WO2005002500A2 - Inhibitors of coronavirus - Google Patents
Inhibitors of coronavirus Download PDFInfo
- Publication number
- WO2005002500A2 WO2005002500A2 PCT/US2004/011210 US2004011210W WO2005002500A2 WO 2005002500 A2 WO2005002500 A2 WO 2005002500A2 US 2004011210 W US2004011210 W US 2004011210W WO 2005002500 A2 WO2005002500 A2 WO 2005002500A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- peptide
- seq
- amino acid
- coronavirus
- residues
- Prior art date
Links
- 241000711573 Coronaviridae Species 0.000 title claims abstract description 115
- 239000003112 inhibitor Substances 0.000 title claims abstract description 106
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 285
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 123
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 77
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 75
- 238000000034 method Methods 0.000 claims abstract description 48
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical class C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 claims abstract description 30
- 208000001528 Coronaviridae Infections Diseases 0.000 claims abstract description 24
- 108091006116 chimeric peptides Proteins 0.000 claims abstract description 13
- 125000000539 amino acid group Chemical group 0.000 claims description 107
- 235000018102 proteins Nutrition 0.000 claims description 74
- 235000001014 amino acid Nutrition 0.000 claims description 67
- 150000001413 amino acids Chemical class 0.000 claims description 60
- 210000004027 cell Anatomy 0.000 claims description 34
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 30
- 241000315672 SARS coronavirus Species 0.000 claims description 29
- 208000015181 infectious disease Diseases 0.000 claims description 23
- 238000006467 substitution reaction Methods 0.000 claims description 19
- 150000001875 compounds Chemical class 0.000 claims description 17
- 239000003623 enhancer Substances 0.000 claims description 15
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 claims description 14
- 101710139375 Corneodesmosin Proteins 0.000 claims description 13
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 claims description 12
- 102100031673 Corneodesmosin Human genes 0.000 claims description 11
- 125000006239 protecting group Chemical group 0.000 claims description 11
- -1 - alkylamino Chemical group 0.000 claims description 9
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 claims description 8
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 claims description 8
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 claims description 7
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 claims description 7
- 229910052739 hydrogen Inorganic materials 0.000 claims description 7
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 claims description 6
- 230000004048 modification Effects 0.000 claims description 6
- 238000012986 modification Methods 0.000 claims description 6
- 230000004962 physiological condition Effects 0.000 claims description 6
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 claims description 5
- 230000002401 inhibitory effect Effects 0.000 claims description 5
- JUQLUIFNNFIIKC-UHFFFAOYSA-N 2-aminopimelic acid Chemical compound OC(=O)C(N)CCCCC(O)=O JUQLUIFNNFIIKC-UHFFFAOYSA-N 0.000 claims description 4
- 239000004472 Lysine Substances 0.000 claims description 4
- 229910052736 halogen Inorganic materials 0.000 claims description 4
- 150000002367 halogens Chemical class 0.000 claims description 4
- 150000002431 hydrogen Chemical class 0.000 claims description 4
- 239000001257 hydrogen Substances 0.000 claims description 4
- 210000004962 mammalian cell Anatomy 0.000 claims description 4
- KZNICNPSHKQLFF-UHFFFAOYSA-N succinimide Chemical compound O=C1CCC(=O)N1 KZNICNPSHKQLFF-UHFFFAOYSA-N 0.000 claims description 4
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 claims description 3
- 125000003282 alkyl amino group Chemical group 0.000 claims description 3
- 125000000217 alkyl group Chemical group 0.000 claims description 3
- 235000003704 aspartic acid Nutrition 0.000 claims description 3
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 claims description 3
- 125000004122 cyclic group Chemical group 0.000 claims description 3
- 235000013922 glutamic acid Nutrition 0.000 claims description 3
- 239000004220 glutamic acid Substances 0.000 claims description 3
- 229910052757 nitrogen Inorganic materials 0.000 claims description 3
- BLCJBICVQSYOIF-UHFFFAOYSA-N 2,2-diaminobutanoic acid Chemical compound CCC(N)(N)C(O)=O BLCJBICVQSYOIF-UHFFFAOYSA-N 0.000 claims description 2
- PECYZEOJVXMISF-REOHCLBHSA-N 3-amino-L-alanine Chemical compound [NH3+]C[C@H](N)C([O-])=O PECYZEOJVXMISF-REOHCLBHSA-N 0.000 claims description 2
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 claims description 2
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 claims description 2
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 claims description 2
- 239000002253 acid Substances 0.000 claims description 2
- 235000004279 alanine Nutrition 0.000 claims description 2
- 238000000423 cell based assay Methods 0.000 claims description 2
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 claims description 2
- 229960003104 ornithine Drugs 0.000 claims description 2
- 229910052760 oxygen Inorganic materials 0.000 claims description 2
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 claims description 2
- 229910052700 potassium Inorganic materials 0.000 claims description 2
- 229960002317 succinimide Drugs 0.000 claims description 2
- 229910052717 sulfur Inorganic materials 0.000 claims description 2
- WZVFVNVHHHUZJS-XFNAGHOKSA-N (2s)-2-(naphthalen-1-ylamino)propanoic acid;(2s)-2-(naphthalen-2-ylamino)propanoic acid Chemical compound C1=CC=CC2=CC(N[C@@H](C)C(O)=O)=CC=C21.C1=CC=C2C(N[C@@H](C)C(O)=O)=CC=CC2=C1 WZVFVNVHHHUZJS-XFNAGHOKSA-N 0.000 claims 1
- CSKLNJOBXITXRM-HSOSERFQSA-N (2s)-2-amino-3-(4-hydroxyphenyl)butanoic acid Chemical compound OC(=O)[C@@H](N)C(C)C1=CC=C(O)C=C1 CSKLNJOBXITXRM-HSOSERFQSA-N 0.000 claims 1
- 229940000406 drug candidate Drugs 0.000 claims 1
- 210000003527 eukaryotic cell Anatomy 0.000 claims 1
- 201000003176 Severe Acute Respiratory Syndrome Diseases 0.000 abstract description 49
- 239000000203 mixture Substances 0.000 abstract description 13
- 238000002560 therapeutic procedure Methods 0.000 abstract description 5
- 108010061994 Coronavirus Spike Glycoprotein Proteins 0.000 abstract description 4
- 230000002265 prevention Effects 0.000 abstract description 3
- 230000010076 replication Effects 0.000 abstract description 3
- 229940024606 amino acid Drugs 0.000 description 61
- 108010075254 C-Peptide Proteins 0.000 description 20
- 229960005486 vaccine Drugs 0.000 description 15
- VOUAQYXWVJDEQY-QENPJCQMSA-N 33017-11-7 Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)NCC(=O)NCC(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N1[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O)CCC1 VOUAQYXWVJDEQY-QENPJCQMSA-N 0.000 description 14
- 101100107610 Arabidopsis thaliana ABCF4 gene Proteins 0.000 description 14
- 101100068078 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GCN4 gene Proteins 0.000 description 14
- 241000700605 Viruses Species 0.000 description 11
- 229920001184 polypeptide Polymers 0.000 description 11
- 230000015572 biosynthetic process Effects 0.000 description 10
- 239000003814 drug Substances 0.000 description 10
- 150000003839 salts Chemical group 0.000 description 10
- 229940096437 Protein S Drugs 0.000 description 9
- 101710198474 Spike protein Proteins 0.000 description 9
- 238000012217 deletion Methods 0.000 description 9
- 230000037430 deletion Effects 0.000 description 9
- 230000028993 immune response Effects 0.000 description 9
- 108020004414 DNA Proteins 0.000 description 8
- 238000003556 assay Methods 0.000 description 8
- 230000036961 partial effect Effects 0.000 description 8
- 239000013638 trimer Substances 0.000 description 8
- 230000003612 virological effect Effects 0.000 description 8
- 210000002966 serum Anatomy 0.000 description 7
- 238000003786 synthesis reaction Methods 0.000 description 7
- 102000053723 Angiotensin-converting enzyme 2 Human genes 0.000 description 6
- 108090000975 Angiotensin-converting enzyme 2 Proteins 0.000 description 6
- 244000309467 Human Coronavirus Species 0.000 description 6
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 6
- 239000012190 activator Substances 0.000 description 6
- 238000007792 addition Methods 0.000 description 6
- 239000002671 adjuvant Substances 0.000 description 6
- 230000008901 benefit Effects 0.000 description 6
- 230000000694 effects Effects 0.000 description 6
- 230000001965 increasing effect Effects 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- 108700002856 Coronavirus Envelope Proteins Proteins 0.000 description 5
- 239000000539 dimer Substances 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 210000005260 human cell Anatomy 0.000 description 5
- 230000002163 immunogen Effects 0.000 description 5
- 230000003993 interaction Effects 0.000 description 5
- 229960000310 isoleucine Drugs 0.000 description 5
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 5
- 239000003446 ligand Substances 0.000 description 5
- PGSADBUBUOPOJS-UHFFFAOYSA-N neutral red Chemical compound Cl.C1=C(C)C(N)=CC2=NC3=CC(N(C)C)=CC=C3N=C21 PGSADBUBUOPOJS-UHFFFAOYSA-N 0.000 description 5
- 230000003381 solubilizing effect Effects 0.000 description 5
- 239000002904 solvent Substances 0.000 description 5
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical group C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 4
- 108010059722 Viral Fusion Proteins Proteins 0.000 description 4
- 239000002552 dosage form Substances 0.000 description 4
- 230000006870 function Effects 0.000 description 4
- 230000004927 fusion Effects 0.000 description 4
- 230000005764 inhibitory process Effects 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 102000005962 receptors Human genes 0.000 description 4
- 108020003175 receptors Proteins 0.000 description 4
- 238000012216 screening Methods 0.000 description 4
- 101150049389 tor2 gene Proteins 0.000 description 4
- 238000013518 transcription Methods 0.000 description 4
- 230000035897 transcription Effects 0.000 description 4
- 125000000430 tryptophan group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C2=C([H])C([H])=C([H])C([H])=C12 0.000 description 4
- 150000008574 D-amino acids Chemical class 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 108090000331 Firefly luciferases Proteins 0.000 description 3
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 3
- 150000008575 L-amino acids Chemical class 0.000 description 3
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical group OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 108091005804 Peptidases Proteins 0.000 description 3
- 108020004511 Recombinant DNA Proteins 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 3
- 239000004473 Threonine Substances 0.000 description 3
- 150000001408 amides Chemical group 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 230000009286 beneficial effect Effects 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- 238000007499 fusion processing Methods 0.000 description 3
- BJRNKVDFDLYUGJ-RMPHRYRLSA-N hydroquinone O-beta-D-glucopyranoside Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=CC=C(O)C=C1 BJRNKVDFDLYUGJ-RMPHRYRLSA-N 0.000 description 3
- 230000003053 immunization Effects 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 238000007918 intramuscular administration Methods 0.000 description 3
- 230000034217 membrane fusion Effects 0.000 description 3
- 230000035772 mutation Effects 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- 238000010647 peptide synthesis reaction Methods 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- 229940124597 therapeutic agent Drugs 0.000 description 3
- 241001430294 unidentified retrovirus Species 0.000 description 3
- OYIFNHCXNCRBQI-UHFFFAOYSA-N 2-aminoadipic acid Chemical compound OC(=O)C(N)CCCC(O)=O OYIFNHCXNCRBQI-UHFFFAOYSA-N 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 208000035473 Communicable disease Diseases 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 241000725303 Human immunodeficiency virus Species 0.000 description 2
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical group OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- 241000713869 Moloney murine leukemia virus Species 0.000 description 2
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 2
- 102000035195 Peptidases Human genes 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 241000220010 Rhode Species 0.000 description 2
- 101150064229 SARS1 gene Proteins 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical group CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 239000000427 antigen Substances 0.000 description 2
- 210000000612 antigen-presenting cell Anatomy 0.000 description 2
- 102000036639 antigens Human genes 0.000 description 2
- 108091007433 antigens Proteins 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 239000002585 base Substances 0.000 description 2
- 229920001222 biopolymer Polymers 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 210000002919 epithelial cell Anatomy 0.000 description 2
- 229940125777 fusion inhibitor Drugs 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 238000002649 immunization Methods 0.000 description 2
- 230000016784 immunoglobulin production Effects 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 108700004028 nef Genes Proteins 0.000 description 2
- 101150023385 nef gene Proteins 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 150000007523 nucleic acids Chemical class 0.000 description 2
- 239000008194 pharmaceutical composition Substances 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 230000003389 potentiating effect Effects 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 230000001681 protective effect Effects 0.000 description 2
- 230000009257 reactivity Effects 0.000 description 2
- 210000002345 respiratory system Anatomy 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- 150000003384 small molecules Chemical class 0.000 description 2
