2-
[(hydroxyamino)(inτino)methyl]pyridin-4-yl}oxy)phenyl]propanarnide (A-85)
Figure imgf000177_0001
[0257] A solution of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-{4-[(2-cyanopyridin-4- yl)oxy]phenyl}propanamide (0.300 g, 0.67 mrnol), hydroxylamine hydrochloride (0.117 g, 1.69 rnrnol), and DIPEA (0.117 mL, 0.67 mrnol) in MeOH was allowed to stir at rt overnight. The mixture was concentrated and purified by column chromatography to give A-85 (68 mg). H NMR (300 MHz, d6 DMSO) δ: 10.48 (br s, IH), 10.17 (br s, IH), 8.50 (d, IH), 8.14-8.20 (m, IH), 7.77-7.85 (m, IH), 7.60-7.66 (m, IH), 7.50-7.56 (m, IH), 7.39-7.47 (m, IH), 7.20-7.26 (m, IH), 7.01- 7.13 (m, 3H), 2.92-3.01 (m, 2H), and 2.65-2.72 (m, 2H). LCMS, FA: Rt= 1.98 min, [MH+ 479.3].
Example 18: Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-[4-({2-
[(ethylamino) (imino)niethyl]pyridin-4-yl}oxy)phenyl]propanarnide (A-112)
Figure imgf000177_0002
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Step 1. Preparation of methyl 4-[4-(3-{[4-cWoro-3-(trifluoroinethyl)phenyl]-arrdno}-3- oxopropyl)phenoxy]pyridine-2-carboximidoate
[0258] To a solution of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-{4-[(2-cyanopyridin-4- yl)oxy]phenyl}propanamide (0.500, 1.12 rnmol) in MeOH was added NaOMe (0.006 g, 0.11 rnmol) in one portion. The reaction mixture was allowed to stir at rt overnight and then concentrated. The crude material was used without further purification.
Step 2. Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-[4-({2-
[(ethylarnino)(imino)m.ethyl]pyridin-4-yl}oxy)phenyl]propanarnide (A-112)
[0259] A mixture of the methyl 4-[4-(3-{[4-chloro-3-(trifluoromethyl)phenyl]-amino}-3- oxopropyl)phenoxy]pyridine-2-carboximidoate (0.150 g, 0.31 mmol) and ethylamine (2.0 M in MeOH, 0.155 mL, 0.31 mmol) in MeOH was heated at 500C for 3 days. The reaction mixture was concentrated and purified by column chromatography to give A-112 (94 mg). H NMR (300
MHz, CD3OD) δ: 8.33 (d, IH), 8.02 (d, IH), 7.68 (dd, IH), 7.56 (d, IH), 7.46 (d, IH), 7.37 (t, IH), 7.15-7.21 (m, IH), 7.01-7.05 (m, IH), 6.93-6.99 (m, IH), 6.88 (dd, IH), 3.27 (q, 2H), 3.03 (t, 2H), 2.69 (t, 2H), and 1.24 (t, 3H). LCMS, FA: Rt = 1.58min, [MH+ 491.3].
[0260] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 18:
A-172 1H NMR (400 MHz, CD3OD; HCOOH salt) δ: 8.52 (d, IH), 8.02 (d, IH), 7.74 (d, IH), 7.67 (dd, IH), 7.31-7.51 (m, 7H), 7.22-7.28 (m, IH), 7.05-7.09 (m, 2H), 7.02 (ddd, IH), 4.71 (s, 2H), 3.05 (t, 2H), and 2.71 (t, 2H). LCMS, FA: Rt= 1.73 min, [MH+ 553.3].
A-227 1H NMR (400 MHz, CD3OD) δ: 8.35 (d, IH), 8.03 (d, IH), 7.69 (dd, IH), 7.57 (d, IH), 7.48 (d, IH), 7.39 (t, IH), 7.18-7.22 (m, IH), 7.03-7.06 (m, IH), 6.96-7.00 (m, IH), 6.90 (dd, IH), 3.69 (dd, 4H), 3.40 (t, 2H), 3.04 (t, 2H), 2.70 (t, 2H), 2.65 (t, 2H), and 2.49-2.56 (m, 4H). LCMS, FA: Rt= 1.60 min, [MH+ 576.3].
A-150 1H NMR (300 MHz, ^6-DMSO; HCOOH salt) δ: 8.54 (s, IH), 8.46 (d, IH), 8.05 (d, IH), 7.70 (dd, IH), 7.51 (d, IH), 7.43 (t, IH), 7.24-7.31 (m, 2H), 7.07-7.10 (m, IH), 6.98-7.05 (m, 2H), 3.75-3.82 (m, 2H), 3.50-3.60 (m, 2H), 3.05 (t, 2H), and 2.72 (t, 2H). LCMS, FA: Rt = 1.59 min, [MH+ 533.3]. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Example 19: Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-{4-[(2-{5-[4-
(diefhylarrdno)phenyl]-lH-irnidazol-2-yl}pyridin-4-yl)oxy]phenyl}propanarm (A-54)
Figure imgf000179_0001
A-245
Figure imgf000179_0002
Step 1. Preparation of 3-[4-({2-[airuno(inxino)niethyl]pyridiri-4-yl}oxy)pheriyl]-N-[4- chloro-3-(trifluoromethyl)phenyl]propanamide (A-245)
[0261] To a solution of N-[4-chloro-3-(trifluorornethyl)phenyl]-3-{4-[(2-cyanopyridin-4- yl)oxy]phenyl}propanamide (0.200 g, 0.45 mmol) in MeOH was added NaOMe (2.4 mg, 0.045 mmol) in one portion. The mixture was allowed to stir at rt for 2 days and then ammonium chloride (35 mg, 0.50 mmol) was added. The reaction mixture was heated at reflux for 30 min and then cooled to rt and concentrated. The residue was recrystallized from EtOH to give A- 245. 1H NMR (300 MHz, ^6-DMSO) δ: 10.39 (br s, IH), 8.47 (d, IH), 8.14 (d, IH), 7.58-7.82 (m, IH), 7.70-7.74 (m, IH), 7.42 (t, IH), 7.21 (d, IH), 7.08-7.13 (m, IH), 6.98-7.06 (m, 2H), 2.96 (t, 2H), and 2.68 (t, 2H). LCMS, FA: Rt= 1.83 min, [MH+ 463.2].
Step 2. Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-{4-[(2-{5-[4-
(diemylarnino)phenyl]-lH-imidazol-2-yl}pyridin-4-yl)oxy]phenyl}propanarnide (A-54)
[0262] A solution of A-245 (30 mg, 0.06 mmol) and KHCO3 (24 mg, 0.24 mmol) in THF
(4 mL) and water (1 mL) was heated at reflux. Reflux was maintained while adding the bromide (16 mg, 0.06 mmol). The mixture was heated at reflux overnight and then concentrated. The residue was purified by column chromatography to give A-54 (8 mg). H Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
NMR (400 MHz7 dfOMSO) δ: 10.37 (s, IH), 8.43 (d, IH), 8.14 (d, IH), 7.75-7.83 (m, IH), 7.54-7.66 (m, 3H), 7.37-7.52 (m, 2H), 7.19-7.25 (m, IH), 7.13-7.17 (m, IH), 7.05-7.11 (m, IH), 6.87-6.92 (m, IH), 6.61-6.67 (m, 2H), 3.28-3.37 (m, 4H), 2.94-3.01 (m, 2H), 2.65-2.73 (m, 2H), and 1.03-1.11 (m, 4H). LCMS, FA: Rt = 2.36 min, [MH+ 634.3].
[0263] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 19:
A-228 1H NMR (400 MHz, CD3OD; HCl salt) δ: 8.53 (d, IH), 8.05 (d, IH), 7.78 (d, IH), 7.69 (dd, IH), 7.49 (d, IH), 7.43 (t, IH), 7.23-7.28 (m, IH), 7.05-7.10 (m, 2H), 6.99- 7.04 (m, IH), 3.06 (t, 2H), and 2.74 (t, 2H). LCMS, FA: R1 = 1.61 min, [MH+ 463.1].
A-232 1H NMR (400 MHz, CD3OD) δ: 8.34-8.41 (m, IH), 8.01-8.09 (m, IH), 7.63-7.76 (m, IH), 7.35-7.52 (m, 3H), 6.98-7.23 (m, 3H), 6.79-6.87 (m, 2H), 3.05 (t, 2H), 2.68-2.76 (m, 2H), and 2.24 (d, 3H). LCMS, FA: Rt= 1.33 min, [MH+ 501.9].
A-158 1H NMR (400 MHz, CD3OD) δ: 8.36 (d, IH), 8.01 (d, IH), 7.65 (dd, IH), 7.38-7.46 (m, 3H), 7.19-7.23 (m, IH), 7.06-7.08 (m, IH), 7.00 (ddd, IH), 6.84-6.86 (m, IH), 6.82 (dd, IH), 3.05 (t, 2H), 2.71 (t, 2H), and 2.25 (d, 3H). LCMS, FA: Rt= 1.97 min, [MH+ 501.0].
A-118 1H NMR (400 MHz, CD3OD) δ: 8.54 (d, IH), 8.01 (d, IH), 7.70 (d, IH), 7.66 (dd, IH), 7.45 (dd, 2H), 7.37 (s, IH), 7.27 (d, IH), 7.10 (s, IH), 7.01-7.07 (m, 2H), 3.07 (dd, 2H), 2.74 (dd, 2H), and 1.41 (s, 9H). LCMS: (FA) ES+ 543.1 (M+l), ES- 541.2 (M-I).
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Example 20: Preparation of 5-{4-[3-(3-{[4-cMoro-3-(rrifluoromethyl)phenyl]amino}-3- oxopropyl)phenoxy]pyridm-2-yl}-l,3,4-oxadiazole-2-carboxamide (A-102)
Figure imgf000181_0001
Step 1. Preparation of ethyl 5-{4-[3-(3-{[4-cWoro-3-(trifluoroniethyl)phenyl]-arrιino}-3- oxopropyl)phenoxy]pyridin-2-yl}-l,3,4~oxadiazole-2-carboxylate
[0264] A mixture of A-57 (50 mg, 0.11 rnmol) and ethyl oxalyl chloride (11 mg, 0.11 mmol) in toluene was heated at reflux for 2 h. The reaction mixture was concentrated and the residue purified by column chromatography to give the desired product. LCMS, FA: [MH+ 561.2].
Step 2. Preparation of 5-{4-[3-(3-{[4-chloro-3-(trifluorornethyl)phenyl]amino}-3- oxopropyl)phenoxy]pyridm-2-yl}~l,3,4~oxadiazole-2-carboxamide (A-102)
[0265] A solution of ethyl 5-{4-[3-(3-{[4-chloro-3-(trifluoromethyl)phenyl]-amino}-3- oxopropyl)phenoxy]pyridin-2-yl}-l,3,4-oxadiazole-2-carboxylate (100 mg) in NH4OH (10 mL) was allowed to stir at rt for 90 min. The reaction mixture was concentrated and the residue recrystallized from MeOH to give A-102. 1H NMR (300 MHz, ^6-DMSO) δ: 8.70 (br s, IH), 8.62 (d, IH), 8.29 (br s, IH), 8.13 (d, IH), 7.76 (dd, IH), 7.58-7.64 (m, 2H), 7.45 (t, IH), 7.23-7.28 (m, IH), 7.14-7.19 (m, 2H), 7.07-7.13 (m, IH), 2.97 (t, 2H), and 2.69 (t, 2H). LCMS, FA: Rt= 1.77 min, [MH+ 532.1]. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Example 21: Preparation of 4-[3-(3-{[3-amino-5-(trifluorome1iιyl)phenyl]arrιino}-3- oxopropyl)phenoxy]-N-meihylpyridine-2-carboxamide (A-225)
Figure imgf000182_0001
[0266] A-141 (0.143 g, 0.293 rnmol) was dissolved in EtOAc (4 mL). The solution was purged with nitrogen and Pd/carbon (10% wtv 14 mg) was added. The mixture was stirred under an atmosphere of hydrogen overnight. The reaction mixture was filtered through Celite and washed with EtOAc and MeOH. The filtrate was concentrated to a yellow solid. Purification by column chromatography (SiO2, 60% EtO Ac/Hex) provided A-225 as an off white solid (80 mg). 1H NMR (400 MHz, CD3OD) δ: 8.44 (d, IH), 7.54 (d, IH), 7.39 (t, IH), 7.21 (d, IH), 7.05-7.08 (m, 3H), 6.93-6.98 (m, 2H), 6.64 (bs, IH), 3.02 (t, 2H), 2.92 (s, 3H), and 2.66 (t, 2H).
[0267] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 21:
A-233 1H NMR (400 MHz, CD3OD; 3ΗC1 salt) δ: 8.40 (d, IH), 7.50 (d, IH), 7.41 (t, IH), 7.22 (d, IH), 7.06 (d, 2H), 7.02 (s, IH), 6.97 (m, 2H), 6.64 (s, IH), 3.83 (s, 4H), 3.02 (t, 2H), and 2.66 (t, 2H). LCMS: (FA) ES+ 470.1 (M+l).
Example 22: Preparation of 4-[3-(3-{[4-(arnmom.emyl)-3-(tofluorornethyl)phenyl]arnino}-3- oxopropyl)phenoxy]-N-methylpyridine-2-carboxamide (A-50)
Raney Ni
Figure imgf000182_0002
Figure imgf000182_0003
[0268] A-258 (115 mg, 0.246 mmol) was dissolved in a solution of NH3 in MeOH (7.0 M,
3 mL) and EtOAc (1 mL). Raney 2800 nickel (slurry in water, 50% v/v, about 1 mL) was added to the reaction mixture. This slurry was stirred under an atmosphere of hydrogen overnight. THF (1 mL) and more Raney 2800 nickel (ca. 1 mL) were added and the reaction mixture was Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
sonicated under an atmosphere of hydrogen overnight. The reaction mixture was then filtered through a pad of Celite washing well with MeOH. The filtrate was concentrated to give A-50 as a yellow oil. 1H NMR (400 MHz, CD3OD) δ: 8.37 (d, IH), 7.99 (bs, IH), 7.78-7.81 (m, IH), 7.55 (d, IH), 7.50 (d, IH), 7.39 (t, IH), 7.20-7.22 (m, IH), 7.03-7.06 (m, IH), 6.93-6.98 (m, 2H), 4.09 (s, 2H), 3.05 (t, 2H), 2.92 (s, 3H), and 2.71 (t, 2H).
[0269] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 22:
A-186 1H NMR (300 MHz, CD3OD) δ: 8.58 (d, IH), 7.96 (d, 2H), 7.66 (d, IH), 7.51 (s, IH), 7.43 (t, IH), 7.27 (d, IH), 7.15-7.12 (m, 2H), 7.02 (dd, IH), 4.18 (s, 2H), 4.11 (s, 4H), 3.08 (t, 2H), and 2.78 (t, 2H). LCMS: (FA) ES+ 484.2 (M+l), ES" 482.3 (M-
A-IOl 1H NMR (400 MHz, CD3OD) δ: 8.38 (d, IH), 7.92 (d, IH), 7.71 (dd, IH), 7.53 (d, IH), 7.48 (d, IH), 7.41 (t, IH), 7.23 (d, IH), 7.07 (t, IH), 7.00-6.95 (m, 2H), 3.91 (s, 2H), 3.81 (s, 4H), 3.06 (t, 2H), 2.71 (t, 2H). LCMS: (FA) ES+ 484 (M+l), ES- 482.27 (M-I).
Example 23: Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-[3-({2-
[(emaniniidoylarnino)methyl]pyridin-4-yl}oxy)phenyl]propanarnide (A-52)
Figure imgf000183_0001
Step 1. Preparation of tert-butyl ({4-[3-(3-{[4-chloro-3-(trifluoromethyl)phenyl]-amino}-3- oxopropyl)phenoxy]pyridin-2-yl}methyl)carbamate (A-125)
[0270] Boc2O (4.16 g, 19.08 mmol) was added to a degassed solution of N-[4-chloro-3-
(rrifluorornethyl)phenyl]-3-{3-[(2-cyanopyridin-4-yl)oxy]phenyl}propanamide (2.83 g, 6.35 mmol), THF (65 mL), and TEA (4.41 mL, 31.75 mmol). Raney nickel (aqueous solution) was Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
added and the solution was degassed. The mixture stirred under a hydrogen atmosphere for 24 h and then filtered through Celite, eluting with EtOH. The filtrate was concentrated and the residue purified by column chromatography (SiO2, 0- 50% EtOAc in hexanes) to give A-125 (0.581 mg, 16 %). 1H NMR (300 MHz, ^6-DMSO) δ: 10.35 (s, IH), 8.29 (d, IH), 8.14 (d, IH), 7.80 (dd, IH), 7.63 (d, IH), 7.39 (t, 2H), 7.17 (d, IH), 7.05 (s, IH), 6.96 (dd, IH), 6.74 (m, 2H), 4.12 (d, 2H), 2.94 (t, 2H), 2.67 (t, 2H), and 1.32 (s, 9H). LCMS: (FA) ES+ 550.5 (M+l).
Step 2. Preparation of 3-(3-{[2-(aminomethyl)pyridin-4-yl]oxy}phenyl)-N-[4-chloro-3-
(trifluoromethyl)phenyl]propanamide (A-97)
[0271] A solution of A-125 (0.58 g, 1.06 mmol) in TFA (2 mL) and DCM (10 mL) was stirred at rt for 5 h. The reaction was concentrated and the residue was purified by column chromatography (SiO2,10: 1: 89 MeOH: FA: DCM) to give A-97 (0.43 mg, 90 %). 1H NMR (300 MHz, CD3OD) δ: 8.25 (d, IH), 8.03 (d, IH), 7.70 (dd, IH), 7.48 (d, IH), 7.39 (t, IH), 7.19 (d, IH), 7.03 (br, IH), 6.95 (d, 2H), 6.70 (dd, IH), 3.82 (s, 2H), 3.04 (t, 2H), and 2.71 (t, 2H). LCMS: (FA) ES+ 516.4 (M+l).
Step 3. Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-[3-({2-
[(emanmτidoylamino)rnethyl]pyridin-4-yl}oxy)phenyl]propanarnide (A-52)
[0272] A solution of A-97 (0.107 g, 0.22 mmol), ethyl ethanimidoate hydrochloride (0.054 g, 0.44 mmol), and TEA (120 mL) in DMF (5 mL) was stirred at 0 0C for 15 min and then concentrated. The residue was partitioned between EtOAc and water. The aqueous layer was extracted with EtOAc, and the combined organic solutions were washed with brine and concentrated. The residue was purified by HPLC eluting with 85 % (95 % water/5 % FA):15 % (99 % ACN:1 % FA) to 20 % (95 % water/5 % FA):15 % (99 % ACN:1 % FA) (20 min gradient) to give A-52. The HCl salt was prepared by dissolving the residue in MeOH and adding 2.0 M HCl in Et2O and concentrating to white solid. 1H NMR (300 MHz, CD3OD; HCl salt) δ: 8.31 (d, IH), 8.09-8.03 (m, IH), 7.73-7.67 (m, IH), 7.54-7.35 (m, 2H), 7.26-7.19 (m, IH), 7.04 (br s, IH), 7.00-6.93 (m, 2H), 6.83-6.76 (m, IH), 4.49 (s, 2H), 3.04 (t, 2H), 2.72 (t, 2H), and 2.78 (s, 3H). LCMS: (FA) ES+ 491.2 (M+l), ES- 489.1 (M-I).
[0273] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 23: Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
A-153 1H NMR 300 MHz, CD3OD; HCl salt) δ: 8.35 (d, IH), 8.06-8.04 (m, IH), 7.88-7.82 (m, 2H), 7.76-7.67 (m, 4H), 7.63-7.35 (m, 5H), 7.26-7.19 (m, IH), 7.04 (br s, IH), 6.99-6.94 (m, 2H), 6.84-6.81 (m, IH), 4.69 (s, 2H), 3.02 (t, 2H), and 2.70 (t, 2H). LCMS: (FA) ES+ 553.1 (M+l), ES- 551.1 (M-I).
A-199 1H NMR (300 MHz, CD3OD) δ: 8.20 (d, IH), 7.95 (s, IH), 7.66 (d, IH), 7.43 (t, IH), 7.33 (m, 2H), 7.19 (d, IH), 7.02 (m, IH), 6.91 (m, 2H), 6.67 (dd, IH), 3.79 (s, 2H), 3.02 (t, 2H), and 2.70 (t, 2H). LCMS: (FA) ES+ 416.30 (M+l).
A-152 1H NMR (300 MHz, CD3OD) δ: 8.19 (d, IH), 7.97 (s, IH), 7.68 (d, IH), 7.42 (m, IH), 7.35 (m, 2H), 7.31 (d, IH), 7.02 (s, IH), 6.93 (d, IH), 6.85 (s, IH), 6.72 (br, IH), 4.26 (s, 2H), 3.02 (t, 2H), 2.70 (t, 2H), and 1.33 (s, 9H). LCMS: (FA) ES+ 516.44 (M+l).
Example 24: Preparation of 4-(3-{3-[(5-ferf-butyl-2-hydroxyphenyl)amino]-3- oxopropyl}phenoxy)pyridine-2-carboxamide (A-90)
Figure imgf000185_0001
[0274] A solution of BBr3 (1 M in DCM, 2.46 mL, 2.46 mmol) was added to a solution of
N-(5-iert-butyl-2-methoxyphenyl)-3-{3-[(2-cyanopyridin-4-yl)oxy]phenyl}propanamide (0.53 g, 1.23 mmol) in DCM (13 mL) at 00C. The solution was warmed to rt and stirred for 16 h. The reaction was poured onto ice slowly, the pH was adjusted to 7, and the solution extracted three times with Et2O. The combined organic solutions were washed with brine and sat. Na2S2O3, dried over Na2SO4 and concentrated to orange solid. The residue was purified by column chromatography to give A-90 (0.16 g, 32 % yield). 1H NMR (300 MHz, CD3OD) δ: 8.31 (d, IH), 7.58 (d, IH), 7.48 (d, IH), 7.41 (t, IH), 7.27-7.21 (m, IH), 7.09-6.90 (m, 4H), 6.78-6.73 (m, IH), 3.06 (t, 2H), 2.76 (t, 2H), and 1.25 (s, 9H). LCMS: (FA) ES+ 435.2 (M+l), ES- 432.2 (M-I). Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Example 25: Preparation of N-[3-(2-arrLinoethyl)-5-(trifluorornethyl)phenyl]-3-(3-{[2-(4,5- dihydro-lH-irrddazol-2-yl)pyridin-4-yl]oxy}phenyl)propanamide (A-148)
Figure imgf000186_0001
[0275] A-148 was prepared by the procedure of Example 13. Deprotection occurred concurrently with the amidine ring formation. 1H NMR (300 MHz, ^6-DMSO; HCl salt) δ: 10.88 (s, IH), 10.58 (s, IH), 8.62 (d, IH), 8.07 (br s, 2H), 7.96 (s, 2H), 7.72 (s, IH), 7.47-7.37 (m, IH), 7.31- 7.15 (m, 4H), 7.07-7.03 (m, IH), 4.00 (s, 4H), 3.10-2.90 (m, 6H), and 2.76-2.69 (m, 2H). LCMS: (FA) ES+ 498.3 (M+l).
[0276] A-201 was prepared from 4-[3-(3-{[3-[2-(l,3-dioxo-l,3-dihydro-2H-isoindol-2- yl)emyl]-5-(trifluorornethyl)phenyl]arruno}-3-oxopropyl)phenoxy]-N-rnethylpyridine-2- carboxamide in a method analogous to that of Example 25. 1H NMR (300 MHz, CD3OD; HCOOH salt) δ: 8.52 (br s, IH), 8.37 (d, IH), 7.74 (s, 2H), 7.52-7.48 (m, IH), 7.43-7.35 (m, IH), 7.31 (br s, IH), 7.25-7.19 (m, IH), 7.10-7.04 (m, IH), 7.02-6.94 (m, 2H), 3.21-3.15 (m, 2H), 3.09-2.94 (s, 4H), 2.91 (s, 3H), and 2.76-2.69 (m, 2H). LCMS: (FA) ES+ 487.3 (M+l).
Example 26: Preparation of substituted aminomethyl imidazoles
Figure imgf000186_0002
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Step 1. Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-[3-({2-[5-
(hydroxyineihyl)-lH-irmdazol-2-yl]pyridin-4-yl}oxy)phenyl]propanarriide (A- 147)
[0277] A solution of A-228 (150 mg, 0.32 mmol), 1,3-dihydroxyacetone dimer (80 mg,
0.44 mmol) and NH4Cl (80 mg, 1.50 mmol) in NH4OH (3 ml) and NH3 in MeOH (7M, 3 mL) was subjected to MWI at 1200C for 5 mins. The reaction mixture was poured into ice-water and extracted with DCM. The combined organic solutions were washed with brine and dried over Na2SO4. The residue was purified by reverse phase HPLC [20% water with ACN (contained 0.1% FA) to 100% ACN (contained 0.1% FA) over 25 mins]. The HCl salt of A-147 was obtained as a white solid after adding IM HCl in ether into the MeOH solution of product and followed by removal of solvent. 1H NMR (300 MHz, CD3OD): δ 8.53 (d, IH), 8.02 (d, IH), 7.66 (dd, IH), 7.61 (d, IH), 7.50 (s, IH), 7.42 (d, IH), 7.39 (d, IH), 7.24 (d, IH), 7.08 (m, IH), 7.02 (m, 2H), 4.66 (s, 2H), 3.04 (t, 2H), 2.73 (t, 2H). LCMS: (FA) ES+ 517.2 (M+l).
Step 2. Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-(3-{[2-(5-formyl-lH- imidazol-2-yl)pyridin-4-yl]oxy}phenyl)propanamide
[0278] Dess-Martin periodinane (354 mg, 0.84 mmol) was added to a suspension of A-
147 (360 mg, 0.70 mmol) in DCM (3 mL) at rt. The resulting suspension was stirred at rt for 30 min, and then quenched by the addition of aq. NaHCO3/Na2SO3 (1:1). The mixture was extracted with DCM and the combined organic solutions were washed with brine and dried over Na2SO4, filtered, and concentrated to give the title compound as an off-white foam and directly used in the next step. LCMS: (FA) ES+ 515.3 (M+l).
Step 3. Preparation of imidazoles
[0279] An amine (4.0 eq) was added to a solution of the appropriate aldehyde (1.0 eq) in
MeOH at rt. The reaction was stirred for 2 h, and then sodium cyanoborohydride (4.0 eq) was added and the reaction was stirred overnight. DCM was added into the reaction mixture and the mixture was washed with brine. The residue was purified by reverse phase HPLC [80% water with ACN (contained 0.1% FA) to 100% ACN (contained 0.1% FA) over 25 mins]. The HCl salt of the imidazole was obtained as a white solid after adding IM HCl in ether into the MeOH solution of product and followed by removal of solvent. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
[0280] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 26:
A-109 1H NMR (300 MHz, CD3OD; 3*HC1 salt): δ 8.59 (d, IH), 8.07 (d, IH), 7.76 (d, IH), 7.72 (s, IH), 7.68 (d, IH), 7.51 (s, IH), 7.48 (d, IH), 7.34 (d, IH), 7.26 (dd, IH), 7.14 (m, IH), 7.12 (dd, IH), 4.33 (s, 2H), 3.10 (t, 2H), 2.80 (s, 3H), 2.78 (t, 2H). LCMS: (FA) ES+ 530.24 (M+l).
A-73 1H NMR (400 MHz, CD3OD; 3*HC1 salt): δ 8.59 (d, IH), 8.05 (d, IH), 7.78 (d, IH), 7.75 (s, IH), 7.69 (dd, IH), 7.52 (d, IH), 7.48 (d, IH), 7.35 (d, IH), 7.28 (dd, IH), 7.20 (m, IH), 7.12 (dd, IH), 4.43 (s, 2H), 3.11 (t, 2H), 2.95 (s, 6H), 2.78 (t, 2H). LCMS: (FA) ES+ 544.69 (M+l).
A-226 1H NMR (400 MHz, CD3OD; 3ΗC1 salt): δ 8.59 (d, IH), 8.05 (d, IH), 7.77 (d, IH), 7.75 (s, IH), 7.69 (dd, IH), 7.52 (d, IH), 7.48 (d, IH), 7.35 (d, IH), 7.28 (dd, IH), 7.20 (m, IH), 7.12 (dd, IH), 4.50 (s, 2H), 3.62 (m, 2H), 3.11 (t, 2H), 2.78 (t, 2H), 2.10 (m, 4H). LCMS: (FA) ES+ 570.61 (M+l).
