WO2005093069A2

WO2005093069A2 - Production of mersacidin and its variants in sigh and/or mrsa negative bacillus host cells

Info

Publication number: WO2005093069A2
Application number: PCT/GB2005/001055
Authority: WO
Inventors: Michael John Dawson; Jesus Cortes Bargallo; Brian Arthur Michael Rudd; Steven Boakes; Gabriele Bierbaum; Anja Hoffmann; Stephanie Schmitz
Original assignee: Novacta Biosystems Limited
Priority date: 2004-03-26
Filing date: 2005-03-21
Publication date: 2005-10-06
Also published as: AU2005225595A1; EP1794298A2; GB0406870D0; WO2005093069A3

Abstract

The present invention relates to methods and products for improved production of the lantibiotic mersacidin. There is provided a method of producing a mersacidin variant which comprises introducing into a cell which is a negative MrsA host cell an expression vector encoding said variant, and recovering said variant from the cell culture. Preferred variants include the novel variants mersacidin F3W, mersacidin G8A and mersacidin F3W G8A. Also provided is a Bacillus cell which is a SigH deficient strain of Bacillus sp. HIL Y-85,54728 (NCIMB Accession Number NCIMB 41211); this cell may also be used in the production of mersacidin and its variants. Further aspects of the invention include a DNA cassette which comprises a nucleotide sequence encoding the mersacidin mrsA propeptide, and a method to transform a Bacillus HIL host cell with plasmid, which method includes the step of electroporation.

Description

Production of Mersacidin and its Variants in SigH and/or MrsA Negative Bacillus Host Cells

Field of the Invention The present invention relates to a bacterial cell, particularly of the genus Bacillus, which has improved properties for the production of an antibiotic.

Background to the Invention Mersacidin belongs to a group of bactericidal peptides that are called lantibiotics . The name signifies that these peptides contain the amino acids lanthionine and/or 3-methyllanthionine. Mersacidin has activity against methicillin-resistant Staphylococcus aureus (MRSA) and is therefore of considerable interest in medicine. Mersacidin is produced by a specific species of the genus Bacillus, which has been designated HIL Y-85, 54728 ("HIL"). The cloning of the mersacidin .gene is disclosed by Bierbaum et al, 1995.

, Mersacidin is produced by processing of a small protein of 68 amino acids. The N-terminal 48 amino acids of the protein form a leader sequence, and the C-terminal 20 amino acids are a propeptide sequence which is processed by modifying enzymes to produce mersacidin. The sequence of the mersacidin gene, mrsA, is provided as SEQ ID NO : 1 and its translation as SEQ ID N0:2.

The mrsA gene forms part of the mrs gene cluster of about 12.3 kb (Altena et al, 2000) . The gene cluster includes regulatory genes which control the production of mersacidin by regulating the expression of the mrsA gene and/or its modifying enzymes. The mrsA gene is expressed in early stationary phase of the growth of the Bacillus HIL strain. A problem with the use of Bacillus HIL as a host cell for the production of products of interest is the fact that under certain conditions the host cell sporulates . For larger scale production presence of spores potentially causes significant handling difficulties especially if the producer strain is a GMO, as is likely to be the case for a producer of a variant mersacidin. In case of a spillage, bacillus spores are difficult to kill with most disinfecting chemicals. Removal of spores in process streams would be difficult without expensive microfiltration. A sporulating GMO is therefore likely to require a higher cost and complexity of engineering for containment and processing.

At a research level, the presence of spores can make the development of alternative lantibiotics based upon engineering of the wild-type gene cluster difficult. For example, overlay assays for anti-bacterial activity can be spoiled by outgrowth of spores .

A further problem generally with the Bacillus HIL strain is that it - in common with many other Bacillus strains - produces other products with anti-bacterial activity. These products can interfere with the development of assays designed to investigate the properties of variant Bacillus HIL strains.

Sigma H is the product of the sigH (or spoOH) gene. It is essential for transcription of genes that function in the transition from exponential to stationary phase and in the induction of sporulation. Mutants deficient in SigH do not sporulate. SigmaH activates transcription of a number of other regulatory proteins e.g. spoOA, spoOF, kinA, spoOM, spoVG, spoVS and the spoIIA family as well as the phr family of secreted peptide pheromones . For further details see Britton et al . J Bacteriol. 184, 4881-90; 2002.

Directly or indirectly Sigma H influences transcription of about 10 % of all genes of Bacillus (Britton et al . , 2002) .- Early results showed that sigma H is involved in the biosynthesis of gramicidin S (Marahiel et al. Mol . Microbiol. 7, 631-636; 1993), and Britton et al . found that the following antibiotic production genes are downregulated in a sigH deficient mutant: cotϊV ( tasA, antimicrobial spore component), pksCDEFGHIKLMNR (polyketide synthesis) , pnbA (paranitrobenzyl esterase) , srfAB (surfactin synthetase) , ywhP { albD) and ywiA { albA, both involved in antilisterial bacteriocin production) , thus knockout affects multiple antibiotic biosynthesis pathways.

Szekat et al . (2003) Appl . Env. Microbiol. 69, 3777-3783 describe the construction of an expression system for generation of variant mersacidins . Modified mrsA genes are generated by site-directed mutagenesis using a commercial phagemid system. The modified genes are then excised and ligated into a temperature sensitive plasmid which replicates in Gram-positive bacteria such as Bacillus sp. The plasmids are introduced into Staphylococcus carnosus by protoplast transformation and then introduced into the mersacidin-producing bacillus again by protoplast transformation. The bacilli are then grown at elevated temperature so that the plasmid cannot replicate autonomously and thus integrates into the chromosome by homologous recombination in the mrsA region. At this stage the bacillus now contains the entire expression plasmid inserted into the mersacidin biosynthetic pathway and hence has two copies of the mrsA gene, one of which is mutated and the other wild-type . These constructs do not produce either mersacidin or the engineered variant presumably due to disruption of other elements of the biosynthetic pathway. The next stage is to grow these constructs for a large number of generations without selection for the plasmid in order to allow a second recombination event to occur to excise the plasmid and to leave a single copy of the mrsA gene. Depending on where the recombination events occur this can either reconstruct the wild- type mrsA gene or generate the engineered variant and clones need to be screened to identify one in which the desired event has occurred. The net result is a direct replacement of the wild-type mrsA gene by a mutant gene in the chromosome. This procedure is lengthy and relatively inefficient for the production of large numbers of variants of mersacidin.

Another problem associated with the production of mersacidin variants is that the Bacillus HIL has only been transformable at low frequencies using protoplast transformation. In order to investigate large numbers of mersacidin derivatives, a more efficient transformation system is required.

Disclosure of the Invention

The present inventors have produced a version of the HIL strain in which the SigH gene has been inactivated. Surprisingly, it has been found that the production of mersacidin is not affected by this change. In the SigH negative derivative mersacidin production was unaffected though both sporulation and production of an antibacterial substance or substances other than mersacidin were both suppressed.

The features of the novel strain thus provide a useful attribute for development of a system for generation and screening of variants of mersacidin. The lack of sporulation and of secreted antibiotics other than mersacidin will also be of benefit for larger-scale production of mersacidin and related lantibiotics expressed from the mrs gene cluster.

Accordingly, the present invention provides a Bacill us which is a SigH deficient strain of the Bacillus sp. HIL Y-85, 54728 (NCIMB Accession Number NCIMB 41211, deposited 19th March 2004) . The strain of the invention is referred to herein as "ΔSigH HIL".

The invention further provides a method of producing a lantibiotic which comprises culturing the bacterial strain of the invention in a culture medium and recovering the lantibiotic from the medium. The lantibiotic may be mersacidin or a derivative thereof.

In another aspect, the invention provides a method of making a ΔSigH HIL, which method comprises introducing into a Bacillus HIL a recombinant DNA construct containing a SigH mutant gene, and integrating said mutant gene at the SigH locus in the genome of the cell.

In another aspect, the inventors have developed a vector system useful for producing and screening lantibiotic derivatives of MrsA. This has been achieved by introducing one or more restriction endonuclease recognition sites into the mrsA gene in order to produce an expression cassette system. Thus in another aspect, the invention provides a recombinant DNA cassette which comprises a nucleotide sequence encoding the mersacidin mrsA propeptide, wherein said sequence comprises a first restriction site at or adjacent the N-terminal encoding region of the encoding sequence; optionally a second restriction site downstream of the first restriction site and within the encoding sequence; and a third restriction site at or adjacent the C-terminal encoding region of the encoding sequence, wherein at least one of said restriction sites does not occur within the mrsA sequence shown as SEQ ID NO:l.

Generally, all two or three sites will be different from each other. It is also desirable that when the cassette is carried by a vector, the sites are unique for that vector.

In a preferred aspect, the non-naturally occurring restriction enzyme site is the second restriction site and is located between codons 8 and 16 of the encoding sequence.

The cassette will desirably also include the mrsA leader sequence and mrsA promoter, and may include in addition or alternatively a mrsRl gene.

The cassette of the invention described above may be engineered in a variety of ways. For example, the fragment obtained by cleaving the cassette between the first and second, first and third, or second and third, restriction sites may be replaced with a variant coding sequence encoding a mersacidin derivative. Thus the invention provides a variant of the cassette of the invention wherein said variant has from 1 to 15 nucleotide substitutions within the encoding region of the encoding sequence .

As an intermediate to the production of such a variant, the sequence of between the first and second, first and third, or second and third, restriction sites may be replaced by a larger stuffer fragment.

In another aspect, the cassette encoding a mersacidin derivative may be used to transform a Bacillus HIL host cell to express the mersacidin derivative, for example to assess its anti-bacterial properties .

In one aspect, a multiplicity of expression cassettes may be made to provide a library of different mersacidin derivatives, which may then be screened for activity.

The cassettes may be transformed into the HIL Bacill us or the SigH deficient HIL of the present invention. An alternative expression host is the HIL Bacillus which comprises a mrsA mutation such that the MrsA gene product is either inactive or not produced. Such a Bacillus is referred to herein a "ΔMrsA HIL". Optionally, this Bacillus may be deficient in SigH. This is referred to herein as a "ΔMrsA ΔSigH HIL".

In another aspect, the invention provides a ΔMrsA HIL cell, wherein the cell further comprises a construct encoding a mersacidin derivative operably linked to a promoter such as a mrsA promoter. The construct may be on an autonomously replicating vector, or integrated into the genome of the host cell at a site outside the mrs gene cluster. The construct may additionally comprise the mrsRl gene.

The mersacidin derivative may be encoded by an expression cassette of the invention.

The invention also provides a method of making a mersacidin derivative which method comprises introducing into a ΔMrsA HIL host cell a construct encoding said mersacidin derivative operably linked to a promoter such as a mrsA promoter and culturing said host cell or progeny thereof in a culture medium and recovering the mersacidin derivative from the medium. The construct may additionally comprise the mrsRl gene. The invention thus further comprises a method of making a mersacidin derivative which method comprises culturing a ΔMrsA HIL host cell which contains a construct encoding said mersacidin derivative operably linked to a promoter such as a mrsA promoter in a culture medium and recovering the mersacidin derivative from the medium.

In another aspect, the invention provides method of producing a mersacidin derivative-producing strain of HIL, said method comprising: transforming a ΔMrsA HIL with a vector comprising said mersacidin derivative coding region which is operably linked to a mrsA promoter, said coding region joined to a downstream mrsRl gene, wherein said vector further comprises a selectable marker; culturing said ΔMrsA HIL under conditions for integration of said vector into said target region; selecting a transfomant in which the mersacidin derivative coding region has been integrated into the target region operably linked to the mrsA promoter.

The ΔMrsA HIL may also be a ΔMrsA ΔSigH HIL. Alternatively the cell may be a host cell comprising the mrs gene cluster in which the mrsA gene has been inactivated, wherein the host cell is optionally also a ΔSigH host cell.

In a further aspect, the present inventors have improved the methods for transformation of the Bacillus HIL strain. Prior to the present invention, protoplast transformation has been used to introduce plasmid DNA into this strain. It has now been found that under appropriate conditions, it is possible to transform Bacill us HIL by electroporation . Accordingly the invention provides a method to transform a Bacillus HIL, including the ΔSigH and/or ΔMrsA derivatives, which method includes the step of electroporation. Description of the Drawings

Figure 1 shows the strategy used by the inventors to inactivate the SigH gene in the HIL strain, by integration of pΔSIGHl into the chromosome of Bacillus sp. HIL Y-85, 54728 TT .

Figure 2 shows growth curves of of sigiϊ-knockout strains of the invention after addition of 10 mg/ml mersacidin. The symbols + and - in the legend refer to with and without addition of mersacidin.

Figure 3 shows the construction of plasmid pNB029. The numbering indicated is according to B . subtilis 168 genome sequence NC 000964.

Figure 4 shows the construction of expression plasmids for a mrsA library.

Figure 5 shows the construction of plasmids of the invention containing stuffer fragments.

Figure 6 shows the construction of plasmid pNB028.

Figure 7 shows a map of pPARl/2.

Figure 8 shows insertion of pPARl/2 into the mrs gene cluster. Insertion of pPARl/2 into the gene cluster (top) . The possible locations of the two copies of mrsA, E17AmrsA or the wildtype gene are shown.