- 239000007790 solid phase Substances 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 238000010189 synthetic method Methods 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 2
- 230000009385 viral infection Effects 0.000 description 2
- LSPHULWDVZXLIL-UHFFFAOYSA-N (+/-)-Camphoric acid Chemical compound CC1(C)C(C(O)=O)CCC1(C)C(O)=O LSPHULWDVZXLIL-UHFFFAOYSA-N 0.000 description 1
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- 229940080296 2-naphthalenesulfonate Drugs 0.000 description 1
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 description 1
- 125000004080 3-carboxypropanoyl group Chemical group O=C([*])C([H])([H])C([H])([H])C(O[H])=O 0.000 description 1
- ZRPLANDPDWYOMZ-UHFFFAOYSA-N 3-cyclopentylpropionic acid Chemical compound OC(=O)CCC1CCCC1 ZRPLANDPDWYOMZ-UHFFFAOYSA-N 0.000 description 1
- XMIIGOLPHOKFCH-UHFFFAOYSA-M 3-phenylpropionate Chemical compound [O-]C(=O)CCC1=CC=CC=C1 XMIIGOLPHOKFCH-UHFFFAOYSA-M 0.000 description 1
- JLLYLQLDYORLBB-UHFFFAOYSA-N 5-bromo-n-methylthiophene-2-sulfonamide Chemical group CNS(=O)(=O)C1=CC=C(Br)S1 JLLYLQLDYORLBB-UHFFFAOYSA-N 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 108010042708 Acetylmuramyl-Alanyl-Isoglutamine Proteins 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- FERIUCNNQQJTOY-UHFFFAOYSA-M Butyrate Chemical compound CCCC([O-])=O FERIUCNNQQJTOY-UHFFFAOYSA-M 0.000 description 1
- FERIUCNNQQJTOY-UHFFFAOYSA-N Butyric acid Natural products CCCC(O)=O FERIUCNNQQJTOY-UHFFFAOYSA-N 0.000 description 1
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 108010049048 Cholera Toxin Proteins 0.000 description 1
- 102000009016 Cholera Toxin Human genes 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- AGPKZVBTJJNPAG-RFZPGFLSSA-N D-Isoleucine Chemical compound CC[C@@H](C)[C@@H](N)C(O)=O AGPKZVBTJJNPAG-RFZPGFLSSA-N 0.000 description 1
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 1
- XBPCUCUWBYBCDP-UHFFFAOYSA-N Dicyclohexylamine Chemical class C1CCCCC1NC1CCCCC1 XBPCUCUWBYBCDP-UHFFFAOYSA-N 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 239000006145 Eagle's minimal essential medium Substances 0.000 description 1
- 102100038132 Endogenous retrovirus group K member 6 Pro protein Human genes 0.000 description 1
- 241000713800 Feline immunodeficiency virus Species 0.000 description 1
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- 101000597577 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5) Outer membrane protein Proteins 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101100151951 Homo sapiens SARS1 gene Proteins 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical compound Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 102100037850 Interferon gamma Human genes 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 102000013462 Interleukin-12 Human genes 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102000000588 Interleukin-2 Human genes 0.000 description 1
- 206010022678 Intestinal infections Diseases 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- 229930182816 L-glutamine Natural products 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 108010027796 Membrane Fusion Proteins Proteins 0.000 description 1
- 102000018897 Membrane Fusion Proteins Human genes 0.000 description 1
- 108010090054 Membrane Glycoproteins Proteins 0.000 description 1
- 102000012750 Membrane Glycoproteins Human genes 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- MBBZMMPHUWSWHV-BDVNFPICSA-N N-methylglucamine Chemical compound CNC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO MBBZMMPHUWSWHV-BDVNFPICSA-N 0.000 description 1
- PVNIIMVLHYAWGP-UHFFFAOYSA-N Niacin Chemical compound OC(=O)C1=CC=CN=C1 PVNIIMVLHYAWGP-UHFFFAOYSA-N 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 239000005642 Oleic acid Substances 0.000 description 1
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 1
- 108010067902 Peptide Library Proteins 0.000 description 1
- 108010081690 Pertussis Toxin Proteins 0.000 description 1
- 229920000805 Polyaspartic acid Polymers 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-M Propionate Chemical compound CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 1
- 206010057190 Respiratory tract infections Diseases 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 101000965899 Simian virus 40 Large T antigen Proteins 0.000 description 1
- 101710167605 Spike glycoprotein Proteins 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- ZMZDMBWJUHKJPS-UHFFFAOYSA-M Thiocyanate anion Chemical compound [S-]C#N ZMZDMBWJUHKJPS-UHFFFAOYSA-M 0.000 description 1
- 101800001690 Transmembrane protein gp41 Proteins 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 206010000059 abdominal discomfort Diseases 0.000 description 1
- 150000008043 acidic salts Chemical class 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- WNLRTRBMVRJNCN-UHFFFAOYSA-L adipate(2-) Chemical compound [O-]C(=O)CCCCC([O-])=O WNLRTRBMVRJNCN-UHFFFAOYSA-L 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229910052783 alkali metal Inorganic materials 0.000 description 1
- 150000001447 alkali salts Chemical class 0.000 description 1
- 229910052784 alkaline earth metal Inorganic materials 0.000 description 1
- AWUCVROLDVIAJX-UHFFFAOYSA-N alpha-glycerophosphate Natural products OCC(O)COP(O)(O)=O AWUCVROLDVIAJX-UHFFFAOYSA-N 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical class [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- LFVGISIMTYGQHF-UHFFFAOYSA-N ammonium dihydrogen phosphate Chemical compound [NH4+].OP(O)([O-])=O LFVGISIMTYGQHF-UHFFFAOYSA-N 0.000 description 1
- 150000003863 ammonium salts Chemical class 0.000 description 1
- 230000000840 anti-viral effect Effects 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 230000030741 antigen processing and presentation Effects 0.000 description 1
- 239000003443 antiviral agent Substances 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 238000002820 assay format Methods 0.000 description 1
- 229940077388 benzenesulfonate Drugs 0.000 description 1
- SRSXLGNVWSONIS-UHFFFAOYSA-M benzenesulfonate Chemical compound [O-]S(=O)(=O)C1=CC=CC=C1 SRSXLGNVWSONIS-UHFFFAOYSA-M 0.000 description 1
- 229940050390 benzoate Drugs 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 1
- 125000001584 benzyloxycarbonyl group Chemical group C(=O)(OCC1=CC=CC=C1)* 0.000 description 1
- XMIIGOLPHOKFCH-UHFFFAOYSA-N beta-phenylpropanoic acid Natural products OC(=O)CCC1=CC=CC=C1 XMIIGOLPHOKFCH-UHFFFAOYSA-N 0.000 description 1
- 229920001400 block copolymer Polymers 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 239000001506 calcium phosphate Chemical class 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- MIOPJNTWMNEORI-UHFFFAOYSA-N camphorsulfonic acid Chemical compound C1CC2(CS(O)(=O)=O)C(=O)CC1C2(C)C MIOPJNTWMNEORI-UHFFFAOYSA-N 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000007910 cell fusion Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 125000003636 chemical group Chemical group 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000012937 correction Methods 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 230000009260 cross reactivity Effects 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 230000000120 cytopathologic effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- MOTZDAYCYVMXPC-UHFFFAOYSA-N dodecyl hydrogen sulfate Chemical compound CCCCCCCCCCCCOS(O)(=O)=O MOTZDAYCYVMXPC-UHFFFAOYSA-N 0.000 description 1
- 229940043264 dodecyl sulfate Drugs 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 238000009510 drug design Methods 0.000 description 1
- 238000007877 drug screening Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 244000309457 enveloped RNA virus Species 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- CCIVGXIOQKPBKL-UHFFFAOYSA-M ethanesulfonate Chemical compound CCS([O-])(=O)=O CCIVGXIOQKPBKL-UHFFFAOYSA-M 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 239000012091 fetal bovine serum Substances 0.000 description 1
- 238000002866 fluorescence resonance energy transfer Methods 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 229960002518 gentamicin Drugs 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 208000019622 heart disease Diseases 0.000 description 1
- MNWFXJYAOYHMED-UHFFFAOYSA-N heptanoic acid Chemical compound CCCCCCC(O)=O MNWFXJYAOYHMED-UHFFFAOYSA-N 0.000 description 1
- FUZZWVXGSFPDMH-UHFFFAOYSA-N hexanoic acid Chemical compound CCCCCC(O)=O FUZZWVXGSFPDMH-UHFFFAOYSA-N 0.000 description 1
- 125000004051 hexyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- XMBWDFGMSWQBCA-UHFFFAOYSA-N hydrogen iodide Chemical compound I XMBWDFGMSWQBCA-UHFFFAOYSA-N 0.000 description 1
- ZMZDMBWJUHKJPS-UHFFFAOYSA-N hydrogen thiocyanate Natural products SC#N ZMZDMBWJUHKJPS-UHFFFAOYSA-N 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-M hydrogensulfate Chemical compound OS([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-M 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 229940102223 injectable solution Drugs 0.000 description 1
- 229940102213 injectable suspension Drugs 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- SUMDYPCJJOFFON-UHFFFAOYSA-N isethionic acid Chemical compound OCCS(O)(=O)=O SUMDYPCJJOFFON-UHFFFAOYSA-N 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 230000003907 kidney function Effects 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 230000003908 liver function Effects 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 159000000003 magnesium salts Chemical class 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- MGJXBDMLVWIYOQ-UHFFFAOYSA-N methylazanide Chemical group [NH-]C MGJXBDMLVWIYOQ-UHFFFAOYSA-N 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 1
- BSOQXXWZTUDTEL-ZUYCGGNHSA-N muramyl dipeptide Chemical compound OC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@H]1[C@H](O)[C@@H](CO)O[C@@H](O)[C@@H]1NC(C)=O BSOQXXWZTUDTEL-ZUYCGGNHSA-N 0.000 description 1
- 125000001446 muramyl group Chemical group N[C@@H](C=O)[C@@H](O[C@@H](C(=O)*)C)[C@H](O)[C@H](O)CO 0.000 description 1
- KVBGVZZKJNLNJU-UHFFFAOYSA-M naphthalene-2-sulfonate Chemical compound C1=CC=CC2=CC(S(=O)(=O)[O-])=CC=C21 KVBGVZZKJNLNJU-UHFFFAOYSA-M 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 230000000926 neurological effect Effects 0.000 description 1
- 235000001968 nicotinic acid Nutrition 0.000 description 1
- 239000011664 nicotinic acid Substances 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 1
- 238000006384 oligomerization reaction Methods 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- JRKICGRDRMAZLK-UHFFFAOYSA-L peroxydisulfate Chemical compound [O-]S(=O)(=O)OOS([O-])(=O)=O JRKICGRDRMAZLK-UHFFFAOYSA-L 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- UYWQUFXKFGHYNT-UHFFFAOYSA-N phenylmethyl ester of formic acid Chemical group O=COCC1=CC=CC=C1 UYWQUFXKFGHYNT-UHFFFAOYSA-N 0.000 description 1
- 229940075930 picrate Drugs 0.000 description 1
- OXNIZHLAWKMVMX-UHFFFAOYSA-M picrate anion Chemical compound [O-]C1=C([N+]([O-])=O)C=C([N+]([O-])=O)C=C1[N+]([O-])=O OXNIZHLAWKMVMX-UHFFFAOYSA-M 0.000 description 1
- 229950010765 pivalate Drugs 0.000 description 1
- IUGYQRQAERSCNH-UHFFFAOYSA-N pivalic acid Chemical compound CC(C)(C)C(O)=O IUGYQRQAERSCNH-UHFFFAOYSA-N 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 229950008882 polysorbate Drugs 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 159000000001 potassium salts Chemical class 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 125000001501 propionyl group Chemical group O=C([*])C([H])([H])C([H])([H])[H] 0.000 description 1
- 230000003161 proteinsynthetic effect Effects 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 150000003242 quaternary ammonium salts Chemical class 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 238000007363 ring formation reaction Methods 0.000 description 1
- 229930182490 saponin Natural products 0.000 description 1
- 235000017709 saponins Nutrition 0.000 description 1
- 150000007949 saponins Chemical class 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- AWUCVROLDVIAJX-GSVOUGTGSA-N sn-glycerol 3-phosphate Chemical compound OC[C@@H](O)COP(O)(O)=O AWUCVROLDVIAJX-GSVOUGTGSA-N 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000008227 sterile water for injection Substances 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 229940095064 tartrate Drugs 0.000 description 1
- 229940126585 therapeutic drug Drugs 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical class [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- ZDPHROOEEOARMN-UHFFFAOYSA-N undecanoic acid Chemical compound CCCCCCCCCCC(O)=O ZDPHROOEEOARMN-UHFFFAOYSA-N 0.000 description 1
- 229940124856 vaccine component Drugs 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 239000013598 vector Substances 0.000 description 1
- 230000007502 viral entry Effects 0.000 description 1
- 230000029812 viral genome replication Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
- C12N2740/16043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/20011—Coronaviridae
- C12N2770/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2810/00—Vectors comprising a targeting moiety
- C12N2810/50—Vectors comprising as targeting moiety peptide derived from defined protein
- C12N2810/60—Vectors comprising as targeting moiety peptide derived from defined protein from viruses
- C12N2810/609—Vectors comprising as targeting moiety peptide derived from defined protein from viruses positive strand RNA viruses
Definitions
- Coronaviruses are nonsegmented, s/s plus strand, enveloped RNA viruses that infect a variety of mammals and birds. In humans, they cause respiratory infections, enteric infections and possibly neurological conditions. Typically, infection results in a mild, self-limited condition, such as a cold or upset stomach. Recently, there have been reports that severe acute respiratory syndrome (SARS) is caused by a coronavirus, SARS-CoV. Although most SARS victims recover, the World Health Organization estimates that SARS is fatal in about 4% of cases, particularly in individuals with an underlying condition, such as a weakened immune response, diabetes or heart disease. Coronavirus envelope protein generally carries two glycoproteins, M or membrane glycoprotein and S or spike protein.