A-58 1H NMR (400 MHz, CD3OD; 4ΗC1 salt): δ 8.61 (d, IH), 8.06 (d, IH), 7.76 (m, 2H), 7.70 (dd, IH), 7.50 (m, 2H), 7.34 (d, IH), 7.28 (dd, IH), 7.20 (m, IH), 7.12 (dd, IH), 4.46 (s, 2H), 3.67 (m, 4H), 3.11 (t, 2H), 3.01 (s, 6H), 2.78 (t, 2H). LCMS: (FA) ES+ 587.63 (M+l).
Example 27: Preparation of amide-substituted imidazoles
Figure imgf000188_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Step 1. Preparation of 2-{4-[3-(3-{[4-cMoro-3-(trifluoromemyl)phenyl]amino}-3- oxopropyl)phenoxy] pyridin-2-yl}-lH-imidazole-4-carboxylic acid (A-113)
[0281] A solution of N-t^Aloro-S-Ctimuorornethy^phenylJ-S-CS-ip-CS-forrnyl-lH- irnidazol-2-yl)pyridin-4-yl]oxy}phenyl)propanarnide (210 mg, 0.41 mmol) in 2-methyl-2-butene (1 mL), ACN (2 mL) and tert-butyl alcohol (2 mL) was cooled to 0 0C, and a solution of sodium chlorite (228 mg, 2.02 mmol) and sodium dihydrogenphosphate (240 mg, 2.0 mmol) in water (1 mL) was added. The yellow solution was stirred at 0 0C overnight. The reaction was quenched with brine and extracted with EtOAc. The combined organic solutions were washed with brine, dried over Na2SO4, filtered, and concentrated to give A-113 as a white solid, which was directly used in the next step. 1H NMR (300 MHz, CD3OD) δ: 6.96 (d, IH), 6.49 (s, IH), 6.42 (d, IH), 6.19 (m, IH), 6.05 (dd, IH), 5.79-5.88 (m, 2H), 5.68 (d, IH), 5.58 (d, IH), 5.53 (s, IH), 5.45 (d, IH), 1.46 (dd, 2H), and 1.14 (22, 2H). LCMS: (FA) ES+ 531.1 (M+l), ES- 529.1 (M-I).
Step 2. Preparation of amide substituted imidazoles
[0282] A solution of the appropriate carboxylic acid (1.0 eq), amine (1.2 eq) and DMAP
(1.2 eq) in DCM was cooled to 0 °C and then EDCI (1.3 eq) was added. The reaction mixture was stirred at rt for 16 h and then diluted with DCM and washed with brine. The crude product was purified by reverse phase HPLC [80% water with ACN (contained 0.1% FA) to 100% ACN (contained 0.1% FA) over 25 mins]. The HCl salt of the title compound was obtained as a white solid after adding IM HCl in ether into the MeOH solution of product and followed by removal of solvent.
[0283] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 27:
A-184 1H NMR (400 MHz, CD3OD; 3ΗC1 salt): δ 8.62 (d, IH), 8.07 (d, IH), 8.04 (s, IH), 7.83 (d, IH), 7.70 (dd, IH), 7.52 (t, IH), 7.46 (d, IH), 7.37 (m, 2H), 7.24 (br, IH), 7.15 (dd, IH), 3.65 (d, 4H), 3.26 (m, 4H), 3.11 (t, 2H), 2.99 (s, 3H), 2.80 (t, 2H). LCMS: (FA) ES+ 613.34 (M+l).
A-204 1H NMR (400 MHz, CD3OD; bisHCl salt): δ 8.61 (d, IH), 8.06 (d, IH), 7.99 (s, IH), 7.81 (d, IH), 7.68 (dd, IH), 7.50 (t, IH), 7.46 (d, IH), 7.34 (d, IH), 7.29 (dd, IH), 7.21 (br, IH), 7.12 (d, IH), 4.11 (br, 4H), 3.75 (m, 4H), 3.10 (t, 2H), 2.79 (t, 2H). LCMS: (FA) ES+ 600.26 (M+l). Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
(s, (dd, (FA)
Figure imgf000190_0001
Example 28: Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-[4-({2-[4- (hydroxynaethyl)-4,5-dihydro-lH-irnidazol-2-yl]pyridin-4- yl}oxy)phenyl]propanamide (A-243)
Figure imgf000190_0002
Step 1. Preparation of methyl 2-{4-[4-(3-{[4-cWoro-3-(trifluorornethyl)phenyl]arnin.o}-3- oxopropyl)phenoxy]pyridin-2-yl}-4,5-dihydro-lH-irnidazole-4-carboxylate
[0284] To a solution of A-142 (300 mg, 0.56 mmol) in MeOH (1.00 mL) were added a few drops of 6N HCl. The mixture was stirred at rt for 5 h. The solvents were evaporated and the residue was purified by chromatography (SiO2, 90:10:1 DMC:MeOH:H2O) to yield the title compound (107 mg, 35 %). LCMS: (FA) ES+ 547.1 (M+l), ES- 545.3 (M-I).
Step 2. Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-[4-({2-[4-
(hydroxyrnethyl)-4,5-dihydro-lH-irnidazol-2-yl]pyridin-4- yl}oxy)phenyl]propanamide (A-243)
[0285] To a solution of methyl 2-{4-[4-(3-{[4-chloro-3-(trifluoromethyl)phenyl]amino}-3- oxopropyl)phenoxy]pyridin-2-yl}-4,5-dihydro-lH-imidazole-4-carboxylate (107 mg, 0.20 mmol) in MeOH (2 mL), at 0 °C, was added sodium borohydride (8.0 mg, 0.22 mmol) portionwise. The reaction mixture was stirred at 0 °C for 45 min, and then warmed to rt and stirred for 18 h. After this time additional sodium borohydride (8.0 mg, 0.22 mmol) was added and the mixture was heated at 60 0C for 18 h. The reaction was then cooled to rt, and IN HCl was added. The Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
solvents were evaporated and the residue was purified by HPLC (250 mm C18 column) eluting with ACN containing 30 % to 100 % of 0.1 % FA in water (20 min gradient) to give A-243 (6.0 mg, 5.8 %). 1H NMR (300 MHz, CD3OD) δ: 8.55 (d, IH), 8.08 (d, IH), 7.76-7.72 (m, IH), 7.61 (d, IH), 7.53 (d, IH), 7.41-7.38 (m, 2H), 7.11-7.08 (m, 3H), 4.45-4.35 (m, IH), 4.06 (t, IH), 3.90-3.83 (m, IH), 3.74-3.61 (m, 2H), 3.06 (t, 2H), and 2.73 (t, 2H). LCMS: (FA) ES+ 519.1 (M+l).
[0286] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 28:
A-180 1H NMR (400 MHz, dβ-OMSO; bisHCl salt) δ: 11.41 (s, IH), 11.33 (s, IH), 10.67 (s, IH), 8.66 (d, IH), 8.20 (d, IH), 8.01 (d, IH), 7.84 (dd, IH), 7.63 (d, IH), 7.44 (t, IH), 7.26-7.21 (m, 2H), 7.15 (s, IH), 7.06 (dd, IH), 5.17 (dd, IH), 4.34-4.16 (m, 2H), 3.75 (s, 3H), 2.97 (t, 2H), and 2.72 (t, 2H). LCMS: (FA) ES+ 547.3 (M+l), ES- 545.4 (M-I).
A-178 1H NMR (300 MHz, CD3OD; HCOOH salt) δ: 8.54 (d, IH), 8.47 (s, IH), 8.04 (d, IH), 7.69 (dd, IH), 7.64 (d, IH), 7.51 (d, IH), 7.44 (t, IH), 7.26 (d, IH), 7.11-7.08 (m, 2H), 7.02 (dd, IH), 4.52-4.45 (m, IH), 4.13 (t, IH), 3.94 (dd, IH), 3.79-3.64 (m, 2H), 3.06 (t, 2H), and 2.73 (t, 2H). LCMS: (FA) ES+ 519.1 (M+l), ES- 517.0 (M-I).
Example 29: Preparation of 3-(3-{[2-(4,5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)- N-[4-(piperazin-l-ylcarbonyl)-3-(trifluoromethyl)phenyl]propanamide (A-69)
Figure imgf000191_0001
Step 1. Preparation of 4-{[3-(3-{[2~(4,5~dihydro-lH-imidazol-2-yl)pyridin-4-yl]- oxy}phenyl)propanoyl]arnino}-2-(trifluorornethyl)benzoic acid (A-19)
[0287] A-19 was prepared by refluxing A-216 (900 mg, 1.76 mmol) with lithium hydroxide (84.0 mg, 3.51 mmol) in THF (15 mL) and water (200 μL) for 72 h. The reaction mixture was concentrated and purified by reverse phase HPLC [water with 20% ACN Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
(contained 0.1% FA) to 100% ACN (contained 0.1% FA) over 25 mins]. 1H NMR (400 MHz, df DMSO) δ: 10.36 (s, IH), 8.47 (d, IH), 8.00 (s, IH), 7.75-7.63 (m, 2H), 7.50 (d, IH), 7.42 (t, IH), 7.22 (d, IH), 7.09-7.01 (m, 3H), 3.69 (s, 4H), 2.96 (t, 2H), and 2.68 (t, 2H). LCMS: (FA) ES+ 499.3 (M+l).
Step 2. Preparation of 3-(3-{[2-(4,5-dihydro-lH-imidazol-2-yl)pyridin-4-yl]oxy}phenyl)-
N-[4-(piperazrn-l-ylcarbonyl)-3-(trifluorornethyl)phenyl]propanarnide (A-69)
[0288] A-69 was prepared by treating A-19 (100 mg, 0.20 rnmol) with oxalyl chloride (60 μL, 0.66 mmol) and DMF ( 100 μL) in methylene chloride (3 mL) at rt. After stirring for 1 h, piperazine ( 125 mg, 1.45 mmol) was added. The reaction mixture was concentrated and purified by reverse phase HPLC [water with 5% ACN (contained 0.1% FA) to 100% ACN (contained 0.1% FA) over 25 mins]. 1H NMR (400 MHz, CD3OD; HCl salt) δ: 8.55 (d, IH), 8.06 (s, IH), 7.80 (dd, IH), 7.62 (d, IH), 7.45-7.39 (m, 2H), 7.26 (d, IH), 7.12-7.08 (m, 2H), 7.01 (dd, IH), 4.08 (s, 4H), 3.94-3.80 (m, 2H), 3.40-3.32 (m, 2H), 3.18-3.11 (m, 2H), 3.07 (t, 2H), 3.02-2.90 (m, 2H), and 2.75 (t, 2H). LCMS: (FA) ES+ 567.0 (M+l).
[0289] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 29:
A-65 H NMR (400 MHz, CD3OD) δ: 8.51 (d, IH), 8.04 (s, IH), 7.77 (dd, IH), 7.61 (d, IH), 7.42 (t, IH), 7.32 (d, IH), 7.25 (d, IH), 7.09-7.07 (m, 2H), 7.02-6.99 (m, IH),
-,+ 4.03 (s, 4H), 3.09-3.05 (m, 5H), 2.81 (s, 3H), and 2.74 (t, 2H). LCMS: (FA) ES+ 526.3 (M+l).
A-159 1H NMR (400 MHz, CD3OD) δ: 8.44 (t, 2H), 7.81 (d, IH), 7.58-7.54 (m, 2H), 7.44 (t, IH), 7.38 (d, IH), 7.26 (d, IH), 7.05-7.00 (m, 3H), 4.07 (s, 4H), 3.09-3.01 (m, 4H), 2.71 (t, 2H), 2.52 (t, 2H). LCMS: (AA) ES+ 527.29 (M+l), ES- 525.39 (M-I).
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Example 30: Preparation of 3-(3-{[2-(4/5-dihydro-lH-irrιidazol-2-yl)pyridin-4-yl]oxy}pherιyl)- N-[3-[3-(dime&ylamino)propyl]-5-(trifluorornethyl)phenyl]propanarrdd^ (A-165)
Figure imgf000193_0001
Step 1. Preparation of 3-{3-[(2-cyanopyridin-4-yl)oxy]phenyl}-N-[3-[3- (drniethylarnino)prop-l-yn-l-yl]-5-(trifluorornethyl)phenyl-]propanarnide
[0290] A solution of N-[3-bromo-5-(trifluoromethyl)phenyl]-3-{3-[(2-cyanopyridin-4- yl)oxy]phenyl}propanamide (prepared following the procedures described in Example 11, 0.500 g, 1.02 mmol), TEA (569 μL, 4.08 mmol), and copper iodide (19.0 mg, 0.10 mmol) in DMF (3 mL) was degassed for 15 min. To this solution was added l-dimethylamino-2-propyne (240 μL, 4.08 mmol) and the reaction degassed for an additional minute. Dichlorobis(triphenylphosphine)- palladium(II) (36 mg, 0.05 mmol) was added to the reaction mixture and the reaction heated at 60 0C for 6 h. The crude reaction mixture was purified by column chromatography to give the title compound. LCMS: (FA) ES+ 493.1 (M+l), ES" 491.1 (M-I).
Step 2. Preparation of 3-(3-{[2-(4,5-dihydro-lH-imidazol-2-yl)pyridrn-4-yl]oxy}phenyl)-
N-[3-[3-(dirnemylarnino)prop-l-yn-l-yl]-5-(trifluoromethyl)phenyl]propanarnide (A-193)
[0291] A-193 was prepared from 3-{3-[(2-cyanopyridin-4-yl)oxy]phenyl}-]Sf-[3-[3-
(dimemylarnino)prop-l-yn-l-yl]-5-(trifluoromethyl)phenyl-]propanamide following the procedures described in Example 13. 1H NMR (300 MHz, CD3OD) δ: 8.37 (d, IH), 7.88 (s, IH), Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
7.79 (S/ IH), 7.47 (d, IH), 7.42-7.37 (m, 2H), 7.20 (d, IH), 7.06 (t, IH), 6.99-6.93 (m, 2H), 3.74 (s, 4H), 3.50 (s, 2H), 3.04 (t, 2H), 2.70 (t, 2H), and 2.37 (s, 6H). LCMS: (FA) ES+ 536.3 (M+l), ES' 534.4 (M-I).
Step 3. Preparation of 3-(3-{[2-(4,5-dihydro-lH-irnidazol-2-yl)pyridin-4-yl]oxy}phenyl)-
N-[3-[3-(dimettιylamino)propyl]-5-(trifluorornethyl)phenyl]propanarnide (A-165)
[0292] A-196 (247 mg, 0.46 rnmol) was dissolved in MeOH (10 mL) and the reaction mixture was degassed. Under argon, Pd (5 wt. % on activated carbon, 10 mol %) was added to the reaction mixture which was then stirred under an atmosphere of hydrogen at rt. The reaction was filtered through Celite and the solvent was evaporated to give A-165. 1H NMR (400 MHz, CD3OD) δ: 8.34 (d, IH), 7.75 (s, IH), 7.54 (s, IH), 7.49 (d, IH), 7.39 (t, IH), 7.21-7.20 (m, 2H), 7.05 (s, IH), 6.-98-6.92 (m, 2H), 3.75 (s, 4H), 3.05 (t, 2H), 2.71-2.63 (m, 4H), 2.35-2.29 (m, 2H), 2.23 (s, 6H), 1.83-1.75 (m, 2H), and 2.23 (s, 6H). LCMS: (FA) ES+ 540.4 (M+l), ES" 538.5 (M- I)-
[0293] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 30:
A-144 1HNMR (400 MHz, CD3OD) δ: 7.94 (d, IH), 7.55 (d, IH), 7.25 (dd, IH), 7.13 (d, IH), 7.04 (d, IH), 6.96 (t, IH), 6.76 (d, IH), 6.65 (t, IH), 6.55-6.50 (m, 2H), 4.5 (s, 4H), 2.92 (s, IH), 2.89-2.87 (m, 2H), 2.61 (t, 2H), 2.28 (t, 2H). LCMS: (FA) ES+ 479.2 (M+l), ES- 477.3 (M-I).
A-63 1H NMR (400 MHz, CD3OD) δ: 8.41 (d, IH), 7.96 (d, IH), 7.67 (dd, IH), 7.53 (d, IH), 7.49 (d, IH), 7.41 (t, IH), 7.22 (d, IH), 7.07 (t, IH), 7.00-6.97 (m, 2H), 4.41 (s, 2H), 3.81 (s, 4H), 3.06 (t, 2H), 2.72 (t, 2H). LCMS: (FA) ES+ 509.2 (M+l), ES- 507.2 (M-I).
A-145 1H NMR (400 MHz, CD3OD) δ: 8.4 (d, IH), 7.86 (s, IH), 7.62 (d, IH), 7.5 (s, IH), 7.39 (t, IH), 7.32 (d, IH), 7.21 (d, IH), 7.05 (s, IH), 6.96 (s, 2H), 3.83 (s, 4H), 3.6 (t, 2H), 3.04 (t, 2H), 2.79 (t, 2H), 2.69 (t, 2H). LCMS: (FA) ES+ 513.8 (M+l), ES- 511.3 (M-I).
A-66 H NMR (400 MHz, CD3OD) δ: 8.3 (d, IH), 7.98 (d, IH), 7.68 (dd, IH), 7.51 (d, IH), 7.46 (d, IH), 7.37 (t, IH), 7.2 (d, IH), 7.03 (t, IH), 6.96-6.92 (m, 2H), 3.73 (s, 4H), 3.52 (s, 2H), 3.02 (t, 2H), 2.69 (t, 2H), 2.36 (s, 6H). LCMS: (FA) ES+ 536.0 (M+l), ES- 534.3 (M-I). Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
A-244 1H NMR (400 MHz, CD3OD) δ: 8.34 (d, IH), 7.89 (s, IH), 7.65 (d, IH), 7.47 (s, IH), 7.38-7.31 (m, 2H), 7.18 (d, IH), 7.03 (s, IH), 6.96-6.89 (m, 2H), 3.72 (s, 4H), 3..02 (t, 2H), 2.68 (q, 4H), 2.36 (t, 2H), 2.22 (s, 6H), 1.78-1.72 (m, 2H). LCMS: (FA) ES+ 540.0 (M+l), ES- 538.3 (M-I).
A-265 1H NMR (400 MHz, CD3OD; HCl salt) δ: 8.37 (d, IH), 7.85 (t, IH), 7.62 (dd, IH), 7.48 (d, IH), 7.39 (t, IH), 7.33 (d, IH), 7.22 (d, IH), 7.06 (s, IH), 6.99-6.93 (m, 2H), 3.75 (s, 4H), 3.04 (t, 2H), 2.75 (dd, 2H), 2.69 (t, 2H), 1.21 (t, 3H). LCMS: (FA) ES+ 483.2 (M+l), ES- 481.1 (M-I).
A-234 1H NMR (400 MHz, CD3OD) δ: 8.38 (d, IH), 7.88 (d, IH), 7.62 (dd, IH), 7.49 (d, IH), 7.4 (t, IH), 7.35 (d, IH), 7.23 (d, IH), 7.06 (t, IH), 7 (dd, IH), 6.97-6.95 (m, IH), 3.81 (s, 4H), 3.67 (s, 3H), 3.07-3.01 (m, 4H), 2.69 (t, 2H), 2.6 (t, 2H). LCMS: (FA) ES+ 541.4 (M+l), ES- 539.4 (M-I).
Example 31: Preparation of 3-{3-[(2-aminopyridin-4-yl)oxy]phenyl}-N-(3-fe?f- butylphenyl)propanamide (A-261)
Figure imgf000195_0001
Step 1. Preparation of tert-butyl 4-[3-(3-methoxy-3-oxopropyl)phenoxy]pyridine-2- carboxylate
[0294] To a solution of 3-(3-{[2-(ferf-butoxycarbonyl)pyridin-4-yl]oxy}phenyl)propanoic acid (prepared from tert-butyl 4-chloropyridine-2-carboxylate using the procedure described for Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Example 8, Step 1, 1.13 g, 32.9 mmol), in MeOH (15 mL) and toluene (15 mL) was added a 2.0M solution of trimethylsilyldiazomethane in hexane (3.29 mL, 65.8 mmol) dropwise. The mixture was stirred for 2 h. The solvents were evaporated and the residue was dissolved in EtOAc, washed with sat. NaHCO3 solution and brine, dried (Na2SO4) and evaporated. The residue was purified by column chromatography to yield the title compound (779 mg, 66.2 %). LCMS: (FA) ES+ 358.3 (M+l), 302.2 (-tBu).
Step 2. Preparation of 4-[3-(3-methoxy-3-oxopropyl)phenoxy]pyridine-2-carboxylic acid
[0295] A solution of fert-butyl 4-[3-(3-methoxy-3-oxopropyl)phenoxy]pyridine-2- carboxylate (779 mg, 2.18 mmol) in 4N HCl -dioxane (10 mL) was stirred for 18 h. The solvents were evaporated to yield the title compound as the HCl salt. (780 mg, 100 %). LCMS: (FA) ES+ 302.0 (M+l).
Step 3. Preparation of methyl 3-[3-({2-[(ferf-butoxycarbonyl)amino]pyridin-4- yl}oxy)phenyl]propanoate
[0296] To a solution of 4-[3-(3-methoxy-3-oxopropyl)phenoxy]pyridine-2-carboxylic acid (736 mg, 2.18 mmol) in THF (20 mL) at 0 0C, was added TEA (1.09 mL, 7.84 mmol) then diphenylphosphonic azide (610 μL, 2.83 mmol) dropwise. The reaction was stirred at 0 0C for 10 min and then allowed to warm to rt. After 2 h, the solvents were evaporated and the residue was taken up in EtOAc, washed with sat. NaHCO3 solution, then brine, dried (Na2SO4), and evaporated. 2-methylpropan-2-ol (10.0 mL) was added and the solution was heated at 85 0C for 40 min, and then allowed to cool to rt. The solvents were evaporated and the residue was purified by chromatography to yield the title compound as an oil (427 mg, 52.6 %). LCMS: (FA) ES+ 327.1 (M+l).
Step 4. Preparation of 3-[3-({2-[(terf-butoxycarbonyl)amino]pyridin-4- yl}oxy)phenyl]propanoic acid
[0297] To a solution of methyl 3-[3-({2-[(ferf-butoxycarbonyl)amino]pyridin-4- yl}oxy)phenyl]propanoate (427 mg, 1.15 mmol) in MeOH (10 mL) and THF (5 mL), was added IM NaOH solution (4.59 mL, 4.49 mmol). The reaction was stirred for 18 h. The solvents were evaporated and the residue was dissolved in water. The solution was acidified to pH=3 by addition of IN HCl. The precipitate was filtered off and washed with water and then hexane, Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
then dried under vacuum to yield the title compound as a white solid (333 mg, 81 %). LCMS: (FA) ES+ 359.1 (M+l), ES" 357.0 (M-I).
Step 5. Preparation of tert-butyl [4-(3-{3-[(3~tert-butylphenyl)amino]-3- oxopropyl}phenoxy)pyridin-2-yl]carbamate
[0298] To a solution of 3-[3-({2-[(førf-butoxycarbonyl)amino]pyridin-4- yl}oxy)phenyl]propanoic acid (333 mg, 0.93 mmol) in DCM (10 mL), were added 3-tert- butylaniline (152 mg, 1.02 mmol), DMAP (125 mg, 1.02 mmol) and then EDCI (196 mg, 1.02 mmol). The reaction was stirred for 18 h., and then diluted with DCM and washed with water and brine. The organic solution was dried over Na2SO4, filtered and concentrated. The residue was purified by column chromatography to yield the title compound as a white solid (389 mg, 86 %). LCMS: (FA) ES+ 490.2 (M+l), ES" 488.2 (M-I).
Step 6. Preparation of 3-{3-[(2-aminopyridin-4-yl)oxy]phenyl}-N-(3-ferf- butylphenyl)propanamide (A-261)
[0299] A solution of tert-hutyl [4-(3-{3-[(3-tert-butylphenyl)amino]-3- oxopropyl}phenoxy)pyridin-2-yl]carbamate (389 mg, 0.79 mmol) in 4M HCl-dioxane (10 mL) was stirred under nitrogen for 18 h. The solvents were evaporated to yield A-261 as the HCl salt (341 mg, 100 %). 1H NMR (400 MHz, .Z6-DMSO; HCl salt) δ: 9.92 (s, IH), 7.91 (d, IH), 7.78 (s, 2H), 7.53 (t, IH), 7.46 (t, 2H), 7.27 (d, IH), 7.21-7.15 (m, 2H), 7.07 (dd, 2H), 6.60 (dd, IH), 6.09 (d, IH), 2.96 (t, 2H), 2.64 (t, 2H), and 1.24 (s, 9H). LCMS: (FA) ES+ 390.16 (M+l), ES- 388.12 (M-I). LCMS: (FA) ES+ 390.2 (M+l), ES" 388.1 (M-I).
[0300] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 31:
A-77 1H NMR (300 MHz, CD3OD) δ: 8.02 (m, 2H), 7.69 (dd, IH), 7.44 (m, 2H), 7.34 (t, IH), 7.13 (dd, IH), 7.03 (br, IH), 6.93 (dd, IH), 6.47 (dd, IH), 3.02 (t, 2H), 2.70 (t, 2H), and 1.45 (s, 9H). LCMS: (FA) ES+ 536.21 (M+l).
A-92 1H NMR (400 MHz, CD3OD) δ: 8.04 (d, IH), 7.71 (dd, IH), 7.69 (d, IH), 7.46 (d, IH), 7.33 (t, IH), 7.13 (d, IH), 7.00 (m, IH), 6.91 (m, IH), 6.14 (dd, IH), 5.99 (d, IH), 3.01 (t, 2H), and 2.70 (t, 2H). LCMS: (FA) ES+ 436.11 (M+l). Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Example 32: Preparation of 3-(3-{[2-(acetylamino)pyridin-4-yl]oxy}phenyl)-N-[3-[2-
(dirnethylamino)ethoxy]-5-(1τifluoromethyl)phenyl]propanamide (A-211)
Figure imgf000198_0001
Step 1. Preparation of methyl 3-{3-[(2-aminopyridin-4-yl)oxy]phenyl}propanoate
[0301] Methyl 3-[3-({2-[(ferf-butoxycarbonyl)amino]pyridin-4-yl}oxy)phenyl]propanoate
(960 mg, 0.25 mmol), trifluoroacetic acid (5.00 mL) and few drops of water were stirred for 3.5 h. at rt. The reaction mixture was concentrated and purified by column chromatography to give the title compound as white solid (790 mg, 100 %). LCMS: (FA) ES+ 273.3 (M+l)
Step 2. Preparation of methyl 3-(3-{[2-(acetylamino)pyridin-4-yl]oxy}phenyl)-propanoate
[0302] Methyl 3-{3-[(2-arninopyridin-4-yl)oxy]phenyl}propanoate (390 mg, 0.14 mmol) was dissolved in pyridine (5 mL) and the reaction mixture was cooled at 0 °C and stirred for Ih. Acetic anhydride (135 μL, 0.14 mmol) was added dropwise and the reaction mixture was allowed to stir for Ih. The reaction mixture was allowed to warm to rt and to stir overnight. The reaction was quenched with water and extracted with EtOAc. The organic solutions were dried (MgSO4), filtered and concentrated. The residue was purified column chromatography to give the title compound (340 mg, 76 %) as a white solid. LCMS: (FA) ES+ 315.29 (M+l).
Step 3. Preparation of 3-(3-{[2-(acetylamino)pyridin-4-yl]oxy}phenyl)propanoic acid
[0303] To a solution of methyl 3-(3-{[2-(acetylamino)pyridin-4-yl]oxy}phenyl)- propanoate (184 mg, 0.59 mmol) in MeOH (5 mL) was added IN NaOH solution (702 μL, 0.70 mmol). The reaction was stirred forlδ h. The solvents were evaporated and the residue was dissolved in water and acidified to pH=l by addition of IN HCl solution. The precipitate was Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
filtered off and washed with water then hexane and dried tinder vacuum to yield the title compound as a white solid (112 mg, 63.7 %). LCMS: (FA) ES+ 301.2 (M+l), ES- 299.3 (M-I).
Step 4. Preparation of 3-(3-{[2-(acetylarnino)pyridin-4-yl]oxy}phenyl)-N-[3-[2-
(diniemylamino)ethoxy]-5-(trifluoromethyl)phenyl]propanamide (A-211)
[0304] A-211 was prepared from 3-(3-{[2-(acetylamino)pyridin-4- yl]oxy}phenyl)propanoic acid, using the procedure described in Example 9. The HCl salt was prepared by dissolving the compound in DCM/MeOH and adding IM HCl in Et2O, and immediately evaporating the solvents. 1H NMR (400 MHz, d6 DMSO) δ: 10.49 (s, IH), 10.27 (br s, IH), 8.18 (d, IH), 7.59 (d, 2H), 7.41 (t, 2H), 7.22 (d, IH), 7.12 (s, IH), 7.03 (dd, IH), 6.98 (s, IH), 6.79-6.76 (1, mH), 4.38 (t, 2H), 3.52-3.48 (m, 2H), 2.95 (t, 2H), 2.83 (s, 3H), 2.82 (s, 3H), 2.69 (t, 2H), and 2.08 (s, 3H). LCMS: (FA) ES+ 531.2 (M+l).