Figure 9 shows potential restriction sites in the mrsA gene (SEQ ID NO:l) which can be generated by silent nucleotide changes. The translation of gene sequence (SEQ ID NO:2) is also shown. Detailed Description of the Invention

Production of ΔSigH HIL

ΔSigH HIL strains of the invention may be made utilising the HIL strain deposited as NCIMB Accession Number NCIMB 41211, deposited 19th March 2004. In order to make the ΔSigH derivative, the SigH gene in the HIL strain may be inactivated in accordance with standard techniques available in the art.

Typically the ΔSigH Bacillus can be made using targeted homologous recombination. This is a method well known in the art and there are a variety of strategies which may be used. In its simplest form, a construct such as a plasmid which contains part of a Bacillus SigH coding sequence is introduced into the HIL strain, e.g. by protoplast transformation. The vector contains a selectable marker such as a chloramphenicol acetyl transferase gene, and the transformed cells are selected for integration of the marker into the chromosome.

The approach described above relies on a single recombination event with an integrative vector. For this approach it is necessary for the incoming SigH gene to be defective at both ends otherwise one intact gene would be recreated.

An alternative approach is to carry out a double homologous recombination (gene replacement) . With this approach only a single defect is needed. When the second recombination event occurs it can either restore the wild-type sigH or generate the mutant .

Thus, in the accompanying Example 1, a SigH gene, truncated at both the N- and C-terminal coding regions was used as the integrant. When this sequence was integrated by homologous recombination it produced a genome with two tandem partial SigH genes, neither of which produce a fully functional gene product. However it will be understood that the precise means by which the SigH gene is inactivated is not a limiting feature of the present invention. Strategies such as double homologous recombination outlined above, which can be used to delete the gene, or substantial portions thereof, from the chromosome altogether, or which inactivate promoter regions of the SigH gene may also be used. A double homologous recombination event to produce a SigH mutant with an internal deletion is illustrated in Example 2.

The SigH coding sequence is widely available in the art, and is also available in databases, such as GenBank, accession no. NC_000964.

In an alternative embodiment, the invention provides a host cell which comprises the mrs gene cluster (this cluster is described in Altena et al, 2000) , wherein the host cell is a ΔSigH host cell. This host cell may be used in the practice of all aspects of the present invention described herein for ΔSigH HIL. The mrs gene cluster may be one in which the mrsA gene is inactivated ^■ or produces an inactive gene product. Such a host cell may be a low GC Gram-positive bacterium, for example any strain of Bacillus, such as B . subtilis . The laboratory strain B . subtilis 168 may be used.

ΔMrsA HIL Strains

In another aspect, the ΔSigH HIL may also be an HIL derivative in which the mrsA gene product is inactive, either because the mrsA gene is transcriptionally inactive, or because the gene product is a mutant which does not show antibacterial activity against bacteria which are normally killed by mersacidin. Such bacteria include Micrococcus luteus, such as M. luteus ATCC 4498. A ΔMrsA HIL in which the mrsA gene is inactivated by insertion into the mrsA gene of an erythromycin resistance gene is disclosed in Altena et al, 2000. Another ΔMrsA HIL is the E17A HIL disclosed by Szekat et al, 2003. A further ΔMrsA HIL is one in which the mrsA gene is altered to include a stop codon resulting in a truncated and inactive gene product. One such example of this is the ΔMrsA HIL pAE4stop as set out in Example 6.

All these and other ΔMrsA HIL strains may be used to produce ΔMrsA ΔSigH HIL strains of the invention.

In addition, the ΔMrsA HIL strains may be used without the ΔSigH feature in the practice of the other aspects of the invention described herein.

Transfer of the mrs gene cluster into a host cell

A restriction map of the mrs gene cluster is shown in Altena et al, 2000. The sequence of this cluster is available as GenBank accession number: AJ250862. Using the deposited HIL strain as a source of DNA, the overlapping restriction fragments illustrated in Altena et al may be obtained by, for example, PCR amplification based on primers derived from AJ250862. These fragments are assembled using standard cloning procedures and the mrs gene cluster cloned into a suitable cloning vector.

Such a vector may be pTRKH2 (0' Sullivan and Klaenhammer 1993) .

The vector may be transformed into a laboratory strain of B . subtilis such as B . subtilis 168 in order to replicate, and plasmid DNA isolated from this host. The plasmid may be integrated into this host, or recovered and introduced into other host cells, particularly low-GC Gram positive host cells. These include Bacillus species, particularly B . subtilis, as well as for example S . carnosus .

Accordingly the present invention provides a bacterial host cell which carries a vector comprising the mrs gene cluster. The invention also provides a bacterial host cell in which the mrs gene cluster has been integrated into the genome, wherein said cell is not the HIL strain.

The bacterial host cell may be a ΔSigH, a ΔMrsA, or a ΔMrsA ΔSigH host cell.

Preferably the host cell is a Bacillus host cell, such as a B . ^'subtilis host cell.

Expression Cassettes

An expression cassette of the invention may be based on any cloning and expression vector used in the art for the expression of genes in host cells . Such vectors will include one or more origins of replication, which may be temperature sensitive. The vectors may include a selectable marker, such as the chloramphenicol acetyl transferase gene, the erythromycin resistance gene or the tetracycline resistance gene. The vector may also contain a targeting region, this region being homologous to a genomic sequence present in the host cell outside the mrs gene cluster. Such a vector may be used to integrate the cassette into the genomic sequence homologous to the targeting region.

The expression cassette may also comprise a mrsRl gene downstream of the mrsA gene or derivative thereof. Where the host cell is a ΔMrsA host cell in which the mrsA gene has been inactivated in a manner which also inactivates the mrsRl gene (e.g. in the strain disclosed in Altena et al, 2000), the expression cassette may further comprise a mrsRl gene.

As used herein, by "at or adjacent the N-terminal encoding region" it is meant that the first base of the restriction site is located at a position from six residues upstream of the ATG codon of the mrsA leader sequence to no more than six codons downstream of the first codon of the propeptide (TGT, encoding cysteine) . Preferably the first base of the restriction site is located at a position from twelve, preferably six, residues upstream to six residues downstream of the first codon of the propeptide encoding sequence.

In one aspect, the first restriction site is an Sphl site. Figure 9 sets out other restriction sites which may be introduced within the leader sequence upstream of the Sphl site, as well as an ApaLI site which may be made two nucleotides downstream of the Sphl site.

Similarly, by "at or adjacent the C-terminal encoding region" it is meant that the first base of the restriction site either includes at least one of the nucleotides of the TAA termination codon of the propeptide or the 5' or 3' nucleotide of the restriction site is no more than twelve, preferably six, residues downstream or upstream respectively of the TAA codon.

In one aspect, the third restriction site is a Hindlll site.

The second restriction site, when present, will lie between the first and third restriction sites. Preferably the restriction site includes at least one nucleotide present from codon 5 to codon 16, preferably codon 8 to 16 of the propeptide-encoding sequence. In the accompanying examples, a BsrGl site has been introduced by altering codon 13 of the MrsA-encoding sequence. In combination with codon 12, this results in the site having the sequence 5' -TGTACA-3M However, other changes are also contemplated by the present invention. Figure 9 sets out other possible non-coding changes which may be made, and the restriction sites which can be created as a result. Thus the second restriction site, when present, may also be an Xmal site spanning the propeptide codons 5-7; an Xmal site at codons 6-7; a Hpal site spanning codons 13-15 or a Spel site at codons 15- 16.

It is also possible to introduce more than one of these changes such that the expression cassette includes two or more sites between the first and third restriction sites.

The cassette may include two or three non-naturally occurring restriction sites. In the accompanying example, all three sites do not normally occur in the MrsA sequence of SEQ ID NO : 1.

The expression cassette simplifies the rapid production of lantibiotics which are mersacidin derivatives, as discussed further herein below.

In one aspect, the region between the first and second sites, the first and third, or the second and third sites, may be replaced by a stuffer fragment. Where two or more sites between the first and third sites are present, the region between any pair of such sites may also be replaced by a stuffer fragment. A stuffer fragment is a piece of DNA which is larger than the sequence which it replaces. The stuffer fragment may be from 50 to 5000 nucleotides in size, for example from about 500 to 2000 nucleotides in size. The value of introducing these stuffer DNA fragments is that when the region is replaced by a lantibiotic- encoding oligonucleotide there is a significant decrease in plasmid size. The resulting plasmid can thus be readily purified away from any minor population of unrestricted plasmid thus eliminating any background.

A cassette of the invention may be used to introduce specific changes to the MrsA sequence in a vector which can then be introduced into a host cell for expression of a lantibiotic. To achieve this, the sequence is desirably operably linked to the MrsA leader sequence, which in turn is operably linked to the MrsA promoter.

In addition or as an alternative, the vector comprising the cassette may also include a mrsRl gene. The mrsRl gene will be located downstream of, and in tandem with, the mersacidin (or derivative thereof) coding sequence.

Expression Libraries

Expression cassettes of the invention may be used to provide libraries of lantibiotic-encoding genes. Such libraries may be made by introducing into the cassette, between the first and second restriction sites, the first and third restriction sites, or the second and third restriction sites, a multiplicity of sequences each of which corresponds to the corresponding mrsA sequence apart from having from 1 to 15, for example from 1 to 10, preferably from 1 to 6, for example from 1 to 3 nucleotide changes compared to the propeptide portion of SEQ ID NO: 2. Preferably such changes result in a change of the protein encoded by the sequence. However non-coding changes are not excluded.

Libraries form a further aspect of the invention. Such libraries may comprise from 10 to 100,000, such as from 10 to 10,000 for example from 10 to 1,000 different coding sequences which are variants of the mersacidin coding sequence as defined in the preceding paragraph. An expression cassette encoding a lantibiotic derivative may be introduced into a HIL cell for expression of the lantibiotic.

In one embodiment, the library may be transformed into a

Bacill us HIL or derivative thereof such as a ΔSigH HIL, a ΔMrsA HIL or a ΔMrsA ΔSigH HIL, colonies isolated and screened for antibacterial activity.

The sequences of the mersacidin variant expressed by individual colonies showing such activity can be determined.

In another embodiment, an expression library of the invention may be transformed into a host cell which comprises the mrs gene cluster, optionally wherein the cell is a ΔSigH host cell, and alternatively or in addition wherein the cell is a ΔMrsA host cell.

Production of Mersacidin

ΔSigH cells of the invention may be used to produce mersacidin. In order to do this, cells are cultured in a suitable culture medium (e.g. Bierbaum et al; 1995), and the mersacidin recovered from the culture medium, e.g. according to the methods of Szekat et al (2003) .

Similarly, ΔMrsA ΔSigH HIL cells of the invention which carry an expression vector capable of expressing MrsA may be used in the production of mersacidin.

Production of Mersacidin Deriva tives

The ΔSigH HIL obtained in the accompanying example produces mersacidin. Szekat et al . describe the construction of an expression system for site-directed mutagenesis of mersacidin. Similar expression systems may be used in the ΔSigH HIL host cell (or ΔSigH host cell comprising the mrs gene cluster) of the present invention in order to obtain a cell which expresses a non-wild-type lantibiotic which is a mersacidin derivative.

The ΔSigH HIL host cell (or ΔSigH host cell comprising the mrs gene cluster) may also be a ΔMrsA cell.

It will be apparent that in producing such cells, the SigH gene may be inactivated either before or after an altered mrsA gene encoding the mersacidin derivative has been introduced into the cell. In either order, the resulting product will be a ΔSigH host cell, such as the HIL Bacillus , of the present invention.

Mersacidin derivatives may be expressed by an expression vector. Such vectors may include an origin of replication, which may be temperature sensitive. The vectors may include a selectable marker, such as the chloramphenicol acetyl transferase gene, the erythromycin resistance gene or the tetracycline resistance gene .

In one embodiment, an altered mrsA gene may be introduced by targeted homologous recombination, according to the method of Szekat et al, 2003. The targeted homologous recombination may be performed as a single homologous recombination, as described herein below, or as a double homologous recombination so as to replace the mrsA gene present in the cell.

The mrsA gene present in the cell may be wild-type or may encode a mersacidin derivative, such as the E17A derivative. The advantage of targeting the E17A derivative (or other derivatives with similar properties) is that this peptide does not have anti-bacterial activity. Thus supplementing this gene with single homologous recombination or replacing it by double homologous recombination with a mersacidin derivative having anti-bacterial activity allows for convenient screening of the resulting ce'lls. Specific mersacidin derivatives with reduced activity include in addition to the E17A, the F3L and S16I derivatives described in Szekat et al . Strains producing these derivatives may be used to generate a ΔSigH HIL of the invention in which the activity of further mrsA variants may be examined against a background of an inactive variant.

Preferred mersacidin derivatives which may be produced include mersacidin compounds which correspond to the amino acid sequence of the mersacidin propeptide set out as SEQ ID NO : 2 apart from one or more, for example from 1 to 6, e.g. from 1 to 3 amino acid alterations. Alterations include substitutions, deletions and insertions.

The mersacidin derivatives may be lantibiotics expressed by members of an expression library of the invention, as described herein above. The invention thus provides a mersacidin derivative obtained by methods of the invention for use in therapy, for example in the treatment of MRSA.

One mersacidin derivative of the invention is mersacidin F3W. Another is mersacidin G8A. Another is mersacidin F3W G8A. These mersacidin derivatives and their use in therapy form a further aspect of the invention.

