WO2004081028A2 - Allergen peptide fragments and use thereof - Google Patents
Allergen peptide fragments and use thereof Download PDFInfo
- Publication number
- WO2004081028A2 WO2004081028A2 PCT/IB2004/001300 IB2004001300W WO2004081028A2 WO 2004081028 A2 WO2004081028 A2 WO 2004081028A2 IB 2004001300 W IB2004001300 W IB 2004001300W WO 2004081028 A2 WO2004081028 A2 WO 2004081028A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- allergen
- seq
- peptide fragments
- amino acid
- overlapping peptide
- Prior art date
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/168—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/35—Allergens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/02—Nasal agents, e.g. decongestants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
- C07K14/43513—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from arachnidae
- C07K14/43531—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from arachnidae from mites
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
- C07K14/43563—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from insects
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
- C07K14/43563—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from insects
- C07K14/43572—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from insects from bees
Definitions
- the present invention relates generally to in vivo methods and compositions designed for allergen-specific immunotherapy.
- the compositions include contiguous overlapping peptide fragments which together comprise the entire amino acid sequence of an allergen.
- IgE-mediated allergies represent a major health problem in the industrialized world.
- the immediate symptoms of the disease e.g. allergic rhinoconjunctivitis, dermatitis, bronchial asthma, anaphylactic shock
- allergens which leads to the release of biological mediators such as histamine or leukotrienes.
- an allergen In order to induce strong effector cell activation, and thus inflammatory responses, an allergen must be able to cross-link effector cell-bound IgE antibodies efficiently.
- Allergy immunotherapy is a treatment that involves injections of small amounts of the allergens to which a person is allergic. Over time, the concentration of the injections is increased, which leads to the production of blocking antibodies (called IgG antibodies, mainly IgG4 antibodies in humans) and a decrease in the level of allergic antibodies (IgE antibodies). In this way immunity is developed (e.g., a person may require allergy immunotherapy against grass, weed and tree pollens, house dust mites, cat and dog dander and insect stings).
- the invention provides a composition containing a plurality of contiguous overlapping peptide fragments (SEQ ID NOs: 1, 2 and 3) which together comprise the entire amino acid sequence of a bee venom allergen (SEQ ID NO: 4), wherein the fragments are capable of inducing a T cell response in patients who are hypersensitive to the allergen.
- the invention provides a composition containing a plurality of contiguous overlapping peptide fragments (SEQ ID NOs: 5 and 6) which together comprise the entire amino acid sequence of a birch pollen allergen (SEQ ID NO: 7), wherein the fragments are capable of inducing a T cell response in patients who are hypersensitive to the allergen.
- the invention provides a composition containing a plurality of contiguous overlapping peptide fragments (SEQ ID NOs: 8 and 9) which together comprise the entire amino acid sequence of a birch pollen profilin allergen (SEQ ID NO: 10), wherein the fragments are capable of inducing a T cell response in patients who are hypersensitive to the allergen.
- the invention provides a composition containing a plurality of contiguous overlapping peptide fragments (SEQ ID NOs: 11, 12 and 13) which together comprise the entire amino acid sequence of a dust mite allergen (SEQ ID NO: 14), wherein the fragments are capable of inducing a T cell response in patients who are hypersensitive to the allergen.
- the invention provides a composition containing a plurality of contiguous overlapping peptide fragments (SEQ ID NOs: 15 and 16) which together comprise the entire amino acid sequence of a dust mite allergen (SEQ ID NO: 17), wherein the fragments are capable of inducing a T cell response in patients who are hypersensitive to the allergen.
- the invention provides a composition containing a plurality of contiguous overlapping peptide fragments (SEQ ID NOs: 5 and 8) which together comprise the entire amino acid sequence of a chimeric birch pollen allergen (SEQ ID NO: 18), wherein the fragments are capable of inducing a T cell response in patients who are hypersensitive to the allergen.
- the invention provides a composition containing a plurality of contiguous overlapping peptide fragments (SEQ ID NOs: 9 and 6) which together comprise the entire amino acid sequence of a chimeric birch pollen allergen (SEQ ID NO: 19), wherein the fragments are capable of inducing a T cell response in patients who are hypersensitive to the allergen.