- S protein is involved in receptor binding and cell fusion and is comprised of two subunits: the N-terminal subunit, called SI, which forms the knob-like component of the spike and the C- terminal subunit, called S2, which forms the stem of the spike.
- SI N-terminal subunit
- S2 C- terminal subunit
- This invention relates to inhibitors of coronaviruses, such as SARS-CoV; methods of identifying inhibitors of coronaviruses; methods and compositions useful for therapy (treatment, or prevention) of coronavirus infections, including methods and compositions for therapy of severe acute respiratory syndrome (SARS); and compositions for use as vaccines and immunogens and methods in which they are used to vaccinate or immunize individuals against coronaviruses, including vaccines and immunogens for use in vaccinating or immunizing individuals against SARS.
- SARS severe acute respiratory syndrome
- the present invention relates to C-peptides, N-peptides, Five-Helix proteins, Heptad Repeat 2 (HR2) peptides, and Heptad Repeat 1 (HRl) coiled-coil peptides, all of which target HRl or HR2 regions of the coronavirus Spike protein to inhibit coronavirus replication. They are for use as inhibitors of coronaviruses in therapy (treatment, or prevention) of coronavirus infection, including for use as vaccines or immunogens. The exact HRl and HR2 regions may differ from the proposed regions. However, the proposed regions provided herein are sufficient to enable the design of the inhibitors. Reference to "comprising" and “comprises” throughout the claim indicates additional groups may be present.
- a C-peptide comprising about 18 amino acids of SEQ ID NO: 1 may have additional groups such as amino acid regions from SEQ ID NO: 1 or other types of groups.
- Reference to "peptide” in a C-peptide and N-peptide indicates amino acids joined together by a peptide bond and salt forms.
- the amino acids may be naturally occurring amino acids or non-naturally occurring amino acids.
- a non-naturally occurring amino acid also referred to as a "modified” amino acid contains a non-naturally occurring R-group.
- “peptide” does not provide a size limitation, smaller length peptides are generally preferred. Smaller length peptides may offer advantages in ease of synthesis and solubility.
- the peptides or proteins can be modified to contain conservative substitutions.
- Conservative substitutions for amino acids are shown in Table 1. Factors that can be taken into account for a conservative substitution include amino acid size, charge, polarity, and hydrophobicity. (See, for example, Ausubel, Current Protocols in Molecular Biology, John Wiley, 1987-2001, Appendix IC.) Conservative substitutions, if present, should substantially maintain or enhance either coronavirus inhibition properties or pharmacokinetic properties. In different embodiments, there are 0, 1, 2, 3, 4, 5, or 6-10 conservative substitutions.
- the tryptophan analog can be D or L.
- the peptides can be modified, e.g., containing one or more tryptophan analogs and / or one or more lactam bridges.
- the present invention also provides retro-inverso analogues of the inhibitors of coronavirus.
- polypeptide refers to a peptide comprising about 10 to about 500 amino acids. Examples of polypeptides include C-peptides, N-peptides, the chimeric N-peptides, Five Helix, Six Helix, and their derivatives.
- the coronavirus inhibitor is a purified polypeptide.
- a "purified polypeptide" represents at least 10% of the total polypeptide present in a sample or preparation.
- the purified polypeptide represents at least about 50%, at least about 75%, or at least about 95% of the total protein in a sample or preparation.
- Reference to "purified polypeptide” does not require that the polypeptide has undergone any purification and may include, for example, chemically synthesized polypeptide that has not been purified.
- the coronavirus inhibitor is a purified oligomer of polypeptide.
- One aspect of the present invention describes a method for treating a patient to inhibit coronavirus replication. The method comprises the step of administering to the patient an effective amount of an inhibitor of coronavirus to the patient.
- Another aspect of the present invention describes a method of inhibiting the ability of a human coronavirus to infect a cell in vitro.
- the method comprises the step of providing an inhibitor of coronavirus to a cell culture infected with the coronavirus.
- Reference to "patient” indicates a mammal undergoing treatment and does not necessarily indicate the presence of a coronavirus infection.
- Treatment can be provided to a patient infected with the coronavirus to decrease the severity of a coronavirus infection. Treatment can also be provided prophylactically to reduce the likelihood or severity of a coronavirus infection.
- a patient can be a human or another type of mammal. Treatment of non-human patients may be useful in protecting pets and livestock, or in evaluating the efficacy of a particular treatment.
- an effective amount indicates an amount sufficient to provide a beneficial effect to a patient.
- Beneficial effects that can be achieved include detectable inhibition of viral replication or decrease in viral load. The inhibition or decrease should be sufficient to provide a medically significant decrease in the severity or likelihood of a coronavirus infection.
- Other features and advantages of the present invention are apparent from the additional descriptions provided herein including the different examples.
- the provided examples illustrate different components and methodology useful in practicing the present invention. The examples do not limit the claimed invention. Based on the present disclosure the skilled artisan can identify and employ other components and methodology useful for practicing the present invention.
- FIG. 1 shows the amino acid sequence (SEQ ID NO:l) of the S or spike protein of human coronavirus recently identified in SARS victims, as well as the heptad repeats predicted by two different methods (Multicoil and Learncoil VMF).
- HRl includes amino acid residues from about 900 to about 974 of SEQ ID NO: 1, while HR2 includes amino acid residues from about 1148 to about 1193 of SEQ ID NO: 1.
- HRl includes amino acid residues from about 900 to about 1005 of SEQ ID NO: 1, while HR2 includes amino acid residues from about 1151 to about 1185 of SEQ ID NO:l.
- Figure 2 shows the amino acid sequences of C34 coil-like inhibitors, also referred to as Heptad Repeat 2 Peptides.
- the a, d and e residues from the heptad repeat of SARS-HR2 are grafted onto the f, b, and c positions, respectively, of the GCN4 coiled coil to make (Cys)SARS-HR2-GCN4 ((Cys)HR2G, SEQ ID NO:6).
- this peptide is covalently coupled to (Cys)GCN4 (SEQ ID NO:7) to form a stable dimer exposing the SARS-HR1 binding interface on one side.
- SARS coronavirus sequence is shown for the SARS coronavirus sequence.
- Figure 3 illustrates retro-inverso peptides.
- the parent linear peptide is shown in the middle (Boxed).
- the retro-inverso analog is shown in parallel (bottom) and antiparallel (top) orientation. It is apparent that in the antiparallel orientation the side-chain topology is maintained, while the direction of the peptide bond is reversed.
- Figures 4A, 4B, and 4C provide examples of tryptophan analogs.
- This invention relates to inhibitors of coronaviruses, such as SARS-CoV.
- the inhibitors comprise sequences derived from the heptad repeat regions (e.g., HRl or HR2) of coronaviruses.
- coronaviruses have a viral membrane containing glycoproteins that permit the viruses to bind to target cells and achieve membrane fusion, an essential process for viral infection, by which the viral and cellular membranes combine to form a single bilayer.
- the S glycoprotein on the viral membranes of coronaviruses is such a fusion protein, which participates in receptor binding and membrane fusion.
- the S protein comprises two heptad repeat regions, HRl and HR2, which are predicted to collapse to form a trimer of hairpin structure in the fusion process.
- Heptad repeat regions have been characterized by structural studies in membrane-fusion proteins of a variety of different viruses. In the fusion processes, the heptad-repeat sequences all form trimeric hairpin-like structures, in which a central three-stranded coiled coil is surrounded by supporting helices packed in an antiparallel manner. The trimer-of-hairpins structure is thought to bring the viral and cellular membrane together.
- trimer-of-hairpins structure presumably corresponds to the fusion-active state.
- viral fusion proteins undergo a series of conformational changes to become the trimer-of-hairpins structure from a pre-hairpin intermediate conformation when exposed to the appropriate triggering signals (Hernandez et al. Annu Rev Cell Dev Biol 12: 627-661 (1996)).
- Various peptides were designed as exogenous inhibitors to bind to the pre-hairpin intermediate in a dominant-negative manner and consequently block formation of the fusion-active hairpin structures in viruses such as HIV (Chan and Kim, Cell 93: 681-684 (1998); Eckert and Kim, Annu Rev Biochem 70: 777-810 (2001)).
- SARS-associated coronavirus is also described by Rota et al., Science 300, 1394-1399 (30 May 2003); published online 1 May 2003, 10.1126/science.1085952; and Marra et al, Science 300, 1399-1404 (30 May 2003); published online 1 May 2003, 10.1126/science.1085953.
- the analysis has shown that coronavirus S protein comprises two heptad repeat regions which are predicted to form a trimer of hairpin structure.
- results of analysis of SARS spike protein (SEQ ID NO:l) by two methods (Multicoil and Learncoil VMF) identified two heptad repeat regions that are predicted to form a trimer of hairpin structure as follows.
- HRl comprises amino acid residues from about 900 to about 974 of SEQ ID NO:l; and by Learncoil VMF, HRl comprises amino acid residues from about 900 to about 1005 of SEQ ID NO: 1.
- HR2 comprises amino acid residues from about 1148 to about 1193 of SEQ ID NO: 1 ; and by Learncoil VMF, HR2 comprises amino acid residues from about 1151 to about 1185 of SEQ ID NO: 1.
- the composition (identity and order of amino acid residues) of the spike (S) protein of SARS coronavirus presented herein is defined with reference to the TOR2 draft genome assembly provided at the website referenced above.
- HR2 Peptides A subject of this invention are peptides, referred to as HR2 (heptad repeat 2) peptides, which comprise at least 20 amino acid residues from coronavirus heptad repeat 2 and are useful as inhibitors of coronavirus infection of mammalian cells, such as human epithelial cells.
- Such peptides are also referred to as C-peptides, because the S2 subunit is at the C terminus of coronavirus S protein and the HR2 region is C-terminal of the HRl region (Fig. 1).
- HR2 peptides are thought to bind to HRl region in the pre- hairpin intermediate of S protein in a dominant-negative manner, block formation of the fusion-active hairpin structures, and consequently inhibit infection of coronaviruses such as SARS-CoV.
- HR2 peptides comprise from about 20 to about 60 amino acid residues from the predicted HR2 region. In some embodiments, HR2 peptides comprise from about 20 to about 50 amino acid residues from the predicted HR2 region.
- Amino acid residues present in these HR2 peptides may be contiguous amino acid residues that occur sequentially in a coronavirus HR2 or may be noncontiguous amino acid residues that are separated by intervening amino acid residues in the coronavirus HR2.
- amino acid residues other than those that occur between the noncontiguous residues in the coronavirus e.g., other than those that occur between the noncontiguous amino acid residues in SARS in nature
- SARS HR2 peptides include any combination of from about 20 amino acid residues to about 60 amino acid residues of SARS HR2 peptide, homologues and variants of such sequences, including variants that result from correction of any errors in the TOR2 draft genome assembly published at http://ybweb.bcgsc.ca/sars/TOR2 draft genome assembly 120403.fasta.gz and additional SARS HR2 regions encoded by the genome of additional coronaviruses identified or obtained from SARS victims that differ from the referenced publicly available sequence.
- SARS HR2 peptides comprise from about 20 to about 60 amino acid residues, which can be contiguous or noncontiguous in the region as it occurs in SARS virus, of the following sequence, which is residues 1144-1200 or 1142-1193 of the predicted spike protein of SARS Tor2 (SEQ ID NO:l).