In- trans complementa tion

In another aspect of the invention, an expression vector encoding and capable of expressing a mersacidin or a lantibiotic peptide which is a mersacidin derivative may be expressed in a ΔMrsA HIL cell, or a ΔMrsA host cell comprising the mrs 'gene cluster. The expression vector may have the features described in the preceding section. The expression vector may additionally comprise an MrsRl coding sequence. This is preferred in the case of a ΔmrsA HIL in which the mrsA gene has been disrupted in such a way that the downstream mrsRl gene is not expressed, though is not essential where the mrsA gene product is produced but in an inactive form.

In one aspect,- the ΔMrsA HIL may be an E17A HIL as described by Szekat et al . Such a host cell expresses an inactive mersacidin derivative, but an active MrsRl. Introducing an expression vector which encodes mersacidin or an active derivative thereof will result in the cell having anti-bacterial activity.

The expression vector may be an autonomously replicating vector, or may be integrated into the host cell. In the case of the latter, integration may occur outside the mrs gene cluster.

The ΔMrsA HIL or host cell may also be ΔSigH.

The expression vector may be a vector comprising an expression cassette of the invention.

In a preferred aspect, the expression vector encodes a mersacidin derivative selected from the group mersacidin F3W, mersacidin G8A and mersacidin F3W G8A.

Homologous Recombina tion

Szekat et al . (2003) Appl . Env. Microbiol. 69, 3777-3783 describe the construction of an expression system for generation of variant mersacidins. Modified mrsA genes are generated by site-directed mutagenesis using a commercial phagemid system. The modified genes are then excised and ligated into a temperature sensitive plasmid which replicates in Gram-positive bacteria such as Bacill us sp. The plasmids are introduced into Staphylococcus carnosus by protoplast transformation and then introduced into the mersacidin-producing bacillus again by protoplast transformation. The bacilli are then grown at elevated temperature so that the plasmid cannot replicate autonomously and thus integrates into the chromosome by homologous recombination in the mrsA region. At this stage the bacillus now contains the entire expression plasmid inserted into the mersacidin biosynthetic pathway and hence has two copies of the mrsA gene, one of which is mutated and the other wild-type. These constructs are reported not to produce either mersacidin or the engineered variant.

The next stage is to grow these constructs for a large number of generations without selection for the plasmid in order to allow a second recombination event to occur to excise the plasmid and to leave a single copy of the mrsA gene. Depending on where the recombination events occur this can either reconstruct the wild- type mrsA gene or generate the engineered variant and clones need to be screened to identify one in which the desired event has occurred.

The net result is a direct replacement of the wild-type mrsA gene by a mutant gene in the chromosome.

In the expression system described by Szekat et al . (2003) a double recombinant must be selected. When the second recombination event occurs it can lead to recovery of the parent construct at least as efficiently as gene replacement. In order to generate the second recombination event, the strains must be grown through many generations under conditions which are not selective for maintenance of the plasmid. This procedure together with examination of the clones to select those that have performed the double cross over and have kept the mutated gene is laborious and time consuming.

This technique may be used in the present invention so as to introduce sequences encoding mersacidin variants in a ΔSigH or ΔMrsA ΔSigH host cell of the invention. In essence, the technique comprises: providing an expression vector encoding a mersacidin variant; introducing the vector into said host cell; integrating the vector by homologous recombination into the mrsA locus of the host cell; selecting for a second homologous recombination event to occur to excise the vector and to leave a single copy of the variant gene.

However, the present invention provides a simpler procedure which involves fewer manipulations and without the need to screen out large numbers of regenerated parental strains.

In the present invention a plasmid is inserted containing an intact mrsRl gene as well as an intact mrsA (or coding region for a mersacidin derivative; for convenience in this section reference is made to mrsA but it will be understood this teaching applies to other mersacidin derivatives) . Additionally the orientation of the chloramphenicol resistance gene has been inverted compared with the earlier work in order to circumvent any issues of readthrough from this gene. When this plasmid was inserted into a strain producing the inactive mersacidin E17A variant (generated by double homologous recombination; Szekat et al . 2003) active mersacidin was produced. This therefore demonstrates a system which may be used to generate variant mersacidins using a single recombination event.

In a preferred aspect, the integrative plasmid contains a selectable marker (e.g. chloramphenicol acetyl transferase), and preferably the selectable marker is transcribed in the opposite orientation to the mrsA gene of the plasmid. Transforma tion

Although in practicing the present invention the Bacillus HIL cells may be transformed using protoplast transformation, as described in the prior art, the present invention also provides an improved transformation protocol utilising electroporation.

Prior to the present invention, it had not been demonstrated that electroporation of Bacillus HIL was possible, and indeed the accompanying examples demonstrate that using standard techniques gave no transformants of Bacillus HIL.

Accordingly, the present invention provides a method for the transformation of recipient Bacillus HIL cells (including ΔSigH, ΔMrsA and ΔMrsA ΔSigH cells) with plasmid DNA, which method includes the steps of: growing plasmid DNA in a host cell such that said DNA is free of methylation; isolating said plasmid DNA; growing said recipient cells in a growth medium supplemented with an osmostabilizer; harvesting said recipient cells to remove the growth medium; resuspending said recipient cells in an electroporation medium comprising an osmostabilizer; and electroporating said recipient cells with said plasmid DNA.

The osmostabilizer may be a sugar such as sucrose or fructose, or a polyol such as glycerol, sorbitol or mannitol, or mixtures of two or more of any of these components. Sorbitol and mannitol are preferred, and particularly mixtures thereof.

The growth medium may be tryptic soy broth or other medium used in the art for culture of Bacillus. The osmostabilizer (s) in the growth medium may be present at a total concentration in the range of 0.5M to 2. OM preferably 1.0 M. Preferably the growth medium includes a mixture of sorbitol in the concentration range of from 0.2 to 1.0M, preferably about 0.5M, and mannitol in the range of 0.2M to 1.0M, preferably about 0.5M.

Cells are generally harvested after the start of the stationary phase .

The osmostabilizer (s) in the electroporation medium may be present in the range of from 0.5 to 3.0M, preferably about 1.5 to 2.0 M. Preferably the electroporation medium contains a mixture of sorbitol in range of from 0.2M to 1.0M, preferably 1M, and mannitol in the range of from 0.2 to 1.0M, preferably 0.75M. The electroporation medium may also contain glycerol, for example from 5 to 30%, preferably 10% v/v.

Electroporation may be performed using standard techniques. The conditions used in the accompanying examples are one set of suitable conditions, and may be used generally in the practice of the present invention. However these may be varied and the precise conditions will depend upon the preferences of those of skill in the art, for example depending upon the apparatus available .

Following electroporation, cells are cultured in a suitable recovery medium. In a preferred aspect, the recovery medium also comprises sorbitol and mannitol, which typically may both be within the concentration ranges set out above for the electroporation medium. The recovery medium also comprises a growth medium, such as tryptic soy broth.

In a preferred aspect, the plasmid DNA is obtained by growth of the plasmid in an E. coli host cell deficient in DNA methylases, such as a dam dcm strain. This embodiment assumes that the plasmid has an origin of replication functional in E. coli . Alternatively, the plasmid DNA may be prepared from S . carnosus or any other natural methylation deficient host.

The process of the invention may be used to obtain frequencies of transformation of at least about 100, preferably at least about 500 and more preferably at least about 1,000 colonies per μg of DNA.

Recovery of the lantibiotic Recovering the mersacidin or other lantibiotic from the medium may be achieved by standard techniques in the art, such as separation from other components of the culture medium by chromatographic means . Such means include the use of hydrophobic resins, reversed phase chromatography, ion exchange chromatography and HPLC. The recovery of mersacidin is illustrated in US-A-5, 112, 806.

One process which may be used is to bind the mersacidin from the culture supernatant onto a hydrophobic resin such as HP20, then elute with acetonitrile-water or methanol-water . This is followed by dilution with water so as to allow binding onto a hydrophobic column such as a C18 reversed phase resin. The mersacidin is then eluted with acetonitrile or methanol and the eluate evaporated to reduce volume. The pH is then adjusted to about pH 2.5 with phosphate buffer and the solution bound onto a strong cation exchanger such Varian SCX, followed by elution with 50% methanol, 250mM phosphate buffer pH7. The eluate is desalted on another C18 column, eluted with methanol, then lyophilised.

This procedure may also be used to recover mersacidin variants, though where said variants have a different charge from mersacidin alterations to the process may be introduced. For example, the ion exchange step may be altered or omitted if the charge is different and hplc might be utilised. If the mersacidin variant is partly bound to the bacteria in which it is produced the product may be released by treatment with methanol, acetonitrile or similar solvents.

Reference herein to "recovery" or "recovering" includes the purification of the mersacidin or variant thereof to a degree such that it will be suitable for pharmaceutical use. Thus generally recovery will include the steps of removal of the microorganism (e.g. by centrifugation or filtration), separating the lantibiotic from other bacterial components present in the culture medium, and optionally if desired components of the culture medium. Thus the mersacidin or variant thereof will be in substantially isolated form.

The mersacidin or variant thereof may be recovered in a solution, such as a buffer required to elute the mersacidin or variant thereof from a chromatography column, or it may be recovered in the form of a lyophilized fraction.

The mersacidin or variant thereof may be in the form of a salt, particularly a pharmaceutically acceptable salt. These include basic salts, such as an alkali or alkaline earth metal salt, e.g. a sodium, potassium, calcium or magnesium salt. The salt may also be an acid addition salt such as those formed with hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid and the like, and organic acids such as acetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, malic acid, malonic acid, succinic acid, maleic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, p- toluenesulfonic acid, salicylic acid and the like. A potassium salt is preferred. The preparation of a potassium salt is described in US-A-5, 112, 806.

Preparation of Compositions .

The recovered lantibiotic or salt thereof may be brought into contact with a pharmaceutically acceptable carrier or diluent to provide a pharmaceutical composition. The composition may be in the form of a liquid, gel or solid.

Pharmaceutically acceptable carriers or diluents include those used in formulations suitable for oral, rectal, nasal, topical (including buccal and sublingual) , vaginal or parenteral (including subcutaneous, intramuscular, intravenous, intradermal, intrathecal and epidural) administration. Oral, nasal and topical administration may include administration by way of aerosols. The formulations may conveniently be presented in unit dosage form and may be prepared by any of the methods well known in the art of pharmacy. Such methods include the step of bringing into association the active ingredient with the carrier which constitutes one or more accessory ingredients. In general the formulations are prepared by uniformly and intimately bringing into association the active ingredient with liquid carriers or finely divided solid carriers or both, and then, if necessary, shaping the product.

For solid compositions, conventional non-toxic solid carriers include, for example, pharmaceutical grades of mannitol, lactose, cellulose, cellulose derivatives, starch, magnesium stearate, sodium saccharin, talcum, glucose, sucrose, magnesium carbonate, and the like may be used. The active compound as defined above may be formulated as suppositories using, for example, polyalkylene glycols, acetylated triglycerides and the like, as the carrier. Liquid pharmaceutically administrable compositions can, for example, be prepared by dissolving, dispersing, etc, an active compound as defined above and optional pharmaceutical adjuvants in a carrier, such as, for example, water, saline aqueous dextrose, glycerol, ethanol, and the like, to thereby form a solution or suspension. If desired, the pharmaceutical composition to be administered may also contain minor amounts of non-toxic auxiliary substances such as wetting or emulsifying agents, pH buffering agents and the like, for example, sodium acetate, sorbitan monolaurate, triethanolamine sodium acetate, sorbitan monolaurate, triethanolamine oleate, etc. Actual methods of preparing such dosage forms are known, or will be apparent, to those skilled in this art; for example, see "Remington: The Science and Practice of Pharmacy", 20th Edition, 2000, pub. Lippincott, Williams & Wilkins. The composition or formulation to be administered will, in any event, contain a quantity of the active compound (s) in an amount effective to alleviate the symptoms of the subject being treated.

For oral administration, a pharmaceutically acceptable non-toxic composition is formed by the incorporation of any of the normally employed excipients, such as, for example, pharmaceutical grades of mannitol, lactose, cellulose, cellulose derivatives, sodium crosscarmellose, starch, magnesium stearate, sodium saccharin, talcum, glucose, sucrose, magnesium, carbonate, and the like. Such compositions take the form of solutions, suspensions, tablets, pills, capsules, powders, sustained release formulations and the like.

Parenteral administration is generally characterized by injection, either subcutaneously, intramuscularly or intravenously. Injectables can be prepared in conventional forms, either as liquid solutions or suspensions, solid forms suitable for solution or suspension in liquid prior to injection, or as emulsions. Suitable excipients are, for example, water, saline, dextrose, glycerol, ethanol or the like. In addition, if desired, the pharmaceutical compositions to be administered may also contain minor amounts of non-toxic auxiliary substances such as wetting or emulsifying agents, pH buffering agents and the like, such as for example, sodium acetate, sorbitan monolaurate, triethanolamine oleate, triethanolamine sodium acetate, etc.

A more recently devised approach for parenteral administration employs the implantation of a slow-release or sustained-release system, such that a constant level of dosage is maintained. See, e.g., US Patent No. 3,710,795.

Dosage forms or compositions containing active ingredient in the range of 0.1 to 95% with the balance made up from non-toxic carrier may be prepared. Preferably, percentages of active ingredient of 0.1% to 50% in solution are employable.