- the invention provides a composition containing a plurality of contiguous overlapping peptide fragments (SEQ ID NOs: 8 and 5) which together comprise the entire amino acid sequence of a chimeric birch pollen allergen (SEQ ID NO: 20), wherein the fragments are capable of inducing a T cell response in patients who are hypersensitive to the allergen.
- the invention provides a composition containing a plurality of contiguous overlapping peptide fragments (SEQ ID NOs: 6 and 9) which together compxise the entire amino acid sequence of a chimeric birch pollen allergen (SEQ ID NO: 21), whierein the fragments are capable of inducing a T cell response in patients who are hypersensitive to the allergen.
- the invention provides a composition containing a plurality of contiguous overlapping peptide fragments (SEQ ID NOs: 15 and 11) which together comprise the entire amino acid sequence of a chimeric dust mite allergen (SEQ ID NO: 22), wherein the fragments are capable of inducing a T cell response in patients who are hypersensitive to the allergen.
- the invention provides a composition containing a plurality of contiguous overlapping peptide fragments (SEQ ID NOs: 13 and 16) which together comprise the entire amino acid sequence of a chimeric dust mite allergen (SEQ ID NO: 23), wherein the fragments are capable of inducing a T cell response in patients who are hypersensitive to the allergen.
- administration of the compositions of the invention results in lower levels of IgE stimulation activity. More preferably, administration results in weak or zero IgE stimulation activity (e.g. weak IgE binding or no IgE binding).
- weak IgE binding refers to IgE production and/or cross-linking that is less than the amount of IgE production and/or IL-4 production stimulated by the whole protein allergen.
- the compositions of the invention do not induce immediate skin reactivity (wheal ⁇ 5 mm with no flare) when injected intradermally at a concentration ⁇ 1 ⁇ g/ml.
- administration of the compositions of the invention results in a decrease in T cell response upon subsequent exposure to the protein allergen, thereby modulating an immune response of a patient against the protein allergen.
- the invention provides in vivo methods of determining the dose of composition needed to desensitize a patient to a specific allergen by introducing a series of compositions containing varying concentrations of a plurality of contiguous overlapping peptide fragments, which together comprise the entire amino acid sequence of the aller en, into the skin of the patient, wherein the fragments are capable of inducing a T cell response in patients who are hypersensitive to the allergen, further wherein said overlapping peptide fragments do not bind or weakly bind IgE; introducing a positive-control and a negative- control into the skin of the patient; checking for development of a wheal or flare at the introduction site; and comparing the size of the papule ( ⁇ 5 mm) and flare produced by the varying concentrations of a plurality of contiguous overlapping peptide fragments to the positive-control and negative-control, thereby determining the dose of composition needed to desensitize the patient to the specific allergen.
- each peptide of the plurality of contiguous overlapping peptide fragments can be 30-90 amino acids in length, e.g., 30, 35, 40, 45, 50, 55, 60, 65, 70, 73, 75, 80, 81, 85, 86 and 90 amino acids in length.
- the amino acid sequences of contiguous overlapping peptide fragments in the plurality overlap by about 10 to about 15 amino acids, e.g., 10, 1 1, 12, 13, 14 and 15 amino acids.
- the methods of the invention are useful in treating a number of different allergies to various allergens.
- the allergens include, but are not limited to, plant pollens, grass pollens, tree pollens, weed pollens, insect venom, dust mite proteins, animal dander, saliva, fungal spores and food allergens (i.e., peanut, milk, gluten and egg).
- the allergen is insect venom.
- the insect venom is bee venom.
- the plurality of contiguous overlapping peptide fragments may include SEQ ID NOs: 1, 2, and 3, which comprise the entire amino acid sequence of the major bee venom allergen (SEQ ID NO: 4).
- the allergen is tree pollen.
- the tree pollen is birch pollen.
- the plurality of contiguous overlapping peptide fragments may include SEQ ID NOs: 5 and 6, which comprise the entire amino acid sequence of the major birch pollen allergen (SEQ ID NO: 7).