- Amino acid residues 1144-1200 SEQ ID NO: 1 has the sequence as follows:
- PD ⁇ -T3LGDISGINASVvNIQKEIDRLNEVA-KNLNES IDLQELGKYEQYIK PWYVWL (SEQ ID NO:2), in which solvent exposed regions of the HR2 include the b, c and f positions of the heptad repeat. The solvent exposed positions are underlined. Additional peptides can be identified using known methods, such as by determining the location and composition (amino acid sequence) or heptad repeat 2 and selecting peptides of from about 20 to about 60 amino acid residues. Examples of such HR2 peptides are partial or full sequence of SEQ ID NO:2.
- HR2 peptides can consist of amino acid residues from N to (N+M-l) of SEQ ID NO:2, wherein M is the length of the HR2 peptide, and N can be any integral number from 1 to (58-M).
- HR2 peptides consist of amino acid residues from 5 to 50, from 9 to 41, from 21 to 57, from 5 to 41, from 30 to 57, or from 1 to 57 of SEQ ID NO:2.
- the region of residues from 30 to 57 of SEQ ID NO:2 appears to be very highly conserved among coronaviruses and, thus is a peptide of particular interest for designing or identifying C-peptide/HR2 peptide inhibitors.
- the HR2 peptide has a sequence of residues 1148-1182 or 1148-1185 of SEQ ID NO:l.
- Residues 1148-1182 of SEQ ID NO:l has the sequence as follows: LGDISGINASVWIQKEIDRLNEVAKNLNESLIDL (SEQ ID NO:3).
- HR2 Coil-Like Inhibitors A further subject of this invention are coronavirus inhibitors, referred to as HR2 coil-like inhibitors, which are stable dimers that expose an HRl binding site in such a manner that it is available for binding. HR2 coil-like inhibitors are thought to inhibit infection of coronaviruses such as SARS-CoV with the same mechanism as that of HR2 peptides.
- coronaviruses such as SARS-CoV
- amino acid residues a, d, and e of coronavirus HR2 e.g., SARS-CoV-HR2
- a coiled coil such as the GCN4 coiled coil
- GCN4-pl to produce (Cys)-E.R2-coiled coil (e.g., (Cys)-SARS-CoV-HR2-GCN4).
- This peptide is then covalently coupled to (Cys) coiled coil (e.g., (Cys)GCN4) to form a stable dimer exposing the HRl binding interface of the coronavirus (here, the SARS-CoV-HRl binding interface) on one side.
- Examples of such HR2 coil-like inhibitors are shown in Figure 2.
- GCN4-pl is a dimeric coiled coil whose sequence was derived from GCN4, a yeast transcription activator (O'Shea, E.
- Additional coil-like inhibitors can be identified using similar techniques, which rely on identification of the heptad register, followed by application to the repeat sequence of one or more coil prediction programs (e.g., Multicoil, Learncoil VMF) and grafting of amino acid residues onto an appropriate coiled coil.
- coil prediction programs e.g., Multicoil, Learncoil VMF
- grafting of amino acid residues onto an appropriate coiled coil See, for example, Sia, S. Doctoral Thesis entitled Rational Design of peptide inhibitors of HIV-1 entry. December 2001, submitted to the Committee on Higher Degrees in Biophysics in partial fulfillment of the requirements of Doctor of Philosophy in the subject of Biophysics, Harvard University (see also Proc Natl Acad Sci USA; 100:9756-61 (2003)). 4.
- HRl Peptides HRl (Heptad Repeat 1) peptides or inhibitors, also referred to as N-peptide inhibitors, are a further subject of this invention.
- HRl peptides are thought to bind to HR2 region in the pre-hairpin intermediate of S protein in a dominant-negative manner, block formation of the fusion-active hairpin structures, and consequently inhibit infection of coronaviruses such as SARS-CoV.
- Such HRl peptides generally include from about 28 to about 60 amino acid residues from coronavirus HRl peptide, although in some cases, they may include fewer than 28 or more than 60 HRl amino acid residues.
- the amino acid residues in the HRl -peptide inhibitors can be residues that occur sequentially (are contiguous) or nonsequentially (are noncontiguous) in the coronavirus HRl as it occurs in nature.
- Contiguous and noncontiguous and sequential and nonsequential are used with reference to the amino acid sequence of a peptide or protein (e.g., HRl, HR2) as it occurs in the virus in nature.
- HRl peptides can be identified and produced, using known methods and the present invention encompasses all HRl peptides from about 28 to about 60 or about 80 amino acid residues from the HRl repeats described herein.
- HRl peptides of the present invention include all peptides of from about 28 to about 60 or about 80 amino acid residues of SARS coronavirus HRl, defined with reference to the deduced amino acid sequence encoded by the referenced publicly available SARS genome data (SEQ ID NO: 1 and Fig. 1).
- amino acid sequences of HRl peptides can be altered, such as by addition, substitution or deletion of one or more amino acid residues, in order to alter certain characteristics (e.g., to increase peptide stability, enhance peptide solubility).
- HRl peptides can have a length of from about 28 to about 60 or about 80 amino acid residues, and be derived from residues 900-1005 or 889-972 of SEQ ID NO: 1.
- Examples of HRl peptides include, but are not limited to: A peptide having a sequence of residues 896-972, 900-938, 914-949, 922-956, 943- 980 or 943-981 of SEQ ID NO: 1.
- Another embodiment of this invention is a complex of an HRl -peptide inhibitor tethered (with an appropriate linker, which can be made of amino acid residues, or can be a chemical or synthetic linker) to a component, such as a ligand (protein or small molecule) that binds coronavirus envelope protein.
- the complex is useful as a therapeutic agent, because the ligand will increase the effective concentration of the tethered HRl-peptide inhibitor moiety in the vicinity of the coronavirus envelope protein.
- HRl peptides are capable of forming trimeric coiled coil.
- the HRl trimeric coiled coil could be stabilized by including cysteine residues to form interchain disulfide bonds in a chemically synthesized or recombinant peptide greater than or equal to 28 and less than or equal to 60 or 80 sequential residues from the predicted HRl region.
- the recombinant versions could contain helix capping residues on the N- and C-terminus. Possible capping residues for the N-terminus are T, D and S. Possible capping residues for the C-terminus are G, R, H, N, or K. Possible amino-terminal caps for the synthetic peptides are acetyl (Ac) or succinimide (sue).
- the HRl comprises the sequence of residues 900-1005. Possible inhibitors of SARS-CoV include, but are not limited to:
- HRl Chimeric Peptides The present invention also relates to HRl chimeric peptides comprised of an HRl peptide fused to a peptide that is capable of forming a solubilizing trimeric coiled coil.
- the HRl chimeric peptides form stable and soluble HRl chimeric trimeric coiled coil.
- HRl chimeric peptides are thought to inhibit infection of coronaviruses such as SARS-CoV with the same mechanism as that of HRl peptides.
- Examples of the HRl chimeric peptides include HR1-IQ peptides and HR1-IZ peptides.
- a HRl chimeric peptide comprises at least a portion of HRl of coronavirus S2 protein, as disclosed in sections 1 and 4.
- the HRl region component of these peptides can be of varying length and will typically be from about 15 to about 50 amino acid residues from the coronavirus HRl region.
- the HRl peptide in some cases, may be shorter than 15 amino acid residues or longer than 50 amino acid residues.
- the peptides capable of forming solubilizing trimeric coiled coils can be from (comprise amino acid residues that correspond to those in) a variety of sources, including IQ peptides and IZ peptides.
- IQ peptide can be from (comprise amino acid residues that correspond to those in) a variety of sources, including yeast transcription activator GCN4, such as GCN4-pII or GCN4-PI Q I; Moloney Murine Leukemia Virus (MoMLV); and the ABC heterotrimer.
- amino acid residues that comprise an IQ peptide of the present invention can be amino acid ' residues that are sequential (consecutive) or noncontiguous (nonconsecutive) in the trimeric coiled-coil peptide from which it is derived and/or amino acid residues that are sequential (consecutive) or noncontiguous (nonconsecutive) in HRl peptide, provided that the resulting IQ peptide (the IQ peptide in which they are present) is stable, soluble, helical, and trimeric under physiological conditions.
- the residues, as included in the IQ peptide can be consecutive or can be separated or joined by a linker.
- the linker can be, for example, an amino acid residue(s) that does not occur between two amino acid residues in the peptide from which the component is derived.
- the "linker" can be a chemical or synthetic linker.
- a component of an IQ peptide or HR1-IQ peptide of the present invention is considered to be derived from another peptide (e.g., a trimeric coiled coil or HRl of a coronavirus) if the component itself (or the nucleic acid molecule(s) that encode the amino acid sequence) is obtained or isolated/separated from a source in which it occurs (e.g., from a cell in which the peptide occurs, such as a portion of a protein from which it can be removed) or is produced by recombinant DNA methods, chemical synthesis or any other method, to comprise an amino acid sequence or a nucleic acid sequence that is the same as or substantially the same as the sequences of the peptide.
- a source in which it occurs e.g., from a cell in which the peptide occurs, such as a portion of a protein from which it can be removed
- a source in which the peptide e.g., from a cell in which the peptide
- the trimeric coiled coil peptide component of an IQ peptide must be sufficient in amino acid composition (identity and number/length) to result, when joined to the HRl peptide portion, in formation of a soluble trimeric helical (coiled-coil) IQ peptide.
- the soluble IQ peptides comprise an IQ region that is a GCN4 trimeric coiled-coil peptide, they are referred to as IQN peptides.
- GCN4-pl is a dimeric coiled coil whose sequence was derived from GCN4, a yeast transcription activator (O'Shea, E. K., et al, Science 254:539-544 (1991)).
- GCN4-pl trimeric coiled-coil peptides have been developed, such as GCN4-pII (Harbury, P. B., et al, Nature 371:80-3 (1994)) and GCN4-pI Q I (Eckert D.M., et al, J. Mol. Biol. 284:859-65 (1998)).
- the trimeric coiled-coil peptides can be used to fuse with the HRl sequence.
- the chimeric HRl -IQN peptides comprise all or a portion of GCN4- ⁇ I Q I or a modified version of all or a portion of GCN4-pI Q I, such as a modified portion that includes mutations for increased solubility, and an HRl peptide of from about 15 to about 50 amino acid residues.
- the trimeric coiled-coil peptide referred to as the "GCN4 portion" comprises at least 15, 16, 17, 18, 19 or 20 amino acid residues of GCN4 (S. K. Sia and P. S. Kim, Proc. Natl. Acad. Sci. U.S.A. 100:9756-9761 (2003)).
- the amino acid residues present in the components of an IQN peptide can correspond to amino acid residues that are sequential (consecutive) or nonsequential (nonconsecutive) in, respectively, the GCN4 transcription activator (or GCN4-pI Q I) and HRl peptide or a modified version of the activator or the HRl peptide, provided that the resulting IQN peptide is an inhibitor of coronavirus infection of cells, as described herein.
- the IQ and IZ peptides of the present invention can be produced as a continuous peptide or as components that are joined or linked after they are formed.
- the terms "joined” or “joined in such a manner” or “incorporated” include incorporating amino acid residues by either approach.
- the GCN component of an IQN peptide can comprise consecutive amino acid residues from GCN4-pI Q I, modified, if desired (e.g., to increase solubility).
- amino acid residues that are not consecutive in the GCN4 activator (or in GCN4-PI Q I), joined in such a manner that they are nonconsecutive or consecutive in the resulting GCN4 component of an IQN peptide can be incorporated in the IQN peptide.
- amino acid residues of the HRl peptide component of an IQN peptide of the present invention can be amino acid residues that occur consecutively or nonconsecutively in HRl peptide of SARS S protein and can be incorporated into in IQN peptide in such a manner that they are consecutive or nonconsecutive in the resulting peptide.
- nonconsecutive amino acid residues they can be separated by one or more "linker" molecules, if needed to retain the respective functions/characteristics of the components and of the IQN peptide.
- an amino acid residue(s) other than the residue(s) that normally occur between two amino acid residues of GCN4 or HRl peptide can be used to link or join the two amino acid residues in the IQN peptide.
- the linker can be a chemical or synthetic linker, for example.
- IQN36, as well as versions of IQN17 that are shortened in the 'IQ' region, are also described. These shortened versions may be therapeutically advantageous because, for example, they are easier and less expensive to produce than are larger peptides.
- the examples of IQ peptides include:
- GCN4-pI Q I RMKQIEDKIEEILSKQYHIENEIARIKKLIGER (SEQID NO:11)
- GCN4-pI Q r RMKQIEDKIEEIESKQKKIENEIARIKKLIGERY (SEQ ID NO:12)
- a specific embodiment of an IQN peptide is IQN17, which contains 29 residues of GCN4-pI Q I, including three mutations for increased solubility.
- the sequence of IQN17 consists of residues 1-29 of SEQ ID NO: 12. Shortened versions of IQN 17, which each include a shorter GCN component than is present in IQN17, are also the subject of this invention.