[0305] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 32:
7.22
Figure imgf000199_0001
Example 33: Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-{3-[(2-{[(4- ethylpiperazm-l-yl)acetyl]amino}pyridin-4-yl)oxy]phenyl}propanarnide (A-192)
Figure imgf000199_0002
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Step 1. Preparation of 3-[3-({2-[(cWoroacetyl)arnino]pyridin-4-yl}oxy)phenyl]-N-[4- chloro-3-(trifluoromethyl)phenyl]-propanarnide
[0306] To a solution of A-92 (0.100 g, 0.22 mmol) and TEA (0.020 mL, 0.25 mmol) in THF
(5 mL) was added 2-chloroacetyl chloride (0.060 mL, 0.44 mmol). The reaction mixture was allowed to stir for 15 min at rt and then concentrated. The residue was redissolved in EtOAc, washed with water and brine, dried over Na2SO4, filtered, and concentrated. The resulting oil was purified by column chromatography to give the title compound as a white solid.
Step 2. Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-{3-[(2-{[(4- ethylpiperazm-l-yl)acetyl]amino}pyridin-4-yl)oxy]phenyl}propanamide (A-192)
[0307] A mixture of 3-[3-({2-[(cWoroacetyl)amino]pyridin-4-yl}oxy)phenyl]-]V-[4-chloro-
3-(trifluoromethyl)phenyl]-propanamide (0.050 g, 0.090 mmol), 1-ethylpiperazine (0.040 mL, 0.29 mmol), and K2CO3 (0.050 g, 0.36 mmol) was stirred at 600C in DMF for 1 h. The mixture was concentrated and partitioned between EtOAc and water. The organic solution was concentrated and the residue was purified by column chromatography to give A-192. H NMR (400 MHz, ^6-DMSO) δ: 10.98 (m, IH), 10.60 (m, IH), 8.21 (m, 2H), 7.83 (dd, IH), 7.63 (d, IH), 7.60 (m, IH), 7.41 (t, IH), 7.21 (d, IH), 7.10 (m, IH), 7.01 (m, IH), 6.75 (dd, IH), 4.85 (br, 6H), 3.84 (br, IH), 3.39 (br, IH), 3.22 (br, 2H), 3.13 (m, 2H), 2.95 (t, 2H), 2.70 (t, 2H), and 1.23 (t, 3H). LCMS: (FA) ES+ 590.3 (M+l).
[0308] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 33:
A-20 1H (400MHz, ^6-DMSO; HCl salt) δ: 9.86 (s, IH), 8.15 (d, IH), 7.51 (t, IH), 7.44- 7.33 (m, 3H), 7.22-7.16 (m, 2H), 7.1 (t, IH), 7.05-7.01 (m, 2H), 6.78-6.75 (m, IH), 2.94 (t, 2H), 2.62 (t, 2H), 1.97-1.9 (m, IH), 1.23 (s, 9H), and 0.86-0.81 (m, 4H). LCMS: (FA) ES+ 458.86 (M+l), ES- 456.3 (M-I).
A-183 1H NMR (300 MHz, CD3OD) δ: 8.01-8.0 (m, 2H), 7.71 (dd, IH), 7.48 (dd, IH), 7.36 (dd, IH), 7.16 (dd, IH), 7.04 (s, IH), 6.95 (dd, IH), 6.58 (dd, IH), 3.03 (dd, 2H), 2.69 (dd, 2H), and 2.11 (s, 3H). LCMS: (FA) ES+ 478.28 (M+l), ES- 476.19 (M-I).
A-98 1H NMR (300 MHz, CD3OD) δ: 8.05 (d, IH), 8.02 (d, IH), 7.67 (dd, IH), 7.63 (d, IH), 7.48 (d, IH), 7.35 (dd, IH), 7.17 (d, IH), 7.03 (dd, IH), 6.95 (dd, IH), 6.58 (dd, IH), 3.02 (dd, 2H), 2.69 (dd, 2H), 1.78-1.87 (m, IH), and 0.80-0.95 (m, 4H). LCMS: (FA) ES+ 504.3 (M+l), ES- 502.2 (M-I). Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Example 34: Preparation of ethyl 2-{4-[3-(3-{[4-ciιloro-3-(trifluoromerhyl)-phenyl]amino}-3- oxopropyl)phenoxy]pyridin-2-yl}-lH-rmidazole-5-carboxylate (A-110)
Figure imgf000201_0001
[0309] To a solution of A-113 (450 mg, 0.847 mmol) in ethanol (4 mL) was added IN
NaOH (5 mL) dropwise. The solution stirred at 70 0C for 10 h and then extracted with EtOAc. The organic solutions were combined, washed with IN HCl, dried over MgSO4, filtered and concentrated. The residue was purified by column chromatography (1% NH4OH/DCM containing 0-10% MeOH) to give A-110 (10 mg, 2%). 1H NMR (300 MHz, CD3OD) δ: 8.41 (d, IH), 7.99 (d, IH), 7.80 (s, IH), 7.64 (dd, IH), 7.59 (s, IH), 7.37-7.43 (m, IH), 7.21 (d, 2H), 7.07 (dd, IH), 7.00 (dd, IH), 6.89 (dd, IH), 4.32 (dd, IH), 3.05 (dd, 2H), 2.71 (dd, 22H), and 1.35 (dd, 3H). LCMS: (FA) ES+ 559.3 (M+l), ES- 557.3 (M-I).
Example 35: Preparation of isobutyl {4-[3-(3-{[4-chloro-3-(trifluoromethyl)-phenyl]amino}-3- oxopropyl)phenoxy]pyridin-2-yl}carbamate (A-221)
Figure imgf000201_0002
[0310] A solution of 4-[3-(3-{[4-chloro-3-(trifluoromethyl)phenyl]amino}-3- oxopropyl)phenoxy]pyridine-2-carboxylic acid (8.0 mmol) in THF (66 mL) was cooled to 0 0C. TEA (2.8 mL, 19.9 mmol) was added, followed by isobutylchloroformate (1.04 mL, 8.0 mmole) and the solution was allowed to stir for 1 h at 0 °C. The reaction mixture was concentrated, diluted with DCM, washed with sat. NaHCO3 extracted with DCM, washed with brine, dried over NaSO4, filtered, and concentrated. The residue was redissolved in toluene (30 mL) and t- butanol (1.3 mL, 13.9 mmol) was added. The solution was heated to 100 °C for 1.5 h and then Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
cooled to rt. The solution was diluted with DCM, washed with NaHCO3 and brine, dried over MgSO4, filtered and concentrated. The residue was purified by column chromatography (hexane/ethyl EtOAc) to give A-221 (600 mg, 17 %). 1H NMR (300 MHz, CD3OD) δ: 8.02-8.07 (m, 2H), 7.69 (dd, IH), 7.49 (dd, IH), 7.40 (dd, IH), 7.19-7.24 (m, 2H), 7.07 (dd, IH), 6.99 (dd, IH), 6.66 (dd, IH), 3.91 (dd, 2H), 3.04 (dd, 2H), 2.71 (dd, 2H), 1.94 (ddd, IH), and 0.94 (d, 6H). LCMS: (FA) ES+ 536.3 (M+l), ES- 534.2 (M-I).
Example 36: Preparation of methyl 2-{4-[3-(3-{[4-chloro-3-(trifluoromethyl)phenyl]amino}-3- oxopropyl)phenoxy]pyridin-2-yl}-lH-imidazole-5-carboxylate (A-170)
Figure imgf000202_0001
[0311] To a solution of A-180 (0.190 g, 0.36 mmol) in DCM (4 mL) was added activated
MnO2 (0.364 g, 3.6 mmol). The reaction mixture was allowed to stir for 72 h and then filtered through Celite and concentrated. The residue was purified by column chromatography to give A-170 (35 mg, 18%).
[0312] 1H NMR (300 MHz, d6 DMSO; HCl salt) δ: 7.00 (d, IH), 6.54 (s, IH), 6.46 (d, IH),
6.21 (d, IH), 6.11 (dd, IH), 5.86-5.96 (m, 2H), 5.76 (d, IH), 5.64 (dd, IH), 5.61 (dd, IH), 5.54 (dd, IH), 2.38 (s, 3H), 1.51 (dd, 2H), and 1.21 (dd, 2H). LCMS: (FA) ES+ 546.2 (M+l), ES- 543.2 (M-I).
Example 37: Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-(3-{[2-(lH-imidazol-2- yl)pyridin-4-yl]oxy}phenyl)propanamide (A-105)
BaMnO4
Figure imgf000202_0002
Figure imgf000202_0003
[0313] To a solution of A-55 (66 mg, 0.13 mmol) in DCM (5 mL) of was added BaMnO4
(600 mg). The solution was allowed to stir for 15 h at 80 °C and then filtered through Celite Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
and concentrated. The residue was purified by reversed phase HPLC (formic in acetonitrile/water) to give A-105 (15 mg, 23%). 1H NMR (300 MHz, CD3OD) δ: 8.42 (d, IH), 8.14 (s, IH), 7.77 (dd, IH), 7.60 (d, IH), 7.42 (dd, IH), 7.37 (d, IH), 7.20 (d, IH), 7.19 (dd, IH), 7.13 (dd, IH), 7.05 (dd, IH), 6.98 (s, IH), 6.91 (dd, IH), 2.97 (dd, 2H), and 2.69 (dd, 2H). LCMS: (FA) ES+ 487.90 (M+l), ES- 484.99 (M-I).
Example 38: Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-[4-Xpyridin-4- ylmethyl)phenyl]propanamide (A-84)
Figure imgf000203_0001
Figure imgf000203_0002
Step 1. Preparation of 4-(pyridin-4-ylmethyl)aniline
[0314] To a solution of 4-(4-nitrobenzyl)pyridine (2.0 g, 9.3 mmol) in MeOH (93 mL) was added Pd on carbon (10% by wt, 0.20 g). The reaction mixture was placed under an atmosphere of hydrogen and allowed to stir for 12 h at rt. The reaction mixture was filtered through Celite and the filtrate concentrated to give the title compound (1.73 g, 100 %). LCMS: (FA) ES+ 185.1 (M+l)
Step 2. Preparation of 4-(4-iodobenzyl)pyridine
[0315] A solution of 4-(pyridin-4-ylmethyl)aniline (679 mg, 3.7 mmol) in acetic acid (1.84 mL) and concentrated hydrochloric acid (0.787 mL) was cooled to 00C. NaNO2 (280 mg, 40.7 mmol) in water (1.23 mL) was added dropwise and the reaction mixture was allowed to stir for 30 min. A solution of KI (737 mg, 4.44 mmol) and iodine (563 mg, 2.22 mmole) in water (3.7 mL) was added dropwise to the above solution. The solution stirred for 30 min at 0°C and for 1 h at rt. The reaction was quenched by the addition of aq. NaS2O4 and the solution was extracted with EtOAc. The combined organic solutions were washed with sat. NaHCO3, brine and 1 % Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
NaOH, dried over MgSO4, filtered and concentrated. The residue was purified by column chromatography to give the title compound (140 mg, 18%). LCMS: (FA) ES+ 296.1 (M+l).
Step 3. Preparation of (2£)-N-[4-chloro-3-(trifluoromethyl)phenyl]-3-[4-(pyridin-4- ylmethyl)phenyl]acrylamide
[0316] A mixture of 4-(4-iodobenzyl)pyridine (129 mg, 0.44 mmol), TEA (67 μL, 0.48 mmol), Pd(PPh3)4 (254 mg, 0.222 mmol) and N-[4-chloro-3-(trifluoromethyl)-phenyl]acrylamide (0.120 g, 0.44 mmol) in DMF (4.4 mL) was heated at 95 °C for 3 h. The reaction mixture was cooled to rt, diluted with water, extracted with EtOAc, washed with brine, dried over NaSO4, filtered and concentrated. The residue was purified by column chromatography to give the title compound (161 mg, 40%). LCMS: (FA) ES+ 417.2 (M+l).
Step 4. Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-[4-(pyridin-4- ylmethyl)phenyl]propanamide (A-84)
[0317] To a solution of (2E)-N-[4-chloro-3-(trifluoromethyl)phenyl]-3-[4-(pyridin-4- ylmethyl)phenyl]acrylamide (70 mg, 0.17 mmol) in MeOH (2 mL) and EtOAc (2 mL) was added Pd/C (10 wt%, 20 mg). The mixture was stirred under hydrogen (60 psi) for 18 h and then filtrated through Celite. The filtrate was concentrated and purified by column, chromatography to give A-84 (28 mg, 41 %). 1H NMR (300 MHz, CD3OD) δ: 8.35 (d, 2H), 8.03 (d, IH), 7.70 (dd, IH), 7.48 (d, IH), 7.10-7.24 (m, 6H), 3.96 (s, 2H), 2.97 (dd, 2H), and 2.65 (dd, 2H). LCMS: (FA) ES+ 419.2 (M+l), ES- 417.2 (M-I).
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Example 39: Preparation of (£)-3-(3-(2-(4, 5-diliydro-lH-imidazol-2-yl)pyridin-4-yloxy)phenyl)- N-(3-isopropylphenyl)acrylamide (B-2)
Figure imgf000205_0001
Step 1. Preparation of (£)-N-(3-isopropylphenyl)-3-(3-rnethoxyphenyl)acrylarriide
[0318] To a solution of (E)-3-(3-methoxyphenyl)acrylic acid (1.50 g, 8.30 mmol) in DCM
(80 mL) under an atmosphere of argon was added oxalyl chloride (1.45 mL, 16.6 mmol) at rt. The reaction was allowed to stir at rt for 2 h and then concentrated. The residue was dissolved in DCM (80 mL). To this solution were added 3-isopropyl-benzenamine (1.24 g, 9.2 mmol) and TEA (2.31 mL, 16.6 mmol). The reaction was allowed to stir at rt for 15 min and then quenched by the addition of water. The mixture was extracted with DCM and the organic solutions were combined, washed with water and brine, dried over Na2SO4, filtered, and concentrated to give the desired amide which was used without further purification. H NMR (400 MHz, CDCl3): δ 7.71 (d, J= 15.2 Hz, IH), 7.64-7.69 (m, IH), 7.51-7.58 (m, IH), 7.44-7.50 (m, IH), 7.20-7.31 (m, IH), 7.11 (d, J = 7.6 Hz, IH), 6.99-7.05 (m, 2H), 6.89-6.93 (m, IH), 6.60 (d, J = 15.6 Hz, IH), 3.82 (s, 3H), 2.90 (sept, / = 7.2 Hz, IH), and 1.24 (t, J = 7.2 Hz, 6H).
Step 2. Preparation of (£)-3-(3-hydroxyphenyl)-N-(3-isopropylphenyl)acrylamide
[0319] A solution of (£)-N-(3-isopropylphenyl)-3-(3-methoxyphenyl)acrylamide (8.30 mmol) in DCM (50 mL) was cooled to 0 0C under an atmosphere of argon. To this solution was added boron tribromide (IM in DCM, 16.5 mL). The reaction mixture was allowed to come to rt and stir for 2 hr before being quenched by the addition of water. The mixture was extracted Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
with EtOAc and the combined organic solutions were washed with water and brine, dried over Na2SO4, filtered, and concentrated. The residue was triturated with DCM and filtered to give the desired phenol (1.22 g, 52% for 2 steps).
Step 3. Preparation of (E)-3-(3-(2-(4,5-dihydro-lH-imidazol-2-yl)pyridin-4- yloxy)phenyl)-N-(3-isopropylphenyl)acrylamide (B-2)
[0320] To a solution of (E)-3-(3-hydroxyphenyl)-N-(3-isopropylphenyl)acrylamide (3.20 mmol) in DMF (40 mL) was added 4-chloro-2-(4,5-dihydro-lH-imidazol-2-yl)pyridine (11.2 rrunol) and cesium carbonate (16.0 mmol). The heterogeneous mixture was heated at 100 0C for 18 h and then cooled to rt. The mixture was diluted with water and extracted with EtOAc. The combined organic solutions were washed with water and brine, dried over Na2SO4, filtered, and concentrated. The residue was purified by column chromatography (90:10:1 DCM:MeOH:NH4OH) to give B-2. 1H NMR (300 MHz, d6-DMSO): δ 10.13 (s, IH), 8.52 (d, J = 5.6 Hz, IH), 7.56-7.61 (m, 3H), 7.50-7.54 (m, 2H), 7.44-7.47 (m, IH), 7.41 (d, J = 2.8 Hz, IH), 7.20-7.29 (m, 2H), 7.17 (dd, / = 6.8, 2.8 Hz, IH), 6.93-6.99 (m, 2H), 6.85 (d, / = 15.6 Hz, IH), 3.32 (s, 4H), 2.85 (sept, / = 6.8 Hz, IH), and 1.18 (d, / = 7.2 Hz, 6H).
[0321] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 39:
B-7 1H NMR (400 MHz, 6-DMSO): δ 10.56 (s, IH), 8.52 (d, / = 5.6 Hz, IH), 8.18 (br s, IH), 7.81-7.89 (m, IH), 7.53-7.70 (m, 4H), 7.39-7.52 (m, 2H), 7.24-7.33 (m, IH), 7.15-7.21 (m, IH), 6.82 (d, / = 15.6 Hz, IH), and 3.59 (s, 4H).
B-9 1H NMR (400 MHz, dfOMSO): δ 10.76 (s, IH), 8.54 (d, / = 5.6 Hz, IH), 8.17 (br s, IH), 7.84-7.84 (m, 2H), 7.57-7.70 (m, 2H), 7.50-7.52 (m, IH), 7.44 (d, / = 2.4 Hz, IH), 7.36-7.40 (m, IH), 7.27-7.31 (m, IH), 7.19 (dd, / = 5.6, 2.4 Hz, IH), 6.80 (d, / = 15.6 Hz, IH), and 3.61 (s, 4H).
B-13 1H NMR (400 MHz, ^6-DMSO): δ 10.34 (s, IH), 8.52 (d, / = 6.0 Hz, IH), 7.66-7.75 (m, 2H), 7.54-7.65 (m, 3H), 7.34-7.49 (m, 4H), 7.24-7.29 (m, IH), 7.17 (dd, / = 5.6, 2.4 Hz, IH), 6.83 (d, / = 15.6 Hz, IH), and 3.59 (s, 4H).
B-14 1H NMR (400 MHz, CDCl3): δ 10.33 (br s, IH), 8.45 (d, / = 5.7 Hz, IH), 7.93 (d, / = 2.7 Hz, IH), 7.80 (dd, / = 8.7, 2.4 Hz, IH), 7.54 (d, / = 15.6 Hz, IH), 7.34-7.39 (m, 2H), 7.15-7.24 (m, 2H), 7.02 (dd, / = 5.7, 2.4 Hz, IH), 6.94-6.97 (m, IH), 6.86-6.91 (m, IH), 6.38 (d, / = 15.6 Hz, IH), and 3.78 (s, 4H). Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000207_0001
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Example 40: Preparation of (2E)-N-[4-chloro-3-(trifluoromethyl)phenyl]-3-[3-(9H-purin-6- yloxy)phenyl]acrylamide (B-3)
Figure imgf000208_0001
Figure imgf000208_0003
TEA, DABCO
Figure imgf000208_0002
[0322] To a mixture of l,4-diazabicyclo[2.2.2]octane (0.098 g, 0.87 mmol) in DCE (25 mL) was added (2E)-N-[4-chloro-3-(txifluorometiiyl)phenyl]-3-(3-hydroxyphenyl)-acrylamide (300 mg, 0.87 mmol) and 6-chloro-9H-purine (1.95 mmol). TEA (366 μL, 2.61 mmol) was added, and the resulting solution was stirred at 60 0C. The solution was diluted with brine and extracted with EtOAc. The combined organic solutions were dried over Na2SO4, filtered and concentrated. Purification by column chromatography (SiO2, 10-80% EtOAc in hexanes) provided the title compound as a white solid (45 mg). 1H NMR (400 MHz, ^6-DMSO): δ 13.68 (br s, IH), 10.67 (s, IH), 8.55 (bs, IH), 8.45 (s, IH), 8.30 (s, IH), 7.92 (dd, IH), 7.70 (d, IH), 7.65 (s, IH), 7.60 (m, 2H), 7.38 (d, IH) and 6.80 (d, IH). LCMS, AA: R1= 1.71 min, [MH+ 460.0].
Example 41: Preparation of (E)-iV-(4-chloro-3-(trifluoromethyl)phenyl)-3-(3-(2-(4,5-dihydro- lH-irnidazol-2-yl)pyridin-4-yloxy)phenyl)--2-rnethylacrylamide (B-12)
Figure imgf000208_0004
Step 1. Preparation N-(4-dhloro-3-(trifluorom.efhyl)phenyl)m.ethacrylamide
[0323] 4-Chloro-3-(trifluoromethyl) aniline (2.6OmL, 26.8 mmol) was dissolved in DCM
(120 mL) and TEA (4.64 mL, 33.3 mmol) was added. The solution was cooled to 0 0C and methacryloyl chloride (5.0 g, 25.6 mmol) was slowly added. The reaction was stirred for 5 h Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
while warming to rt. The organic phase was washed with 0.5M KHSO4SoIUtIOn, sat. NaHCO3 solution and brine, dried over Na2SO4, filtered, and concentrated to provide the title compound (6.51 g) as a light yellow oil. LCMS, FA: Rt= 1.88 min, [MH+ 264.0].
Step 2. Preparation of (E)-N-(4-chloro-3-(trifluoromefhyl)phenyl)-3-(3-hydroxyphenyl)-
2-methylacrylamide
[0324] To a flame-dried flask, NaHCO3 (5.2Og, 61.88 mmol), 3 A molecular sieves (10.9 g), N-(4-chloro-3-(trifluoromethyl)phenyl) methacrylamide (6.51 g, 24.75 mmol), and 3- iodophenol (5.99 g, 27.23 mmol) were added under an atmosphere of argon. The solids were then dissolved in ACN (100 mL) and stirred at rt for 10 min. PPh3 (650 mg, 2.48 mmol) was added and argon bubbled through the reaction mixture. Pd(OAc)2 (278 mg, 1.24 mmόl) was added and the reaction mixture was heated at 600C for 12 h. Additional palladium acetate was added and the reaction mixture was heated for 24 h. The mixture was cooled to rt and filtered through a pad of Celite. The filtrate was washed with sat. NaHCO3 and the aqueous solution extracted with EtOAc. The combined organic solutions were dried over Na2SO4, filtered, and concentrated to provide a brown oil. Purification by column chromatography (SiO2, 0-10% Et2O in DCM) provided the titled compound. LCMS, FA: Rt= 1.94 min, [MH+ 356.0].
Step 3. Preparation of (E)-N-(4-chloro-3-(trifluoromethyl)phenyl)-3-(3-(2-cyanopyridin-
4-yloxy)phenyl)-2-methylacrylamide
[0325] (E)-JV-(4-Chloro-3-(trifluoromethyl)phenyl)-3-(3-hydroxyphenyl)-2- methylacrylamide (1.0 g, 2.81 mmol), 4-chloropicolinonitrile (428 mg, 3.09 mmol) and cesium carbonate (2.75 g, 8.43 mmol) were combined and stirred in DMF. The reaction mixture was heated at 100 0C overnight and then cooled to rt. The mixture was filtered to remove cesium carbonate, the collected precipitate was washed with EtOAc, and the combined filtrate was concentrated. Purification by column chromatography (SiO2, 0-80% EtOAc in hexanes) provided the title compound (883 mg). LCMS, FA: Rt= 2.15 min, [MH+ 458.0]. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Step 4. Preparation of (£)-N-(4-Chloro-3-(trifluoromethyl)phenyl)-3-(3-(2--(4/5-dihydro-
2H-irrddazol-2-yl)pyridine-4-yloxy)phenyl)-2-methylacrylarnide (B-12)
[0326] (£)-N-(4-Chloro-3-(trifluoromethyl)phenyl)-3-(3-(2-cyanopyridin-4- yloxy)phenyl)-2-methylacrylamide (500 mg, 1.09 mmol) and TEA (456 μL, 3.27 mmol) were combined and stirred in ethanol. H2S was bubbled into the solution for 2 min then the reaction mixture was sealed and allowed to stir at rt. Reaction completion was checked by LCMS and TLC. The mixture was diluted with EtOAc and washed with brine. The aqueous phase was extracted with EtOAc, and the organic solutions were combined, dried over Na2SO4, filtered, and concentrated to provide a yellow residue. The residue was redissolved in ethylene diamine (3 mL), heated to 600C for 5 min, and then allowed to cool to rt. The mixture was diluted with EtOAc and washed with brine. The aqueous phase was extracted with EtOAc, and the organic solutions were combined, dried over Na2SO4, filtered, and concentrated. Purification by column chromatography (SiO2, 0-10% MeOH with 1% NH4OH in DCM) provided B-12 (415 mg). LCMS, FA: R1 = 1.34 min, [MH+ 501.0]. 1H NMR (400 MHz, CD3OD): δ 8.49 (d, IH), 8.18 (d, IH), 7.91-7.89 (dd, IH), 7.57-7.53 (m, 3H), 7.40 (d, IH), 7.35 (s, IH), 7.23 (m, IH), 7.16-7.13 (dd, IH), 7.09-7.07 (m, IH), 3.77 (s, 4H), and 2.16 (d, 3H).
[0327] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 41:
B-I 1H NMR (300 MHz, CD3OD): δ 8.50 (d, IH), 8.19 (d, IH), 7.85-7.80 (dd, IH), 7.57-7.50 (m, 4H), 7.36 (m, IH), 7.21-7.17 (m, IH), 7.09-7.07 (dd, IH), 6.35 (d, IH), 4.87 (s, 4H), and 2.61 (d, 3H). LCMS, FA: Rt = 1.37 min, [MH+ 501.0].
B-139 1H NMR (400 MHz, CD3OD): δ 8.65 (d, IH), 8.49 (br s, IH), 7.68-7.66 (m, 2H), 7.58 (t, IH), 7.47-7.44 (m, 2H), 7.32 (br s, IH), 7.28-7.22 (m, 3H), 7.20-7.16 (m, 2H), 4.09 (s, 4H), 2.17 (d, 3H), and 1.32 (s, 9H). LCMS, FA: Rt = 2.06 min, [MH+ 444.0].
B-6 1H NMR (400 MHz, CD3OD): δ 8.48 (d, IH), 7.67 (s, IH), 7.57 (s, IH), 7.53 (d, IH), 7.45 (d, IH), 7.39 (d, IH), 7.31 (s, IH), 7.27-7.22 (m, 2H), 7.18-7.13 (m, 2H), 7.10-7.08 (dd, IH), 2.93 (s, 3H), 2.15 (s, 3H), and 1.32 (s, 9H). LCMS, FA: Rt = 2.06 min, [MH+ 444.0]. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Example 42: Preparation of (£)-2-(3-(2-(4/5-Dihydro-lH-imidazol-2-yl)pyridin-4- yloxy)benzyHdene)-N-(4-cWoro-3-(1τifluorornethyl)phenyl)butanarnide (B-8)