- the plurality of contiguous overlapping peptide fragments may include SEQ ID NOs: 8 and 9, which comprise the entire amino acid sequence of birch pollen profilin allergen (SEQ ID NO: 10).
- the allergen is dust mite proteins.
- the plurality of contiguous overlapping peptide fragments may include SEQ ID NOs: 11, 12, and 13, which comprise the entire amino acid sequence of the dust mite allergen D. pteronyssinus 1 (SEQ ID NO: 14).
- the plurality of contiguous overlapping peptide fragments may include SEQ ID NOs: 15 and 16, which comprise the entire amino acid sequence of the dust mite allergen D. pteronyssinus 2 (SEQ ID NO: 17).
- the plurality of contiguous overlapping peptide fragments may include at least two contiguous overlapping peptide fragments selected from the group consisting of SEQ ID NOs: 1, 2, 3, 5, 6, 8, 9, 11, 12, 13, 15 and 16.
- the introducing is done by skin prick, intradermal or subcutaneous injection. Those skilled in the art will recognize that any means of introducing can be employed.
- the varying concentrations of contiguous overlapping peptide fragments is from a concentration of about 0.001 ⁇ g/ml to about 100 ⁇ g/ml. In preferred embodiments, the concentration of contiguous overlapping peptide fragments are between 0.001-10.0, 0.01-10.0, or 0.1-1.0 ⁇ g/ml.
- the invention provides in vivo methods of inducing tolerance in a patient allergic to a specific allergen by introducing a plurality of contiguous overlapping peptide fragments which together form an entire amino acid sequence of the allergen into the skin of the patient, wherein the fragments are capable of inducing a T cell response in patients who are hypersensitive to the allergen, further wherein said overlapping peptide fragments do not bind or weakly bind IgE; and creating antibodies to the allergen, thereby building immunity to the allergen, wherein the immunity leads to tolerance of the allergen in the patient.
- the patient is selected from the group consisting of humans, dogs, cats, pigs, horses, rats and mice. In one preferred embodiment, the patient is a human.
- the antibodies created to the allergen are IgG antibodies. More preferably, the IgG antibodies are IgG4 antibodies.
- each peptide of the plurality of contiguous overlapping peptide fragments can be 30-90 amino acids in length, e.g., 30, 35, 40, 45, 50, 55, 60, 65, 70, 73, 75, 80, 81, 85, 86 and 90 amino acids in length.
- the amino acid sequences of contiguous overlapping peptide fragments in the plurality overlap by about 10 to about 15 amino acids, e.g., 10, 11, 12, 13, 14 and 15 amino acids.
- the varying concentrations of contiguous overlapping peptide fragments is from a concentration of about 0.001 ⁇ g/ml to about 1000 ⁇ g/ml. In preferred embodiments, the concentration of contiguous overlapping peptide fragments are between 0.001-100.0, 0.01-10.0, or 0.1-1.0 ⁇ g/ml.
- the methods of the invention are useful in treating a number of different allergies to various allergens.
- the allergens include, but are not limited to, plant pollens, grass pollens, tree pollens, weed pollens, insect venom, dust mite proteins, animal dander, saliva, fungal spores and food allergens (i.e., peanut, milk, gluten and egg).
- the allergen is insect venom.
- the insect venom is bee venom.
- the plurality of contiguous overlapping peptide fragments may include SEQ ID NOs: 1, 2, and 3, which comprise the entire amino acid sequence of the major bee venom allergen (SEQ ID NO: 4).
- the allergen is tree pollen.
- the tree pollen is birch pollen.
- the plurality of contiguous overlapping peptide fragments may include SEQ ID NOs: 5 and 6, which comprise the entire amino acid sequence of the major birch pollen allergen (SEQ ID NO: 7).
- the plurality of contiguous overlapping peptide fragments may include SEQ ID NOs: 8 and 9, which comprise the entire amino acid sequence of birch pollen profilin allergen (SEQ ID NO: 10).
- the allergen is dust mite proteins.
- the plurality of contiguous overlapping peptide fragments may include SEQ ID NOs: 11, 12, and 13, which comprise the entire amino acid sequence of the dust mite allergen D.