- shortened IQN17 peptides are: a) shortened IQN17 #1, consisting of residues 22-29 of SEQ ID NO: 12; b) shortened IQN17 #2, consisting of residues 15-29 of SEQ ID NO: 12; c) shortened IQN17 #4, consisting of residues 8-29 of SEQ ID NO: 12; d) shortened IQN17 #5, consisting of residues 8-28 of SEQ ID NO: 12; and e) shortened IQN17 #3, in which there are 15 non-HRl amino acid residues KIKKIENEIARIKKL (SEQ ID NO: 13).
- GCN4-pI Q F with a Q to I mutation is referred to as GCN4-pIT .
- the solubilizing trimeric coiled-coil peptide can also be from other designed trimeric coiled coils, such as the isoleucine zipper (IZ) described by Tanaka et al. (Suzuki, K., Hiroaki, H., Kohda, D. & Tanaka, T. Protein Eng. 11:1051-1055 (1998)), or derivatives of this 'IZ' sequence. In those embodiments in which the trimeric coiled-coil peptide is from the isoleucine zipper, they are referred to as IZ peptides.
- IZ isoleucine zipper
- Tanaka' s isoleucine zipper Ac-YGGIEKKIEAIEKKIEAIEKKIEAIEK IEA-NH 2 (SEQ ID NO: 14)
- the "IZ" molecule derivative Ac-YGGIK EIEAIKKEQEAIKKKIEAIEKEIEA-NH 2 (SEQ ID NO: 15).
- the solubilizing trimeric coiled-coil peptide can comprise a trimeric coiled-coil peptide from HIV.
- HRl chimeric peptide configurations In one embodiment, the components of the HR1-IQ peptides are present in the following "order":
- HR1-IQN17 and other HR1-IQN peptides can be tested for their ability to inhibit coronavirus infection of cells using known methods.
- Soluble HRl chimeric peptides of the present invention comprise, in specific embodiments, the amino acid sequences shown as follows:
- SEQ ID NO: 17 or a peptide consisting of residues 2-67 of SEQ ID NO: 17;
- TIKKEIEAIKKEQEAIKKKIEAIEKRLQ5LQTYVTQQLIRAAEI-RASAM (SEQ ID NO:22), or a peptide consisting of residues 2-49 of SEQ ID NO:22; TRMKQIEDKIEEIESKQKKIENEIARIKKRLQSLQTYVTQQLIRAAEIRASAN (SEQ ID NO:23), or a peptide consisting of residues 2-53 of SEQ ID NO:23;
- TRMKQIEDKIEEIE5KQKKIENEIARIKKALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDR (SEQ ID NO:24), or a peptide consisting of residues 2-67 of SEQ ID NO:24;
- TIKKEIEAIKKEQEAIKKKIEAIEKALMTLVKQ SSNFGAISSVLNDILSRLDKVEAEVQIDR (SEQ ID NO:25), or a peptide consisting of residues 2-63 of SEQ ID NO:25.
- IKKEIEAIKKEQEAIKKKIEAIEKEISQIQESLTTTSTALGK QDW QNAQALMTLVKQLS SEQ ID NO:26
- IKKEIEAIKKEQEAIKKKIEAINVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQ SEQ ID NO:27.
- IZN36 examples of IZ peptides, referred to as IZN36, IZN23 and IZN17-like inhibitors of SARS coronavirus are shown as follows.
- Such inhibitor peptides can be administered to an individual, such as in a pharmaceutical composition comprising one or more (at least one) of the IZ peptides and an appropriate carrier (e.g., an appropriate buffer or carrier) to prevent or inhibit SARS infection in the individual.
- an appropriate carrier e.g., an appropriate buffer or carrier
- Five-Helix Proteins Another embodiment of the present invention encompasses Five-Helix or Five-Helix proteins.
- the Five-Helix proteins comprise three heptad repeat 1 (HRl) components and at least two and up to, but not including, three heptad repeat 2 (HR2) components of coronavirus S2 protein, and are soluble under physiological conditions.
- the Five-Helix proteins interact with or bind to HR2 of coronavirus S2 protein; and inhibit coronavirus infection of mammalian cells, particularly human cells, such as epithelial cells of the upper respiratory tract or gastrointestinal tract.
- Five-Helix includes three HRl components and at least two HR2 components of coronavirus S2 protein.
- the HRl and HR2 components are separated by linkers, preferably amino acid residue linkers, which can be of any length.
- the amino acid linkers can be, for example, GGGSSGGGSGG (SEQ ID NO:33).
- Six-Helix protein which comprises three HRl components and three HR2 components of coronavirus S protein, joined by linkers, such as amino acid residue linkers.
- the amino acid sequence of Six-Helix differs from those shown in the figure by addition, deletion, substitution or alteration of at least one amino acid residue.
- a Five-Helix protein of this invention comprises three heptad repeat 1 (HRl) components and at least two and up to, but not including, three heptad repeat 2 (HR2) components of an S2 protein of a coronavirus that causes SARS; interacts with or binds to HR2 of the SARS-CoV S2 protein; and inhibits infection of human cells, such as infection of cells of the epithelium of the respiratory tract.
- HRl heptad repeat 1
- HR2 three heptad repeat 2
- Five-Helix can be represented as: HRl-linker-HR2-linker-HRl-linker-HR2- linker-HRl, wherein HRl represents a coronavirus HRl and HR2 represents a coronavirus HR2.
- Five-Helix can be represented as: HRl-lmker-HR2-linker-HRl-linker-HR2-linker- HR1 -linker-partial HR2 wherein HRl represents a coronavirus HRl and HR2 represents a coronavirus HR2 and "partial HR2" indicates that this component is a portion of a coronavirus HR2.
- the term Five- Helix or Five-Helix protein encompasses all such embodiments (those including three HRl components and two or more, but less than three, HR2 components, separated by appropriate linkers).
- the HRl and HR2 components are human coronavirus heptad repeats and partial HR2 is a partial (less than a complete) human coronavirus heptad repeat.
- the Five Helix protein can be represented as: HRl of SARS virus-linker-HR2 of SARS virus-linker-HRl of SARS virus-linker-HR2 of SARS virus-linker-HRl of SARS.
- the Five Helix protein can be represented as: HRl of SARS virus-linker-HR2 of SARS virus-linker-HRl of SARS virus-linker-HR2 of SARS virus-linker-HRl of SARS-linker-partial HR2 of SARS.
- the Five-Helix proteins comprise HRl components having the sequence of from about residue 900 to about residue 1013 of SEQ ID NO: 1, HR2 components having the sequence of residues from about 1148 to about 1193 of SEQ ID NO: 1, and amino acid linkers therebetween.
- the HRl and/or HR2 SARS sequence can be altered by the addition, deletion or substitution of one or more amino acid residues to produce additional Five-Helix proteins.
- a Five-Helix protein comprises three HRl repeats having the following amino acid sequence: the residues 900-1005 of SEQ ID NO:l, and at least two and up to, but not including, three HR2 repeats having the following amino acid sequence: the residues 1151-1185 of SEQ ID NO: 1.
- a Five-Helix protein comprises three HRl repeats having the following amino acid sequence: the residues 900-974 of SEQ ID NO: 1, and at least two and up to, but not including, three HR2 repeats having the following sequence: the residues 1148-1193 of SEQ ID NO: 1.
- a Five-Helix protein comprises three HRl repeats having the amino acid sequence: the residues 900-1005 of SEQ ID NO: 1, and at least two and up to, but not including, three HR2 repeats having the following sequence: the residues 1148-1193 of SEQ ID NO: 1.
- a five-helix protein comprises three HRl repeats having the amino acid sequence: the residues 900-974 of SEQ ID NO: 1, and at least two and up to, but not including, three HR2 repeats having the following amino acid sequence: the residues 1151-1185 of SEQ ID NO: 1.
- a Five-Helix protein has the sequence of residues 1-243 of SEQ ID NO:34, whereas the corresponding Six-Helix the sequence of SEQ ID NO:34: MVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAGGGSSGGGSGGDISGINASVV-SriQKEI
- a Five-Helix protein has the sequence of residues 1-237 of SEQ ID NO:35, whereas the corresponding Six-Helix the sequence of SEQ ID NO: 34.
- a Five-Helix protein has the sequence of residues 1-237 of SEQ ID NO:36, whereas the corresponding Six-Helix the sequence of SEQ ID NO:36:
- a Five-Helix protein has the sequence of residues 1-317 of SEQ ID NO:37, whereas the corresponding Six-Helix the sequence of SEQ ID NO:37:
- amino acid residues in the C-peptide helix (HR2) can be changed to other amino acid residues with considerable flexibility.
- amino acid residues can generally be changed to (substituted with) naturally-occurring amino acid residue except, in general, proline, which can be used as a cap.
- Amino acid residues in the N-peptide helix (HRl) can also be changed.
- the amino acid residues that are buried in the coiled-coil trimer can be substituted with amino acid residues that can be accommodated in the interface.
- Such characteristics of amino acid as size, charge and hydrophobicity must be taken into consideration in selecting amino acid substitutions in the N-peptide.
- the amino acid residue composition of Five-Helix of the present invention can vary greatly. In those instances in which Five-Helix is used in therapeutic applications, it must present a surface or region that is available for binding or interacting with coronavirus HR2. That is, the remaining surface of Five-Helix must be present in such a manner or conformation that it is available to bind or interact with coronavirus HR2.
- the HRl components of Five-Helix proteins of the present invention can vary in amino acid composition (type and number). They will generally comprise from about 20 to about 100 amino acid residues of HRl of coronavirus (e.g., human) S2 protein and each component can comprise any number of amino acid residues from about 20 to about 100. They will generally comprise from about 20 to about 60 amino acid residues of HR2 of coronavirus (e.g., human) S2 protein and each can comprise any number of amino acid residues from about 20 to about 60.
- the amino acid composition of each HRl component in a Five-Helix protein can be the same or different.
- the amino acid composition of each HR2 component in a Five-Helix protein can be the same or different.
- the amino acid residues included in HRl and HR2 can occur sequentially/consecutively in the corresponding region of a coronavirus or may be nonconsecutive amino acids (e.g., amino acids that are not consecutive in the coronavirus HRl and/or HR2 can make up an HRl or HR2 of a Five-Helix).
- Five-Helix protein can comprise equivalent HRl and HR2 components from other coronaviruses, which can be identified using known methods, such as Multicoil and Learncoil VMF. See, for example, Wolf, E.
- Five-Helix proteins of the present invention can differ from a sequence presented herein by addition, deletion, substitution or alteration of at least one amino acid residue.
- the linkers can be of any length or composition, provided that the Five-Helix protein conformation, described herein, is retained.
- Five-Helix can be an L-amino acid protein, a D-amino acid protein or a combination of L-amino acid residues and D-amino acid residues; these residues can be modified residues or non naturally occurring residues.
- the Retro-inverso Analogues further relates to the inhibitors that are retro-inverso analogues of the inhibitors derived from HRl and/or HR2 of the coronaviruses such as SARS-CoV.
- the in vivo stability of a peptide is critical for its application in therapies.
- the retro-inverso analogues have higher stability than their counterparts, while reserving the capability of binding the pre-hairpin intermediate of S protein and inhibiting coronavirus inhibition.
- the Retro-inverso Peptides The retro-inverso analogue of a peptide is more stable than the peptide, while it often maintains the biological activities of the peptide.
- a retro-inverso peptide is an isomer of a linear peptide in which the direction of the amino acid sequence is reversed, and the chirality of each amino acid residue is inverted (Goodman & Chorev, Ace. Chem. Res. 12:1-7 (1979); Chorev & Goodman, M. Ace. Chem. Res. 26:266-273 (1993); Chorev & Goodman, M. Trends Biotechnol. 13:438-445 (1995); Fletcher & Campbell, Chem. Rev.
- amino acids comprising more than one chiral center, like isoleucine and threonine
- the amino acid used in the retro-inverso analog may comprise any combination of the possible configurations of the said amino acid.
- "i” may represent (D)-Isoleucine, (D)-allo-isoleucine, or (L)-allo-isoleucine
- "t” may represent (D) threonine, (D)-allo-threonine, or (L)-allo-threonine.
- retro-inverso peptides which maintain the same biological activity of the parent peptides (for recent examples see Levi et al., Res. Human Retroviruses 16:59-65 (2000); Tayor et al., 2000; Pescarolo et al., FASEB J. 15:31-33 (2000); Chen et ah, J. Med. Chem. 45 1624-1632 (2002); D'Ursi et al, J.
- peptides are thought to act in a dominant-negative manner, by substituting for one or more components of the trimer, which results from collapse of the HR 1 and 2, thereby preventing the conformational changes necessary for fusion (Lambert et al., Proc. Natl. Acad. Sci. U.S.A. 93:2186-2191 (1996); Chan & Kim, Cell 93:681-684 (1998); Sodroski, Cell 99:243-246 (1999)). This interaction occurs over a large surface area, and does not depend on a single, specific contact between the interacting peptide pairs.