Variant lantibiotics (e.g. mersacidin F3W, mersacidin G8A or mersacidin F3W G8A) and compositions thereof may be used in methods of treatment of the human or animal body, for example in the treatment of bacterial ^' infection, particularly MRSA (methicillin resistant staphylococcus aureus) infection. Such treatment may comprise the step of administering to a subject in need of treatment an effective amount of said lantibiotic or composition thereof. In another aspect, the invention provides a variant lantibiotic, particularly mersacidin F3W, mersacidin G8A or mersacidin F3W G8A for use in a method of treatment of the human or animal body, and the use of a lantibiotic, particularly mersacidin F3W, mersacidin G8A or mersacidin F3W G8A, for the manufacture of a medicament for use in a method of anti-bacterial treatment.

The invention is illustrated by the following examples. Example 1 - ΔSigH HIL

Construction of the sigH knockout mutant : A mutant of the mersacidin-producing strain Bacillus sp. HIL Y- 85,54728 (NCIMB Accession Number NCIMB 41211, deposited 19th March 2004) has been generated in which sigH was inactivated by insertion of a plasmid (pΔSIGHl) that carried an internal fragment of sigH (bp 165-488; accession number NC_000964, Entrez-Nucleotide) . The protein that is encoded by this fragment carries a deletion in the N-terminus, which is responsible for binding to the -10 region of the σH promoter and a deletion in the C-terminus that is involved in binding to the -35 region of the σH promoter (Lonetto et al . J.Bacteriol. 174, 3843-3849). After integration of this plasmid into the chromosome, two copies of sigH will be present in the chromosome, however both copies will encode inactive proteins (see Figure 1) . The upstream copy will carry the deletion of the C-terminus (bp 489- 657) and the downstream copy will encode a protein with a deletion in the N-terminus (bp 1-164) . Both proteins will be inactive .

Primers used for amplification of the internal fragment of sigH:

Template: purified chromosomal DNA of Bacillus sp . HIL Y- 85,54728 (prepared according to Altena et al. Applied and Environmental Microbiology 66, 2565-2571; 2000) . PCR conditions

PCR with these primers yielded the correct product of 339 bp and another product of approximately 500 bp . The 339 bp fragment was purified from an agarose gel employing MinElute Gel extraction kits (Qiagen, Hilden) , digested with Kpnl and Xbal and then ligated with the similarly digested temperature-sensitive plasmid pTVOmcs (Guder et al. Applied and Environmental Microbiology 68, 106-113; 2002) . The construct (pΔSIGHl) was then transformed into Staphylococcus carnosus TM 300 (ATCC 51365) by protoplast transformation (according to Gδtz & Schuhmacher FEMS Microbiol. Lett. 40, 285-288; 1987) and the transformants incubated at 30°C. The plasmid pΔSIGHl (4,676 kb) was then isolated from Staphylococcus carnosus TM 300 and transformed into the mersacidin producer strain Bacillus sp. HIL-85, 54728 by protoplast transformation (according to Grosch & Wollweber in Genetic Exchange, Streips et al . eds, pp. 97-105, Marcel Dekker Inc. 1982). Transformants were cultivated at 30°C on tryptic soy agar containing chloramphenicol (20mg/l) . For integration of the plasmid into the chromosome, a preculture was carried out in tryptic soy broth containing chloramphenicol (20mg/l) at 30°C, 180rpm. Diluted aliquots were then plated onto tryptic soy agar containing chloramphenicol (20mg/l) and the plates were incubated at 42 °C in order to select clones that had integrated the plasmid into the chromosome . Integration of pΔSIGHl was verified by PCR using the following primers :

pTVOIns-1 and pTVOIns-2 anneal within pTVOmcs and produce an amplification product of 496 bp that contains the insert and the neighbouring parts of the vector. A PCR product with this primer combination would indicate the presence of free plasmid in the cell. Integration would be indicated by a 596 bp product amplified with SigHl and pTVOIns-1 and a 404 bp product amplified with SigH2 and pTVOIns-2. The bands obtained with the various primer combinations were consistent with integration of pΔSIGHl in the expected manner.

Properties of the SigH deficient strain : When grown at 42 °C in the presence of the appropriate antibiotic (Mueller-Hinton broth plus 20mg/l chloramphenicol, 180rpm, 72h) , the pΔSIGHl plasmid remained integrated. In contrast to the parent strain, no spores were formed, to test for spore formation, 1 ml of culture was incubated for 1 h at 90 °C in order to kill all vegetative cells. Aliquots of this suspension were then plated on nutrient agar. No colonies were formed by the sigH mutant, whereas 5 x 10⁹ CFU/ml were counted for the parent strain treated in the same way. The mutant is also characterised by the formation of translucent colonies on LB agar plates after storage at 4C, and sensitivity to chloroform: a colony is overlayed with a drop of chloroform, when the chloroform has evaporated, the plate is incubated at 37 °C. Vegetative cells are killed by chloroform, while spores are not sensitive to chloroform. Colonies from the mutant strain were killed by this procedure whereas the parent strain survived. Antibiotic production by the SigH deficient strain :

The SigH deficient strain was grown for 72 h in production broth (Bierbaum et al . FEMS Microbiol. Lett. 127, 121-126) containing chloramphenicol (20mg/l) at 42°C and 190 rpm. Production of mersacidin was similar to the Bacillus sp. HIL Y-85, 54728 control. Zones of inhibition of growth of Micrococcus l uteus ATCC 4498 produced by four separate ΔsigH transformants were similar to those obtained with the parent Bacillus sp . HIL Y- 85,54728 whereas no zone was observed with a strain (reel; described in Altena et al . 2000) which is deficient in mersacidin production.

The production of (an) antibacterial substance (s) other than mersacidin (see Altena et al . 2000) was inhibited in the SigmaH deficient strains . The SigmaH deficient strain and the parent strain were incubated in LB-broth for 16 hours and the sterilised (filtration) culture supernatant was tested for antibiotic activity against M. luteus ATCC 4498 as indicator strain in an agar diffusion assay on a blood agar plate. No significant mersacidin production occurs under these conditions as judged by hplc (on Phenomenex Luna 3μ C18 150mm x 4.6mm; solvent A: 30% acetonitrile in 20mM potassium phosphate buffer pH 7.0, solvent B: 65% acetonitrile in 20mM potassium phosphate buffer pH 7.0. Gradient: 0%B to 100%B in 10 minutes, held at 100%B for 1 minute, then returned to 0% B in 20 seconds. Flow rate: lml/minute, lOμl injection, UV detection at 268nm) . However, the parent strain Bacillus sp . HIL Y-85, 54728 shows a zone of activity against M. luteus under these conditions which is due to one or more other antibiotics. In contrast no inhibition zones were formed by the SigH deficient strain under the same conditions . Application of the SigH deletion strain in an overlay assay:

The SigH deletion strain was incubated on production agar (i. e. production broth plus 1.5% agar) for 72 h. The colonies were killed by overlaying with a drop of chloroform. This was then allowed to evaporate and the plate was overlayed with soft agar containing M. luteus ATCC 4498. Large inhibition zones were observed (diameter 3.6 cm) . When the parent strain was used in a similar fashion the agar overlay was overgrown by bacilli as the spores survive the chloroform treatment.

Immunity of the SigH deficient strain to mersacidin :

The mersacidin biosynthetic cluster contains genes which confer immunity to mersacidin (Altena et al . 2000; Guder et al . , 2002). The immunity of the SigH deficient strain was tested in half- strength Mueller Hinton medium after addition of 10 mg/ml mersacidin to the culture at an optical density of about 0.4. The SigH deficient strain resumed growth at least as quickly as the parent strain, indicating that, like mersacidin production, immunity is also unaffected (Figure 2).

Example 2 - Stable sigH deletion mutant This example illustrates the construction of a sigH mutant via double homologous recombination. The mutant of Example 1 above is prepared by single homologous recombination. As such it is necessary to use antibiotic selection to maintain the integrant, whereas the new sigH is a stable gene replacement obtained by deletion of a portion of the SigH gene from the bacterial chromosome .

Construction of plasmid pNB029 for obtaining a sigH deletion mutant of Bacillus HIL . (a) Construction of plasmid pΔyacP2. A PCR product containing from base 116152 to base 116766 of the corresponding region of Bacillus HIL chromosome (numbering according to Bacillus subtilis 168 genome sequence NC_000964) was obtained using oligonucleotides yacPEcoRI: 5' -AATGAATTCCAGGAAACAGGGTTATTGTTG (SEQ ID NO: 9) and yacPHindlll: 5' -TCCAAGCTTCCTATTAAGAAATAGGATCTTGC (SEQ ID NO: 10) and chromosomal DNA of Bacillus HIL as template. The PCR product was purified by agarose gel electrophoresis and eluted from the agarose gel by using the QIAquick Gel Extraction Kit (Qiagen) . The purified PCR product was digested with EcoRI and HindiII and ligated to pBT2 previously digested with EcoRI and HindiII and the ligation mixture was used to transform Escherichia coli

DH10B (Invitrogen) . Ampicillin resistant colonies were selected and the containing plasmids were isolated and characterised by restriction analysis. Plasmids with the expected restriction pattern were further characterised by sequencing. Plasmid containing the expected insert sequence was selected and called pΔyacP2.

(b) Construction of plasmid pΔrpmG.

A PCR product containing from base 117137 to base 117767 of the corresponding region of Bacillus HIL chromosome (numbering according to Bacillus subtilis 168 genome sequence NC_000964) was obtained using oligonucleotides rpmGHindlll: 5' -GACAAGCTTAGTTACCAAGAGATTTCTGATGA (SEQ ID NO: 11) and rpmGEcoRV: 5' -ATAGATATCCCGCTGAACGGGTTTTGGC (SEQ ID NO: 12) and chromosomal DNA of Bacillus HIL as template. The PCR product was purified by agarose gel electrophoresis and eluted from the agarose gel by using the QIAquick Gel Extraction Kit (Qiagen) .

The purified PCR product was ligated to pUCl8 previously digested with Smal and the ligation mixture was used to transform Escherichia coli DH10B (Invitrogen) . Ampicillin resistant colonies were selected and the containing plasmids were isolated and characterised by restriction analysis.

Plasmids with the expected restriction pattern were further characterised by sequencing. Plasmid containing the expected insert sequence was selected and called pΔrpmG .

(c) Construction of plasmid pNB029. Plasmid pΔrpmG was digested with HindiII and HcoRV and the insert of approximately 550bp was purified by agarose gel electrophoresis and eluted from the agarose gel by using the QIAquick Gel Extraction Kit (Qiagen) . This insert was ligated to pΔyacP2 previously digested with HindiII and EcoRV and the ligation mixture was used to transform Escherichia coli DH10B (Invitrogen) . Ampicillin resistant colonies were selected and the containing plasmids were isolated and characterised by restriction analysis. Plasmid displaying the expected restriction pattern was selected and called pNB029 (Figure 3).

Genera tion of Bacillus HIL ΔsigH.

Protoplasts from Bacillus HIL were prepared according to Szekat et al . , 2003 and transformed with plasmid pNB029. Chloramphenicol resistant .colonies were transferred to tryptic soy agar containing chloramphenicol (20mg/l) and grown at 30°C for 24h. For integration of the plasmid into the chromosome, a preculture in tryptic soy broth plus chloramphenicol (20mg/l) was carried out at 30°C and 200 rp . Diluted aliquots of this preculture were plated onto tryptic soy agar containing chloramphenicol (20 mg/1) and the plates were incubated at 42 °C to select clones that had integrated the plasmid into the chromosome. One colony was selected and grown at 42 °C and 200 rpm on tryptic soy broth containing chloramphenicol (20mg/l) for 24 hours. Serial dilutions of this culture were plated on tryptic soy agar containing chloramphenicol (20mg/l) to obtain isolated colonies which have pNB029 integrated into the chromosome of Bacillus HIL. One colony was selected and grown at 42°C and 200 rpm on 50 ml of tryptic soy broth, after 12h of growth, 0.05ml of this culture were transferred to 50 ml of tryptic soy broth and grown in the same conditions of the previous culture, 5 consecutive subcultures were carried out and samples of the sixth subculture were titrated and frozen. Colonies from this culture were grown on tryptic soy agar at 30°C for 24h and replicated into tryptic soy agar containing chloramphenicol (20mg/l) . Chloramphenicol sensitive colonies were isolated and chromosomal DNA was prepared. DNA samples were analysed by PCR and the colonies that have a deletion in sigH were isolated.

Example 3 - Cassette Expression System

Construction of plasmid pNB013 :

A PCR product containing from base 4836 to base 5249 of the mersacidin gene cluster (accession number: AJ250862) representing the promoter and leader sequence of mrsA was obtained using oligonucleotides: jc7 5 ' CTTATGAGAATTCGAGACAAGGTAAACT (SEQ ID NO: 13) and jc8 5'GCATGCTGCTTCCATGTCTCCCGCACCTACT (SEQ ID NO: 14) and plasmid pMERl (Altena et al . , Appl . Env. Microbiol. 66, 2565-2571; 2000) as template. PCR was carried out using a Robocycler Gradient 96 (Stratagene) and the reaction conditions were- as follows: Cycle 1; denaturation at 95C for 3 min, annealing at 45C for 1 min, extension at 72C for 1 min, cycle2-26; denaturation at 95C for 1 min, annealing at 45C for 1 min, extension at 72C for 1 min, and a further incubation at 72C for 10 min. The enzyme used was Pfu polymerase (Promega) and the buffer and dNTPs composition and concentration used was the recommended by the suppliers. The PCR product was purified by agarose gel electrophoresis and eluted from the agarose gel by using the QIAquick Gel Extraction Kit (Qiagen) . The purified PCR product was ligated to pUC18 (Norrander, J., Kempe, T. and

Messing, J. (1983) Construction of improved M13 vectors using oligodeoxynucleotide-directed mutagenesis. Gene 26:101-106.) previously digested with Smal and the ligation mixture was used to transform Escherichia coli DH10B (Invitrogen) . Ampicillin resistant colonies were selected and the contained plasmids were isolated and characterised by restriction analysis. Plasmids with the expected restriction pattern were further characterised by sequencing using M13mpl8 reverse and forward primers.