Figure imgf000211_0001
Step 1. Preparation of (E)-Efhyl 2-(3-methoxybenzylidene)butanoate
[0328] Under an atmosphere of argon, to a flame-dried flask were added KHMDS (2.55 g, 12.78 mmol) and THF (40 mL). The mixture was cooled to -78 °C and a solution of triethyl-2- phosphonobutyrate (3.00 ml, 12.7 mmol) in THF (10 mL) was slowly added. The reaction mixture was allowed to stir at -78 °C for 1 h. To the cold reaction mixture was added a solution of 3-anisaldehyde (1.54 mL, 12.66 mmol) in THF (10 mL). After 10 min, the cooling bath was removed and the reaction was allowed to warm slowly to rt over 3 h. The reaction was quenched by pouring onto ice. The aqueous phase was extracted with EtOAc and the combined organic solutions were dried over Na2SO4, filtered, and concentrated. Purification by column chromatography (SiO2, 0-8% EtOAc in hexanes) provided the title compound (2.17 g).1H NMR (300 MHz, d6-DMSO): δ 7.61 (s, IH), 7.33-7.26 (dd, IH), 6.97 (d, IH), 6.91-6.86 (m, 2H), 4.27 (q, 2H), 3.82 (s, 3H), 2.55 (q, 2H), 1.35 (t, 3H), and 1.17 (t, 3H).
Step 2. Preparation of (2E)-2-(3-methoxybenzylidene)butanoic acid
[0329] (E)-Emyl-2-(3-methoxybenzylidene)butanoate (300 mg, 1.28 mmol) was dissolved in THF (30 mL), and LiOH (61 mg, 2.56 mmol), and water (100 μL) were added. The reaction mixture was heated to reflux for 48 h and then cooled to rt. The reaction mixture was diluted with EtOAc and IN HCl. The aqueous phase was extracted with EtOAc and the Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
combined organic solutions were dried over Na2SO4, filtered, and concentrated. Purification by column chromatography (SiO2, 0-70% EtOAc with 1% acetic acid in DCM) provided the title compound (190 mg). 1H NMR (400 MHz, d6-DMSO): δ 7.52 (s, IH), 7.37-7.33 (dd, IH), 6.99 (d, IH), 6.95-6.93 (m, 2H), 3.77 (s, 3H), 2.43 (q, 2H), and 1.10 (t, 3H).
Step 3. Preparation of (2E)-N-[4-chloro-3-(trifluoromethyl)phenyl]-2-(3- methoxybenzylidene)butanamide
[0330] (2E)~2-(3-metnoxybenzylidene)butanoic acid (190 mg, 0.92 mmol), 4-chloro-3-
(trifluorornethyl)aniline (189 mg, 0.97 mmol) and DMAP (135 mg, 1.11 mmol) were mixed together and stirred in DCM (15 mL). The reaction mixture was cooled to 0 0C and EDCI (118 mg, 1.29 mmol) was added. The reaction was allowed to warm slowly to rt overnight. The mixture was diluted with DCM and washed with IN HCl, sat. NaHCO3 and brine, dried over Na2SO4, filtered, and concentrated. The residue was purified by column chromatography (SiO2, 0-15% EtOAc in hexanes) to give the title compound (216 mg). 1H NMR (400 MHz, d6-DMSO): δ 10.44 (s, IH), 8.29 (d, IH), 8.05-8.02 (dd, IH), 7.68 (d, IH), 7.39-7.35 (m, IH), 7.22 (s, IH), 6.99 (d, IH), 6.95-6.93 (m, 2H), 3.77 (s, 3H), 2.54 (q, 2H), and 1.08 (t, 3H).
Step 4. Preparation of (£)-2-(3-hydroxybenzylidene)-N-(4-chloro-3-(trifluoromethyl) phenyljbutanamide
[0331] A solution of (2E)-N-[4-chloro-3-(trifluoromeihyl)phenyl]-2-(3- methoxybenzylidene)butanamide (216 mg, 0.54 mmol) in DCM (15 mL) was cooled to 00C under an atmosphere of argon. To this solution was added BBr3 (IM in DCM, 1.18 mL). The cooling bath was removed and the reaction mixture was allowed to warm to rt. After stirring for 2 h, the reaction was quenched by the addition of water. The mixture was extracted with EtOAc and the combined organic solutions were washed with water and brine, dried over Na2SO4, filtered, and concentrated. The residue was triturated with DCM and filtered to give the desired phenol (189 mg). 1H NMR (400 MHz, d4~MeOH): δ 8.19 (d, IH), 7.91-7.87 (dd, IH), 7.55 (d, IH), 7.24-7.16 (m, 2H), 6.87-6.85 (m, 2H), 6.77-6.74 (dd, IH), 2.63 (q, 2H), and 1.14 (t, 3H). Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Step 5. Preparation of (£)-2-(3-(2-(4/5-dihydro-lH-irnidazol-2-yl)pyridin-4- yloxy)berιzylidene)-N-(4-chloro-3-(trifluoromethyl)phenyl) butanamide (B-8)
[0332] B-8 was prepared from (E)-2-(3-hydroxybenzyKdene)-N-(4-chloro-3-
(trifluoromethyl) phenyl)butanamide by the methods described above. LCMS, FA: Rt = 1.41 min, [MH+ 515.0]. 1H NMR (400 MHz, d4-MeOH): δ 8.53 (d, IH), 8.19 (d, IH), 7.91-7.88 (dd, IH), 7.59-7.53 (m, 3H), 7.36 (d, IH), 7.22 (s, IH), 7.17-7.10 (m, 3H), 3.84 (s, 4H), 2.65-2.60 (m, 2H), and 1.11 (t, 3H).
[0333] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 42:
B-Il 1H NMR (300 MHz, d6-DMSO): δ 10.81 (s, IH), 8.52 (d, IH), 8.33 (s, IH), 8.10 (d, IH), 7.74-7.59 (m, 3H), 7.53 (s, IH), 7.42 (s, IH), 7.29 (d, IH), 7.22-7.09 (m, 2H), and 3.58 (s, 4H). LCMS, FA: Rt = 1.32 min, [MH+ 505.0].
Example 43: Preparation of (£)-N-(3-rert-butylphenyl)-3-(3-(2-(4,5-dihydro-lH-imidazol-2- yl)pyridin-4-yloxy)phenyl)-2-(hydroxymethyl)acrylamide (1-140)
Figure imgf000213_0001
Step 1. Preparation of ethyl 2-((førf-butyldimethylsilyloxy)methyl)acrylate
[0334] Ethyl-2(hydroxymethyl) acrylate (2.0 mL, 17.12 mmol), imidazole (2.3 g, 34.24 mmol), and tert-butyl dimethylsilyl chloride (3.1 g, 20.54 mmol) were stirred in a solution of DMF (10 mL) at rt overnight. The reaction was diluted with EtOAc and washed with a 10% Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
solution of LiCl. The aqueous phase was extracted with EtOAc, the organic solutions combined, dried over Na2SO4, filtered, and concentrated. Purification by column chromatography (SiO2, 0- 10% EtOAc in hexanes) provided the title compound (2.69 g). 1H NMR (300 MHz, d6-DMSO): δ 6.13 (d, IH), 5.82 (d, IH), 4.30 (s, 2H), 4.14 (q, 2H), 1.21 (t, 3H), 0.87 (s, 9H), and 0.05 (s, 6H).
Step 2. Preparation of (E)-2-((fer^butyldirnethylsilyloxy)rnethyl)-3-(3-rnethoxyphenyl) acrylic acid
[0335] Ethyl 2-((ierf-butyldimethylsilyloxy)methyl)acrylate (2.15 g, 8.8 mmol) and LiOH
(421 mg, 17.6 mmol) were dissolved in THF (100 mL) and water (100 μL). The reaction mixture was heated to reflux for 48 h then cooled to rt. The reaction mixture was diluted with EtOAc and IN HCl. The aqueous phase was extracted with EtOAc and the combined organic solutions were dried over Na2SO4, filtered, and concentrated. Purification by column chromatography (SiO2, 0-10% EtOAc with 1% acetic acid in DCM) provided the title compound (1.04 g). 1H NMR (400 MHz, d6-DMSO): δ 12.57 (s, IH), 6.13-6.09 (dd, IH), 5.81-5.76 (dd, IH), 4.28 (d, 2H), 0.88 (s, 9H), and 0.05 (s, 6H).
Step 3. Preparation of 2-((ierf-butyldimethylsilyloxy)methyl)-]V-(3-te7'i-butylphenyl) acrylamide
[0336] The title compound was prepared as described in Example 10, Step 3, using (E)-
2-((tert-butyldimethylsilyloxy)methyl)-3-(3-methoxyphenyl) acrylic acid and 3-tert-bvtiyl aniline. LCMS, FA: Rt= 2.51 min, [MH+ 348.0].
Step 4. Preparation of (E)-2-((ferf-butyldimethylsilyloxy)methyl)-]V-(3-ierf-butylphenyl)-
3-(3-(2-cyanopyridin-4-yloxy)phenyl)acrylamide
[0337] The title compound was prepared as described in Example 36, Step 2, using 2-
((fert-butyldimethylsilyloxy)methyl)-N'-(3-ter/--butylphenyl) acrylamide and 4-(3- iodophenoxy)picolinonitrile (prepared as described in Example 11, Step 1 using 3-iodophenol and 4-cmoropicolmonitrile). LCMS, FA: Rt= 2.61 min, [MH+ 542.0]. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Step 5. Preparation of (E)-2-((ter^butyldirnethylsilyloxy)rnethyl)-N-(3-terf-butylphenyl)-
3-(3-(2-(4/5-dihydro-lH-irrddazol-2-yl)pyridin-4-yloxy)phenyl)acrylarrιide
[0338] The title compound was prepared as described in Example 13. H NMR (300
MHz, d4-MeOH): δ 8.47 (d, IH), 7.61 (t, IH), 7.57-7.54: (m, 2H), 7.49-7.46 (m, 2H), 7.40-7.37 (m, 2H), 7.25 (t, IH), 7.21-7.16 (m, 2H), 7.06-7.04 (dd, IH), 4.59 (s, 2H), 3.75 (s, 4H), and 1.31 (s, 9H), 0.81 (s, 9H), 0.01 (s, 6H).
Step 6. Preparation of (E)-N-(3-feri-butylphenyl)-3-(3-(2-(4,5-dihydro-lH-imidazol-2- yl)pyridin-4-yloxy)phenyl)-2-(hydroxymethyl)acrylamide (B-140)
[0339] (£)-2-((ter^butyldimethylsilyloxy)methyl)-iV-(3-feri-butylphenyl)-3-(3-(2-(4,5- dihydro-lH-irnidazol-2-yl)pyridin-4-yloxy)phenyl)acrylarnide (107 mg, 0.18 rnrnol) was dissolved in a 1:1 mixture of THF/pyridine (3 mL). The reaction mixture was cooled to 0 0C and 20 drops of HF /pyridine were added. The reaction was sealed and allowed to warm to rt over 5 h. The mixture was diluted with EtOAc and washed with sat. NaHCO3, dried over Na2SO4, filtered, and concentrated. Purification by column chromatography (SiO2, 0-10% MeOH with 1% NH4OH in DCM) provided B-140 (32 mg). LCMS, FA: Rt= 1.21 min, [MH+ 471.0]. 1H NMR (300 MHz, d4-MeOH): δ 8.48 (d, IH), 7.68 (t, IH), 7.56-7.51 (m, 3H), 7.48-7.44 (m, IH), 7.41 (d, IH), 7.31 (t, IH), 7.25 (t, IH), 7.19-7.15 (m, 2H), 7.08-7.05 (dd, IH), 4.52 (s, 2H), 3.75 (s, 4H), and 1.32 (s, 9H).
Example 44: Preparation of N-[4-chloro-3-(trifluoromethyl)phenyl]-3-(3-{[2-(4,5-dihydro-lH- imidazol-2-yl)pyridin-4-yl]oxy}phenyl)butanamide (A-132)
Figure imgf000215_0001
[0340] B-I (25 mg, 0.05 mmol) was dissolved in MeOH (10 mL) and the reaction mixture was degassed. Under argon, 5 wt. % Pd on activated carbon (10 mol %) was added to the reaction mixture which was then stirred under 1 atmosphere of hydrogen at rt. The reaction was filtered over Celite. The solvent was evaporated to obtain A-132. 1H NMR (400 MHz, d6- DMSO) δ: 10.37 (s, IH), 8.45 (d, IH), 8.23 (s, IH), 8.11 (d, IH), 7.75 (d, IH), 7.61 (d, IH), 7.44-7.40 Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
(m, 2H), 7.23 (d, IH), 7.12 (s, IH), 7.04-7.01 (m, 2H), 3.34-3.29 (m, IH), 2.68-2.57 (m, 2H), and 1.26 (d, 3H). LCMS: (FA) ES+ 503.0 (M+l), ES' 501.0 (M-I).
[0341] Compounds in the following table were prepared from the appropriate starting materials in a method analogous to that of Example 44:
A-215 1H NMR (400 MHz, CD3OD) δ: 8.32 (d, IH), 7.98 (d, IH), 7.62 (dd, IH), 7.44 (d, IH), 7.42 (d, IH), 7.36 (t, IH), 7.13-7.18 (m, IH), 6.98-7.01 (m, IH), 6.93-6.97 (m, IH), 6.87 (dd, IH), 3.74 (s, 4H), 3.01 (dd, IH), 2.73-2.82 (m, 2H), and 1.24 (d, 3H).
A-135 1H NMR (400 MHz, CD3OD) δ: 8.42 (d, IH), 8.03 (d, IH), 7.67 (dd, IH), 7.49-7.51 (m, IH), 7.46-7.49 (m, IH), 7.40 (d, IH), 7.24 (dd, IH), 7.19 (d, IH), 6.95 (dd, IH), 3.78 (s, 4H), 3.04 (t, 2H), 2.70 (t, 2H), and 3.04 (t, 2H). LCMS, FA: Rt = 1.33 min, [MH+ 523.1].
A-62 1H NMR (400 MHz, CD3OD) δ: 8.42 (d, IH), 8.05 (d, IH), 7.73 (dd, IH), 7.50 (d, IH), 7.40 (d, IH), 7.22-7.25 (m, IH), 7.15-7.20 (m, IH), 6.97 (d, IH), 6.92 (dd, IH), 3.77 (s, 4H), 3.01 (t, 2H), 2.70 (t, 2H) and 2.09 (s, 3H). LCMS, FA: Rt = 1.31 min, [MH+ 503.3].
Example 45: Expression and Purification of Raf Kinase Enzymes
Wild-Type B-Raf
[0342] Enzymatically active wild-type B-Raf was purchased from Upstate (cat# 14-530).
V599E B-Raf
[0343] Enzymatically active mutant B-Raf (V599E) was purchased from Upstate (cat# 14-
557).
Wild Type C-Raf
[0344] Enzymatically active C-Raf was purchased from Upstate (cat# 14-352).
Example 46: Raf Kinase Enzyme Assays B-Raf Flash Plate® Assay
[0345] Enzyme mix (15 μL), containing 50 mM HEPES pH 7.5, 0.025% Brij 35, 10 mM
DTT, 4 nM B-Raf (V599E or Wild Type), was added to the wells of an assay plate and incubated Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
for 20 minutes. Substrate mix (15 μL), containing 50 mM HEPES pH 7.5, 0.025% Brij 35, 10 mM MnCl2, 2 μM Peptide 118 (Biotin-DRGFPRARYRARTTNYNSSR-
SRFYSGFNSRPRGRVYRGRARATSWYSPY-NH2, New England Peptide), 1 μM ATP, 0.2 mg/mL BSA, P ATP 0.5 μCi/reaction was then added. Final reagent concentrations in the reaction mixture were 50 mM HEPES pH 7.5, 0.025% Brij 35, 5 mM DTT, 5 mM MnCl2, 1 μM Peptide 118, 0.5 μM ATP, 0.1 mg/mL BSA, 2 nM B-Raf Wild Type, and 33P ATP 0.5 μCi/ /reaction. The reaction mixture, with or without Raf kinase inhibitor, was incubated for 60 minutes, and then stopped by the addition of 50 μL of 100 mM EDTA. The stopped reaction mixture (65 μL) was transferred to a Flash Plate® (Perkin Elmer) and incubated for 2 hours. The wells were washed three times with 0.02% Tween-20. Plates were read on a TopCount analyzer.
[0346] The following compounds exhibited IC50 values less than or equal to 50 nM in this assay: A-5, A-7, A-20, A-27, A-35, A-51, A-53, A-55, A-58, A-59, A-63, A-73, A-74, A-89-91, A-96, A-98, A-99, A-100-103, A-105, A-108-110, A-112, A-113, A-115, A-108-110, A-112, A-113, A- 115, A-117, A-122, A-128-130, A-137, A-141, A-142, A-144, A-145, A-147-149, A-151, A-154, A- 156-158, A-164-166, A-170, A-171, A-176, A-178, A-183, A-184, A-186, A-189-195, A-200, A-201, A-203, A-204, A-209, A-211, A-216, A-220, A-221, A-225, A-226, A-228, A-230-234, A-237, A-239, A-243, A-245, A-255, A-257, A-258, A-265, B-2, B-5-7, B-9, B-Il, B-12, B-139, B-140
[0347] The following compounds exhibited IC50 values of greater than 50 nM and less than 500 nM in this assay: A-2-4, A-6, A-8, A-9, A-18, A-24, A-36, A-50, A-52, A-60-62> A-65-68, A-70, A-72, A-75-78, A-80-82, A-84-86, A-93, A-94, A-97, A-118-120, A-123, A-124, A-127, A-132, A-135, A-136, A-138, A-139, A-143, A-150, A-152, A-153, A-159-162, A-169, A-172-174, A-177, A- 180, A-181, A-185, A-187, A-199, A-202, A-205, A-207, A-208, A-210, A-213, A-215, A-217-219, A- 223, A-224, A-227, A-229, A-235, A-236, A-238, A-240, A-241, A-244, A-248-251, A-259-261, A- 264, B-I, B-3, B-8, B-10.
[0348] The following compounds exhibited IC50 values greater than 500 nM in this assay: A-I, A-6, A-ll-13, A-19, A-21, A-23, A-54, A-56, A-57, A-64, A-69, A-71, A-79, A-83, A-87, A-88, A-92, A-95, A-104, A-105, A-107, A-Hl, A-114, A-116, A-121, A-125, A-126, A-131, A-134, A-140, A-146, A-155, A-163, A-167, A-175, A-177, A-182, A-188, A-196-198, A-206, A-212, A-214, A-222, A-242, A-246, A-252-254, A-256, A-262, A-263, B-13. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
C-Raf Flash Plate® Assay
[0349] Enzyme mix (15 μL), containing 50 mM HEPES pH 7.5, 0.025% Brij 35, 10 mM
DTT, 20 nM C-Raf (Wild Type), was added to the wells of an assay plate and incubated for 20 minutes. Substrate mix (15 μL), containing 50 mM HEPES pH 7.5, 0.025% Brij 35, 10 mM MnCl2,
4 μM Peptide 118, 1 μM ATP, 0.1 mg/mL BSA, 33P ATP 0.5 μCi/reaction was then added. Final reagent concentrations in the reaction mixture were 50 mM HEPES pH 7.5, 0.025% Brij 35, 5 mM DTT, 5 mM MnCl2, 2 μM Peptide 118, 1.0 μM ATP, 0.1 mg/mL BSA, 10 nM C-Raf Wild Type, and 33 P ATP 0.5 μCi/ /reaction. The reaction mixture was incubated for 40 minutes, and then stopped by the addition of 50 μL of 100 mM EDTA. The stopped reaction mixture (65 μL) was transferred to a Flash Plate® (Perkin Elmer) and incubated for 2 hours. The wells were washed three times with 0.02% Tween-20. Plates were read on a TopCount analyzer.
Example 47: Raf Kinase Cellular Assays Phospho-ERK ELISA Assay
[0350] Inhibition of Raf kinase activity in whole cell systems can be assessed by determining the decrease in phosphorylation of Raf kinase substrates. Any known Raf kinase substrate can be used to measure inhibition of Raf kinase activity in a whole cell system.
[0351] In a specific example, A375 cells were seeded in a 96-well cell culture plate
(12x10 cells/100 μL/well) and incubated overnight at 370C. Medium was removed, and cells were incubated with Raf kinase inhibitors for 3 hours at 370C. Medium was removed, and cells were fixed with 4% paraformaldehyde for 15 minutes at room temperature.
[0352] Methanol was added for 15 min. Cells were removed and blocked with 10% sheep serum and 1% BSA in PBS overnight at 40C. Cells were incubated with anti- p44/42MAPK antibody (1:100, Cell Signaling Technologies, #9101L) (20 μL/well) for one hour at room temperature. After washing with PBS three times, cells were stained with anti-rabbit horseradish peroxidase-linked antibody from donkey (1:100, Amersham Bioscience #NA934V) for 1 hour at room temperature. Cells were washed three times with 0.5% Tween-20 in PBS and twice with PBS. 3,3^5,5'-Tetramethylbenzidine (TMB) liquid substrate system (Sigma, #T8665) (50 μL/well) was added, and cells were incubated for 30-45 minutes at room temperature. Optical density was read at 650 run. Cells were then washed 3-5 times with PBS to remove color Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
solution. Results were normalized for the protein content in each well using a BCA protein assay kit (Pierce).
[0353] The following compounds exhibited IC50 values less than or equal to 1 μM in this assay: A-59, A-96, A-115, A-144, A-171, A-184, A-219, A-265, B-2, B-5, B-7-9, B-Il, B-12, B-139, B- 140.
[0354] The following compounds exhibited IC50 values greater than 1 μM and less than
10 μM in this assay: A-12, A-27, A-35, A-51, A-55, A-58, A-61-63, A-72-74, A-76, A-89-91, A-98, A-99, A-101, A-103, A-104, A-108-110, A-113, A-117, A-122, A-124, A-127-130, A-132, A-145, A- 147-149, A-151, A-153, A-154, A-156, A-157, A-161, A-165, A-166, A-169, A-170, A-176, A-178, A- 183, A-186, A-189, A-190, A-192, A-193, A-195, A-200, A-204, A-205, A-209, A-211, A-216, A-218, A-220, A-223, A-226, A-228, A-230-233, A-237, A-239, A-243-245, A-248, A-251, A-255, A-257, B- 3, B-6, B-10.
[0355] The following compounds exhibited IC50 values greater than 10 μM and less than
25 μM in this assay: A-Il, A-24, A-26, A-50, A-52, A-66, A-67, A-78, A-86, A-102, A-105, A-106, A-112, A-137, A-158, A-180, A-187, A-191, A-201, A-203, A-213, A-225, A-227, A-234, A-249, A- 259, B-I.
Example 48: Anti-proliferation Assays WST assay
[0356] A375 cells (4000) in 100 μL of 1% FBS-DMEM were seeded into wells of a 96-well cell culture plate and incubated overnight at 370C. Test compounds were added to the wells and the plates were incubated for 48 hours at 370C. Test compound solution was added (100 μL/well in 1% FBS DMEM), and the plates were incubated at 370C for 48 hours. WST-I reagent (Roche #1644807, 10 μL) was added to each well and incubated for four hours at 370C as described by the manufacturer. The optical density for each well was read at 450 run and 600 ran. A well containing medium only was used as a control. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Example 49: In vivo Assays In vivo Tumor Efficacy Model
[0357] Raf kinase inhibitors are tested for their ability to inhibit tumor growth in standard xenograft tumor models.
[0358] For example, HCT-116 cells (IxIO6) in 100 μL of phosphate buffered saline are aseptically injected into the subcutaneous space in the right dorsal flank of female CD-I nude mice (age 5-8 weeks, Charles River) using a 23-ga needle. Beginning at day 7 after inoculation, tumors are measured twice weekly using a vernier caliper. Tumor volumes are calculated using standard procedures (0.5 x length x width ). When the tumors reach a volume of approximately 200 mm , mice are injected i.v. in the tail vein with test compound (100 μL) at various doses and schedules. All control groups receive vehicle alone. Tumor size and body weight are measured twice a week , and the study is terminated when the control tumors reach approximately 2000 mm. Analogous procedures are followed for melanoma (A375 or A2058 cells), colon (HT-29 or HCT-116 cells), and lung (H460 cells) tumor models.
[0359] While the foregoing invention has been described in some detail for purposes of clarity and understanding, these particular embodiments are to be considered as illustrative and not restrictive. It will be appreciated by one skilled in the art from a reading of this disclosure that various changes in form and detail can be made without departing from the true scope of the invention, which is to be defined by the appended claims rather than by the specific embodiments.
[0360] . The patent and scientific literature referred to herein establishes knowledge that is available to those with skill in the art. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. The issued patents, applications, and references that are cited herein are hereby incorporated by reference to the same extent as if each was specifically and individually indicated to be incorporated by reference. In the case of inconsistencies, the present disclosure, including definitions, will control.