- the plurality of contiguous overlapping peptide fragments may include SEQ ID NOs: 15 and 16, which comprise the entire amino acid sequence of the dust mite allergen D. pteronyssinus 2 (SEQ ID NO: 17).
- the plurality of contiguous overlapping peptide fragments may include at least two contiguous overlapping peptide fragments selected from the group consisting of SEQ ID NOs: 1, 2, 3, 5, 6, 8, 9, 11, 12, 13, 15 and 16.
- the methods of the invention do not induce immediate skin reactivity (wheal ⁇ 5 mm with no flare) when injected intradermally at a concentration ⁇ 1 ⁇ g/ml.
- the introducing is done by parenteral, e.g., skin prick, intravenous, intradermal, subcutaneous, oral, nasal, mucosal (e.g., inhalation), transdermal (topical), transmucosal, lymph node and rectal administration.
- parenteral e.g., skin prick, intravenous, intradermal, subcutaneous, oral, nasal, mucosal (e.g., inhalation), transdermal (topical), transmucosal, lymph node and rectal administration.
- FIG. 1 is a graph showing PLA derived overlapping peptide therapy induces specific T cell anergy in bee venom hypersensitive patients. Hatched columns: peptide-treated group, open columns: control group (treated with albumin). Results are presented as plot-boxes and whiskers with successive percentiles 5, 25, 50, 75, 95. Medians are indicated by thick bars.
- FIG. 2 is a series of graphs showing overlapping peptide therapy deviates T cell cytokine response and strongly stimulates IL-10 secretion.
- Cytokines panel A: IL-4; panel B: IFN- ⁇ ; panel C: IL-10) from supernatants of short term T cell lines were measured by ELISA in cell supernatant. Results are presented as plot-boxes and whiskers with successive percentiles 5, 25, 50, 75, 95. Medians are indicated by thick bars.
- FIG. 3 is a series of graphs showing anti-PLA 2 specific serum IgE.
- Anti-PLA 2 specific serum IgE were measured in peptide-treated group (panel A) and in control group (panel B) at the indicated time-points. Median values are indicated by thick bars.
- FIG. 4 is a series of graphs showing anti-PL A . specific serum IgG4. Anti-PLA 2 specific serum IgG4 were measured in peptide-treated group (panel A) and in control group (panel B) at the indicated time-points. Median values are indicated by thick bars.
- FIG. 5 is a photograph showing absence of immediate allergic reaction to overlapping peptide fragments. A representative patient from the peptide group was injected intradermally with, respectively from left to right, 0.01 ⁇ g/ml native PLA 2 , 1 ⁇ g/ml of each of the three synthetic peptide fragments OPF ⁇ -60 , OPF 7-99 and OPF 0- ⁇ 34 separately and with a mixture of them (1 ⁇ g/ml each) (arrows).
- FIG. 6 is a series of graphs showing intradermal skin tests with peptides and native PLA 2 . Results are expressed as end-point concentrations (log 10 scale) at enrollment into the study (day 0) and after the last injection at day 70 in patients from peptide group (panels A, B) and control group (panels C, D), tested respectively with the three overlapping peptide fragments (as a mixture) (panels A, C) and with native PLA 2 (panels B, D).
- FIG. 7 is a series of graphs showing in vitro IgE binding to whole BV and native PLA (panels A, B) and to overlapping peptide fragments OPF ⁇ -60 , OPF 4 - and OPF 0-134 (panels C, D, E respectively), analyzed by dot blot assays after each injection. Results are expressed as absorbance arbitrary units. Open columns: control group; hatched columns: peptide group.
- the invention is based, in part, on the discovery that a plurality of contiguous overlapping peptide fragments can be used for allergen specific immunotherapy.
- the use of a plurality of contiguous overlapping peptide fragments for allergen immunotherapy induces both humoral and cellular responses comparable to native allergen rush immunotherapy.
- Advantages of using the plurality of contiguous overlapping peptide fragments of the invention include, but are not limited to, their ability to induce a T helper cell response in hypersensitive patients due to the fact that they contain all possible T cell epitopes; their ability to efficiently recruit specific T cells, leading to a modulation of the immune response to allergens; and their ability to display low IgE binding activity (they are hypoallergenic).