Plasmid containing the expected insert sequence and ligated into pUClδ in the orientation that the insert can be excised by digesting with EcoRI was selected and called pNB013 (Figure 4).

Construction of plasmid pNB014 . Plasmid pNB013 was digested with HcoRI and the 425 bp DNA fragment generated in this reaction was purified by agarose gel electrophoresis and eluted using the QIAquick Gel Extraction Kit (Qiagen) . The purified fragment was ligated to pCUl (Augustin et al . Eur. J. Biochem. 204, 1149-1154; 1992) previously digested with EcoRI and treated with shrimp alkaline phosphatase (Amersham Life Sciences) . The ligation mixture was used to transform E . coli DH10B (Invitrogen) , ampicillin resistant colonies were selected and the contained plasmids were isolated and characterised by restriction analysis. Plasmid with the expected restriction pattern where the 425 bp fragment can be excised by digesting with EcoRI and not with Sphl was selected and called pNB014 (Figure 4) .

Construction of plasmid pNB018.

Plasmid pNB014 was digested with Sphl and Hindlll and the 5.6 kbp DNA fragment generated in this reaction was purified by agarose gel electrophoresis and eluted using the QIAquick Gel Extraction Kit (Qiagen) . This DNA fragment was ligated to the annealed complementary oligonucleotides representing the coding sequence for the propeptide region of mrsA into which a silent mutation has been introduced to create a HsrGl site which is not present in the natural sequence: j c9 :

5' CACTTTTACATTGCCTGGTGGCGGCGGTGTTTGTACACTAACTTCTGAATGTATTTGTTA (SEQ ID NO:15) jclO: 5 ' AGCTTAACAAATACATTCAGAAGTTAGTGTACAAACACCGCCGCCACCAGGCAATGTAAAAG TGCATG (SEQ^' ID NO: 16)

The ligation mixture was used to transform E . coli DH10B (Invitrogen), ampicillin resistant colonies were selected and the contained plasmids were isolated and characterised by restriction analysis . The plasmids containing the newly introduced BsrGI site were selected and sequenced using Ml3mpl8 reverse primer. The plasmid containing the expected sequence was called pNB018 (Figure 4) . This plasmid is a pCUl derivative containing the promoter of mrsA and the structural gene mrsA modified in a way that the area encoding the propeptide region of mersacidin from amino acid 1 to 12 can be removed by digestion with the restriction enzymes Sphl and BsrGI , the area between amino acids 12-20 with the restriction enzymes BsrGI and HindllI, and the area between amino acids 1-20 with the enzymes Sphl and HindiII (Figure 4) .

Plasmid pNB018 may be used for generating libraries of mersacidin variants which will complement, in trans, strains which have a fully active mersacidin biosynthetic cluster including an expressed mrsRl gene. It is particularly useful for complementing derivatives in which the mrsA gene as been mutated to produce an antibacterially-inactive lantibiotic, or ^knocked out' without affecting mrsRl expression.

Cons truction of pNB026.

In order to generate a plasmid for construction of libraries of mutations in the first 11 amino acids of mersacidin with no background wild type mrsA gene, plasmid pNB018 was digested with Sphl and BsrGI and the 5.6 kbp DNA fragment generated in this reaction was purified by agarose gel electrophoresis and eluted using the QIAquick Gel Extraction Kit (Qiagen) . This DNA fragment was ligated to a purified 1.5 kbp Sphl/BsrGI fragment obtained from pNB2008. Plasmid pNB2008 is a pUC18 derivative containing a PCR product from base 5δ26 to 9353 of the mrs gene cluster (accession number: AJ250δ62) cloned in the orientation such that base 5δ26 is close to the HcoRI site and base 9353 to the HindiII in the multiple cloning site of this vector.

The ligation mixture was used to transform Escherichia coli DH10B (Invitrogen) . Ampicillin resistant colonies were selected and the contained plasmids were isolated and characterised by restriction analysis. Plasmid with the expected restriction pattern was called pNB026 (Figure 5) .

Construction of pNB027.

In order to generate a plasmid for construction of libraries of mutations from amino acid 12 to 20 of mersacidin with no background wild type mrsA gene, plasmid pNBOlδ was digested with HsrGI and HindiII and the 5.6 kbp DNA fragment generated in this reaction was purified by agarose gel electrophoresis and eluted using the QIAquick Gel Extraction Kit (Qiagen) . This DNA fragment was ligated to a purified 930 bp BsrGI/HindiII fragment (from base 7δ41-δ774 of mrs gene cluster) obtained from pNB3002. Plasmid pNB3002 is a pUC18 derivative containing from base 7841 of the mrs gene cluster to the next HcoRI site outside the cluster, downstream of mrsΥ . The ligation mixture was used to transform Escherichia coli DH10B (Invitrogen) . Ampicillin resistant colonies were selected and the contained plasmids were isolated and characterised by restriction analysis. Plasmid with the expected restriction pattern was called pNB027 (Figure 5) . The value of introducing these ^Λstuffer' DNA fragments is that when the region is replaced by the annealed oligonucleotides to generate the variant library there is a significant decrease in plasmid size. The resulting plasmids can thus be readily purified away from any minor population of unrestricted plasmid thus eliminating any background' which would otherwise generate wildtype mersacidin.

Construction of a library of mrsA genes .

Plasmid pNB026 was digested with Sphl and BsrGI and the 5.6 kbp DNA fragment generated in this reaction was purified by agarose gel electrophoresis and eluted using the QIAquick Gel Extraction Kit (Qiagen) . This DNA fragment was ligated to the annealed complementary, degenerate oligonucleotides:

jc27: 5'CACTTTTACADTGCCTGBTGBCGBCGBTGBTT (SEQ ID N0.17) jc28: 5'GTACAAVCAVCGVCGVCAVCAGGCAHTGTAAAAGTGCATG (SEQ ID NO: 18)

D = A or G or T; B = C or G or T; V = A or C or G; H = A or C or T.

The ligation mixture was used to transform E. coli DH10B (Invitrogen) . One tenth of the volume of the transformation mixture (0.1 ml) was used to titrate the library by plating on LA + ampicillin (100 mg/1) . After growth for 12h at 37C, ampicillin resistant colonies were counted and a sample of the contained plasmids were isolated and characterised by sequence analysis to assess the diversity of the library. The 0.9 ml remaining of the transformation mixture was inoculated into 100ml LB + ampicillin (lOOmg/1) and incubated at 30C, 250 rpm. After 12h growth, plasmid DNA was prepared. The plasmid library is introduced into dcm dam E . coli and grown, the plasmid DNA recovered and used to transform E17A HIL. Transformants are screened for anti-bacterial activity.

Construction of plasmid pNB024. Plasmid pNBOlδ was digested with EcoRI and EcoRV and incubated with Klenow fragment of DNA polymerase in the presence of dATP, dTTP, dGTP and dCTP. The 5.4 kbp DNA fragment generated in this reaction was separated and purified by agarose gel electrophoresis and elution using the QIAquick Gel Extraction Kit (Qiagen) . The purified fragment was religated and used to transform E. coli DH10B (Invitrogen) . Ampicillin resistant colonies were selected and the contained plasmids were isolated and characterised by restriction analysis. The plasmid that lost the DNA sequence comprised between HcoRI and EcoRV in positions 4δ43 and 4997 of the mersacidin gene cluster (accession number: AJ250862) respectively was called pNB024 (Figure 4) . This plasmid is a pNB018 derivative containing a 150 bp deletion at the- 5' end of the promoter of mrsA.

Plasmid pNB024 has similar utility to pNBOlδ but lacks the putative operator site upstream of mrsA and thus gives lower expression of the introduced mrsA variant.

Construction of plasmid pNB028 (see Figure 6)

A PCR product containing from base 5313 to base 5905 of the mersacidin gene cluster (accession number: AJ250δ62), representing the 5' end of the mrsRl gene as far as the BsrGI site, was obtained using oligonucleotides: jc36: 5'AAGCTTGATTTATATAGGCTGTTTCCC (SEQ ID NO: 19) and jc37: 5'GTGTACGTAAAGACTTGACCTACC (SEQ ID NO: 20) and plasmid pMERl (Altena et al . , 2000) as template. PCR was carried out using a Robocycler Gradient 96 (Stratagene) and the reaction conditions were as follows: Cycle 1; denaturation at 95C for 3 min, annealing at 45C for 1 min, extension at 72C for 1 min, cycle2-26; denaturation at 95C for 1 min, annealing at 45C for 1 min, extension at 72C for 1 min, and a further incubation at 72C for 10 min. The enzyme used was Pfu polymerase (Promega) and the buffer and dNTPs composition and concentration used was the recommended by the suppliers. The PCR product was purified by agarose gel electrophoresis and eluted from the agarose gel by using the QIAquick Gel Extraction Kit (Qiagen) . The purified PCR product was ligated to pUC19 (Yanisch-Perron, C, Vieira, J. and Messing, J. (1985) Improved M13 phage cloning vectors and host strains: Nucleotide sequences of the Ml3mpl8 and pUC19 vectors. Gene 33:103-119) previously digested with Smal and the ligation mixture was used to transform Escherichia coli DH10B (Invitrogen) . Ampicillin resistant colonies were selected and the containing plasmids were isolated and characterised by restriction analysis. Plasmids with the expected restriction pattern were further characterised by sequencing using M13mpl8 reverse and forward primers. Plasmid containing the expected insert sequence and ligated into pUC19 in the orientation that the insert can be excised by digesting with Hindlll was selected and called pMRl5' .

A PCR product containing from base 5δ94 to base 6130 of the mersacidin gene cluster (accession number :AJ250662) , representing the 3' end of the mrsRl gene beyond the BsrGI site, was obtained using oligonucleotides: jc32: 5'CTTTACGTACACATTAGTTCTCTTAGAG (SEQ ID NO: 21) and jc33: 5' GGAAGCGGAAGAGCTTTAAAGAAAGAACAAAACACCCC (SEQ ID NO: 22) and plasmid pMERl (Altena et al . , 2000) as template. PCR was carried out using a Robocycler Gradient 96 (Stratagene) and the reaction conditions were as follows: Cycle 1; denaturation at 95C for 3 min, annealing at 45C for 1 min, extension at 72C for 1 min, cycle2-26; denaturation at 95C for 1 min, annealing at 45C for 1 min, extension at 72C for 1 min, and a further incubation at 72C for 10 min. The enzyme used was Pfu polymerase (Promega) and the buffer and dNTPs composition and concentration used was the recommended by the suppliers. The PCR product was purified by agarose gel electrophoresis and eluted from the agarose gel by using the QIAquick Gel Extraction Kit (Qiagen) . The purified PCR product was ligated to pUCl9 previously digested with Sinai and the ligation mixture was used to transform Escherichia coli DH10B (Invitrogen) . Ampicillin resistant colonies were selected and the contained plasmids were isolated and characterised by restriction analysis. Plasmids with the expected restriction pattern were further characterised by sequencing using M13mplδ reverse and forward primers. Plasmid containing the expected insert sequence was selected and called pMRl3' .

Plasmid pMRl3' was digested with SnaBI and Sapl , the 250 bp DNA fragment generated in this reaction was purified by agarose gel electrophoresis and eluted using the QIAquick Gel Extraction Kit (Qiagen) . Plasmid pMR15' was linearised by digestion with SnaBI and Sapl and ligated to the 250bp fragment isolated from pMR13' . The ligation mixture was used to transform Escherichia coli

DH10B (Invitrogen) . Ampicillin resistant colonies were selected and the contained plasmids were isolated and characterised by restriction analysis. Plasmid with the expected restriction pattern was selected and called pMRl . pMRl contains the entire mrsRl gene but with a silent mutation to remove the internal BsrGI site.

Plasmid pMRl was digested with HindiII and Sapl, the δ2δ bp DNA fragment generated in this reaction was purified by agarose gel electrophoresis and eluted using the QIAquick Gel Extraction Kit (Qiagen) . Plasmid pNBOlδ was linearised by digestion with HindiII and Sapl and ligated to the 828 bp DNA fragment isolated from pMRl . The ligation mixture was used to transform Escherichia coli DH10B (Invitrogen) . Ampicillin resistant colonies were selected and the contained plasmids were isolated and characterised by restriction analysis. Plasmid with the expected restriction pattern was selected and called pNB028. This plasmid is a derivative of pNBOlδ containing downstream of the modified mrsA gene, the regulatory gene mrsRl with a silent mutation to eliminate the BsrGI site present within the sequence of this gene.

Plasmid pNB02δ has similar utility to pNB018, but it will also complement strains in which mrsRl is defective eg due to polar effects of a knockout of mrsA gene (as in reel Altena et al . 2000) .