Claims

Attorney Docket No. MPI05-002P1RNWOM January 12, 2006WHAT IS CLAIMED IS:
1. A compound of formula (I):
Figure imgf000221_0001
or a pharmaceutically acceptable salt thereof; wherein:
G1 is -C(R )(Re)-/ -O-, -S-, or -N(R)-, wherein G1 is attached to Ring A at the position meta or para to L ;
Figure imgf000221_0002
Ring A is substituted with 0-2 Ra;
Ring B is an optionally substituted mono- or bicyclic aromatic ring system having one to four ring nitrogen atoms and optionally one or two additional ring heteroatoms independently selected from oxygen and sulfur;
Ring C is an optionally substituted 5- or 6-membered aryl or heteroaryl ring having 0-3 ring nitrogen atoms and optionally one additional ring heteroatom selected from oxygen and sulfur;
Ra is halo, -NO2, -CN, -OR5, -SR6, -S(O)R6, -SO2R6, -SO2N(R4)2, -N(R4)2, -OC(O)R5, -CO2R5, -C(O)N(R4)2, -N(R4)SO2R6, -N(R4)SO2N(R4)2, or an optionally substituted C1-4 aliphatic;
R is hydrogen, fluoro, C1-4 aliphatic, C1-4 fluoroaliphatic, -NH2, -NH(C1-4 alkyl), -N(C1-4 alkyl)2, OH, or -0(C1-4 alkyl);
Re is hydrogen, fluoro, C1-4 aliphatic, or C1-4 fluoroaliphatic; or Rd and Re, taken together with the carbon atom to which they are attached, form a 3- to 6-membered cycloaliphatic or heterocyclyl ring; Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Rf is -H, -C(O)R5, -C(O)N(R4)2/ -CO2R6, -SO2R6, -SO2N(R4),, or an optionally substituted C1-6 aliphatic;
Rs is hydrogen, fluoro, C1-4 aliphatic, or C1-4 fluoroaliphatic; and
Rh is hydrogen, fluoro, C1-4 aliphatic, C1-4 fluoroaliphatic, -OH, -0(C1-4 alkyl), -N(R4J2,
-N(R4)C(O)(C1-4 aliphatic), -C(O)(C1-4 alkyl), -CO2H, -CO2(C1-4 alkyl), or -C(O)N(R4)2; or
Rε and R1, taken together with the carbon atom to which they are attached, form a 3- to 6- membered cycloaliphatic ring;
RJ is hydrogen, fluoro, C1-4 aliphatic, or C1-4 fluoroaliphatic; and k
R is hydrogen, fluoro, C14 aliphatic, C14 fluoroaliphatic, -OH, -0(C14 alkyl), -C(O)(C1., alkyl), -CO2H, -CO2(C1-4 alkyl), or -C(O)N(R4)2; or
R and R , taken together with the carbon atom to which they are attached, form a 3- to 6- membered cycloaliphatic ring; or each of Rε and R; is hydrogen, fluoro, C14 aliphatic, or C14 fluoroaliphatic; and
R and R , taken together with the intervening carbon atoms, form a 3- to 6-membered cycloaliphatic ring;
Rm is hydrogen, fluoro, -OR5, -C(O)R5, -C(O)N(R4)2, -CO2R5, -SO2R6, -SO2N(R4)2, or an optionally substituted C14 aliphatic;
Rn is hydrogen, fluoro, -C(O)R5, -C(O)N(R4)2, -CO2R5, -SO2R6, -SO2N(R4)2, or an optionally substituted C1-4 aliphatic;
,4 each R independently is hydrogen or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl group; or two R on the same nitrogen atom, taken together with the nitrogen atom, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S; Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
each R independently is hydrogen or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl group; and each R independently is an optionally substituted aliphatic, aryl, or heteroaryl group; and m is 1 or 2; provided that G is attached to Ring A at the position meta to L when L is -C(Rm)=C(Rn)-;
further provided that Ring B is other than imidazolyl when L1 is -[C(R8) (R1^]1n-C(R') (Rk)-, Ring C is substituted or unsubstituted phenyl and G is -CH2- in the para position; and further provided that the compound of formula (Z) is other than:
]V-(3-chloro-2-ethyl-4-pyridinyl)-4-[[5-(trifluoromethyl)-2-pyridinyl]oxy]- benzenepropanamide;
4-[[3-cyano-6-(l-methylethyl)2-pyridinyl]oxy]--V-(2,6-diethylphenyl)- benzenepropanamide;
4-[[5-bronio-4-(2-propynyloxy)-2-pyrimidinyl]arnino-N-(4-hydroxyphenyl)- benzenebutanamide;
4-[(4,5-dihydro-2-tWazolyl)arnino]-N-phenyl-benzenebutanarnide;
N"-(3-chloro-2-ethyl-4-pyridinyl)-4-[[5-(trifluoromethyl)-2-pyridinyl]oxy]- benzenebutanamide; or
4-[[4,6-bis-(3,5-diarnino-l-piperidinyl)-l,3,5-triazin-2-yl]amino]-β-hydroxy-N-[2- (trifluoromethyl)phenyl]benzenebutanamide.
2. The compound of claim 1, characterized by one or more of the following features:
(a) each Ra independently is -F, -Cl, -CN, -NO2, CM alkyl, -CF3, -0(C14 alkyl), -OCF3, -S(C14 alkyl), -SO2(C1-4 alkyl), -NH2, -NH(C14 alkyl), -N(C14 alkyl)2, -CO2H, -C(O)NH2, or -C(O)NH(C14 alkyl); Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
(b) Rh and Rk are each independently hydrogen, fluoro, C14 alkyl, or
C14 fluoroalkyl;
(c) L is -C(Rm)=C(Rn)-, and Rm and Rn are trans to each other;
(d) Rm and Rn are each independently hydrogen, fluoro, C14 fluoroaliphatic, or a C14 aliphatic optionally substituted with one substituent selected from -NH2, -NH(C14 alkyl), -N(C14 alkyl)2, -OH, or -Q(C14 alkyl);
. i .
(e) L is -CH2-CH2- or -CH2-CH2-CH2-; and
(f) G1 is -O- or -NH-.
3. The compound of claim 1, wherein: Ring B is substituted on its substitutable ring carbon atoms with 0-2 R and 0-2 R ;
each Rb independently is halo, -NO2, -CN, -C(R5)=C(R5)2, -G≡C-R5, -OR5, -SR6, -S(O)R6, -SO2R6, -SO2N(R4),, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4),, -N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-R6, -NR4CO2R6, -N(R4)SO2R6, -N(R4)SO2N(R4)2, -O-C(O)R5, -OC(O)N(R4)2, -C(O)R5, -CO2R5, -C(O)N(R4)2, -C(O)N(R4)-OR5, -C(O)N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-N(R4)-C(O)R5 / -C(=NR4)-N(R4)2, -C(=NR4)-OR5, -C(=NR4)-N(R4)-OR5, -C(R6)=N-OR5, or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl; each R independently is selected from the group consisting of C14 aliphatic, C14 fluoroaliphatic, halo, -OH, -O(C14 aliphatic), -NH2, -NH(C14 alkyl), and -N(C14 alkyl)2; each substitutable ring nitrogen atom in Ring B is unsubstituted or is substituted with
-C(O)R5, -C(O)N(R4)2, -CO2R6, -SO2R6, -SO2N(R4)2, C14 aliphatic, an optionally substituted C6-10 aryl, or a C6-10 ar(C14)alkyl, the aryl portion of which is optionally substituted; and one ring nitrogen atom in Ring B optionally is oxidized. W
Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
4. The compound of claim 3, wherein each R independently is selected from the group consisting of C1-6 aliphatic, C1-6 fluoroaliphatic, halo, -Rlb, -R2b, -T^-R113, -T1-R2b / -V1-T1-Rlb, and V-T'-R*;
T is a C1 6 alkylene chain optionally substituted with R a or R , wherein the alkylene chain optionally is interrupted by -C(R5)=C(R5)-, -OC-, -O-, -S-, -S(O)-, -S(O)2-, -SO2N(R4)-, -N(R4)-, -N(R4)C(O)-, -NR4C(O)N(R4)-, -N(R4)C(=NR4)-N(R4)-, -N(R4)-C(=NR4)-, -N(R4)CO2-, -N(R4)SO2-, -N(R4)SO2N(R4)-, -OC(O)-, -OC(O)N(R4)-, -C(O)-, -CO2-, -C(O)N(R4)-, -C(=NR4)-N(R4)-, -C(NR4)=N(R4)-, -C(=NR4)-O-, or -C(R )=N-O-, and wherein T1 or a portion thereof optionally forms part of a 3-7 membered ring;
V1 is -C(R5)=C(R5)-, -C=C-, -O-, -S-, -S(O)-, -S(O)2-, -SO2N(R4)-, -N(R4)-, -N(R4)C(O)-, -NR4C(O)N(R4)-, -N(R4)C(=NR4)-N(R4)-, -N(R4)C(=NR4)-, -N(R4)CO2-, -N(R4)SO2-, -N(R4)SO2N(R4)-, -OC(O)-, -OC(O)N(R4)-, -C(O)-, -CO2-, -C(O)N(R4)-, -C(O)N(R4)-O-, -C(O)N(R4)C(=NR4)-N(R4)-, -N(R4)C(=NR4)-N(R4)-C(O)-, -C(=NR4)-N(R4)-, -C(NR4)=N(R4)-, -C(=NR4)-O-, or -C(R6)=N-O-;
each R independently is an optionally substituted aryl, heteroaryl, heterocyclyl, or cycloaliphatic ring; each R2b independently is -NO2, -CN, -C(R5)=C(R5)2, -C≡C-R5, -OR5, -SR6, -S(O)R6, -SO2R6, -SO2N(R4)2, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4),, -N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-R6, -NR4CO2R6, -N(R4)SO2R6, -N(R4)SO2N(R4)2, -O-C(O)R5, -OC(O)N(R4),, -C(O)R5, -CO2R5, -C(O)N(R4)2, -C(O)N(R4)-OR5, -C(O)N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-N(R4)-C(O)R5, -C(=NR4)-N(R4)2, -C(=NR4)-OR5, -C(=NRVN(R4)-OR5, or -C(R6)=N-OR5;
each R a independently is selected from the group consisting of -F, -OH, -O(CM alkyl), -CN, -N(R4)2, -C(O)(CM alkyl), -CO2H, -CO2(C1^ alkyl), -C(O)NH2, and -C(O)NH(C1-4 alkyl); Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
each R independently is a Cα_3 aliphatic optionally substituted with R Λ or R , or two substituents R on the same carbon atom, taken together with the carbon atom to which they are attached, form a 3- to 6-membered cycloaliphatic ring; and
-.7 . each R independently is an optionally substituted aryl or heteroaryl ring.
5. The compound of claim 4, wherein:
Ring B is a radical derived from an aromatic ring system selected from the group consisting of pyrrole, oxazole, thiazole, imidazole, pyrazole, isoxazole, isothiazole, oxadiazole, triazole, thiadiazole, pyridine, pyridazine, pyrimidine, pyrazine, triazine, indolizine, indole, isoindole, indazole, benzimidazole, benzthiazole, benzoxazole, pyrrolopyridine, imidazopyridine, oxazolopyridine, thiazolopyridine, triazolopyridine, pyrrolopyrimidine, purine, triazolopyrimidine, quinoline, isoquinoline, cinnoline, phthalazine, quinazoline, quinoxaline, naphthyridine, and pteridine, wherein the point of attachment connecting Ring B to G may be on either ring when Ring B is a radical derived from a bicyclic ring system;
Ring B optionally is substituted on any substitutable ring carbon atom or ring nitrogen atom; and one ring nitrogen atom in Ring B optionally is oxidized.
6. The compound of claim 5, wherein the substitutable ring carbon atoms in Ring B are substituted with 0-1 R and 0-1 R ;
R is selected from the group consisting of C14 aliphatic, C1-4 fluoroaliphatic, halo, -R , -R , -Tα-Rlb -T'-R2", -V'-T'-R1", and -V'-T'-R2';
T r.1 i -s a C1-4 alkylene chain optionally substituted with one or two substituents independently selected from the group consisting of C1-3 aliphatic, C1-3 fluoroaliphatic, -F, -OH, -O(C1-4 alkyl), -CO2H, -CO2(C^4 alkyl), -C(O)NH2, and -C(O)NH(CM alkyl), wherein the alkylene chain optionally is interrupted with Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
-N(R4)-, -C(=NR4)-N(R4)-, -C(NR4)=N(R4)-, -N(R4)-C(=NR4)-, -N(RVc(O)-, or -C(O)N(R4)-;
V1 is -C(R5)=C(R5)~, -OC-, -O-, -N(R4)-, -N(R4)C(O)-, -C(O)N(R4)-, -C(=NR4)-N(R4)-, -C(NR4)=N(R4)-, or -N(R4)-C(=NR4)-;
,1b . each R independently is an optionally substituted aryl, heteroaryl, heterocyclyl, or cycloaliphatic ring; each R2b independently is -NO2, -CN, -C(R5)=C(R5)2, -C≡C-R5, -OR5, -SO2R6, -SO2N(R4)2, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4),, -N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-R6, -NR4CO2R6, -N(R4)SO2R6, -N(R4)SO2N(R4)2, -O-C(O)R5, -OC(O)N(R4)2, -C(O)R5, -CO2R5, -C(O)N(R4)2, -C(O)N(R4)-OR5, -C(O)N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-N(R4)-C(O)R5, -C(=NR4)-N(R4)2, -C(=NR4)-OR5, -C(=NR4)-N(R4)-OR5, or -C(R6)=N-OR5; and
R is selected from the group consisting of C1-4 aliphatic, C1-4 fluoroaliphatic, halo, -OH, -0(C1-4 aliphatic), -NH2, -NH(C1-4 aliphatic), and -N(C1-4 aliphatic)2.
7. The compound of claim 6, wherein:
Ring B is a radical derived from pyrrole, oxazole, thiazole, imidazole, pyxazole, isoxazole, pyridine, pyridazine, pyrimidine, pyrazine, pyrrolopyridine, imidazolopyridine, pyrazolopyridine, triazolopyridine, pyrrolopyrimidine, purine, pyrazolopyrimidine, triazolopyrimidine, benzimidazole, or benzthiazole, wherein the point of attachment connecting Ring B to G may be on either ring when Ring B is a radical derived from a bicyclic ring system;
Ring B optionally is substituted on any substitutable ring carbon atom or ring nitrogen atom; and one ring nitrogen atom in Ring B optionally is oxidized. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
8. The compound of claim 7, wherein Ring B is an optionally substituted pyrimidinyl, pyridyl, or N-oxidopyridyl.
9. The compound of claim 1, having formula (III):
Figure imgf000228_0001
or a pharmaceutically acceptable salt thereof; wherein: X is CH or N;
Ring B is substituted with 0-1 R and 0-1 R , and one nitrogen atom in Ring B optionally is oxidized;
.R is selected from the group consisting of C1-4 aliphatic, C1-4 fluoroaliphatic, halo, -R , -R2b, -T'-R1" -T'-R2', -V1^-R1", and -V1^-R2";
T is a C14 alkylene chain optionally substituted with one or two substituents independently selected from the group consisting of C1-3 aliphatic, C1-3 fluoroaliphatic, -F, -OH, -U(C1-4 alkyl), -CO2H, -CO2(C1-4 alkyl), -C(O)NH2, and -C(O)NH(C1-4 alkyl), wherein the alkylene chain optionally is interrupted with -N(R4)-, -C(=NR4)-N(R4h -C(NR4)=N(R4)-, -N(R4)-C(=NR4)-, -N(R4)-C(O)-, or -C(O)N(R4)-;
V1 is -C(R5)=C(R5)-/ -CsC-, -O-, -N(R4)-, -N(R4)C(O)-, -C(O)N(R4)-, -C(=NR4)-N(R4)-, -C(NR4)=N(R4)-, or -N(R^-C (=NR4)-;
each R independently is an optionally substituted aryl, heteroaryl, heterocyclyl, or cycloaliphatic ring; each R2b independently is -NO2, -CN, -C(R5)=C(R5)2, -C≡C-R5, -OR5, -SO2R6,
-SO2N(RV -N(RV -NR4C(O)R5, -NR4C(O)N(R4),, -N(R4)C(=NR4)-N(R4) 'v Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
-N(R4)C(=NR4)-R6 / -NR4CO2R6, -N(R4)SO2R6, -N(R4)SO2N(R4)2, -0-C(O)R5, -OC(O)N(R4)2/ -C(O)R5, -CO2R5, -C(O)N(R4)2, -C(O)N(R4)-OR5, -C(O)N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-N(R4)-C(O)R5, -C(=NR4)-N(R4)2, -C(=NR4)-OR5, -C(=NR4)-N(R4)-OR5,or -C(R6)=N-OR5; and
R is selected from the group consisting of C1-4 aliphatic, C1-4 fluoroaliphatic, halo, -OH, -0(C1-4 aliphatic), -NH2, -NH(C1-4 aliphatic), and -N(C1-4 aliphatic).,.
10. The compound of claim 9, having the formula (IV):
Figure imgf000229_0001
or a pharmaceutically acceptable salt thereof; wherein: G1 is -O- or -NH-;
X and X are each independently CH or N, provided that X and X are not both N;
Rb is selected from the group consisting of halo, -N(R4)2, -CO2R5, -C(O)-N(R4)2,
-C(O)-N(R4)-OR5, -N(R4)C(O)R5, -N(R4)C(O)-OR5, -N(R4)C(O)-N(R4)2, -N(R4)SO2R6, -C(=NR4)N(R4)2, and -C(=NR4)N(R4)-OR5;
R is selected from the group consisting of C1-4 aliphatic, C1-4 fluoroaliphatic, halo, -OH, -0(C1-4 aliphatic), -NH2, -NH(C1-4 aliphatic), and -N(C1-4 aliphatic).,; g is O or 1; and h is O or 1.
11. The compound of claim 10, wherein: Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Rb is selected from the group consisting of halo, -N(R4")(R4z), -CO2R5", -C(O)-N(R4") (R4z), -C(O)-N(R4")-OR5", -N(R4x)C(O)R5x, -N(R4")C(O)-OR5x, -N(R4x)C(O)-N(R4x)(R4z), -N(R4x)SO2R6x, -C(=NR4x)N(R4x)(R42), and -C(=NR4x)N(R4x)-OR5x;
R4x is hydrogen, C1-4 alkyl, C1-4 fluoroalkyl, or C6-10 ar(C1-4)alkyl, the aryl portion of which may be optionally substituted;
R z is hydrogen, C1 4 alkyl, C1-4 fluoroalkyl, C6-10 ar(C1-4)alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring; or
R x and R , taken together with the nitrogen atom to which they are attached, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S; and each R x independently is hydrogen, C1-4 alkyl, C1-4 fluoroalkyl, C6-10 ar(Cw)alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring; and each R independently is C1-4 alkyl, C1-4 fluoroalkyl, C6-10 ar(C1-4)alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring.
12. The compound of claim 11, wherein Rb is -N(R4x)(R4z), -C(O)-N(R4x)(R4z), or -C(=NH)N(R X)(R z), and R x and R , taken together with the nitrogen atom to which they are attached, form a morpholinyl, piperidinyl, piperazinyl, or pyrrolidinyl ring.
13. The compound of claim 11, wherein R is selected from the group consisting of halo, -NH(R4z), -N(R^)(R42), -CO2R5x, -C(O)-NH(R42), -C(O)-N(R4") (R4z), -C(O)-NH-OR5", -NHC(O)R5", -NHC(O)-OR5x, -NHC(O)-N(R^)(R42), -NHSO2R6", -C(=NH)N(R4x)(R4z), -C(=NH)N(R4")(R42), and -C(=NH)NH-OR5x.
14. The compound of claim 9, having the formula (IV): Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000231_0001
or a pharmaceutically acceptable salt thereof; wherein: G1 is -O- or -NH-;
X and X are each independently CH or N, provided that X and X are not both N;
R^s -V^-R^ or -V^-R2";
V1 is -N(R4)-, -N(R4)-C(O)-, -N(R4JSO2R6, -N(R4)C(O)-OR5, -C(O)N(R4)-, -C(=NR4)N(R4)-, or -N(R4)-C(=NR4)-;
T is a C1-4 alkylene chain optionally substituted with -F, C1 3 alkyl, or C1-3 fluoroalkyl;
,1b .
R is an optionally substituted C3 6 cycloaliphatic or an optionally substituted phenyl, pyrrolyl, imidazolyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, pyrazolyl, triazolyl, tetrazolyl, oxadiazolyl, thiadiazolyl, pyrrolinyl, imidazolinyl, pyrazoHnyl, pyrrolidinyl, imidazolidinyl, pyrazolidinyl, piperidinyl, morphoHnyl, piperazinyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, or tetrahydropyrimidinyl ring;
R2b is -N(R4)2/ -NR4C(O)R5, -C(O)N(R4)2/ -CO2R5, or -OR5;
R is selected from the group consisting of C1-4 aliphatic, C1-4 fluoroaliphatic, halo, -OH, -0(C1-4 aliphatic), -NH2, -NH(C1-4 aliphatic), and -N(C14 aliphatic)2; g is 0 or 1; and h is 0 or 1.
15. The compound of claim 14, wherein: V1 is -N(R4x)-, -N(R4x)-C(O)-, -C(O)N(R4")-, -C(=NR4x)N(R4x)-, or -N(R4x)-C(=NR4x)-; Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
R is an optionally substituted C36 cycloaliphatic or an optionally substituted pyrrolidinyl, piperidinyl, moψholiriyl, or piperazinyl; and
R2b is -N(R4x)(R4z), -NR4xC(O)R5x, -C(O)N(R4") (R42), -CO2R5x, or -OR5x;
R x is hydrogen, C1 4 alkyl, C1-4 fluoroalkyl, or C6-10 ar(CM)alkyl, the aryl portion of which may be optionally substituted;
R4z is hydrogen, C1-4 alkyl, C1-4 fluoroalkyl, C6-10 ar(C1-4)alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring; or
R x and R , taken together with the nitrogen atom to which they are attached, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S; and each R independently is hydrogen, C1-4 alkyl, C1-4 fluoroalkyl, C6-10 ar(Cα 4)alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring.
1 9 1
16. The compound of claim 15, wherein X and X are each CH and V is -C(O)-NH- or -NH-C(O)-.
17. The compound of claim 16, wherein R is selected from the group consisting of:
Figure imgf000232_0001
s is 2 or 3; and Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
t is 1, 2, or 3.
18. The compound of claim 9, having the formula (IV):
Figure imgf000233_0001
or a pharmaceutically acceptable salt thereof; wherein: G1 is -O- or -NH-;
1 2 1 9
X and X are each independently CH or N, provided that X and X are not both N;
R _b i .s - —T1 - -R,1b or - -Tpi - rR,2b ;
T is a C1-6 alkylene chain optionally substituted with -F, C1 3 alkyl, or C13 fluoroalkyl, wherein the alkylene chain optionally is interrupted by -N(R4)-, -C(O)-N(R4)-/ -C(=NR4)-N(R4h -N(R4)-C(O)-, or -N(R4)-C(=NR4)-;
R is an optionally substituted C36 cycloaliphatic or an optionally substituted phenyl, pyrrolyl, imidazolyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, pyrazolyl, triazolyl, tetrazolyl, oxadiazolyl, thiadiazolyl, pyrroBnyl, imidazolinyl, pyrazolinyl, pyrrolidinyl, imidazolidinyl, pyrazolidinyl, piperidinyl, morpholinyl, piperazinyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, or tetrahydropyrimidinyl ring;
R2b is -OR5, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4)2, -C(O)N(R4)-OR5, -C(O)N(R4)2, -N(R4)-CO2R5, -N(R4)-C(=NR4)-R5 or -C(=NR4)-N(R4)2;
R is selected from the group consisting of C1-4 aliphatic, C fluoroaliphatic, halo, -OH, -0(C1-4 aliphatic), -NH2, -NH(C14 aliphatic), and -N(C1-4 aliphatic)2; g is 0 or 1; and Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
h is 0 or 1.
19. The compound of claim 18, wherein:
Rb is selected from the group consisting of -(CH2)^R1", -(CH2)^R2", -(CH2)^ -(CH2)rN(R4x)-(CH2)rRlx, -(CH2)fN(R4x)-(CH2),;-R2x / -(CH2)?-N(R4x)-(CH2)rR2y -(CH2)fN(R4x)C(=NR4x)-(CH2)?-Rlx, -(CH2)7-N(R4x)C(=NR4x)-(CH2)fR2x, -(CH2)rN(R4x)C(=NR4x)-(CH2)(;-R2y;
Ix
R is an optionally substituted phenyl, piperidinyl, piperazinyl, morpholinyl, or pyrrolidinyl ring;
R2x is -C(O)N(R4x)(R4z);
R2y is -N(R^)(R42), -NR4xC(O)R5x, -N(R4x)-CO2R5x, -N(R4x)-C(=NR4x)-R5x or -OR5x;
,4x .
R is hydrogen, C14 alkyl, C14 fluoroalkyl, or C6 10 ar(C14)alkyl, the aryl portion of which may be optionally substituted;
,4z .
R is hydrogen, C14 alkyl, C14 fluoroalkyl, C540 ar(C14)alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring; or
R x and R z, taken together with the nitrogen atom to which they are attached, form an optionally substituted morpholinyl, piperidinyl, piperazinyl, or pyrrolidinyl ring;
Sx
R is hydrogen, C14 alkyl, C14 fluoroalkyl, or C6-10 ar(C14)alkyl, the aryl portion of which may be optionally substituted.
R is selected from the group consisting of C1 4 aliphatic, C14 fluoroaliphatic, halo, -OH, -O(C14 aliphatic), -NH2, -NH(C14 aliphatic), and -N(C14 aliphatic)2; q is 1, 2, or 3; and s is 2 or 3.
20. The compound of claim 9, having the formula (V): Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000235_0001
or a pharmaceutically acceptable salt thereof; wherein: G1 is -O- or -NH-;
X and X are each independently CH or N, provided that X and X are not both N; Ring D is an aryl, heteroaryl, heterocyclyl, or cycloaliphatic ring; each substitutable saturated ring carbon atom in Ring D is unsubstituted or is substituted with =O, =S, =C(R5)2, =N-OR5, =N-R5, or -Rd; each substitutable unsaturated ring carbon atom in Ring D is unsubstituted or is substituted with -Rd; each substitutable ring nitrogen atom in Ring D is unsubstituted or is substituted with
-C(O)R5, -C(O)N(R4)2/ -CO2R6, -SO2R6, -SO2(NR4)2, an optionally substituted CH0 aryl, or a C1A aliphatic optionally substituted with R or R ; one ring nitrogen atom in Ring D optionally is oxidized; each Rd independently is halo, -NO2, -CN, -C(R5)=C(R5)2, -C≡C-R5, -OR5, -SR6, -S(O)R6, -SO2R6, -SO2N(R4)2, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4),, -N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-R6, -NR4CO2R6, -N(R4)SO2R6, -N(R4)SO2N(R4)2, -O-C(O)R5, -OC(O)N(R4)2, -C(O)R5, -CO2R5, -C(O)N(R4)2, -C(O)N(RVOR5, -C(O)N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-N(R4)-C(O)R5, -C(=NR4)-N(R4)2, -C(=NR4)-OR5, -C(=NR4)-N(RVθR5, -C(R )=N-OR , or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl; Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
R8b is selected from the group consisting of C1-4 aliphatic, C1-4 fluoroaliphatic, halo, -OH, -0(C1-4 aliphatic), -NH2, -NH(C1-4 aliphatic), and -N(C1-4 aliphatic),,; and gis O or 1.