- the plurality of contiguous overlapping peptide fragments of the invention display 2004/081028
- the ability of a plurality of contiguous overlapping peptide fragments to induce a T helper cell response in hypersensitive patients may be due to the fact that the amino acid sequence of contiguous overlapping peptide fragments in the plurality overlap by about 10 to about 15 amino acids, , e.g., 10, 11, 12, 13, 14 and 15 amino acids and cover multiple T cell epitopes. Therefore these combinations of peptides do not require T cell epitope customization to fit with each patient's major histocompatibility complex (MHC) molecules (HLA restriction).
- MHC major histocompatibility complex
- the ability of contiguous overlapping peptide fragments to display low IgE binding activity may be due to the fact that the contiguous overlapping peptide fragments are linear and are unable to crosslink with IgE antibodies.
- One important application of the invention is to the problem of allergies to foods or materials in the surroundings. Millions of individuals are subjected to severe symptomatology in response to otherwise harmless components of the environment, for example, ragweed or other pollens.
- the method of the invention can prevent or diminish this immune response which results in widespread discomfort.
- human leukocyte antigen and HLA is here defined as a genetic fingerprint on white blood cells and platelets, composed of proteins that play a critical role in activating the body's immune system to respond to foreign organisms.
- plurality of contiguous overlapping peptide fragments OPF is here defined as at least one, but most likely two, three, four, or five, contiguous overlapping peptide fragments.
- MNOPQRSTUV OPF 13 . 22
- TUVWXYZ OPF 20 .26
- hyposensitive is here defined as abnormally susceptible physiologically to a specific agent via IgE-mediated mechanisms (as an antigen or drug). Such antigen is in the present specification and claims called an allergen.
- hyposensitive is here defined as not being sensitive to a specific agent (as an antigen or drug). Such antigen is in the present specification and claims called an allergen.
- the terms “desensitize”, “immunological tolerance” or “tolerance” are here defined as to make (a sensitized or hypersensitive individual) insensitive or nonreactive to a sensitizing agent (as an antigen or drug) by a reduction in immunological reactivity of a host towards specific tolerated antigen(s).
- allergen is in the present specification and claims called an allergen.
- positive-control is here defined as a native allergen that when applied to the skin will produce a positive reaction i.e.
- negative-control is here defined as a composition that when applied to the skin, should not produce, at 15 minutes, a response with a flare > 5 mm when the injected volume of solution (50 ⁇ l) produces spontaneously a papule of 5 mm.
- Negative-controls include OPF diluent, albumin solution or saline (salt-water) solution.
- papule is here defined as a small circumscribed, superficial, solid elevation of the skin. When related to allergens, it is usually measured by a wheal and flare reaction which is an outward spreading zone of reddening flare followed rapidly by a wheal (swelling) at the site of introduction of the allergen.
- wheal and flare reaction is an outward spreading zone of reddening flare followed rapidly by a wheal (swelling) at the site of introduction of the allergen.
- erythema is here defined as redness of the skin produced by congestion of the capillaries, which may result from a variety of causes.
- isolated or purified peptide fragments or biologically active portion thereof is substantially free of material (e.g., other, contaminating proteins) from the cell suspension, tissue source, or serum preparation from which the allergen peptide fragments are derived, or substantially free from chemical precursors or other chemicals when chemically synthesized.
- material e.g., other, contaminating proteins
- substantially free of other material includes preparations of the allergen-derived peptide fragments in which the peptide fragments are separated from cellular components of the cells from which it is isolated or recombinantly produced.
- the peptide fragments having less than about 30% (by dry weight) of non-allergen protein (also referred to herein as a "contaminating protein"), more preferably less than about 20% of non-allergen protein, still more preferably less than about 10% of non-allergen protein, and most preferably less than about 5% non-allergen protein.