Example 4 - In trans Complementation

Complementa tion of Bacillus sp . HIL Y-85 , 54728 E1 7A in trans using pNB018 and pNB024

This strain is a gene replacement mutant where the mrsA gene has been substituted for a mutant mrsA that produces the mersacidin variant E17A with no antibacterial activity (Szekat et al . (2003) Appl. Env. Microbiol. 69, 3777-3783). Plasmids pNBOlδ and pNB024 were introduced into E . coli dam dcm strain ET12567 by electroporation. Ampicillin resistant colonies were selected, plasmid DNA was prepared using the Promega Wizard mini-prep kit and concentrated by ethanol precipitation. These plasmid preparations were used to transform electrocompetent cells of Bacillus sp . HIL Y-85, 54728 E17A by the method described previously for Bacillus sp . HIL.

Two transformants from each plasmid were selected and streaked to L-agar containing 20mg/l chloramphenicol and incubated at 30C for 24hours. A loopful of growth was used from each to inoculate 7ml of tryptic soy broth containing 20mg/l chloramphenicol in a miniaturised culture vessel. These seed cultures were incubated at 30C with shaking at 250 rpm for approximately 24 hours, 0.3ml of each culture was used to inoculate 7 ml of production medium containing 20mg/l chloramphenicol in miniaturised culture vessels, which were incubated at 30C with shaking at 250rpm for 5 days. The composition of the production medium is shown below.

Mersacidin production medium (2x BPM + 300 mM gl ucose)

The cultures were assayed for production of mersacidin by HPLC and bioassay against Micrococcus luteus ATCC4698. Samples of production cultures (1ml) were centrifuged at 14000 rpm for 10 minutes. Supernatants were decanted and used undiluted for HPLC and bioassay.

For bioassays, M. luteus was inoculated from frozen stock into 10 ml half-strength Muller-Hinton broth in a 50 ml conical flask, and incubated at 30C with shaking at 250 rpm for approximately 7 hours, 0.3ml of this culture was used to inoculate 300ml of Muller-Hinton agar which was poured into a bioassay plate. Wells (6 mm diameter) were made with a cork-borer. Samples of 50μl of supernatants were added to these wells. The concentration of mersacidin in the samples was calculated by comparing the diameter of inhibition zones of samples against a range of concentrations of a pure mersacidin standard. For HPLC analysis, a gradient system was used. The column was a Phenomenex Luna 3μ C18 150mm x 4.6mm. Solvent A was 30% acetonitrile in 20mM potassium phosphate buffer pH 7.0, solvent B was 65% acetonitrile in 20mM potassium phosphate buffer pH 7.0. The gradient increased from 0%B to 100%B in 10 minutes, held at 100%B for 1 minute, then returned to 0% B in 20 seconds. Total run time was 15 minutes at l l/minute, lOμl injection, detection at UV 268nm.

The results are shown in the table below, and show that both pNB018 and pNB024 restore mersacidin production in Bacill us HIL E17A. Plasmid pNB018 gives mersacidin production levels comparable to the original (wild-type) HIL, but pNB024 gives reduced production.

Mersacidin mg/L

Complementa tion of Bacillus sp . HIL Y-85, 54728 reel by pNB028

This strain is a gene replacement mutant, the mrsA gene has been substituted for an erythromycin resistance gene ( ermB) placed in the opposite orientation to mrsRl (Altena et al . , 2000). Plasmid pNB02δ was prepared from E. coli ET12567, introduced into Bacill us HIL Y-δ5,5472δ reel by electroporation, and five transformants were tested for mersacidin production using the same conditions and procedure as used for pNBOlδ and pNB024 previously. The results are shown below, Mersacidin mg/1

Plasmid pNB028 restored mersacidin production in 4 of 5 transformants tested, to levels of 29-65% compared to wild type levels (i.e. the parental HIL strain) . No production was seen in one transformant, and generally in these experiments, approximately 10-20% of transformants failed to make mersacidin. The reason for this is not known, but presumably reflects instability in the strain or in the plasmid construct.

Construction of mersacidin derivative genes and in trans complementa tion .

jcl5: 5'CACTTTTACATTGCCTGGTGYCGGCGGTGTTT (SEQ ID NO: 23) jelβ: 5'GTACAAACACCGCCGRCACCAGGCAATGTAAAAGTGCATG (SEQ^' ID NO:24

R = A or G C or T

These oligonucleotides are designed so they would produce a mixture of mutant mrsA genes encoding for mersacidin variants G8A or G6V. The ligation mixture was used to transform E . coli DH10B (Invitrogen) . Six ampicillin resistant colonies were selected, grown in LB + ampicillin (100 mg/1) and plasmids were isolated and characterised by sequence analysis. From the six clones analysed, four encoded the mutation G8A (pNB2026) and two the mutation GδV. Plasmids encoding each mutant were used to transform E. coli ET12567.^' Plasmids obtained from these strains were used to transform Bacillus sp . HIL Y-δ5,5472δ E17A.

Chloramphenicol resistant colonies were selected and grown in 3ml Tryptic Soy Broth at 30C for 24 hours, 250 rpm and 0.3ml of these cultures were used to inoculate 7ml of 2xBPM + 300 mM glucose + chloramphenicol (20mg/l) . After five days of incubation at 30C and 250rpm, a 1 ml sample was collected and centrifuged at 13000 rpm for 10 min, the supernatant was removed, extracted with 1 volume of chloroform and the aqueous phase used for bioassay and HPLC-MS analysis (see accompanying disclosure for method) . LC-MS showed for wildtype mersacidin peaks at m/z=913 (M+2H)²⁺, m/z=924 (M+H+Na)²⁺ , m/z=932 (M+H+K)²⁺. For GδA peaks were observed at 920, 931, 939 and for GδV at 934, 945, 953. These masses are consistent with production of the expected mature lantibiotic products . Production of GδA was comparable to mersacidin while the production of G8V was considerably lower. Bioassays against M. luteus showed that mersacidin variant G8A has antibiotic activity while the variant GδV was inactive.

Production of a mersacidin variant using in trans complementa tion .

Plasmid pNB026 was digested with Sphl and BsrGI and the 5.6 kbp DNA fragment generated in this reaction was purified by agarose gel electrophoresis and eluted using the QIAquick Gel Extraction Kit (Qiagen) . This DNA fragment was ligated to the annealed complementary oligonucleotides: 0/SB34F: 5' CACTTGGACATTGCCTGGTGGCGGCGGTGTTT (SEQ ID NO: 25) 0/SB35R: 5' GTACAAACACCGCCGCCACCAGGCAATGTCCAAGTGCATG (SEQ ID NO: 26)

These oligonucleotides are designed so they would produce a mutant mrsA gene encoding for the mersacidin variant F3W.

The ligation mixture was used to transform E . coli DH10B (Invitrogen) . Ampicillin resistant colonies were selected, grown in LB + ampicillin (100 mg/1) and plasmids were isolated and characterised by sequence analysis. Plasmid encoding the expected mutant (pNB2024) was used to transform E . coli ET12567 and the plasmid obtained from this strains was used to transform Bacillus sp. HIL Y-85, 54728 E17A. Chloramphenicol resistant colonies were selected and grown in 3ml Tryptic Soy Broth at 30C for 24 hours, 250 rpm and 0.3ml of these cultures were used to inoculate 7ml of 2xBPM + 300 mM glucose + chloramphenicol (20mg/l) . After five days of incubation at 30C and 250rpm, 1 ml sample was collected and centrifuged at 13000 rpm for 10 min, the supernatant was removed extracted with 1 volume of chloroform and the aqueous phase used for bioassay and HPLC-MS analysis . LC-MS results showed that the mersacidin variant F3W (m/z=932.5 (M+2H)²⁺, m/z=943.5 (M+H+Na)²⁺ , m/z=951.5 (M+H+K) ²⁺ ) was produced at concentration comparable to the wild type production of mersacidin. Bioassays against M. l uteus showed that mersacidin variant F3W has antibiotic activity comparable to mersacidin.

Example 5 - Single Homologous Recombination

Construction of pPARl/2 :

In order to test the effect of insertion of a plasmid harbouring a functional mrsRl gene on the expression of mersacidin, the plasmid pPARl/2 was constructed. Plasmid pPARl/2 comprises mrsA, mrsRl and the promoter of mrsA (see below) but not the EcoRI- EcoRV (putative operator) region upstream of mrsA in a temperature-sensitive insertion vector (pTVOmcs; Guder et al . Applied and Environmental Microbiology 68, 106-113; 2002). A map is shown in Figure 7. The BcoRI site was introduced by the amplification primer 5 'mrsARl.

PCR of the mrsAmrsRl region from the plasmid pMERl (Altena et al . , 2000) with the primers 5'mrsARl and 3 'mrsARl yielded the expected product of 1078 bp .

Primer used for amplification of the insert (promoter, mrsA and mrsRl ) of pMer2

PCR conditions

The fragment was purified by agarose gel electrophoresis employing MinElute Gel extraction kits (Qiagen, Hilden) , digested with BcoRl and HindiII and then ligated with the similarly digested temperature-sensitive plasmid pTVOmcs (Guder et al . , 2002). The construct was used to transform Staphylococcus carnosus TM 300 protoplasts (according to Gδtz and Schuhmacher FEMS Microbiol. Lett. 40, 2δ5-2δ8; 1987) and the transformants were incubated at 30°C. The plasmid pPARl/2 was then isolated from Staphylococcus carnosus TM 300 and used to transform protoplasts of the E17A mersacidin producer strain Bacillus HIL E17A (Szekat et al . , 2003) according to Grosch and Wollweber (in Genetic Exchange, Streips et al . eds, pp. 97-105, Marcel Dekker Inc. 198219δ2). The variant E17A mersacidin does not show antibacterial activity and simplifies detection of production of mersacidin variants with antibacterial activity.

Integra tion of pPARl/2 into the chromosome of Bacillus HIL E1 7A :

Transformants were grown at 30°C on tryptic soy agar containing chloramphenicol (20mg/l) . For integration of the plasmid into the chromosome, a preculture in tryptic soy broth plus chloramphenicol (20mg/l) was carried out at 30°C and 180 rpm. Diluted aliquots of this preculture were plated onto tryptic soy agar containing chloramphenicol (20 mg/1) and the plates were incubated at 42 °C to select clones that had integrated the plasmid into the chromosome. There are two possible points of integration for the plasmid so the location of the incoming wildtype gene depends on whether the cross over takes place upstream or downstream of the point mutation (T->G) that leads to the E17A exchange (Figure 8) . There are promoter regions in front of both structural genes, however the BcoRI-EcoRV region that might fulfil the role of an operator is only present upstream of the first (upstream) copy of the structural gene. It was therefore not clear, whether both copies would be transcribed.

The resulting colonies and the strains bearing the free plasmid were tested for production of active mersacidin and characterized by PCR:

Overnight cultures (1 ml tryptic soy broth plus 20 mg/1 chloramphenicol at 42 °C) of each transformant were harvested and washed with sterile water. The pellet was resuspended in 0.1 ml water and 1 μl was used as template for PCR analysis. The templates were denatured for 10 min at 94 °C. A competitive PCR using Taq polymerase (Qiagen, Hilden) and E17A Mut or E17A Umut as reverse primers and primer5 ' , which anneals upstream of the BcoRI site on the chromosome as forward primer, was used to determine the location of the mutant and wild type gene (Szekat et al . , 2003) . The expected size of the PCR product is 509 bp .

Primers used for competitive PCR:

PCR conditions

The transformants were tested for the presence of free plasmid by PCR with the primer pair pTVOIns-1 and pTV0Ins-2 using Taq polymerase (Qiagen, Hilden) . The primers anneal with pTVOmcs and amplify a fragment of 1.2 kb that contains the insert and the neighbouring parts of the vector.

PCR conditions

In order to determine whether multiple insertions had occurred, a long range PCR employing BIO-X-ACT long DNA-polymerase (Bioline, Luckenwalde) was performed with primerδ ' and 3'mrsD. Primer5' anneals upstream of the BcoRI site and primer 3'mrsD anneals in the 3' terminus of mrsD . The PCR product should comprise all of the inserted plasmid.

PCR conditions

Antibacterial activity was tested after 72 h incubation in double strength production medium (Bierbaum et al . FEMS Microbiol. Lett. 127, 121-126). The supernatant was sterilised by filtration and 50 μl were plated on blood agar plates with M. luteus as indicator organism.

The following correlation was observed between mersacidin production and the nature of the construct:

Where inhibition zones were detected production of wild type mersacidin was confirmed by hplc-MS:

Column: Phenomenex Luna C18(2) 150x4.6mm 3μ Flow rate: lml/min Mobile phase: A 10% acetonitrile, 0.1% formic acid 90% water B 90% acetonitrile, 0.1% formic acid, 90% water Linear gradient A to B over 10 minutes, hold 1 min, B→A

Wavelength: 200-400nm

Inj ection lOμl volume :

Post column 1:10 split :

Mass Micromass Platform LC spectrometer:

Mode: Electrospray positive

Nitrogen flow: 3801/hr

Capillary 3.15KV voltage :

Cone voltage: 40V

Skimmer lens 5V offset :

Mersacidin was detected as a doubly charged ion m/z=913 (M+2H)²⁺, together with its sodium and potassium adducts m/z=924 (M+H+Na)²⁺, m/z=932 (M+H+K)²⁺.