21. The compound of claim 20, wherein Ring D is an optionally substituted heteroaryl or heterocyclyl selected from the group consisting of azetidinyl, pyrrolyl, imidazolyl, oxazolyl, thiazolyl, isoxazolyl, isofhiazolyl, pyrazolyl, triazolyl, tetrazolyl, oxadiazolyl, thiadiazolyl, pyrrolinyl, imidazolinyl, pyrazolinyl, pyrrolidinyl, imidazolidinyl, pyrazolidinyl, piperidinyl, morpholinyl, piperazinyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, and tetrahydropyrimidinyl.
22. The compound of claim 21, wherein: Ring D is substituted with 0-1 Rd and 0-1 R8d;
R is selected from the group consisting of C1-4 aliphatic, C1-4 fluoroaliphatic, halo, -R , -R ,
T is a C1-4 alkylene chain optionally substituted with one or two substituents independently selected from the group consisting of C1-3 aliphatic, C1-3 fluoroaliphatic, -F, -OH, -O(C1-4 alkyl), -CO2H, -CO2(C1-4 alkyl), -C(O)NH2, and -C(O)NH(C1-4 alkyl);
V3 is -O-, -N(R4)-/ -N(R4)C(O)-, -C(O)N(R4)-/ -C(=NR4)-N(R4)-, -C(NR4)=N(R4)-/ or -N(R4)C(=NR4)-;
each R independently is an optionally substituted aryl, heteroaryl, heterocyclyl, or cycloaliphatic ring; each R2d independently is -NO2, -CN, -C(R5)=C(R5)2, -C≡C-R5, -OR5, -SO2R6, -SO2N(R4)2, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4),, -N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-R6, -NR4CO2R6, -N(R4)SO2R6, -N(R4)SO2N(R4)2, -O-C(O)R5, -OC(O)N(R4)2, -C(O)R5, -CO2R5, -C(O)N(R4)2, -C(O)N(R4)-OR5, -C(O)N(R4)C(=NR4)-N(R4)2, Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
~N(R4)C(=NR4)-N(R4)-C(O)R5, -C(=NR4)-N(R4)2, -C(=NR4)-OR5, -C(=NR4)-N(R4)-OR5,or -C(R6)=N-OR5; and
R is C1-4 aliphatic, C1-4 fluoroaliphatic, halo, -OH, -0(C1-4 aliphatic), -NH2, -NH(C1-4 aliphatic), or -N(C1-4 aliphatic)2.
23. The compound of claim 22, wherein each R independently is selected from the group consisting of -OR5, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4),, -O-C(O)R5, -CO2R5, -C(O)R5, -C(O)N(R4)2, -C(O)N(R4)-OR5, and -C(=NR4)-N(R4)2.
24. The compound of claim 20, wherein Ring D is selected from the group consisting of:
Figure imgf000237_0001
Rv is hydrogen, halo, C1-4 aliphatic, C1-4 fluoroaliphatic, -OR5, -N(R4)2, -CO2R5, -C(O)N(R4)2, -T^-OR5, -T^-NCR^ -T3-CO2R5, -T3-C(O)N(R4)2, or an optionaUy substituted 5- or 6- membered aryl or heteroaryl; each Rw independently is hydrogen, halo, C1-4 aliphatic, C1-4 fluoroaliphatic, -OR5, -N(R4)2, -CO2R5, -C(O)N(R4)2, -T3-OR5, -T^-N(R4),, -T'-CO.R5, -T3-C(O)N(R4)2, or an optionaUy substituted 5- or 6-membered aryl or heteroaryl; each Rx independently is hydrogen, fluoro, C1 4 aliphatic, C1-4 fluoroaliphatic, -CO2R , -C(O)N(R4)2, -T^N(R4),, -T'-OR5, -T3-CO2R5, or -T3-C(O)N(R4)2; Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Ry is hydrogen, halo, C1-4 aliphatic, C1-4 fluoroaliphatic, -OR , -N(R4)2, -CO2R5, -C(O)N(R )2, -T'-OR5, -^^(R4),, -T^-CO2R5, or -T3-C(O)N(R4)2;
each R2 independently is hydrogen, fluoro, C1-4 aliphatic, or C1-4 fluoroaliphatic; and
T is a C1-4 alkylene chain optionally substituted with one or two substituents independently selected from the group consisting of C1-3 aliphatic, C1-3 fluoroaliphatic, -F, -OH, -0(C1-4 alkyl), -CO2H, -CO2(C1-4 alkyl), -C(O)NH2, and -C(O)NH(C1-4 alkyl).
25. The compound of claim 20, wherein Ring D is selected from the group consisting of:
Figure imgf000238_0001
Rv is hydrogen, halo, C1-4 aliphatic, C1-4 fluoroaliphatic, -(CH2)p-OR5x, -(CH2)p-N(R4x)(R4z), -(CH2)p-CO2R5x, -(CH2)p-C(O)N(R4x)(R4z), or an optionally substituted phenyl, pyridyl, or pyrimidinyl group;
each Rw independently is hydrogen, an optionally substituted phenyl, pyridyl, or
5x pyrimidinyl group, halo, C1-4 aliphatic, C1-4 fluoroaliphatic, -(CH2)p-OR , -(CH2)p-N(R4x)(R4z), -(CH2)p-CO2R5x, -(CH2)p-C(O)N(R4x)(R4z), -(CH2)?-N(R4x)-(CH2)fRlx, -(CH2)?-N(R4x)-(CH2)?-R2x, -(CH2)fN(R4x)-(CH2)s-R2y -(CH2)fN(R4x)C(=NR4x)-(CH2)fRlx, -(CH2),- N(R4x)C(=NR4x)-(CH2)f R2x, or -(CH2)9-N(R4x)C(=NR4x)-(CH2)?-R2y;
each Rx independently is hydrogen, fluoro, C1-4 aliphatic, C1-4 fluoroaliphatic, -(CH2)p-CO2R5x, -(CH2)p-C(O)N(R4x)(R4z), -(CH2)r-N(R4x)(R4z), or -(CH2)rOR5x;
Ry is hydrogen, fluoro, C1-4 aliphatic, C1-4 fluoroaliphatic, -(CH^-NtR^XR*2), -(CH2)p-OR5x, -(CH2)p-CO2R5x, -(CH2)p-C(O)N(R4x)(R4z);
each Rz independently is hydrogen, fluoro, C1 4 aliphatic, or C14 fluoroaliphatic; Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
each R x independently is an optionally substituted phenyl, piperidinyl, piperazinyl, morpholinyl, or pyrrolidinyl ring; each R2x independently is -C(O)N(R^)(R42);
each R2y independently is -N(R4") (R4z), -NR4xC(O)R5x, -N(R4x)-CO2R5x, -N(R4x)-C(=NR4x)-R5x or -OR5x;
each R x independently is hydrogen, C1 4 alkyl, C1-4 fluoroalkyl, or C6-10 ar(CM)alkyl, the aryl portion of which may be optionally substituted; each R z independently is hydrogen, C1-4 alkyl, C1-4 fluoroalkyl, C6-10 ar(C1-4)alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring; or
R " and R , taken together with the nitrogen atom to which they are attached, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S; each R5x independently is hydrogen, C1-4 alkyl, C1-4 fluoroalkyl, C6-10 ar(Cj_4)alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring; γ is 0, 1, or 2; q is 1, 2, or 3; r is 1 or 2; and s is 2 or 3.
26. The compound of claim 25, wherein: X and X are each CH; and Ring D is selected from the group consisting of: Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000240_0001
27. The compound of claim 1, wherein: Ring C is substituted on its substitutable ring carbon atoms with 0-2 Rc and 0-2 R c;
each Rc independently is halo, -NO2, -CN, -C(R5)=C(R5)2, -C≡C-R5, -OR5, -SR6, -S(O)R6, -SO2R6, -SO2N(R4)2, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4),, -N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-R6, -NR4CO2R6, -N(R4)SO2R6, -N(R4)SO2N(R4)2, -O-C(O)R5, -OC(O)N(R4)2, -C(O)R5, -CO2R5, -C(O)N(R4)2, -C(O)N(R4)-OR5, -C(O)N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-N(R4)-C(O)R5, -C(=NR4)-N(R4)2, -C(=NR4)-OR5, -C(=NR4)-N(R4)-OR5, -C(R6)=N-OR5, or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl; or two adjacent Rc, taken together with the intervening ring atoms, form an optionally substituted fused 5- or 6-membered aromatic or non-aromatic ring having 0-3 ring heteroatoms independently selected from the group consisting of O, N, and S;
8c each R independently is selected from the group consisting of C1-4 aliphatic, C1-4 fluoroaliphatic, -0(C1-4 alkyl), -0(C1-4 fluoroalkyl), and halo; each substitutable ring nitrogen atom in Ring C is unsubstituted or is substituted with
-C(O)R5, -C(O)N(R4)2, -CO2R6, -SO2R6, -SO2N(R4)2, an optionally substituted C6-10 aryl, or a
C1-4 aliphatic optionally substituted with -F, -OH, -0(C1-4 alkyl), -CN, -N(R -.4 \. , -C(O)(C1-4 alkyl), -CO2H, -CO2(C1-4 alkyl), -C(O)NH2, -C(O)NH(C1-4 alkyl), or an optionally substituted C6-10 aryl ring; and one ring nitrogen atom in Ring C optionally is oxidized.
28. The compound of claim 27, wherein each Rc independently is selected from the group consisting of C1-6 aliphatic, C1-6 fluoroaliphatic, halo, -R c, -R c, -T2-R2c, and -T2-Rlc; Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
T2 is a C1-6 alkylene chain optionally substituted with R3a or R3b, wherein the alkylene chain optionally is interrupted by -C(R5)=C(R5)-, -CsC-, -O-, -S-, -S(O)-, -S(O)2-, -SO2N(R4)-, -N(R4)-, -N(R4)C(O)-, -NR4C(O)N(R4)-, -N(R4)CO2- , -N(R4)SO2-, -C(O)N(R4)-, -C(O)-, -CO2-, -OC(O)-, or -OC(O)N(R4)-, and wherein T2 or a portion thereof optionally forms part of a 3-7 membered ring; each R c independently is an optionally substituted aryl, heteroaryl, heterocyclyl, or cycloaliphatic ring; each R2c independently is -NO2, -CN, -C(R5)=C(R5)2, -C≡C-R5, -OR5, -SR6, -S(O)R6, -SO2R6, -SO2N(R4)2, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4),, -N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-R6, -NR4CO2R6, -N(R4)SO2R6, -N(R4)SO2N(R4)2, -O-C(O)R5, -OC(O)N(R4)2, -C(O)R5, -CO2R5, -C(O)N(R4)2, -C(O)N(R4)-OR5, -C(O)N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-N(R4)-C(O)R5, -C(=NR4)-N(R4)2, -C(=NR4)-OR5, -C(=NR4)-N(R4)-OR5, or -C(R6)=N-OR5;
each R a independently is selected from the group consisting of -F, -OH, -0(C14 alkyl), -CN, -N(R4)2, -C(O)(C1-4 alkyl), -CO2H, -CO2(C1., alkyl), -C(O)NH2, and -C(O)NH(C1-4 alkyl);
each R independently is a C1-3 aliphatic optionally substituted with R a or R , or two substituents R on the same carbon atom, taken together with the carbon atom to which they are attached, form a 3- to 6-membered cycloaliphatic ring; each R independently is hydrogen or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl group; or two R on the same nitrogen atom, taken together with the nitrogen atom, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S; each R ,5 i .ndependently is hydrogen or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl group; Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
each R independently is an optionally substituted aliphatic, aryl, or heteroaryl group; and each R independently is an optionally substituted aryl or heteroaryl ring;
29. The compound of claim 28, wherein Ring C is an optionally substituted phenyl, furanyl, thienyl, pyrrolyl, oxazolyl, thiazolyl, imidazolyl, pyrazolyl, isoxazolyl, isofhiazolyl, oxadiazolyl, triazolyl, thiadiazolyl, pyridyl, pyridazinyl, pyrirnidinyl, pyrazinyl, or triazinyl, wherein one ring nitrogen atom in Ring C is optionally oxidized.
30. The compound of claim 28, wherein:
Ring C is a 5- or 6-membered heteroaryl substituted with 0-2 Rc; and
each Rc independently is selected from the group consisting of -halo, C1-4 alkyl,
C14 fluoroalkyl, -0(C1-4 alkyl), and -O(CM fluoroalkyl), or two adjacent Rc, taken together with the intervening ring atoms, form an optionally substituted fused 5- or 6-membered aromatic or non-aromatic ring having 0-3 ring heteroatoms selected from the group consisting of O, N, and S.
31. The compound of claim 28, wherein: Ring C is phenyl substituted with 0-2 Rc and 0-1 R8c;
each Rc independently is selected from the group consisting of C1-4 aliphatic,
C1-4 fluoroaliphatic, halo, -R2c and -T2-R2c; or two adjacent Rc, taken together with the intervening ring atoms, form an optionally substituted fused 5- or 6-membered aromatic or non-aromatic ring having 0-3 ring heteroatoms independently selected from the group consisting of O, N, and S;
T is a C1-4 alkylene chain optionally substituted with one or two groups independently selected from -F, C14 aliphatic, and C1-4 fluoroaliphatic; and
,2c . each R independently is -CN, -C(R )=C(R )2, -OC-R , -OR , -SR , -N(R )2, -NR C(O)R , -NR4C(O)N(R4)2, -NR4CO2R6, -CO2R5, or -C(O)N(R4)2; and Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
each R8c independently is selected from the group consisting of C1-4 aliphatic, C1-4 fluoroaliphatic, -C)(C1-4 alkyl), -Q(C1-4 fluoroalkyl), and halo.
32. The compound of claim 30, wherein: each Rc independently is halo, -CN, -C(R5x)=C(R5x)(R5y), -C≡C-R5y, -OR5y, -SR6x, -CO2R5x,
-C(O)N(R X)(R y), or a C1-4 aliphatic or C1-4 fluoroaliphatic optionally substituted with one or two substituents independently selected from the group consisting of -OR x, -N(R4x)(R4y), -SR6x, -CO2R5x, or -C(O)N(R4") (R4y); or two adjacent Rc, taken together with the intervening ring atoms, form an optionally substituted fused 5- or 6-membered aromatic or non-aromatic ring having 0-3 ring heteroatoms independently selected from the group consisting of O, N, and S;
R x is hydrogen, C1-4 alkyl, C1-4 fluoroalkyl, or C6-10 ar(C1-4)alkyl, the aryl portion of which may be optionally substituted, or two R on the same nitrogen atom, taken together with the nitrogen atom, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S;
R y is hydrogen, C6-10 ar(C1-4)alkyl, the aryl portion of which may be optionally substituted, an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring, or a C1-4 alkyl or C1-4 fluoroalkyl optionally substituted with one or two substituents independently selected from the group consisting of -OR x, -N(R λ)2, -CO2R λ, or -C(O)N(R4x)2; or
R x and R y, taken together with the nitrogen atom to which they are attached, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S; each R x independently is hydrogen, C1-4 alkyl, C1-4 fluoroalkyl, C6-10 ar(C1-4)alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring; Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
each R y independently is hydrogen, an optionally substituted C6-10 aryl, a C6.loar(C1_4)alkyl/ the aryl portion of which may be optionally substituted, or a C1 4 alkyl "or C1-4 fluoroalkyl optionally substituted with one or two substituents independently selected from the group consisting of -OR5x, -N(R4x)2, -CO2R5x, or -C(O)N(R4x)2; and
,6x . each R independently is C1-4 alkyl, C1-4 fluoroalkyl, C6-10 ar(CM)alkyl/ the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring.
33. The compound of claim 32, wherein Ring C is selected from the group consisting of:
Figure imgf000244_0001
each Rc independently is halo, -CN,
Figure imgf000244_0002
,5x
-CO2R", -C(O)N(R )(R y), or a C1-4 aliphatic or C1-4 fluoroaliphatic optionally substituted with one or two substituents independently selected from the group consisting of -OR x, -N(R4x)(R4y), -SR6x, -CO2R5x, or -C(O)N(R4x)(R4y); or two adjacent Rc, taken together with the intervening ring atoms, form an optionally substituted fused 5- or 6-membered aromatic or non-aromatic ring having 0-3 ring heteroatoms independently selected from the group consisting of O, N, and S;
-.c .
R is C1-4 aliphatic, C1-4 fluoroaliphatic, halo, -CN, -OH, -O(C1-4 alkyl), -O(C1-4 fluoroalkyl), -S(C1-4 alkyl), -NH2, -NH(C1-4 alkyl), or -N(C1-4 alkyl)2; and
,8c .
R is C1-4 aliphatic, C1-4 fluoroaliphatic, or halo.
34. The compound of claim 33, wherein Ring C is selected from the group consisting of: Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Figure imgf000245_0001
35. A compound of claim I1 having the formula (VZ):
Figure imgf000245_0002
or a pharmaceutically acceptable salt thereof; wherein:
G -.1 i .s -O- or -NH-;
X and X are each independently CH or N, provided that X and X are not both N; one ring nitrogen atom in Ring B optionally is oxidized;
Rm is hydrogen, fluoro, -OR5, -C(O)R5, -C(O)N(R4)2, -CO2R5, -SO2R6, -SO2N(R4)2, or an optionally substituted C1-1 aliphatic; Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
Rn is hydrogen, fluoro, -C(O)R5, -C(O)N(R4)2, -CO2R5, -SO2R6, -SO2N(R4)2, or an optionally substituted C1-4 aliphatic;
Ring A is substituted with 0-2 Ra;
each Ra independently is -F, -Cl, -NO2, -CH3, -CF3, -OCH3, -OCF3, -SCH3, -SO2CH3, -CN, -CO2H, -C(O)NH2, or -C(O)NHCH3;
R is selected from the group consisting of C14 aliphatic, C1-4 fluoroaliphatic, halo, -R , -R , -t-R^ -T'-R2", -V1Y-R1", and -V1Y-R2";
T is a C1-4 alkylene chain optionally substituted with one or two substituents independently selected from the group consisting of C1-3 aliphatic, C1-3 fluoroaliphatic, -F, -OH, -O(C1-4 alkyl), -CO2H, -CO2(C1-4 alkyl), -C(O)NH2, and -C(O)NH(C1-4 alkyl), wherein the alkylene chain optionally is interrupted with -N(R4)-, -C(=NR4)-N(R4)-, -C(NR4)=N(R4)-, -N(R4)-C(=NR4)-, -N(R4)-C(O)-, or -C(O)N(R4)-
V1 is -C(R5)=C(R5)-, -OC-, -O-, -N(R4)-, -N(R4)C(O)-, -C(O)N(R4)-, -C(=NR4)-N(R4)-, or -C(NR4)=N(R4)-;
each R independently is an optionally substituted aryl, heteroaryl, heterocyclyl, or cycloaliphatic ring; each R2b independently is -NO2, -CN, -C(R5)=C(R5)2, -C≡C-R5, -OR5, -SO2R6, -SO2N(R4)2, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4),, -N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-R6, -NR4CO2R6, -N(R4)SO2R6, -N(R4)SO2N(R4)2, -O-C(O)R5, -OC(O)N(R4)2, -C(O)R5, -CO2R5, -C(O)N(R4)2, -C(O)N(R4)-OR5, -C(O)N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-N(R4)-C(O)R5, -C(=NR4)-N(R4)2, -C(=NR4)-OR5, -C(=NR4)-N(R4)-OR5,or-C(R6)=N-OR5;
R is selected from the group consisting of C1-4 aliphatic, C1-4 fluoroaliphatic, halo, -OH, -0(C1-4 aliphatic), -NH2, -NH(C1-4 aliphatic), and -N(C1-4 aliρhatic)2; Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
each Rc independently is selected from the group consisting of C1 6 aliphatic, Cα.6 fluoroaliphatic, halo, -Rlc, -R2c, -T2-R2c, and -T2-Rlc;
T is a C1 6 alkylene chain optionally substituted with R a or R , wherein the alkylene chain optionally is interrupted by -C(R5)=C(R5)-/ -CsC-, -O-, -S-, -S(O)-, -S(O)2-, -SO2N(R4)-/ -N(R4)-/ -N(R4)C(O)-, -NR4C(O)N(R4)-, -N(R4)CO2-, -N(R4)SO2-, -C(O)N(R4)-, -C(O)-, -CO2-, -OC(O)-, or -OC(O)N(R4)-, and wherein T2 or a portion thereof optionally forms part of a 3-7 membered ring;
,1c . each R independently is an optionally substituted aryl, heteroaryl, heterocyclyl, or cycloaliphatic ring;
,2c . each R" independently is -NO2, -CN, -C(Rl=C(RO2, -OC-R , -OR3, -SR , -S(O)R", -SO2R , -SO2N(R4)2, -N(R4)2, -NR4C(O)R5, -NR4C(O)N(R4),, -N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-R6, -NR4CO2R6, -N(R4)SO2R6, -N(R4)SO2N(R4)2, -O-C(O)R5, -OC(O)N(R4)2, -C(O)R5, -CO2R5, -C(O)N(R4),, -C(O)N(R4)-OR5, -C(O)N(R4)C(=NR4)-N(R4)2, -N(R4)C(=NR4)-N(R4)-C(O)R5, -C(=NR4)-N(R4)2, -C(=NR4)-OR5, -C(=NR4)-N(R4)-OR5, or -C(R6)=N-OR5;
each R a independently is selected from the group consisting of -F, -OH, -O(CM alkyl), -CN, -N(R4)2, -C(O)(C1., alkyl), -CO2H, -CO2(C1., alkyl), -C(O)NH2, and -C(O)NH(C1-4 alkyl);
each R independently is a Cα_3 aliphatic optionally substituted with R a or R , or two substituents R on the same carbon atom, taken together with the carbon atom to which they are attached, form a 3- to 6-membered cycloaliphatic ring; each R c independently is selected from the group consisting of C1-4 aliphatic, C1-4 fluoroaliphatic, -0(C1-4 alkyl), -0(C1-4 fluoroalkyl), and halo;
each R independently is hydrogen or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl group; or two R on the same nitrogen atom, taken together with the Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
nitrogen atom, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms selected from N, O, and S; each R independently is hydrogen or an optionally substituted aliphatic, aryl, heteroaryl, or heterocyclyl group; each R independently is an optionally substituted aliphatic, aryl, or heteroaryl group;
7 each R independently is an optionally substituted aryl or heteroaryl ring; g is 0 or 1; h is 0 or 1; j is 0 or 1; and k is 0, 1, or 2.
36. The compound of claim 35, wherein: Rm is hydrogen, and Rn is hydrogen, fluoro, -CH3, or -CH2OH;
X1 and X2 are each CH;
Ring A has no substituents Ra;
each Rc independently is halo, -CN, -C(R5>C(R5x)(R5y), -C≡C-R5y, -OR5y, -SR6", -CO2R5x,
-C(O)N(R4x)(R4y), or a Cw aliphatic or C14 fluoroaliphatic optionally substituted with one or two substituents independently selected from the group consisting of -OR , -N(R4x)(R4y), -SR6x, -CO2R5x, or -C(O)N(R4x)(R4y); or two adjacent Rc, taken together with the intervening ring atoms, form an optionally substituted fused 5- or 6-membered aromatic or non-aromatic ring having 0-3 ring heteroatoms independently selected from the group consisting of O, N, and S;
R is hydrogen, C1-4 alkyl, C14 fluoroalkyl, or C6-10 a^C^alkyl, the aryl portion of which may be optionally substituted, or two R x on the same nitrogen atom, taken together with the nitrogen atom, form an optionally substituted 4- to 8-membered Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S;
R4y is hydrogen, C6-10 ar(C1-4)alkyl, the aryl portion of which may be optionally substituted, an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring, or a C alkyl or C1-4 fluoroalkyl optionally substituted with one or two substituents independently selected from the group consisting of -OR x, -N(R x)2, -CO2R5x, or -C(O)N(R4x)2; or
R x and R y, taken together with the nitrogen atom to which they are attached, form an optionally substituted 4- to 8-membered heterocyclyl ring having, in addition to the nitrogen atom, 0-2 ring heteroatoms independently selected from N, O, and S; each R x independently is hydrogen, C1-4 alkyl, C1-4 fluoroalkyl, C640 ar(CM)alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring; each R y independently is hydrogen, an optionally substituted C6-10 aryl, a
CMOar(CM)alkyl, the aryl portion of which may be optionally substituted, or a C1-4 alkyl or C1-4 fluoroalkyl optionally substituted with one or two substituents independently selected from the group consisting of -OR x, -N(R x)2, -CO2R x, or -C(O)N(R4x)2; and
each R independently is C1-4 alkyl, C1-4 fluoroalkyl, C6-10 ar(C1-4)alkyl, the aryl portion of which may be optionally substituted, or an optionally substituted 5- or 6-membered aryl, heteroaryl, or heterocyclyl ring.
37. A compound selected from the compounds listed in Table 1 or Table 2.
38. A pharmaceutical composition comprising a compound according to claim 1 and a pharmaceutically acceptable carrier. Attorney Docket No. MPI05-002P1RNWOM January 12, 2006
39. The pharmaceutical composition according to claim 38, formulated for administration to a human patient.
40. Use of a compound according to claim 1 for the treatment or prophylaxis of a human disorder.
41. The use according to claim 40, characterized in that the disorder is caused, mediated, or exacerbated by Raf kinase activity.
42. A method for the treatment or prophylaxis of cancer in a patient in need thereof, comprising administering to the patient a compound of claim 1.
PCT/US2006/001490 2005-01-14 2006-01-12 Cinnamide and hydrocinnamide derivatives with raf-kinase inhibitory activity WO2006076706A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
JP2007551462A JP2008527007A (en) 2005-01-14 2006-01-12 Cinnamide and hydrocinnamide derivatives having Raf-kinase inhibitory activity
CA002594860A CA2594860A1 (en) 2005-01-14 2006-01-12 Cinnamide and hydrocinnamide derivatives with raf-kinase inhibitory activity
AU2006204724A AU2006204724A1 (en) 2005-01-14 2006-01-12 Cinnamide and hydrocinnamide derivatives with raf-kinase inhibitory activity
EP06718548A EP1856053A1 (en) 2005-01-14 2006-01-12 Cinnamide and hydrocinnamide derivatives with raf-kinase inhibitory activity