- N-terminal truncations of the potent HTV-1 fusion inhibitor DP-178 give rise to fully active peptides (Lawless et al, Biochemistry 35: 13697-13708 (1996)).
- retro-inverso peptides invariably show extended stability in serum, because the inverted amide backbone makes them poor substrates for serum proteases (Goodman & Chorev, Ace. Chem. Res. 12:1-7 (1979); Chorev & Goodman, M. Ace. Chem. Res. 26:266-273 (1993); Chorev & Goodman, M. Trends Biotechnol. 13:438-445 (1995); Levi et al, Res.
- the inhibitor comprises a retro-inverso analogue of any of the inhibitory peptides or proteins disclosed herein, including C-peptides, N-peptides, Five-Helix proteins, Heptad Repeat 2 (HR2) peptides, and Heptad Repeat 1 (HRl) coiled-coil peptides.
- the inhibitor comprises a retro-inverso analogue of a sequence from coronavirus heptad repeat 1 or heptad repeat 2.
- the coronavirus is a human coronavirus or a mouse coronavirus.
- the coronavirus is a human SARS coronavirus (SARS-CoV).
- the inhibitor comprises a retro-inverso analogue of a sequence from coronavirus heptad repeat 2 (HR2); the sequence has a length of at least 20 amino acid residues.
- the inhibitor is a retro-inverso analogue of HR2 peptide or C-peptide disclosed herein.
- the inhibitor comprises a retro- inverso analogue of the predicted HR2 region.
- the HR2 sequence has a length of from about 20 to about 60 amino acid residues, or preferably from about 20 to about 50 amino acid residues.
- Amino acid residues present in these inhibitors may be a retro-inverso sequence of amino acid residues that occur sequentially in a coronavirus HR2 or may be amino acid residues that are separated by other (intervening) amino acid residues in the coronavirus HR2.
- the inhibitors can bind to the HRl regions of the pre-hairpin intermediate in a dominant-negative manner to block formation of the hairpin structures, and thereby prevent the infection of coronavirus to the cells.
- Possible inhibitors include, but are not limited to, peptides comprising a retro-inverso analogue of the amino acid sequences disclosed in sections 2-5 and peptides that have an amino acid sequence sufficiently similar to any of those sequences to function in the same manner.
- a inhibitor comprises a retro-inverso analogue of some or all of the amino acid sequence of SARS virus HR2, as disclosed in section 2.
- the SARS fusion inhibitors comprise from about 20 amino acid residues to about 60 amino acid residues.
- Amino acid residues present in these retro-inverso inhibitors may be a sequence of amino acid residues that occur consecutively (contiguously) in a coronavirus HR2 or may be amino acid residues that are separated by other (intervening) amino acid residues noncontiguously) in the coronavirus HR2.
- the inhibitor can comprise a retro-inverso analogue of any of the sequences derived from SEQ ID NO: 2, as disclosed in section 2.
- the inhibitor can be any of the sequences derived from the retro-inverso analogue of SEQ ID NO:2, which is l vy pwkiyqeykgleqldilsenlnkavenlrdiekqinvvsanigsidgldvdp.
- HR2 retro-inverso analogues are partial or full sequence of the retro-inverso analogue of SEQ ID NO:2.
- HR2 retro-inverso analogues can consist of amino acid residues from N to (N+M-l) of the analogue, wherein M is the length of the HR2 peptide, and N can be any integral number from 1 to (58-M).
- the inhibitor comprises ldilsenlnkavenlrdiekqinwsanigsidgl, which is the retro-inverso analogue of SEQ ID NO:3.
- the fusion inhibitor of a coronavirus comprises a retro-inverso analogue of a sequence of at least 28 amino acid residues from coronavirus heptad repeat 1 (HRl).
- HRl coronavirus heptad repeat 1
- the retro-inverso inhibitors can bind to the HRl regions of the pre-hairpin intermediate in a dominant-negative manner to block formation of the hairpin structures, and thereby prevent the infection of coronavirus to the cells.
- the inhibitor is retro- inverso HRl peptide or N-peptide.
- the inhibitor can be the retro-inverso analogue of any of the HRl or N-peptide inhibitors disclosed herein.
- the inhibitor comprises a retro- inverso analogue of soluble HR1-IQ peptides or HR1-IZ peptides, which are comprised of a soluble trimeric coiled coil fused to an HRl peptide, which has the sequence of at least a portion of HRl of coronavirus S2 protein.
- the peptides comprise a peptide of at least 15 amino acid residues from HRl of a coronavirus fused in the proper heptad repeat register to a soluble trimeric coiled coil, such as GCN4-pIqI or IZ.
- the HRl region component of these peptides can be of varying length and will typically be from about 15 to about 50 amino acid residues from the coronavirus HRl region.
- the inhibitor can be the retro-inverso analogue of any of the HRl coiled-coil inhibitors disclosed herein.
- the inhibitor comprises a peptide having a retro-inverso analogue of sequence selected from the group consisting of the partial or full sequence of SEQ ID NO: 16-28.
- Inhibitors Containing Tryptophan Analogs The present invention further relates to C-peptide and N-peptide coronavirus inhibitors containing one or more tryptophan analogs.
- C-peptide and N-peptide inhibitors can be obtained based on the disclosure provided herein including the identification of HRl and HR2 sequences, and the use of tryptophan analogs. Tryptophan analogs can be used to increase serum half-life and improve pharmacokinetic properties.
- Additional regions that may be present include additional coronavirus regions and other types of regions such as enhancer regions.
- Enhancer regions either substantially maintain or enhance either coronavirus inhibitor properties or pharmacokinetic properties. Examples of enhancer regions are provided in Barney et al, International Publication Number WO 01/03723, published January 18, 2001.
- Tryptophan analogs can be present in either D or L stereochemistry.
- Preferred tryptophan analogs are modified amino acids having an R group (D or L stereochemistry) independently selected from the group consisting of:
- X is O, S, or NR 7 ; Y is C-R 5 or N; W is N or CH; Z is CH or N; Ri, R 2 , and R 5 are independently selected from the group consisting of hydrogen, halogen, Ci-C ⁇ alkyl, -C 6 alkylamino, amino, and carboxyl; R 3 and R 4 are either (1) independently selected from the group consisting of hydrogen, halogen, C ⁇ -C 6 alkyl, -C ⁇ alkylamino, amino, and carboxyl; or (2) joined together to provide a fused benzene ring; Re is H or methyl; R 7 is H or linear, branched or cyclic C C 6 alkyl; and n is O or 1; further provided that in the case of formula I, Ri may also be CH 2 where there is a bond from tills CH 2 to the alpha-NH of the modified amino acid. Specific examples of different tryptophan analogs are shown in Figures 4A, 4B and 4C. The
- enhancer regions are shorter length amino acid sequences up to about eight amino acids.
- the enhancer region at the N-terminus is XQEXEQK (SEQ ID NO:38)
- the enhancer region at the C-terminus is XPXYVXL (SEQ ID NO:39)
- tryptophan analogs may be present in the HR2 based region or an additional amino acid region located at the N-terminus or C-terminus of the HR2 based region.
- the C-peptide consists of: (a) a HR2 based region comprising about 18 amino acids of SEQ ID NO: 2 optionally modified with one or more conservative substitutions thereof; (b) an optionally present N-terminus enhancer group joined to the N-terminus of the HR2 based region; (c) an optionally present C-terminus enhancer group joined to the C-terminus of the HR2 based region; provided that at least one tryptophan analog is present, further provided that the C-peptide N-terminus, C-terminus, or both the N-terminus and C- terminus may contain a protecting group.
- a C-peptide consists of (a) a HR2 based region consisting of a sequence selected from the group consisting of: amino acid residues from N to (N+M-l) of SEQ ID NO:2, wherein M is the length of the HR2 peptide, and N can be any integral number from 1 to (58-M).
- an optionally present N-terminus enhancer group preferably WQEWEQKI (SEQ ID NO:40), where one or both tryptophans may be replaced with a tryptophan analog
- an optionally present C-terminus enhancer group preferably, WPWYVWL (SEQ ID NO:41) where one, two or all three tryptophans may be replaced with a tryptophan analog; provided that at least one tryptophan analog is present; and provided that the C-peptide N-terminus, C-teraiinus, or both the N-terminus and C-terminus may contain a protecting group.
- the HR2 peptide has a sequence of Z-LGDISGINASWNIQKEIDRLNEVAKMLNESLIDLXPXYVXL (SEQ ID NO:42), and a variant thereof comprising one or more conservative substitutions; wherein Z is an optionally present enhancer group, wherein each X is independently either tryptophan or a tryptophan analog; provided that the C-peptide N-terminus, C-terminus, or both the N-terminus and C-terminus may contain a protecting group.
- lactam bridges The introduction of one or more lactam bridges into a C-peptide or N-peptide can be used to stabilize a conformation providing advantages over the corresponding structure not containing lactam bridges. Advantages that can be provided include one or more of the following; resistance to proteolytic enzyme, improved serum half-life, enhanced biological activity, and enhanced pharmacokinetic properties. The same enhanced stability, coupled with cross-reactivity of the antibody response between the linear and the corresponding cyclic constrained sequences, may make the peptides more suitable than their linear counterparts for generation of an immune response as part of a vaccine. 9.1.
- Lactam Bridges A lactam bridge is formed between a carboxyl moiety of a first amino acid and an amino moiety of a second amino acid. The carboxyl and amino moieties form an amide bond.
- the general structure of an individual amino acid and amino acids in a peptide are as follows (where R is an amino acid R group):
- lactam bridges into a particular peptide can make use of amino acids having suitable groups or involve modifying the peptide to insert one or more suitable amino acids.
- Suitable amino acids for forming a lactam bridge include naturally occurring amino acid and non-naturally occurring amino acids.
- Suitable amino acids are amino acid pairs where one amino acid contains a free amino and another contains a free carboxyl.
- Examples of amino acids containing an R-group carboxyl moiety include naturally occurring amino acids such as aspartic acid and glutamic acid, and non-naturally occurring amino acids such as 2-aminohexanedioic acid and 2-aminoheptanedioic acid.
- amino acids containing an R-group amino moiety include naturally occurring amino acids such as lysine and ornithine, and non-naturally occurring amino acids such as diaminobutyric acid and diaminopropanoic acid. Cyclization in an (i, i + 3), (i, i + 4) and (i, i + 7) spaced side chain to a side chain lactam bridge stabilizes turn conformations and helical segments. (Taylor Biopolymers (Peptide Science) 66:49-25, 2002.) A peptide can be modified to contain amino acids with appropriate groups (carboxyl and amino pairs) suitably spaced apart.
- the C-peptide consists of a sequence selected from the group consisting of: any of the sequences derived from SEQ ID NO:2, as disclosed in section 2; that is (a) modified to contain one or more lactam bridges each of which is independently in an (i, i + 3), (i, i + 4) or (i, i +7) orientation; (b) optionally modified to contain one or more conservative substitutions; (c) optionally modified to contain a C-terminus deletion; and (d) optionally modified to contain a N-terminus deletion, provided that the N-terminus, C-terminus, or both the N-terminus and C-terminus may contain a protecting group.
- HR2 retro-inverso analogues can consist of amino acid residues from N to (N+M-1) of SEQ ID NO:33, wherein M is the length of the HR2 peptide, and N can be any integral number from 1 to (58-M).
- Examples of peptides containing (i, 1+3), (i, i+4), or (i, i+7) lactam bridges are:
- the inhibitors can be produced by a variety of methods, including by means of recombinant DNA or RNA methods and / or known chemical synthetic methods. They can also be obtained from a library of peptides, such as a combinatorial peptide library. They may be capped or uncapped with certain amino acids. Recombinant versions can contain helix capping residues on the N- terminus, the C-terminus or both. Possible capping residues for the N-terminus are amino acid T, D and S and for the C-terminus include amino acid G, R, H, N, and K.
- the peptides may also contain a C-terminus cap (also referred to herein as a C-terminus "protecting group”) or a N-terminus cap (also referred to herein as a N-terminus “protecting group”).
- a C-terminus protecting group is a modification to the C-terminal amino acid that reduces the reactivity of the carboxyl terminus under in vivo conditions.
- the carboxyl terminus is preferably modified at the ⁇ - carbonyl group. Examples of modification include chemical groups such as amide, methylamide, and ethylamide.
- An N-terminus protecting group is a modification to the N-terminal amino acid that reduces the reactivity of the amino terminus under in vivo conditions.
- the N-terminal amino acid can be modified with groups such as acetyl, propionyl, succinyl, benzyl, benzyloxycarbonyl or t-butyloxycarbonyl.