These results indicate that the wild type mrsA gene was expressed after integration in the upstream or downstream position. There was no production of antibacterial activity when the plasmid was autonomous (i.e. not integrated into the chromosome) . One clone (number 2, which produced a large inhibition zone) was characterised further using long range PCR covering the region where the insertion had taken place. All colonies tested gave the expected 6.7 kb band corresponding to a single insertion, as well as a 12.1 kb band, indicating a double integration and a small band (1.3 kb) corresponding to the intact mersacidin biosynthetic gene cluster. This example illustrates complementation by this approach, and may also be used for the production of mersacidin derivatives. The approach based on the plasmid used herein would also complement the mrsA knockout strain reel (Altena et al . 2000) which would be beneficial as there would be no background lantibiotic at all. Because the reel strain has had the mrsA gene inactivated by replacement of the gene by the erm gene, the presence of the mrsRl gene on the plasmid used is required due to the "polar" effect of the mrsA lesion in reel - in other words, it is believed that the mrsRl gene is produced by read- through of a transcript from the mrsA gene and that by # disrupting the mrsA in this way there is no read through into the mrsRl gene.

Example 6 - Construction of Bacillus HIL mrsA E4stop An alternative means to provide a Bacillus ΔMrsA of the invention is illustrated by this example, in which a stop codon is introduced into the mrsA gene by homologous recombination.

Construction of plasmid pAE4stop

For construction of Bacillus HIL mrsA E4stop a stop codon was introduced into the mrsA gene by substituting the DNA encoding the fourth amino acid of mrsA for a TAA codon. This mutation was introduced using the method described by Szekat et al . , 2003. A plasmid for mutagenesis was created by subcloning the 1.1 kb EcoRI-Kpnl fragment that harbours mrsA and nearly all of mrsRl into the pALTER-1 vector of the Altered Sites in vitro Mutagenesis System (Promega) . Single strand DNA of the recombinant plasmid was purified and used for the synthesis of the second strand. The mutation was introduced by using the mutagenic oligonucleotide GAATACA ATG AGT CAA TAA GCT ATC ATT CGT T (SEQ ID NO: 36) as primer. The exchange, that introduces the stop codon, has been printed in bold. A second primer (provided in the mutagenesis kit) repairs a mutation in the ampicillin resistance gene of the vector which serves as a selection marker. The mutagenesis reaction was used to transform E. coli JM109. Plasmids obtained from E . coli JM109 were sequenced to verify that the mutant gene was created. The plasmid with the expected sequence was called pINl.

The mutant mrsA gene with the exchange E4stop was then amplified from pINl by PCR. The following primers were used for amplification :

pINlHIN: GGC GAA TTC GAG ACA AGG TAA AC (SEQ ID NO: 37; the natural Eco RI site upstream of mrsA is underlined, the GGC is sequence of pALTER-1) .

pINlRUCK: TTT CTG CAG AGA ATT TTC TAA TAG TTT ATA TAA (SEQ ID

NO: 38; the undelined Pstl site was introduced for cloning and is not present in the original sequence) .

The amplified 652 bp fragment covers the operator and promoter region of mrsA, mrsA~E4stop and the downstream region of mrsA and ends just 4 bp upstream of the ribosome binding site of mrsRl . This fragment was digested with EcoRI/ Pstl and ligated to pBT2 previously digested with EcoRI / Pstl , the ligation mixture was used to transform E. coli SCS110. Ampicillin resistant colonies were obtained and plasmid was isolated. Plasmids were characterised by restriction analysis and the plasmid with the expected restriction pattern was selected. The recombinant plasmid pAE4stop was then sequenced in order to verify that the mutation was present and that no other exchanges had occurred.

Genera tion of Bacillus HIL mrsA E4stop-.

Plasmid pAE4stop was introduced into Bacillus HIL by electroporation. The transformation mixture was plated on Luria Agar containing chloramphenicol (20 mg/1) and the plates were incubated at 30°C to allow replication of the (temperature sensitive) vector. The recombinant Bacillus HIL/pAE4stop was then plated on tryptone soy agar containing chloramphenicol (20 mg/1) and incubated at 42°C in order to select integrants of pAE4stop into the chromosome. Integration in Bacillus HIL/pAE4stop was monitored by PCR using the primers: pBT2reverse: 5' CCT GAC TGC GTT AGC AAT TTA ACT GTG 3' (SEQ ID NO:39) Primer 5': 5* GGG TAT ATG CGG TAT AAA CTT ATG 3' (SEQ ID NO : 40 )

The integrant Bacillus HIL/pAE4stop was cultured for at least 100 generations at 42 °C in the absence of chloramphenicol in order to obtain strains that had performed the second cross over. A 10% glycerol stock was made from this culture and used to obtain isolated colonies for identification of possible double recombinants . Approximately 10000 colonies were tested for growth on tryptic soy agar containing chloramphenicol (20 mg/1) and stored on nutrient agar. Colonies that didn't grow on chloramphenicol containing agar after incubation for 48 h were tested for mersacidin production. Six out of thirteen tested colonies did not produce antibacterial activity. Chromosomal DNA of this strains was prepared and analysed by competitive PCR using the primers :

Two clones carrying E4stop--nrs-²l gene were identified and verified by DNA sequencing. One of these clones carrying the E4stop mutation in mrsA was selected and called Bacillus HIL mrsA E4stop. Example 7 - Expression of mersacidins in Bacillus HIL mrsA E4stop

The plasmids pNBOlδ (contains wild-type mrsA; see example 3) , pNB2024 (contains F3W mutant mrsA; see example 4) and pNB2026 (contains G8A mutant mrsA; see example 4) were introduced into E. coli dam dcm strain ET12567 by electroporation. Ampicillin resistant colonies were selected, plasmid DNA was prepared using the Promega Wizard miniprep kit and concentrated by ethanol precipitation. These plasmid preparations were used to transform electrocompetent cells of Bacillus sp. HIL mrsA E4stop by the method described in Example 10 below.

Two transformants from each plasmid were selected and streaked to L Agar containing 20 mg/1 chloramphenicol and incubated at 30°C for 24 hours. A loopful of growth was used from each to inoculate 3ml of tryptic soy broth containing 20 mg/1 chloramphenicol in a 15ml culture tube. These seed cultures were incubated at 30°C with shaking at 250 rpm for 24 hours, 0.5ml of each culture was used to inoculate 10 ml of production medium (2xBPM + 300 mM glucose) containing 20 mg/1 chloramphenicol in 50ml conical flasks, which were incubated at 30°C with shaking at 250 rpm for five days. The cultures were analysed for production of mersacidin or the appropriate variants. Samples of the cultures (1ml) were centrifuged at 14000 rpm for 10 minutes. Supernatants were decanted and used undiluted for HPLC-MS, and bioassay. These data showed that in supernatants of Bacillus sp.HIL AmrsA E4stop/pNB01 , mersacidin was produced at a concentration comparable to the wild type Bacillus sp.HIL. In supernatants of Bacill us sp. HIL AmrsA E4stop/pNB2024 , the mersacidin variant F3W was produced at a concentration comparable to the wild type Bacillus sp. HIL, and in supernatants of Bacillus sp. HIL AmrsA E4stop/pNB2026 the mersacidin variant GδA was produced at a concentration comparable to the wild type Bacillus sp.HIL. Example 8 - Isolation of mersacidin F3W

Growth conditions

Bacillus sp . AmrsA E4stop/pNB2024 was inoculated from a single colony on Luria Agar containing chloramphenicol (20mg/l) into 50ml tryptic soy broth containing chloramphenicol (20mg/l) in a 250 ml conical flask and incubated at 30°C and 250 rpm. After 24 hours, 4 x 10ml of this culture were used to inoculate 4 x 500 ml of 2x BPM + 300 mM glucose containing chloramphenicol (20 mg/1) in 4 x 2 litres conical flasks, and the cultures were incubated for 5 days at 30°C and 200 rpm.

Harvesting

After five days growth, the cultures were harvested by centrifugation at 4000 rpm and 4°C for 30 minutes. The supertant was decanted and stored for further analysis and the cell pellet was discarded.

Isola tion

Diaion HP20 (70g) (Supelco) was suspended in 150 ml of methanol, mixed by swirling and left for 20 minutes. Methanol was decanted, the resin was suspended in 150 ml of water by swirling and left for 20 minutes. Water was decanted and the resin was suspended in 600 ml of water. The resin was collected in bond elut reservoirs (PK/100 60 ml, Varian) and excess water flushed through by passing air via a syringe.

Conditioned diaion HP20 resin (76g) was added to lδ40 ml of culture broth, mixed by swirling and left overnight at 4°C. The Broth-Diaion HP20 mixture was dispensed into three bond elute reservoirs (60 ml reservoir, Varian), the resin was washed with four bed volumes of water; three bed volumes of each of 25, 50, 75 and 100% methanol and samples of each fraction were taken for HPLC analysis. Fractions containing mersacidin F3W (75-100% methanol) were pooled and concentrated using a rotary evaporator from 1 litre to 325 ml (approx.50% MeOH) .

Reverse phase chromatography was carried out using two Clδ Bond Elut columns (Mega BE-C18, 10 ml, Varian ). The columns were conditioned with two bed volumes of 100% methanol followed by 1.5 bed volumes of water. The concentrate containing mersacidin F3W was loaded evenly onto the two columns. The columns were eluted in sequence with two bed volumes of 50%, 75 % and 100% methanol. Finally the columns were washed by addition of a further two bed volumes of methanol. Samples were taken from each fraction for HPLC analysis. Fractions containing significant amounts of mersacidin F3W were pooled and concentrated by evaporation to 50-60ml.

Cation Exchange chromatography was carried out using four lg columns of SCX Bond Elut (Varian) . The columns were conditioned by equilibrating with 1.5 bed volumes of 100% methanol followed by one bed volume of 40 mM potassium phosphate buffer pH 2.0 in 50% methanol. The concentrate containing mersacidin F3W was mixed 1:1 with 40 mM potassium phosphate buffer pH 2.0 in 50% methanol, loaded evenly onto the 4 columns and the flow through was collected. The column was eluted sequentially with one bed volume of 40 mM potassium phosphate buffer pH 2.0 in 50% methanol. Mersacidin F3W was eluted with two bed volumes of 250 mM potassium phosphate buffer pH 7.0 in 50% methanol. The eluate was concentrated by evaporation. Preparative HPLC was used for purification of mersacidin F3W, the conditions were as follows:

Fractions containing significant amounts of mersacidin F3W (retention time = 12-14 min) were pooled and concentrated by evaporation.

After preparative HPLC the sample was desalted using a Clδ bond elut column (lg) (Varian) . The column was conditioned with two bed volumes of 100% methanol followed by 1.5 bed volumes of water. The concentrate containing mersacidin F3W was loaded onto the column and the column was eluted in sequence with two bed volumes of 50% methanol and 2-3 bed volumes of 100% methanol. Samples were taken from each fraction for HPLC analysis. Fractions from the elution with 100% methanol were evaporated to give mersacidin F3W (m/z =933.5 (M+2H)²⁺; m/z = 944 (M+H+Na)²⁺).

Example 9 - SigH deletion of Bacillus HIL mrsA E4stop Protoplasts from Bacillus HIL ΔmrsA E4stop were prepared according to Szekat et al . , 2003 and transformed with plasmid pNB029 (see Example 2). Chloramphenicol resistant colonies were transferred to tryptic soy agar containing chloramphenicol (20mg/l) and grown at 30°C for 24h. For integration of the plasmid into the chromosome, a preculture in tryptic soy broth plus chloramphenicol (20mg/l) was carried out at 30°C and 200 rpm. Diluted aliquots of this preculture were plated onto tryptic soy agar containing chloramphenicol (20 mg/1) and the plates were incubated at 42°C to select clones that had integrated the plasmid into the chromosome. One colony was selected and grown at 42 °C and 200 rpm on tryptic soy broth containing chloramphenicol (20mg/l) for 24 hours. Serial dilutions of this culture were plated on tryptic soy agar containing chloramphenicol (20mg/l) to obtain isolated colonies which have pNB029 integrated into the chromosome of Bacill us HIL ΔmrsA . One colony was selected and grown at 42 °C and 200 rpm on 50 ml of tryptic soy broth, after 12h of growth, 0.05ml of this culture were transferred to 50 ml of tryptic soy broth and grown in the same conditions of the previuos culture, 5 consecutive subcultures were carried out and samples of the sixth subculture were titrated and frozen. Colonies from this culture were grown on tryptic soy agar at 30°C for 24h and replicated into tryptic soy agar containing chloramphenicol (20mg/l) . Chloramphenicol sensitive colonies were isolated and chromosomal DNA was prepared. DNA samples were analysed by PCR and the colonies that have a deletion in sigH were isolated.

Example 10 - Transformation by Electroporation

The only published methods for the introduction of DNA into Bacill us sp . HIL, the producer of mersacidin, involve protoplast transformation and the use of an intermediate host, Staphylococcus carnosus (eg Szekat, C. et al. Applied and Environmental Microbiology 69, 3777-37δ3; 2003) .

In the published work plasmids for genetic manipulation of Bacillus HIL were constructed in the general cloning host Escherichia coli and then introduced by protoplast transformation into S. carnosus . The authors found that plasmids could not be transformed directly into HIL Y-85, 54726 using DNA prepared from E . coli, but that it was necessary to use S . carnosus as an intermediate host (unpublished results). Plasmid DNA prepared from S . carnosus transformants was introduced into Bacillus HIL by protoplast transformation. Each transformation gave from 0 to 10 transformants per experiment. This procedure is laborious and time-consuming, and the number of transformants generated is very low.