- non-allergen protein also referred to herein as a "contaminating protein”
- the allergen-derived peptide fragments are recombinantly produced, it is also preferably substantially free of culture medium, . e. , culture medium represents less than about 20%, more preferably less than about 10%, and most preferably less than about 5% of the volume of the overlapping peptides preparation.
- the language “substantially free of chemical precursors or other chemicals” includes preparations of the allergen-derived peptide fragments in which the peptide fragments are separated from chemical precursors or other chemicals which are involved in the synthesis of the protein.
- the language “substantially free of chemical precursors or other chemicals” includes preparations of the allergen-derived peptide fragments having less than about 30% (by dry weight) of chemical precursors or non-allergen chemicals, more preferably less than about 20% chemical precursors or non-allergen chemicals, still more preferably less than about 10% chemical precursors or non-allergen chemicals, and most preferably less than about 5% chemical precursors or non-allergen chemicals.
- Manipulations of the sequences included within the scope of the invention may be made at the peptide level. Included within the scope of the present invention are peptide fragments (derivative or analog thereof) that are modified during or after translation or synthesis (e.g., by glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to an antibody molecule or other cellular ligand, and the like).
- any of the numerous chemical modification methods known within the art may be utilized including, but not limited to, specific chemical cleavage by cyanogen bromide, trypsin, chymotrypsin, papain, V8 protease, NaBH 4 , acetylation, formylation, oxidation, reduction, metabolic synthesis in the presence of tunicamycin, etc.
- sequences of a peptide are modified to include a fluorescent label
- Allergen-derived peptide fragments, analogs, derivatives, and variants thereof can be chemically synthesized.
- a peptide fragment corresponding to a portion of an allergen protein that includes a desired domain or that mediates a desired activity in vitro may be synthesized by use of a peptide synthesizer.
- the amino acid sequence of a protein isolated from the natural source may be determined, e.g., by direct sequencing of the isolated protein.
- the protein may also be analyzed by hydrophilicity analysis (see, Hopp and Woods, PNAS USA 78:3824, 1981) which can be used to identify the hydrophobic and hydrophilic regions of the protein, thus aiding in the design of peptides for experimental manipulation, such as in binding experiments, antibody synthesis, etc. Secondary structural analysis may also be performed to identify regions of a peptide that adopt specific structural motifs. (See, Chou and Fasman, Biochem, 13:222, 1974). Manipulation, translation, secondary structure prediction, hydrophilicity and hydrophobicity profiles, open reading frame prediction and plotting, and determination of sequence homologies, can be accomplished using computer software programs available in the art.
- the peptide fragments, derivatives and other variants described herein, can be modified.
- the invention includes, e.g., myristylated, glycosylated, palmitoylated and phosphorylated peptides and their derivatives.
- Conservative amino acid substitutions can be made in the peptide fragments at one or more predicted non-essential amino acid residues.
- a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g.
- lysine, arginine, histidine acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proiine, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g. , tyrosine, phenylalanine, tryptophan, histidine).
- acidic side chains e.g., aspartic acid, glutamic acid
- uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine
- a predicted non-essential amino acid residue in the allergen-derived fragment is preferably replaced with another amino acid residue from the same side chain family.
- mutations can be introduced randomly along all or part of the allergen coding sequence, to identify mutants that retain T cell stimulating activity but have lower or reduced/weak levels of IgE stimulating activity.
- a mutant allergen peptide fragment can be assayed for (1) the ability to stimulate or induce T cell proliferation or (2) the ability, or lack of, to bind IgE antibodies from, e.g., the sera of an individual hypersensitive to the allergen.
- the terms "stimulate” or “induce” are used interchangeably herein.
- a peptide fragment or combination of overlapping peptide fragments derived from a protein allergen can be tested to determine whether the peptide will produce local or systemic symptoms that are related to a Type I reaction.
- This reaction involves the interaction of antigen with antibody of the immunoglobulin class IgE, which attaches to the host cells in the skin and other tissues (mast cells, basophils, platelets, and eosinophils).
- An antigen encounter results in release of the cell contents, including active molecules such as histamine, heparin, serotonin, and other vasoactive substances, producing local or systemic symptoms that are manifest within minutes to a few hours following antigen-IgE interaction.