- the peptides are produced using standard techniques including those involving step-wise chemical synthesis. Techniques for chemical synthesis of peptides are well known in the art. (See e.g., Vincent, in Peptide and Protein Drug Delivery, New York,
- Tryptophan analogs can be produced and incorporated into a peptide taking into account well known techniques. Different tryptophan analogs can be obtained from commercial sources such as RSP Amino Acid Analogues Inc., Bachem, and Sigma; or based on techniques such as those described by
- the retro-inverso peptides of the present invention may be chemically synthesized, using the same methods utilized for the synthesis of normal peptides. See, e.g., J. Biol. Chem. 270:11921-11926 (1995), Briand et al., Proc. Natl. Acad. Sci. U.S.A. 94:12545-12550 (1997), Fletcher & Campbell, Chem. Rev. 98:763-795(1998), Levi et al., Res. Human Retroviruses 16:59-65 (2000); Tayor et al., 2000; Pescarolo et ah, FASEB J. 15:31-33 (2000); Chen et al., J. Med. Chem. 45 1624-1632 (2002); D'Ursi et al, J. Med. Chem. 46 1807-1810 (2003)
- the present invention further relates to DNA encoding Five-Helix; methods of producing Five- Helix.
- Five-Helix protein can be produced by a variety of methods. For example, it can be produced from a larger protein, such as 6-Helix, by enzymatic (trypsin) digestion. Alternatively, it can be produced, using known methods and expression systems, by expressing Five-Helix protein-encoding DNA, which can be a single DNA that encodes the entire Five-Helix protein or two or more DNA "units", each of which encodes a portion (e.g., one or more HRl component, one or more HR2 components) of Five-Helix protein.
- the yield of expression and purification of Five-Helix can be significantly improved by direct expression of the Five-Helix gene in an appropriate host cell, such as E. coli.
- the Five- Helix gene encodes the residues present in the final Five-Helix protein.
- a C-terminal His-tag can be attached to facilitate purification (with or without a protease cleavage site to later remove the tag).
- the protein can then be used directly without the proteolytic cleavage and unfolding steps required for producing Five-Helix starting from Six-Helix.
- This Five-Helix molecule may be expressed as a folded active molecule, allowing its use in biological selections or screens for optimizing its properties.
- protein synthetic methods can be used to produce Five-Helix protein.
- the HRl and HR2 components of Five-Helix can be joined covalently (such as by means of a linker of at least one (one or more) amino acid residues) or by other means which results in formation of a protein which is stable under physiological conditions and is correctly folded such that the remaining surface of Five Helix is presented so that it is available to bind or interact with coronavirus HR2.
- the components can be similarly joined.
- Five-Helix can be assessed to determine if it acts on the virus before it enters the cell. Five-Helix should be soluble under physiological conditions and should also be stable under physiological conditions.
- 5-Helix variants with an increased molecular weight (by oligomerization or tethering to a large protein) to reduce the rate of kidney clearance.
- Five- Helix dimers can be made by disulfide crosslinking, to produce a molecule filtered to a lesser extent than the Five-Helix "monomer".
- Bioavailability of Five-Helix can be affected (enhanced) by producing variants in nonbacterial cells, in which the protein would be glycosylated as it is produced.
- glycosylation sites can be engineered into Five-Helix.
- -Another embodiment of this invention is a complex of Five-Helix tethered (with an appropriate linker, which can be made of amino acid residues, or can be a chemical or synthetic linker) to a component, such as a ligand (protein or small molecule) that binds coronavirus envelope protein.
- the complex is useful as a therapeutic agent, because the ligand will increase the effective concentration of the tethered Five-Helix moiety in the vicinity of the coronavirus envelope protein.
- Utilities of the Coronavirus Inhibitors The present invention relates to methods in which the peptides and Five-Helix proteins are used.
- the peptides and Five-Helix are useful as therapeutic agents or drugs to prevent coronavirus infection or reduce the extent to which it occurs; as a reagent for identifying (screening for) or designing other therapeutics or prophylactics effective against coronavirus infection.
- the peptides and Five-Helix are used to reduce coronavirus infection in an individual.
- the peptides or Five-Helix is administered to an individual in sufficient quantity to reduce (totally or partially) infection of the individual's cells.
- a dose of the peptides or Five-Helix sufficient to reduce coronavirus infection is administered in such a manner (e.g., by injection, topical administration, intranasal route, intravenous route) that it inhibits (totally or partially) coronavirus entry into cells.
- the peptides or Five-Helix can be administered to an individual who is infected, to reduce further infection, or to an uninfected individual to prevent infection or reduce the extent to which infection occurs.
- the Five-Helix can also be administered via expression of Five-Helix-encoding DNA in appropriate host cells or vectors.
- the present invention provides a method of inhibiting infection of human cells by coronavirus in an individual, comprising administering to the individual a pharmaceutical composition comprising the retro-inverso analogue of a SARS-CoV HR peptide in sufficient quantity to inhibit infection of human cells by the SARS virus, and ' a pharmaceutical acceptable carrier, wherein infection of human cells is inhibited.
- HR-peptide coronavirus inhibitors can be formulated and administered to a subject using the guidance provided herein along with techniques well known in the art. The preferred route of administration ensures that an effective amount of compound reaches the target. Guidelines for pharmaceutical administration in general are provided in, for example, Remington's Pharmaceutical Sciences 18 th Edition, Ed. Gennaro, Mack Publishing, 1990, and Modern Pharmaceutics 2 nd Edition, Eds. Banker and Rhodes, Marcel Dekker, Inc., 1990.
- HR-peptide coronavirus inhibitors can be prepared as acidic or basic salts.
- salts in the form of water- or oil-soluble or dispersible products
- pharmaceutically acceptable salts include conventional non- toxic salts or the quaternary ammonium salts that are formed, e.g., from inorganic or organic acids or bases.
- examples of such salts include acid addition salts such as acetate, adipate, alginate, aspartate, benzoate, benzenesulfonate, bisulfate, butyrate, citrate, camphorate, camphorsulfonate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, fumarate, glucoheptanoate, glycerophosphate, hemisulfate, heptanoate, hexanoate, hydrochloride, hydrobromide, hydroiodide, 2- hydroxyethanesulfonate, lactate, maleate, methanesulfonate, 2-na
- HR-peptide coronavirus inhibitors can be administered using different routes such as an intravenous route, an intraperitoneal route, a subcutaneous route, a topical route, an intramuscular route, or an intranasal route.
- the injectable solution or suspension may be formulated using suitable non-toxic, parenterally-acceptable diluents or solvents, such as Ringer's solution or isotonic sodium chloride solution, or suitable dispersing or wetting and suspending agents, such as sterile, bland, fixed oils, including synthetic mono- or diglycerides, and fatty acids, including oleic acid.
- Pharmaceutically acceptable carriers facilitate storage and administration of a HR-peptide to a patient.
- Pharmaceutically acceptable carriers may contain different components such as a buffer, sterile water for injection, normal saline or phosphate buffered saline, sucrose, histidine, salts and polysorbate.
- Suitable dosing regimens are preferably determined taking into account factors well known in the art including type of subject being dosed; age, weight, sex and medical condition of the subject; the route of administration; the renal and hepatic function of the subject; the desired effect; and the particular compound employed.
- Optimal precision in achieving concentrations of drug within the range that yields efficacy without toxicity requires a regimen based on the kinetics of the drug's availability to target sites. This involves a consideration of the distribution, equilibrium, and elimination of a drug.
- the daily dose for a subject is expected to be between 0.01 and 1,000 mg per subject per day.
- HR-peptide coronavirus inhibitors can be provided in kit.
- kit typically contains an active compound in dosage forms for administration.
- a dosage form contains a sufficient amount of active compound such that a beneficial effect can be obtained when administered to a patient during regular intervals, such as 1 to 6 times a day, during the course of 1 or more days.
- a kit contains instructions indicating the use of the dosage form for treating coronavirus and the amount of dosage form to be taken over a specified time period.
- rmmunogens HR-peptides providing appropriate epitopes may be used as an immunogen for anti-coronavirus antibody production.
- the immunogen can be used, for example, as a vaccine component or to produce monoclonal or polyclonal antibodies that are subsequently isolated and used to target the coronavirus Spike protein.
- the invention relates to a method of eliciting an immune response to coronavirus in an individual, comprising introducing, by an appropriate route, a composition comprising Five-Helix and a physiologically acceptable carrier, in a dose sufficient to elicit the immune response in the individual.
- Vaccines comprising the peptides or Five-Helix (or a variant or portion thereof) in a physiologically acceptable carrier are the subject of this invention.
- Immunogens can be formulated as a vaccine or used for antibody production and isolation taking into account the guidance provided herein along with techniques well known in the art. Techniques for producing and using antibodies are well known in the art. Examples of such techniques are described in Ausubel, Current Protocols in Molecular Biology, John Wiley, 1987-1998, Harlow et al., Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory, 1988, and Kohler et al., Nature 256:495-497, 1975. Guidelines for pharmaceutical vaccine administration in general are provided in, for example, Vaccines Eds. Plotkin and Orenstein, W.B.
- a vaccine can be administered in conjunction with an adjuvant.
- Adjuvants are substances that can assist an immunogen in producing an immune response. Adjuvants can function by different mechanisms such as one or more of the following: increasing the antigen biologic or immunologic half- life; improving antigen delivery to antigen-presenting cells; improving antigen processing and presentation by antigen-presenting cells; and inducing production of immunomodulatory cytokines. (Vogel, Clinical Infectious Diseases 30 (suppl.
- adjuvants can be employed to assist in the production of an immune response.
- adjuvants include aluminum hydroxide, aluminum phosphate, other salts of aluminum, calcium phosphate, DNA CpG motifs, monophosphoryl lipid A, cholera toxin, E.
- Vaccines can be administered by different routes such as subcutaneous, intramuscular, or mucosal.
- Subcutaneous and intramuscular administration can be performed using, for example, needles or jet-injectors.
- Suitable dosing regimens are preferably determined taking into account factors well known in the art including age, weight, sex and medical condition of the patient; the route of administration; the desired effect; and the particular compound employed.
- the immunogen can be used in multi-dose vaccine formats. It is expected that a dose would consist of the range of 1 ⁇ g to 1.0 mg total polypeptide, in an embodiment of the present invention the range is 0.1 mg to 1.0 mg.
- the timing of doses depends upon factors well known in the art. After the initial administration one or more booster doses may subsequently be administered to maintain or boost antibody titers.
- retro-inverso peptides can also be used as vaccines against SARS.
- Several studies have documented that the retro-inverso analogs of linear peptide epitopes can be useful as vaccines (Guichard et al., Proc. Natl. Acad. Sci. U.S.A. 91:9765-9769 (1994); Benkirane et al., J. Biol. Chem. 270:11921- 11926 (1995); Briand et al., Proc. Natl. Acad. Sci. U.S.A.
- FMDV Foot-and-Mouse disease virus
- the invention relates to a method of identifying a compound or molecule that binds the peptides or Five-Helix and inhibits coronavirus infection of mammalian cells.
- the compound or molecule to be assessed is referred to as a candidate inhibitor.
- the method comprises combining a candidate inhibitor and the peptides or Five-Helix under appropriate binding conditions, and determining and selecting the compound or molecule that binds the peptides or Five-Helix.
- the method optionally further comprises determining and selecting the selected compound or molecule that inhibits coronavirus infection of mammalian (e.g., human) cells, such as in a cell-based assay.
- mammalian e.g., human
- Such a compound or molecule may be used to inhibit (totally or partially) coronavirus infection of human or non-human animals.
- Other embodiments are within the following claims. While several embodiments have been shown and described, various modifications may be made without departing from the spirit and scope of the present invention. EXAMPLES Examples are provided below to further illustrate different features of the present invention. The examples also illustrate useful methodology for practicing the invention. These examples do not limit the claimed invention.
- Example 1 The Assays Used to Test the Peptide Activity
- the identification of SARS coronavirus HRl and HR2 sequences provides substrates that can be employed to evaluate the ability of compound to inhibit HRl and HR2 interactions.
- Compounds that can be evaluated include C-peptides and N-peptides.
- Different types of assay formats can be employed to measure the ability of a compound to inhibit HRl and HR2 interactions.
- Detectable labels on either or both HRl and HR2 can be used to help measure HRl and HR2 interactions. Examples of different types of labels include fluorescent labels, radioactive labels, and donor-acceptor pairs (e.g., FRET labels).
- Peptide activity can also be measured by providing a peptide to a cell infected with the coronavirus.
- an assay can be performed to measure a compound' s ability to prevent virus infection and cell-to-cell spread over a 72-hour incubation; where antiviral activity is assayed by measuring retention of the cells' ability to phagocytose neutral red.