In addition to protoplast transformation, electroporation has been used extensively as a means of transforming a wide variety of microorganisms including Bacill us species. Electroporation is generally considered to be a more convenient method of transformation than protoplast transformation. It has been demonstrated that using high osmolarity in the growth, electroporation and recovery media increases transformation efficiency for plasmid DNA in Bacillus subtilis and Bacill us licheniformis (Xue, G-P et al . Journal of Microbiological Methods 34, 183-191; 1999) . There have been no reports of electroporation of Bacillus HIL.

A procedure has been developed for transformation of Bacill us HIL using electroporation of plasmid DNA prepared from strains of E. coli . This involved preparing plasmid DNA for transformation from E. coli strains deficient in DNA methylases, ie dam dcm mutants. In contrast to the procedure used by Xue et al, which gave no transformants of Bacillus HIL, electroporation was achieved by using DNA prepared from S . carnosus or E . coli dam dcm strains, and altering the media and conditions used for growth and electroporation of the Bacillus strain. Using the procedure of the invention, 100-1,000 transformants could be generated in a single electroporation, using DNA prepared directly from E . coli without the need of an intermediate host. This represents a much more efficient and convenient method for transformation . Prepara tion of plasmid DNA

The Gram-positive/E . coli shuttle vector pCUl (Augustin, J. et al (1992), European Journal of Biochemistry 204, pll49-1154) was introduced into chemically-competent E . coli BL21* (DE3) cells obtained from Invitrogen. This strain carries dam and dcm mutations. Transformants were selected on L agar containing lOOμg/ml ampicillin. A transformant was picked and used to inoculate 10ml of L broth. This culture was grown at 37°C for approximately 16 hours with shaking at 250rpm. The culture was centifuged at 10,000rpm for 10 minutes and the pellet resuspended in 750μl of resuspension buffer. This suspension was divided into 3 eppendorf tubes and plasmid DNA was prepared using the Promega Wizard mini-prep plasmid isolation kit using the manufacturer's instructions. Plasmid DNA was recovered in 300μl sterile de-ionised water, concentrated by ethanol precipitation and re-dissolved in 25μl of sterile water. 1.5μl of this DNA was used to electroporate 60μl of an electrocompetent cell suspension of Bacillus HIL.

Preparation of electrocompetent cells of HIL Y-85 , 54728. A frozen cell suspension of Bacillus HIL (maintained at -80°C in 10% glycerol) was used to inoculate 10ml of L broth and the culture was incubated at 30°C with shaking (250rpm) for approximately 16 hours. 3.125ml of this culture was used to inoculate 50ml of tryptic soy broth - supplemented with sorbitol and mannitol (both to 0.5M) in a 250ml conical flask. This culture was shaken at 250rpm at 30oC for 4.5 hours (reaching an OD at 600nm of approximately 2.0) then cooled on ice for lOmins before centrifuging at 2,500rpm for 30 minutes. The pellet was resuspended in 6ml of ice-cold electroporation medium (10% glycerol in IM sorbitol, 0.75M mannitol) and then centrifuged for 3 minutes at 12,000rpm. The cells were washed another three times in 3ml ice-cold electroporation medium (with centrifugation for 3 mins at 12,000 rpm) before finally resuspending in 1ml of ice-cold electroporation medium. 60 μl aliquots were used for electroporation, either immediately or after storage at -80°C (and thawing on ice) .

Electropora tion of Bacillus HIL . 1.5μl of plasmid DNA was added to 60μl of ice-cold electrocompetent cells, mixed, and transferred to a pre-cooled electroporation cuvette with a 1mm gap. The voltage used for electroporation was 2500V on an electroporator preset for capacitance (lOμF) and resistance (600Ω). Time constants were typically in the range of 3-6. Immediately following electroporation, 1ml of recovery medium was added (tryptic soy broth supplemented with sorbitol to IM and mannitol to 0.75M), mixed, then the suspension was transferred to an eppendorf tube and incubated at 30°C for 3 hours in a waterbath. Following recovery the suspension was centrifuged at 12,000rpm for 3 minutes, the pellet was resuspended in 200μl tryptic soy broth and then plated on L agar containing 20μg/ml chloramphenicol to select for transformants. Typically, approximately 1,000 transformants were obtained in each electroporation.

Electropora tion using plasmid DNA from methyla ting E.coli strains or from Staphylococcus carnosus.

The electroporation method given by Xue, G-P et al. (Journal of Microbiological Methods 34, 183-191; 1999) when initially tested with Bacill us HIL and Bacill us subtilis 168 (the commonly-used laboratory strain of B . subtilis) gave a modest number of transformants with B. subtilis 168 in our hands, but none with Bacill us HIL. A number of modifications were made to the method which improved electroporation efficiencies in B . subtilis 168, but not Bacillus HIL.

In one experiment, cells were prepared from both strains. The basic method was similar to that described above, but with the following differences: • The growth medium used was L-broth containing 0.5M sorbitol

• The electroporation medium comprised 0.5M sorbitol, 0.5M mannitol and 10% glycerol

• The recovery medium was L-broth containing IM sorbitol and 0.75M mannitol

Cells were grown for 4.5 hours and prepared and electroporated as before, with 1.5μl of pCUl prepared from E. coli DH10B. A total of 505 transformants were obtained from B . subtilis 168, but none from Bacillus HIL.

Electroporation of Bacillus HIL was also attempted using plasmid prepared from Staphylococcus carnpsus . In this experiment the method was as used above, except that the electroporation medium consisted of IM sorbitol, 0.75M mannitol and 10% glycerol. Two plasmid preps were used, pCUl prepared from E. coli DH10B, as above, and pTVOmcs prepared from S . carnosus . pTVOmcs is a Gram- positive vector which cannot replicate in E. coli (Guder, A. et al.(2002), Applied and Environmental Microbiology 68, p. 106- 113) . No transformants were obtained from pCUl, but 406 transformants were obtained from pTVOmcs. This is taken as further indication that the methylated DNA from E.coli DH10B is restricted by a methylation-specific system in Bacillus HIL, but that S. carnosus-prepared DNA is not methylated and therefore gives a much higher transformation frequency.

References :

Altena et al . , Appl . Env. Microbiol. 66, 2565-2571; 2000 Bierbaum et al . (1995) FEMS Microbiol. Lett. 127, 121-126 Britton et al . J Bacteriol. 184, 4881-90; 2002.

Guder et al . Applied and Environmental Microbiology 68, 106-113; 2002

Lonetto et al . J. Bacteriol. 174, 3843-3849; 1992,

Marahiel et al . Mol. Microbiol. 7, 631-636; 1993

O'Sullivan, D.J. and Klaenhammer, T.R. (1993) Gene, 137:227-231. Szekat et al . (2003) Appl . Env. Microbiol. 69, 3777-3783

Sequences :

The present application includes reference to the following sequences :

SEQ ID NO:l

MrsA gene sequence of the MrsA encoding sequence including the leader sequence and the propeptide region . The propeptide encoding region is shown underlined : atgagtca agaagctatc attcgttcat ggaaagatcc tttttcccgt gaaaattcta 5161 cacaaaatcc agctggtaac ccattcagtg agctgaaaga agcacaaatg gataagttag 5221 taggtgcggg agacatggaa gcagcatgta cttttacatt gcctggtggc ggcggtgttt 5281 gtactctaac ttctgaatgt atttgttaa

SEQ ID NO : 2 - Translation of SEQ ID NO : l . The propeptide region is underlined .

MSQEAI IRSWKDPFSRENSTQNPAGNPFSELKEAQMDKLVGAGDMEAACTFTLPGGGGVCTLTS ECIC

Further sequences ( SEQ ID NO : 3 to SEQ ID NO : 43 ) are set out in the description .

Claims

1. A method of producing a mersacidin variant which comprises introducing into a cell which is a ΔMrsA host cell an expression vector encoding said variant, and recovering said variant from the cell culture.

2. The method of claim 1 wherein the host cell is a ΔMrsA mutant of Bacillus sp . HIL Y-85, 54728 (NCIMB Accession Number NCIMB 41211) .

3. The method of claim 1 or 2 wherein said vector further comprises a mrsRl gene.

4. The method of claim 1, 2 or 3 wherein the ΔMrsA host cell comprises a mrsA altered to include a stop codon resulting in a truncated and inactive gene product.

5. The method of claim 4 wherein said host cell is HIL mrsA E4stop obtainable by mutation of Bacillus sp . HIL Y-δ5, 54728 (NCIMB Accession Number NCIMB 41211) .

6. The method of any one of the preceding claims wherein the host cell is a ΔSigH host cell.

7. The method of any one of the preceding claims wherein the mersacidin variant is selected from the group of mersacidin F3W, mersacidin GδA and mersacidin F3W GδA.

δ. A Bacillus cell which is a SigH deficient strain of Bacillus sp. HIL Y-85, 54726 (NCIMB Accession Number NCIMB 41211) .

9. A Bacillus cell according to claim 8 which is also a ΔMrsA strain.

10. A bacterial host cell selected from the group (i) a bacterial host cell which carries the mrs gene cluster on a plasmid vector, or (ii) a bacterial host cell which carries the mrs gene cluster integrated into the genome, said cell being other than Bacillus sp. HIL Y-85, 54728 (NCIMB Accession Number NCIMB 41211) .

11. A ΔSigH bacterial host cell which carries the mrs gene cluster.

12. A ΔSigH bacterial host cell which carries the mrs gene cluster in which the mrsA gene product is either inactive or not produced.

13. A method of producing a mersacidin which comprises culturing the bacterial strain of claim 8, 10' or 11 in a culture medium and recovering the mersacidin from the medium.

14. A method of producing a mersacidin variant which comprises: providing a cell according to any one of claims 8 to 12, wherein said cell has been transformed with an expression vector encoding said variant; culturing said cell in a cell culture; and recovering said variant from the cell culture.

15. A mersacidin variant obtained by the method of claim 1 to 7, 13 or 14, or a salt thereof, optionally in the form of a pharmaceutical composition.

16. A mersacidin variant which is selected from the group of mersacidin F3W, mersacidin G8A and mersacidin F3W GδA, or a salt of any of said variants.

17. A pharmaceutical composition comprising a mersacidin variant or salt thereof according to claim 16 together with a pharmaceutically acceptable diluent or carrier.

18. A mersacidin variant according to claim 16 or a composition according to claim 17 for use in a method of treatment of the human or animal body.

19. A mersacidin variant for use according to claim 18 wherein said treatment is anti-bacterial treatment.

20. A method of making a SigH deficient Bacill us sp. HIL Y- 85, 54728 (NCIMB 41211) which method comprises introducing into said Bacillus a recombinant DNA construct containing a SigH inactive mutant, and integrating said mutant at the SigH locus in the genome of the cell.

21. The method of claim 20 wherein said mutant is truncated at the N- and C-terminal encoding regions of SigH, or comprises an internal deletion of SigH.

22. The method of claim 21 which includes the further step of selection for a double homologous recombination.

23. The method of any one of claims 20 to 22 which further comprises altering or replacing the mrsA gene.

24. The method of any one of claims 20 to 22 which comprises introducing into the cell a vector encoding a mersacidin variant .

25. A bacterial cell obtained by the method of any one of claims 20 to 24.

26. A recombinant DNA cassette which comprises a nucleotide sequence encoding the mersacidin mrsA propeptide, wherein said sequence comprises a first restriction site at or adjacent the N-terminal encoding region of the encoding sequence; optionally a second restriction site downstream of the first restriction site and within the encoding sequence; and a third restriction site at or adjacent the C-terminal encoding region of the encoding sequence, wherein at least one of said restriction sites does not occur within the mrsA sequence shown as SEQ ID NO : 1.

27. The cassette of claim 26, wherein the non-naturally occurring restriction enzyme site is the second restriction site and is located between codons 5 and 16 of the encoding sequence.

28. The cassette of claim 26 or 27 which further comprises the mrsA leader sequence and mrsA promoter.

29. A variant of the cassette of any one of claims 26 to 27 wherein said variant has from 1 to 15 nucleotide substitutions within the encoding region of the encoding sequence.

30. A library comprising from 10 to 100,000 different cassettes of claim 28.

31. A library according to claim 30 which has been transformed into a ΔMrsA HIL cell, or a cell as defined in any one of claims δ to 12.

32. A ΔMrsA HIL cell, or a cell as defined in any one of claims 8 to 12, wherein the cell further comprises a construct encoding a mersacidin variant peptide under the control of a mrsA promoter.

33. A method to transform a Bacillus HIL host cell with plasmid, which method includes the step of electroporation.

34. The method of claim 33 wherein the cell is a ΔSigH HIL, a ΔMrsA HIL or a ΔMrsA ΔSigH HIL cell.

35. The method of claim 33 or 34 which includes the steps of: growing plasmid DNA in a host cell such that said DNA is free of methylation; isolating said plasmid DNA; growing said recipient cells in a growth medium supplemented with an osmostabilizer; harvesting said recipient cells to remove the growth medium; resuspending said recipient cells in an electroporation medium comprising an osmostabilizer; and electroporating said recipient cells with said plasmid DNA.

36. The method of claim 35 wherein said growth medium osmostabilizer comprises a mixture of sorbitol in the concentration range of from 0.2 to 1.0M and mannitol in the range of 0.2M to 1.0M.

37. The method of claim 35 or 36 wherein the electroporation medium osmostabilizer comprises a mixture of sorbitol in range of from 0.2M to 1.0M and mannitol in the range of from 0.2 to 1.0M.

38. The method of any one of claims 23 to 37 wherein said plasmid DNA has been prepared in a host cell selected from the group of an E. coli host cell deficient in DNA methylases, and S. carnosus .