- T cell stimulating activity can be tested by culturing T cells obtained from an individual sensitive to the allergen proteins and variants described herein (i.e., an individual who has an immune response to the protein allergen or protein antigen) with an allergen protein or variant and determining the presence or absence of proliferation by the T cells in response to the peptide as measured by, for example, incorporation of tritiated thymidine.
- Stimulation indices for responses by T cells to peptides useful in methods of the invention can be calculated as the maximum counts per minute (cpm) incorporated in response to the peptide divided by the cpm of the control medium.
- a peptide derived from a protein allergen may have a stimulation index of about 2.0.
- a stimulation index of at least 2.0 is generally considered positive for purposes of defining peptides useful as immunotherapeutic agents.
- Preferred peptides or fragments or combinations of overlapping fragments have a stimulation index of at least 2.5, more preferably at least 3.5 and most preferably at least 5.0.
- the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second amino or nucleic acid sequence).
- the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
- a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are homologous at that position (i.e., as used herein amino acid or nucleic acid "homology” is equivalent to amino acid or nucleic acid "identity").
- the percent homology between the two sequences is a function of the number of identical positions shared by the sequences (i.e. , percent homology equals the number of identical positions divided by the total number of positions times 100).
- a specific allergen "chimeric protein” or “fusion protein” comprises, an allergen polypeptide operatively linked to a non-allergen polypeptide.
- An " allergen polypeptide” refers to a polypeptide having an amino acid sequence corresponding to a specific allergen
- a “non-allergen polypeptide” refers to a polypeptide having an amino acid sequence corresponding to a protein which is not substantially homologous to the specific allergen, e.g., a protein which is different from the allergen and which is derived from the same or a different organism.
- the allergen polypeptide can correspond to all or a portion of a specific allergen protein.
- a specific allergen fusion protein comprises at least one biologically active portion of the specific allergen.
- the non-allergen polypeptide can be fused to the N-terminus or C-tertninus of the allergen polypeptide.
- compositions suitable for administration can be incorporated into compositions suitable for administration.
- Such compositions typically include the contiguous overlapping peptide fragments and a pharmaceutically acceptable carrier.
- pharmaceutically acceptable carrier refers to a carrier that does not cause an allergic reaction or other untoward effect in subjects to whom it is administered.
- Suitable pharmaceutically acceptable carriers include, for example, water, saline, phosphate buffered saline, dextrose, glycerol, ethanol, or the like, and combinations thereof.
- the composition can contain minor amounts of auxiliary substances such as wetting or emulsifying agents, and/or pH buffering agents which enhance the effectiveness of the vaccine. Attention is directed to Remington's
- Immunostimulatory adjuvants are predominantly derived from pathogens, e.g., lipopolysaccharide (LPS) and monophosphoryl lipid A (MPL), which activate cells of the immune system.
- pathogens e.g., lipopolysaccharide (LPS) and monophosphoryl lipid A (MPL)
- LPS lipopolysaccharide
- MPL monophosphoryl lipid A
- Bacterial CpG motifs in DNA have direct immunostimulatory effects on immune cells in vitro, the immunostimulatory effect is due to the presence of unmethylated CpG dinucleotides, which are under-represented and are methylated in vertebrate DNA. Unmethylated CpGs in the context of selective flanking sequences are thought to be recognized by cells of the immune system to allow discrimination of pathogen-derived DNA from self DNA.
- CpG motifs are most potent for the induction of Thl responses, mainly through stimulating TNF ⁇ , IL-1, IL-6 and IL-12, and through the expression of co-stimulatory molecules.
- CpGs also appear to have significant potential as mucosally administered adjuvants.
- CpGs also appear to have significant potential for the modulation of existing immune responses, which may be useful in various clinical settings, including allergies.
- O'Hagan et al Biomolecular Engineering, 18:69-85, 2001; Singh and O'Hagan, Nature Biotechnology, 17:1075-1081, 1999.
- the use of such media and agents for pharmaceutically active substances is well known in the art.
- compositions Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions. As used herein, the phrases 'composition' and 'therapeutic composition' are interchangeable.