- An example of such as assay (based on USAMRIID assay) is as follows: 1) Incubate cells with different concentrations of test peptide (may be done in triplicate). The different concentrations may be serial dilutions and should include a control with no peptide.
- Peptide dilutions can be performed in a suitable buffer (e.g., EMEM, 1% fetal bovine serum, 1.0% L-glutamine (100 X), 1.0% HEPES, 0.1% Funigzone (250 ⁇ g/ 20 ml), 0.1% Gentamicin (50 mg/ml)) added to a 96- well microtiter plate of confluent Vero 76 cells (VERO 76, ATCC number CRL-1587). At different drug concentrations wells are inoculated with SARS associated coronavirus (e.g., MOI of 0.01) or are not infected.
- a suitable buffer e.g., EMEM, 1% fetal bovine serum, 1.0% L-glutamine (100 X), 1.0% HEPES, 0.1% Funigzone (250 ⁇ g/ 20 ml), 0.1% Gentamicin (50 mg/ml)
- a suitable buffer e.g., EMEM, 1% fetal bovine serum
- Plates can then be rocked for 30 minutes at 150 RPM to liberate neutral red and the optical density (at 450 nm) can be measured with a plate reading spectrometer.
- Other embodiments are within the following claims. While several embodiments have been shown and described, various modifications may be made without departing from the spirit and scope of the present invention.
- Example 2 An assay based on the pseudotyping of HTV cores with SARS-CoV Spike protein.
- the present invention also provides a SARS-spike dependent entry assay useful for screening inhibitors of SARS-CoV entry and fusion.
- cells transiently or stably expressing angiotensin converting enzyme-2 (ACE-2) are infected with HIV-1 Luciferase reporter viruses pseudotyped with SARS-CoV Spike protein.
- HTV DNA that has a deletion in its envelope sequence and containing firefly luciferase in place of the Nef gene is co-transfected with a mammalian expression vector encoding codon optimized SARS- CoV Spike protein.
- a plasmid DNA encoding the NL4-3 viral clone, which contains a deletion in its envelope sequence and containing firefly luciferase in place of the Nef gene is co-transfected in 293T cells (a human embryonic kidney cell line stably expressing the Simian Virus 40 Large T antigen) with a mammalian expression vector encoding a codon optimized SARS-CoV Spike protein (See, e.g., Simmons, G., et al., PNAS 101:4240-5 (2004)).
- the transfected cells produce in their supernatants HTV cores that are pseudotyped with SARS Spike protein.
- reporter viruses are capable of entering 293T cells transiently or stably transfected with expression vectors encoding the angiotensin converting enzyme-2 (ACE-2), a cellular receptor for SARS-CoV (Li, W., et al., Nature 426:450-4 (2003); Wong, S.K., et al., Journal of Biological Chemistry 279:3197-201 (2004)).
- ACE-2 angiotensin converting enzyme-2
- SARS-CoV a cellular receptor for SARS-CoV
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oncology (AREA)
- Animal Behavior & Ethology (AREA)
- Communicable Diseases (AREA)
- General Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
Claims
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CA002522329A CA2522329A1 (en) | 2003-04-14 | 2004-04-12 | Inhibitors of coronavirus |
EP04750008A EP1615610A2 (en) | 2003-04-14 | 2004-04-12 | Inhibitors of coronavirus |
Applications Claiming Priority (10)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US46310003P | 2003-04-14 | 2003-04-14 | |
US60/463,100 | 2003-04-14 | ||
US46719003P | 2003-04-30 | 2003-04-30 | |
US60/467,190 | 2003-04-30 | ||
US47886003P | 2003-06-16 | 2003-06-16 | |
US60/478,860 | 2003-06-16 | ||
US47942903P | 2003-06-18 | 2003-06-18 | |
US47943003P | 2003-06-18 | 2003-06-18 | |
US60/479,429 | 2003-06-18 | ||
US60/479,430 | 2003-06-18 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2005002500A2 true WO2005002500A2 (en) | 2005-01-13 |
WO2005002500A3 WO2005002500A3 (en) | 2006-10-05 |
Family
ID=33568933
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2004/011210 WO2005002500A2 (en) | 2003-04-14 | 2004-04-12 | Inhibitors of coronavirus |
Country Status (3)
Country | Link |
---|---|
EP (1) | EP1615610A2 (en) |
CA (1) | CA2522329A1 (en) |
WO (1) | WO2005002500A2 (en) |
Cited By (11)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005063801A2 (en) * | 2003-12-30 | 2005-07-14 | Universiteit Utrecht Holding B.V. | Method for decreasing the contact between hepta-repeat region s of the corona-virus spike proteins and use thereof |
WO2015143335A1 (en) * | 2014-03-20 | 2015-09-24 | The University Of North Carolina At Chapel Hill | Methods and compositions for chimeric coronavirus spike proteins |
CN111349150A (en) * | 2020-03-24 | 2020-06-30 | 北京中科微盾生物科技有限责任公司 | Polypeptide for inhibiting novel coronavirus and application thereof |
CN111471088A (en) * | 2020-04-21 | 2020-07-31 | 北京中科微盾生物科技有限责任公司 | Polypeptide for inhibiting SARS-COV-2 infection, composition and use thereof |
CN112538105A (en) * | 2020-06-29 | 2021-03-23 | 斯克里普斯研究院 | Stable coronavirus spike (S) protein antigens and related vaccines |
WO2021183463A1 (en) * | 2020-03-09 | 2021-09-16 | President And Fellows Of Harvard College | Compositions and methods for treating coronavirus |
US20210380653A1 (en) * | 2020-06-05 | 2021-12-09 | Theraly Fibrosis, Inc. | Trail compositions with reduced immunogenicity |
CN114437184A (en) * | 2021-08-16 | 2022-05-06 | 中国科学院微生物研究所 | Polypeptide for resisting novel coronavirus and application thereof |
WO2022213076A1 (en) * | 2021-03-30 | 2022-10-06 | Baylor College Of Medicine | Methods and compositions for high-potency polypeptide-based protein inhibition |
US11479582B2 (en) | 2020-10-16 | 2022-10-25 | King Faisal University | Anti-SARS-CoV-2 fusion peptides |
WO2022227702A1 (en) * | 2021-04-28 | 2022-11-03 | 苏州大学 | Preparation method for interfering peptide targeting sars-cov-2 n protein and application thereof |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN107022008B (en) * | 2016-01-30 | 2021-04-23 | 山西锦波生物医药股份有限公司 | Polypeptide for broad-spectrum inhibition of human coronavirus infection and application thereof |
-
2004
- 2004-04-12 EP EP04750008A patent/EP1615610A2/en not_active Withdrawn
- 2004-04-12 CA CA002522329A patent/CA2522329A1/en not_active Abandoned
- 2004-04-12 WO PCT/US2004/011210 patent/WO2005002500A2/en not_active Application Discontinuation
Non-Patent Citations (4)
Title |
---|
BOSCH ET AL.: 'Severe acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition spike protein heptad-derived peptides' PNAS vol. 101, no. 22, June 2004, pages 8455 - 8460, XP002994902 * |
VEIGA ET AL.: 'Why are HIV-1 fusion inhibitors nor effective against SARS-CoV?Biophysical evaluation of molecular interactions. Biochimica et Biophysica Acta' BIOCHIMICA ET BIOPHYSICA ACTA vol. 1760, no. 55, 2006, pages 55 - 61, XP005213847 * |
YUAN ET AL.: 'Suppression of Sars-CoV entry by peptides corresponding to heptad regions on spike glycoprotein' BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS vol. 319, 2004, pages 746 - 752, XP004512502 * |
ZHU ET AL.: 'Following the rule: formation of the 6-helix bundle of the fusion core from severe acute respiratory syndrome coronavirus spike protein and identification of potent peptide inhibitors' BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS vol. 319, 2004, pages 283 - 288, XP004509880 * |
Cited By (16)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005063801A3 (en) * | 2003-12-30 | 2005-09-29 | Univ Utrecht Holding Bv | Method for decreasing the contact between hepta-repeat region s of the corona-virus spike proteins and use thereof |
WO2005063801A2 (en) * | 2003-12-30 | 2005-07-14 | Universiteit Utrecht Holding B.V. | Method for decreasing the contact between hepta-repeat region s of the corona-virus spike proteins and use thereof |
WO2015143335A1 (en) * | 2014-03-20 | 2015-09-24 | The University Of North Carolina At Chapel Hill | Methods and compositions for chimeric coronavirus spike proteins |
US9884895B2 (en) | 2014-03-20 | 2018-02-06 | The University Of North Carolina At Chapel Hill | Methods and compositions for chimeric coronavirus spike proteins |
WO2021183463A1 (en) * | 2020-03-09 | 2021-09-16 | President And Fellows Of Harvard College | Compositions and methods for treating coronavirus |
CN111349150A (en) * | 2020-03-24 | 2020-06-30 | 北京中科微盾生物科技有限责任公司 | Polypeptide for inhibiting novel coronavirus and application thereof |
CN111349150B (en) * | 2020-03-24 | 2021-02-09 | 北京中科微盾生物科技有限责任公司 | Polypeptide for inhibiting novel coronavirus and application thereof |
CN111471088A (en) * | 2020-04-21 | 2020-07-31 | 北京中科微盾生物科技有限责任公司 | Polypeptide for inhibiting SARS-COV-2 infection, composition and use thereof |
US20210380653A1 (en) * | 2020-06-05 | 2021-12-09 | Theraly Fibrosis, Inc. | Trail compositions with reduced immunogenicity |
US11767353B2 (en) * | 2020-06-05 | 2023-09-26 | Theraly Fibrosis, Inc. | Trail compositions with reduced immunogenicity |
CN112538105A (en) * | 2020-06-29 | 2021-03-23 | 斯克里普斯研究院 | Stable coronavirus spike (S) protein antigens and related vaccines |
CN112538105B (en) * | 2020-06-29 | 2022-04-12 | 斯克里普斯研究院 | Stable coronavirus spike (S) protein antigens and related vaccines |
US11479582B2 (en) | 2020-10-16 | 2022-10-25 | King Faisal University | Anti-SARS-CoV-2 fusion peptides |
WO2022213076A1 (en) * | 2021-03-30 | 2022-10-06 | Baylor College Of Medicine | Methods and compositions for high-potency polypeptide-based protein inhibition |
WO2022227702A1 (en) * | 2021-04-28 | 2022-11-03 | 苏州大学 | Preparation method for interfering peptide targeting sars-cov-2 n protein and application thereof |
CN114437184A (en) * | 2021-08-16 | 2022-05-06 | 中国科学院微生物研究所 | Polypeptide for resisting novel coronavirus and application thereof |
Also Published As
Publication number | Publication date |
---|---|
EP1615610A2 (en) | 2006-01-18 |
WO2005002500A3 (en) | 2006-10-05 |
CA2522329A1 (en) | 2005-01-13 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11229694B2 (en) | Vaccine against RSV | |
TWI341844B (en) | Hiv fusion inhibitor peptides with improved biological properties | |
Tian et al. | Structure− affinity relationships in the gp41 ELDKWA epitope for the HIV‐1 neutralizing monoclonal antibody 2F5: effects of side‐chain and backbone modifications and conformational constraints | |
EP2566493B1 (en) | Bifunctional molecules for inactivating hiv and blocking hiv | |
Al-Azzam et al. | Peptides to combat viral infectious diseases | |
EP1797112B1 (en) | Inhibitors of hepatitits c virus | |
US20230330238A1 (en) | Chimeric conjugates for degradation of viral and host proteins and methods of use | |
JP3604384B2 (en) | Anti-feline immunodeficiency virus (FIV) vaccine | |
WO2010045613A1 (en) | Immunoenhancer-linked oligomeric hiv vaccines | |
WO2005002500A2 (en) | Inhibitors of coronavirus | |
JP2015521592A (en) | Stabilized gp120 | |
WO2021200800A1 (en) | Vaccine for preventing or treating coronavirus infection or symptoms associated with coronavirus infection | |
WO1994016109A1 (en) | Membrane fusion events and means for altering same | |
WO1995031999A1 (en) | Compositions of transactivating proteins of human immunodeficiency virus | |
KR20220017919A (en) | Adjuvants based on peptide nucleic acids | |
US20030219451A1 (en) | Stable helical C peptides and uses therefor | |
WO2005062871A2 (en) | Tat linear epitope peptides and conjugates thereof for use in therapeutic compositions and assays |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): BW GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
WWE | Wipo information: entry into national phase |
Ref document number: 2004750008 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2522329 Country of ref document: CA |
|
WWP | Wipo information: published in national office |
Ref document number: 2004750008 Country of ref document: EP |
|
WWW | Wipo information: withdrawn in national office |
Ref document number: 2004750008 Country of ref document: EP |