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US64392805P 2005-01-14 2005-01-14
US60/643,928 2005-01-14
US71063505P 2005-08-23 2005-08-23
US60/710,635 2005-08-23

Publications (1)

Publication Number Publication Date
WO2006076706A1 true WO2006076706A1 (en) 2006-07-20

Family

ID=36177938

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2006/001490 WO2006076706A1 (en) 2005-01-14 2006-01-12 Cinnamide and hydrocinnamide derivatives with raf-kinase inhibitory activity

Country Status (6)

Country Link
US (1) US7652041B2 (en)
EP (1) EP1856053A1 (en)
JP (1) JP2008527007A (en)
AU (1) AU2006204724A1 (en)
CA (1) CA2594860A1 (en)
WO (1) WO2006076706A1 (en)

Cited By (41)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2007015809A2 (en) * 2005-07-22 2007-02-08 Merck & Co., Inc. Hiv reverse transcriptase inhibitors
WO2008030448A1 (en) * 2006-09-07 2008-03-13 Millennium Pharmaceuticals, Inc. Phenethylamide derivatives with kinase inhibitory activity
EP2179984A1 (en) * 2008-10-27 2010-04-28 Congenia S.r.l. Acrylamido derivatives useful as inhibitors of the mitochondrial permeability transition
JP2010515739A (en) * 2007-01-10 2010-05-13 アエリエ・ファーマシューティカルズ・インコーポレーテッド 6-aminoisoquinoline compounds
EP2303021A2 (en) * 2008-06-16 2011-04-06 University of Tennessee Research Foundation Compounds for the treatment of cancer
US7973164B2 (en) 2006-03-02 2011-07-05 Astrazeneca Ab Quinoline derivatives
JP2011527998A (en) * 2008-07-16 2011-11-10 ビトップ アーゲー Synthesis of cyclic amidine
US8153643B2 (en) 2004-10-12 2012-04-10 Astrazeneca Ab Quinazoline derivatives
US8450344B2 (en) 2008-07-25 2013-05-28 Aerie Pharmaceuticals, Inc. Beta- and gamma-amino-isoquinoline amide compounds and substituted benzamide compounds
US8455514B2 (en) 2008-01-17 2013-06-04 Aerie Pharmaceuticals, Inc. 6-and 7-amino isoquinoline compounds and methods for making and using the same
US8455647B2 (en) 2005-07-11 2013-06-04 Aerie Pharmaceuticals, Inc. 6-aminoisoquinoline compounds
US8716310B2 (en) 2009-05-01 2014-05-06 Aerie Pharmaceuticals, Inc. Dual mechanism inhibitors for the treatment of disease
US8809326B2 (en) 2006-09-20 2014-08-19 Aerie Pharmaceuticals, Inc. Isoquinolinone Rho kinase inhibitors
US8822513B2 (en) 2010-03-01 2014-09-02 Gtx, Inc. Compounds for treatment of cancer
US20150119586A1 (en) * 2012-05-08 2015-04-30 Ishihara Sangyo Kaisha, Ltd. Method for producing a substituted benzoic acid compound
US9029408B2 (en) 2008-06-16 2015-05-12 Gtx, Inc. Compounds for treatment of cancer
US9334242B2 (en) 2008-06-16 2016-05-10 Gtx, Inc. Compounds for treatment of cancer
US9409921B2 (en) 2008-06-27 2016-08-09 Celgene Avilomics Research, Inc. 2,4-disubstituted pyrimidines as kinase inhibitors
US9408885B2 (en) 2011-12-01 2016-08-09 Vib Vzw Combinations of therapeutic agents for treating melanoma
US9415043B2 (en) 2013-03-15 2016-08-16 Aerie Pharmaceuticals, Inc. Combination therapy
US9447049B2 (en) 2010-03-01 2016-09-20 University Of Tennessee Research Foundation Compounds for treatment of cancer
WO2016155359A1 (en) * 2015-03-27 2016-10-06 沈阳三生制药有限责任公司 Compound of 3-hydroxyl pyridine, preparation method thereof and pharmaceutical use thereof
US9492471B2 (en) 2013-08-27 2016-11-15 Celgene Avilomics Research, Inc. Methods of treating a disease or disorder associated with Bruton'S Tyrosine Kinase
US9549927B2 (en) 2012-12-21 2017-01-24 Celgene Avilomics Research, Inc. Heteroaryl compounds and uses thereof
US9604936B2 (en) 2010-08-10 2017-03-28 Celgene Car Llc Besylate salt of a BTK inhibitor
US9643927B1 (en) 2015-11-17 2017-05-09 Aerie Pharmaceuticals, Inc. Process for the preparation of kinase inhibitors and intermediates thereof
US9765038B2 (en) 2010-11-01 2017-09-19 Celgene Car Llc Heteroaryl compounds and uses thereof
US9987276B2 (en) 2008-06-27 2018-06-05 Celgene Car Llc Substituted 2,4-diaminopyrimidines as kinase inhibitors
WO2018146253A1 (en) 2017-02-10 2018-08-16 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and pharmaceutical compositions for the treatment of cancers associated with activation of the mapk pathway
WO2019133810A1 (en) 2017-12-28 2019-07-04 Tract Pharmaceuticals, Inc. Stem cell culture systems for columnar epithelial stem cells, and uses related thereto
US10434101B2 (en) 2010-11-01 2019-10-08 Celgene Car Llc Heterocyclic compounds and uses thereof
US10550087B2 (en) 2015-11-17 2020-02-04 Aerie Pharmaceuticals, Inc. Process for the preparation of kinase inhibitors and intermediates thereof
CN111233774A (en) * 2018-11-28 2020-06-05 鲁南制药集团股份有限公司 Amino pyrimidine compound
US10683293B2 (en) 2014-08-04 2020-06-16 Nuevolution A/S Optionally fused heterocyclyl-substituted derivatives of pyrimidine useful for the treatment of inflammatory, metabolic, oncologic and autoimmune diseases
US10858339B2 (en) 2017-03-31 2020-12-08 Aerie Pharmaceuticals, Inc. Aryl cyclopropyl-amino-isoquinolinyl amide compounds
US11351168B1 (en) 2008-06-27 2022-06-07 Celgene Car Llc 2,4-disubstituted pyrimidines useful as kinase inhibitors
US11389441B2 (en) 2016-08-31 2022-07-19 Aerie Pharmaceuticals, Inc. Ophthalmic compositions
US11427563B2 (en) 2018-09-14 2022-08-30 Aerie Pharmaceuticals, Inc. Aryl cyclopropyl-amino-isoquinolinyl amide compounds
US11447479B2 (en) 2019-12-20 2022-09-20 Nuevolution A/S Compounds active towards nuclear receptors
US11613532B2 (en) 2020-03-31 2023-03-28 Nuevolution A/S Compounds active towards nuclear receptors
US11780843B2 (en) 2020-03-31 2023-10-10 Nuevolution A/S Compounds active towards nuclear receptors

Families Citing this family (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006040526A1 (en) * 2004-10-12 2006-04-20 Astrazeneca Ab Quinazoline derivatives for use against cancer
US20090076075A1 (en) * 2006-03-02 2009-03-19 Frederic Henri Jung Quinoline derivatives
US8604031B2 (en) 2006-05-18 2013-12-10 Mannkind Corporation Intracellular kinase inhibitors
AU2008222807A1 (en) * 2007-03-08 2008-09-12 Plexxikon, Inc. PPAR active compounds
WO2010129053A2 (en) 2009-05-05 2010-11-11 Dana Farber Cancer Institute Egfr inhibitors and methods of treating disorders
EP2637502B1 (en) 2010-11-10 2018-01-10 Celgene CAR LLC Mutant-selective egfr inhibitors and uses thereof
CA2853498A1 (en) 2011-10-28 2013-05-02 Celgene Avilomics Research, Inc. Methods of treating a bruton's tyrosine kinase disease or disorder
CN104284584B (en) 2012-03-15 2019-06-04 西建卡尔有限责任公司 The salt of epidermal growth factor receptor kinase inhibitor
SG11201405691WA (en) 2012-03-15 2014-10-30 Celgene Avilomics Res Inc Solid forms of an epidermal growth factor receptor kinase inhibitor
CN103508961B (en) * 2012-06-26 2015-07-22 中美冠科生物技术(太仓)有限公司 Antitumor drug
US20150225369A1 (en) * 2012-08-29 2015-08-13 Merck Patent Gmbh Ddr2 inhibitors for the treatment of osteoarthritis
MX2015009952A (en) 2013-02-08 2015-10-05 Celgene Avilomics Res Inc Erk inhibitors and uses thereof.
US9415049B2 (en) 2013-12-20 2016-08-16 Celgene Avilomics Research, Inc. Heteroaryl compounds and uses thereof
EP3179858B1 (en) 2014-08-13 2019-05-15 Celgene Car Llc Forms and compositions of an erk inhibitor

Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0284632A1 (en) * 1987-03-30 1988-10-05 Shosuke Okamoto Phenylalanine derivative and proteinase inhibitor
WO1998022103A1 (en) * 1996-11-16 1998-05-28 Zeneca Limited Raf kinase inhibitors
US5763463A (en) * 1995-04-28 1998-06-09 Kumiai Chemical Industry Co., Ltd. Pyridine compounds which are useful as pesticides
US5990147A (en) * 1997-11-07 1999-11-23 Schering Corporation H3 receptor ligands of the phenyl-alkyl-imidazoles type
US6034251A (en) * 1997-11-07 2000-03-07 Schering Corporation Phenyl-alkyl-imidazoles
WO2001021595A1 (en) * 1999-09-21 2001-03-29 Astrazeneca Ab Quinazoline derivatives
WO2002024653A1 (en) * 2000-09-21 2002-03-28 Signal Pharmaceuticals, Inc. Compounds and methods for modulation of estrogen receptors
WO2004019941A1 (en) * 2002-08-27 2004-03-11 Merck Patent Gmbh Glycinamide derivatives as raf-kinase inhibitors
WO2004048343A1 (en) * 2002-11-28 2004-06-10 Schering Aktiengesellschaft Chk-, pdk- and akt-inhibitory pyrimidines, their production and use as pharmaceutical agents
EP1431267A1 (en) * 2001-08-09 2004-06-23 Ono Pharmaceutical Co., Ltd. Carboxylic acid derivative compounds and drugs comprising these compounds as the active ingredient

Family Cites Families (30)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
BE668367A (en)
US2415554A (en) * 1947-02-11 Oh nh-cc
CA1297633C (en) * 1985-09-27 1992-03-17 Shosuke Okamoto Phenylalanine derivative and proteinase inhibitor
JPH07113758B2 (en) * 1988-03-28 1995-12-06 富士写真フイルム株式会社 Silver halide photographic light-sensitive material
WO1989011852A1 (en) 1988-06-06 1989-12-14 Showa Denko Kabushiki Kaisha Agent for treating pancreatitis or the like
TW202452B (en) 1989-12-01 1993-03-21 Ciba Geigy Ag
US5356894A (en) * 1990-05-29 1994-10-18 Rodney Peter W Morpholinyl substituted [1,2,4]-triazolo[1,5-a]triazine as antagonist
EP0459702A1 (en) 1990-05-29 1991-12-04 Zeneca Limited Azole Derivatives
EP0501656B1 (en) * 1991-02-21 1997-01-22 Sankyo Company Limited New benzene derivatives having (NGF) production-promoting activity
JP2739260B2 (en) 1991-04-10 1998-04-15 富士写真フイルム株式会社 Silver halide photographic material
WO1993015043A1 (en) 1992-01-24 1993-08-05 Yoshitomi Pharmaceutical Industries, Ltd. Arylalkananilide compound and pharmaceutical use thereof
ES2079315B1 (en) * 1994-02-24 1996-10-16 Uriach & Cia Sa J NEW IMIDAZOPIRIDINES.
CA2214685C (en) 1995-03-10 2008-05-20 Berlex Laboratories, Inc. Benzamidine derivatives their preparation and their use as anti-coagulants
CA2185737A1 (en) * 1995-09-18 1997-03-19 Akira Yoshida Amid and urea derivatives
AUPO252896A0 (en) 1996-09-24 1996-10-17 Fujisawa Pharmaceutical Co., Ltd. Amidine derivatives
AU1296699A (en) 1997-11-07 1999-05-31 Schering Corporation H3 receptor ligands of the phenyl-alkyl-imidazoles type
ES2188029T3 (en) 1997-11-07 2003-06-16 Schering Corp PHENYL-RENT-IMIDAZOLS AS ANTAGONISTS OF THE H3 RECEIVER.
MXPA02008535A (en) 2000-03-06 2002-12-13 Warner Lambert Co 5 alkylpyrido[2,3 d]pyrimidines tyrosine kinase inhibitors.
EP1267874A2 (en) 2000-03-09 2003-01-02 Aventis Pharma Deutschland GmbH Therapeutic uses of ppar mediators
HUP0400651A2 (en) 2000-11-07 2004-06-28 Bristol-Myers Squibb Company Acid derivatives useful as serine protease inhibitors and pharmaceutical compositions containing them
US7235576B1 (en) * 2001-01-12 2007-06-26 Bayer Pharmaceuticals Corporation Omega-carboxyaryl substituted diphenyl ureas as raf kinase inhibitors
KR20040063897A (en) 2001-09-14 2004-07-14 툴라릭, 인코포레이티드 Linked biaryl compounds
MXPA05000020A (en) 2002-07-01 2005-12-05 Pharmacia & Upjohn Co Llc Inhibitors of hcv ns5b polymerase.
US20040198743A1 (en) * 2003-01-31 2004-10-07 Schering Corporation Methods for treating allergic skin and allergic ocular conditions using combinations of histamine receptor antagonists
DE602004016127D1 (en) 2003-03-07 2008-10-09 Lilly Co Eli ANTAGONISTS OF OPIOID RECEPTORS
DE10335725A1 (en) * 2003-08-05 2005-03-03 Bayer Cropscience Gmbh Safener based on aromatic-aliphatic carboxylic acid derivatives
GB0319124D0 (en) 2003-08-14 2003-09-17 Smithkline Beecham Corp Chemical compounds
EP1663204B1 (en) 2003-08-29 2014-05-07 Exelixis, Inc. C-kit modulators and methods of use
WO2005028467A1 (en) 2003-09-15 2005-03-31 Anadys Pharmaceuticals, Inc. Antibacterial 3,5-diaminopiperidine-substitute aromatic and heteroaromatic compounds
MX2007001215A (en) 2004-08-06 2007-04-17 Otsuka Pharma Co Ltd Aromatic compounds.

Patent Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0284632A1 (en) * 1987-03-30 1988-10-05 Shosuke Okamoto Phenylalanine derivative and proteinase inhibitor
US5763463A (en) * 1995-04-28 1998-06-09 Kumiai Chemical Industry Co., Ltd. Pyridine compounds which are useful as pesticides
WO1998022103A1 (en) * 1996-11-16 1998-05-28 Zeneca Limited Raf kinase inhibitors
US5990147A (en) * 1997-11-07 1999-11-23 Schering Corporation H3 receptor ligands of the phenyl-alkyl-imidazoles type
US6034251A (en) * 1997-11-07 2000-03-07 Schering Corporation Phenyl-alkyl-imidazoles
WO2001021595A1 (en) * 1999-09-21 2001-03-29 Astrazeneca Ab Quinazoline derivatives
WO2002024653A1 (en) * 2000-09-21 2002-03-28 Signal Pharmaceuticals, Inc. Compounds and methods for modulation of estrogen receptors
EP1431267A1 (en) * 2001-08-09 2004-06-23 Ono Pharmaceutical Co., Ltd. Carboxylic acid derivative compounds and drugs comprising these compounds as the active ingredient
WO2004019941A1 (en) * 2002-08-27 2004-03-11 Merck Patent Gmbh Glycinamide derivatives as raf-kinase inhibitors
WO2004048343A1 (en) * 2002-11-28 2004-06-10 Schering Aktiengesellschaft Chk-, pdk- and akt-inhibitory pyrimidines, their production and use as pharmaceutical agents

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
ATWELL, G. J. ET AL: "Potential antitumor agents. 13. Bisquaternary salts", JOURNAL OF MEDICINAL CHEMISTRY , 16(6), 673-8 CODEN: JMCMAR; ISSN: 0022-2623, 1973, XP002378754 *

Cited By (99)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8153643B2 (en) 2004-10-12 2012-04-10 Astrazeneca Ab Quinazoline derivatives
US8455647B2 (en) 2005-07-11 2013-06-04 Aerie Pharmaceuticals, Inc. 6-aminoisoquinoline compounds
WO2007015809A3 (en) * 2005-07-22 2007-03-29 Merck & Co Inc Hiv reverse transcriptase inhibitors
WO2007015809A2 (en) * 2005-07-22 2007-02-08 Merck & Co., Inc. Hiv reverse transcriptase inhibitors
US7807684B2 (en) 2005-07-22 2010-10-05 Merck Sharp & Dohme Corp. HIV reverse transcriptase inhibitors
US7973164B2 (en) 2006-03-02 2011-07-05 Astrazeneca Ab Quinoline derivatives
WO2008030448A1 (en) * 2006-09-07 2008-03-13 Millennium Pharmaceuticals, Inc. Phenethylamide derivatives with kinase inhibitory activity
US8809326B2 (en) 2006-09-20 2014-08-19 Aerie Pharmaceuticals, Inc. Isoquinolinone Rho kinase inhibitors
US10624882B2 (en) 2006-09-20 2020-04-21 Aerie Pharmaceuticals, Inc. Rho kinase inhibitors
US9890123B2 (en) 2007-01-10 2018-02-13 Aerie Pharmaceuticals, Inc. 6-aminoisoquinoline compounds
US10472327B2 (en) 2007-01-10 2019-11-12 Aerie Pharmaceuticals, Inc. 6-aminoisoquinoline compounds
JP2010515739A (en) * 2007-01-10 2010-05-13 アエリエ・ファーマシューティカルズ・インコーポレーテッド 6-aminoisoquinoline compounds
US9365518B2 (en) 2007-01-10 2016-06-14 Aerie Pharmaceuticals, Inc. 6-aminoisoquinoline compounds
US8455513B2 (en) 2007-01-10 2013-06-04 Aerie Pharmaceuticals, Inc. 6-aminoisoquinoline compounds
US10899714B2 (en) 2007-01-10 2021-01-26 Aerie Pharmaceuticals, Inc. 6-aminoisoquinoline compounds
US8921392B2 (en) 2007-01-10 2014-12-30 Aerie Pharmaceuticals, Inc. 6-aminoisoquinoline compounds
US8455514B2 (en) 2008-01-17 2013-06-04 Aerie Pharmaceuticals, Inc. 6-and 7-amino isoquinoline compounds and methods for making and using the same
US8871757B2 (en) 2008-01-17 2014-10-28 Aerie Pharmaceuticals, Inc. 6-and 7-amino isoquinoline compounds and methods for making and using the same
US8592465B2 (en) 2008-06-16 2013-11-26 University Of Tennessee Research Foundation Compounds for treatment of cancer
EP2303021A4 (en) * 2008-06-16 2012-03-14 Univ Tennessee Res Foundation Compounds for the treatment of cancer
US10865196B2 (en) 2008-06-16 2020-12-15 University Of Tennessee Research Foundation Compounds for treatment of cancer
AU2009330686B2 (en) * 2008-06-16 2014-07-03 The Ohio State University Research Foundation Compounds for the treatment of cancer
US9334242B2 (en) 2008-06-16 2016-05-10 Gtx, Inc. Compounds for treatment of cancer
US10301285B2 (en) 2008-06-16 2019-05-28 Gtx, Inc. Compounds for treatment of cancer
EP2303021A2 (en) * 2008-06-16 2011-04-06 University of Tennessee Research Foundation Compounds for the treatment of cancer
US9029408B2 (en) 2008-06-16 2015-05-12 Gtx, Inc. Compounds for treatment of cancer
US10010548B2 (en) 2008-06-27 2018-07-03 Celgene Car Llc 2,4-disubstituted pyrimidines useful as kinase inhibitors
US10596172B2 (en) 2008-06-27 2020-03-24 Celgene Car Llc 2,4-disubstituted pyrimidines useful as kinase inhibitors
US10828300B2 (en) 2008-06-27 2020-11-10 Celgene Car Llc Substituted 2,4-diaminopyrimidines as kinase inhibitors
US11351168B1 (en) 2008-06-27 2022-06-07 Celgene Car Llc 2,4-disubstituted pyrimidines useful as kinase inhibitors
US9987276B2 (en) 2008-06-27 2018-06-05 Celgene Car Llc Substituted 2,4-diaminopyrimidines as kinase inhibitors
US9409921B2 (en) 2008-06-27 2016-08-09 Celgene Avilomics Research, Inc. 2,4-disubstituted pyrimidines as kinase inhibitors
JP2011527998A (en) * 2008-07-16 2011-11-10 ビトップ アーゲー Synthesis of cyclic amidine
US10882840B2 (en) 2008-07-25 2021-01-05 Aerie Pharmaceuticals, Inc. Beta- and gamma-amino-isoquinoline amide compounds and substituted benzamide compounds
US10112920B2 (en) 2008-07-25 2018-10-30 Aerie Pharmaceuticals, Inc. Beta- and gamma-amino-isoquinoline amide compounds and substituted benzamide compounds
US9096569B2 (en) 2008-07-25 2015-08-04 Aerie Pharmaceuticals, Inc. Beta- and gamma-amino-isoquinoline amide compounds and substituted benzamide compounds
US9884840B2 (en) 2008-07-25 2018-02-06 Aerie Pharmaceuticals, Inc. Beta- and gamma-amino-isoquinoline amide compounds and substituted benzamide compounds
US8759388B2 (en) 2008-07-25 2014-06-24 Aerie Pharmaceuticals, Inc. Beta- and gamma-amino-isoquinoline amide compounds and substituted benzamide compounds
US10532993B2 (en) 2008-07-25 2020-01-14 Aerie Pharmaceuticals, Inc. Beta- and gamma-amino-isoquinoline amide compounds and substituted benzamide compounds
US9512101B2 (en) 2008-07-25 2016-12-06 Aerie Pharmaceuticals, Inc. Beta- and gamma-amino-isoquinoline amide compounds and substituted benzamide compounds
US8450344B2 (en) 2008-07-25 2013-05-28 Aerie Pharmaceuticals, Inc. Beta- and gamma-amino-isoquinoline amide compounds and substituted benzamide compounds
US11021456B2 (en) 2008-07-25 2021-06-01 Aerie Pharmaceuticals, Inc. Beta- and gamma-amino-isoquinoline amide compounds and substituted benzamide compounds
EA020320B1 (en) * 2008-10-27 2014-10-30 Конгения Срл Acrylamido derivatives useful as inhibitors of the mitochondrial permeability transition
US8669261B2 (en) 2008-10-27 2014-03-11 Congenia SLR Acrylomido derivatives useful as inhibitors of the mitochondrial permeability transition
US8470831B2 (en) 2008-10-27 2013-06-25 Cogenia SRL Acrylamido derivatives useful as inhibitors of the mitochondrial permeability transition
EP2179984A1 (en) * 2008-10-27 2010-04-28 Congenia S.r.l. Acrylamido derivatives useful as inhibitors of the mitochondrial permeability transition
WO2010049768A1 (en) * 2008-10-27 2010-05-06 Congenia Srl Acrylamido derivatives useful as inhibitors of the mitochondrial permeability transition
US9951059B2 (en) 2009-05-01 2018-04-24 Aerie Pharmaceuticals, Inc. Dual mechanism inhibitors for the treatment of disease
US10174017B2 (en) 2009-05-01 2019-01-08 Aerie Pharmaceuticals, Inc. Dual mechanism inhibitors for the treatment of disease
US10654844B2 (en) 2009-05-01 2020-05-19 Aerie Pharmaceuticals, Inc. Dual mechanism inhibitors for the treatment of disease
US11618748B2 (en) 2009-05-01 2023-04-04 Aerie Pharmaceuticals, Inc. Dual mechanism inhibitors for the treatment of disease
US11028081B2 (en) 2009-05-01 2021-06-08 Aerie Pharmaceuticals, Inc. Dual mechanism inhibitors for the treatment of disease
US10316029B2 (en) 2009-05-01 2019-06-11 Aerie Pharmaceuticals, Inc. Dual mechanism inhibitors for the treatment of disease
US8716310B2 (en) 2009-05-01 2014-05-06 Aerie Pharmaceuticals, Inc. Dual mechanism inhibitors for the treatment of disease
US9447049B2 (en) 2010-03-01 2016-09-20 University Of Tennessee Research Foundation Compounds for treatment of cancer
US8822513B2 (en) 2010-03-01 2014-09-02 Gtx, Inc. Compounds for treatment of cancer
US11465987B2 (en) 2010-03-01 2022-10-11 Oncternal Therapeutics, Inc. Compounds for treatment of cancer
US9604936B2 (en) 2010-08-10 2017-03-28 Celgene Car Llc Besylate salt of a BTK inhibitor
US10081606B2 (en) 2010-11-01 2018-09-25 Celgene Car Llc Heteroaryl compounds and uses thereof
US10434101B2 (en) 2010-11-01 2019-10-08 Celgene Car Llc Heterocyclic compounds and uses thereof
US9765038B2 (en) 2010-11-01 2017-09-19 Celgene Car Llc Heteroaryl compounds and uses thereof
US11096942B2 (en) 2010-11-01 2021-08-24 Celgene Car Llc Heterocyclic compounds and uses thereof
US9408885B2 (en) 2011-12-01 2016-08-09 Vib Vzw Combinations of therapeutic agents for treating melanoma
US20150119586A1 (en) * 2012-05-08 2015-04-30 Ishihara Sangyo Kaisha, Ltd. Method for producing a substituted benzoic acid compound
US9580401B2 (en) * 2012-05-08 2017-02-28 Ishihara Sangyo Kaisha, Ltd. Method for producing a substituted benzoic acid compound
US9549927B2 (en) 2012-12-21 2017-01-24 Celgene Avilomics Research, Inc. Heteroaryl compounds and uses thereof
US10588901B2 (en) 2013-03-15 2020-03-17 Aerie Pharmaceuticals, Inc. Combination therapy
US10568878B2 (en) 2013-03-15 2020-02-25 Aerie Pharmaceuticals, Inc. Combination therapy
US9993470B2 (en) 2013-03-15 2018-06-12 Aerie Pharmaceuticals, Inc. Combination therapy
US11185538B2 (en) 2013-03-15 2021-11-30 Aerie Pharmaceuticals, Inc. Compositions for treating glaucoma or reducing intraocular pressure
US9931336B2 (en) 2013-03-15 2018-04-03 Aerie Pharmaceuticals, Inc. Combination therapy
US11020385B2 (en) 2013-03-15 2021-06-01 Aerie Pharmaceuticals, Inc. Combination therapy
US9849122B2 (en) 2013-03-15 2017-12-26 Aerie Pharmaceuticals, Inc. Combination therapy
US11197853B2 (en) 2013-03-15 2021-12-14 Aerie Pharmaceuticals, Inc. Combination therapy
US9415043B2 (en) 2013-03-15 2016-08-16 Aerie Pharmaceuticals, Inc. Combination therapy
US9492471B2 (en) 2013-08-27 2016-11-15 Celgene Avilomics Research, Inc. Methods of treating a disease or disorder associated with Bruton'S Tyrosine Kinase
US10683293B2 (en) 2014-08-04 2020-06-16 Nuevolution A/S Optionally fused heterocyclyl-substituted derivatives of pyrimidine useful for the treatment of inflammatory, metabolic, oncologic and autoimmune diseases
US11254681B2 (en) 2014-08-04 2022-02-22 Nuevolution A/S Optionally fused heterocyclyl-substituted derivatives of pyrimidine useful for the treatment of inflammatory, metabolic, oncologic and autoimmune diseases
US10689383B2 (en) 2014-08-04 2020-06-23 Nuevolution A/S Optionally fused heterocyclyl-substituted derivatives of pyrimidine useful for the treatment of inflammatory, metabolic, oncologic and autoimmune diseases
WO2016155359A1 (en) * 2015-03-27 2016-10-06 沈阳三生制药有限责任公司 Compound of 3-hydroxyl pyridine, preparation method thereof and pharmaceutical use thereof
CN106146395A (en) * 2015-03-27 2016-11-23 沈阳三生制药有限责任公司 3-hydroxypyridine compound, its preparation method and pharmaceutical applications thereof
CN106146395B (en) * 2015-03-27 2019-01-01 沈阳三生制药有限责任公司 3- hydroxypyridine compound, preparation method and its pharmaceutical applications
US9643927B1 (en) 2015-11-17 2017-05-09 Aerie Pharmaceuticals, Inc. Process for the preparation of kinase inhibitors and intermediates thereof
US10550087B2 (en) 2015-11-17 2020-02-04 Aerie Pharmaceuticals, Inc. Process for the preparation of kinase inhibitors and intermediates thereof
US11389441B2 (en) 2016-08-31 2022-07-19 Aerie Pharmaceuticals, Inc. Ophthalmic compositions
US11707460B2 (en) 2016-08-31 2023-07-25 Aerie Pharmaceuticals, Inc. Ophthalmic compositions
US11590123B2 (en) 2016-08-31 2023-02-28 Aerie Pharmaceuticals, Inc. Ophthalmic compositions
WO2018146253A1 (en) 2017-02-10 2018-08-16 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and pharmaceutical compositions for the treatment of cancers associated with activation of the mapk pathway
US10858339B2 (en) 2017-03-31 2020-12-08 Aerie Pharmaceuticals, Inc. Aryl cyclopropyl-amino-isoquinolinyl amide compounds
US11312700B2 (en) 2017-03-31 2022-04-26 Aerie Pharmaceuticals, Inc. Aryl cyclopropyl-amino-isoquinolinyl amide compounds
US12018012B2 (en) 2017-03-31 2024-06-25 Aerie Pharmaceuticals, Inc. Aryl cyclopropyl-amino-isoquinolinyl amide compounds
WO2019133810A1 (en) 2017-12-28 2019-07-04 Tract Pharmaceuticals, Inc. Stem cell culture systems for columnar epithelial stem cells, and uses related thereto
US11427563B2 (en) 2018-09-14 2022-08-30 Aerie Pharmaceuticals, Inc. Aryl cyclopropyl-amino-isoquinolinyl amide compounds
US11891376B2 (en) 2018-09-14 2024-02-06 Aerie Pharmaceuticals, Inc. Aryl cyclopropyl-amino-isoquinolinyl amide compounds
CN111233774A (en) * 2018-11-28 2020-06-05 鲁南制药集团股份有限公司 Amino pyrimidine compound
CN111233774B (en) * 2018-11-28 2023-04-14 鲁南制药集团股份有限公司 Amino pyrimidine compound
US11447479B2 (en) 2019-12-20 2022-09-20 Nuevolution A/S Compounds active towards nuclear receptors
US11613532B2 (en) 2020-03-31 2023-03-28 Nuevolution A/S Compounds active towards nuclear receptors
US11780843B2 (en) 2020-03-31 2023-10-10 Nuevolution A/S Compounds active towards nuclear receptors

Also Published As

Publication number Publication date
CA2594860A1 (en) 2006-07-20
US20060160803A1 (en) 2006-07-20
JP2008527007A (en) 2008-07-24
EP1856053A1 (en) 2007-11-21
AU2006204724A1 (en) 2006-07-20
US7652041B2 (en) 2010-01-26

Similar Documents

Publication Publication Date Title
EP1856053A1 (en) Cinnamide and hydrocinnamide derivatives with raf-kinase inhibitory activity
JP7026196B2 (en) RET inhibitor
TWI536991B (en) Inhibitors of focal adhesion kinase
EP2061761A1 (en) Phenethylamide derivatives with kinase inhibitory activity
RU2615130C2 (en) Heterocyclic compounds useful as pdk1 inhibitors
JP5490153B2 (en) N- (hetero) aryl, 2- (hetero) aryl substituted acetamides for use as WNT signaling regulators
CN109810041B (en) Halogenated allylamine SSAO/VAP-1 inhibitor and application thereof
WO2012002577A1 (en) Novel nicotinamide derivatives or salts thereof
EP1957460A1 (en) Bicyclic compounds with kinase inhibitory activity
RU2497808C2 (en) 5,6-bisaryl-2-pyridine carboxamide derivatives, method for preparing and using them in therapy as receptor antagonists
JP2015506985A (en) Methyl group-modifying enzyme regulator, composition and use thereof
JP2009023986A (en) Biaryl derivative as anticancer agent
BRPI0212726B1 (en) lactam-containing compounds and derivatives thereof, pharmaceutical composition comprising them and their uses
JP2010521458A5 (en)
EP2760830B1 (en) Pyrrolinone carboxamide compounds useful as endothelial lipase inhibitors
CN103547570A (en) Picolinamido-propanoic acid derivatives useful as glucagon receptor antagonists
AU2004255566A1 (en) Malonamide derivatives
AU2004224239A1 (en) Oxamide derivatives useful as RAF-kinase inhibitors
KR20130106186A (en) Azaindole derivatives, trk inhibitoring composition and pharmaceutical compositions for prevention and treatment of diseases linked to trk comprising the same
KR20140037197A (en) Positive allosteric modulators of nicotinic acetylcholine receptor
JP7387208B2 (en) Biphenyl group fluorine-substituted double bond derivatives, their production methods and pharmaceutical applications
JP6773655B2 (en) MAPK inhibitor
TW202412773A (en) Heteroaryl derivative compounds, and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application
ENP Entry into the national phase

Ref document number: 2594860

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2007551462

Country of ref document: JP

Ref document number: 2006204724

Country of ref document: AU

Ref document number: 5440/DELNP/2007

Country of ref document: IN

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2006718548

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2006204724

Country of ref document: AU

Date of ref document: 20060112

Kind code of ref document: A