- compositions containing the contiguous overlapping allergen peptide fragments, or variants thereof can be administered to a patient (such as a human) sensitive to the specific allergen in a form which results in a decrease in the T cell response of the mammal upon subsequent exposure to the protein allergen.
- a decrease or modification of the T cell response of a mammal sensitive to a protein allergen is defined as non-responsiveness or diminution in symptoms to the protein allergen in the patient, as determined by standard clinical procedures (see, Varney et al, British Medical Journal, 302: 265, 1990), including diminution in allergen induced asthmatic conditions.
- a diminution in symptoms to an allergen includes any reduction in the allergic response of a patient, such as a human, to the allergen following a treatment regimen with a composition as described herein.
- This diminution in symptoms may be determined subjectively in a human (e.g., the patient feels more comfortable upon exposure to the allergen), or clinically, such as with a standard skin test or provocation assay.
- administration of the above-described contiguous overlapping allergen peptide fragments or their variants may result in lower levels of IgE stimulation activity.
- administration results in weak IgE stimulating activity. More preferably, administration results in zero IgE stimulating activity.
- weak IgE stimulating activity refers to IgE production and/or cross-linking that is less than the amount of IgE production and/or IL-4 production stimulated by the whole protein allergen.
- compositions of the present invention to desensitize or tolerize an individual to a protein allergen or other protein antigen can be carried out using procedures, at dosages and for periods of time effective to reduce sensitivity (i.e., to reduce the allergic response) of the individual to a protein allergen or other protein antigen.
- Effective amounts of the compositions will vary according to factors such as the degree of sensitivity of the individual to the protein allergen, the age, sex, and weight of the individual, and the ability of the peptide(s) to elicit a tollerogenic response in the individual.
- Dosage regimens may be adjusted to provide the optimum therapeutic response. For example, several divided doses may be administered daily or the dose may be proportionally reduced as indicated by the exigencies of the therapeutic situation.
- a composition of the invention is formulated to be compatible with its intended route of administration.
- routes of administration include parenteral, e.g., skin prick, intravenous, intradermal, subcutaneous, oral, nasal, mucosal (e.g., inhalation), transderrnal (topical), transmucosal, lymph node and rectal administration.
- Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of toxicity such as sodium chloride or dextrose.
- the pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
- the parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
- Administration e.g., subcutaneous administration, of an allergen-derived overlapping peptide or variant peptides as described herein to a patient, such as a human, can tolerize or anergize appropriate T cell subpopulations such that they become unresponsive to the protein allergen and do not participate in stimulating an immune response upon subsequent exposure.
- administration of such a peptide may modify the lymphokine secretion profile as compared with exposure to the naturally-occurring protein allergen or portion thereof (e.g., result in a decrease of IL-4 and/or an increase in IL-10, TGF ⁇ , and IFN- ⁇ ).
- compositions suitable for injectable use include sterile aqueous solutions (where the peptides or protein are water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
- suitable carriers include physiological saline, bacteriostatic water, Cremophor ELTM (BASF, Parsippany, N. J.) or phosphate buffered saline (PBS).
- the composition must be sterile and should be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
- the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
- isotonic agents for example, sugars, polyalcohols such as manitol, sorbitol, sodium chloride in the composition.
- Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
- Sterile injectable solutions can be prepared by incorporating the active compound
- dispersions are prepared by incorporating the active compound into a sterile vehicle which contains a basic dispersion medium and the required other ingredients from those enumerated above.
- sterile powders for the preparation of sterile injectable solutions the preferred methods of preparation are vacuum drying and freeze-drying which yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For the purpose of oral therapeutic administration, the active compound can be incorporated with excipients and used in the form of tablets, troches, or capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed. Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition.
- the tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
- a binder such as microcrystalline cellulose, gum tragacanth or gelatin
- an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch
- a lubricant such as magnesium stearate or Sterotes
- a glidant such as colloidal silicon dioxide
- the compounds are delivered in the form of an aerosol spray from pressured container or dispenser which contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
- a suitable propellant e.g., a gas such as carbon dioxide, or a nebulizer.
- Systemic administration can also be by transmucosal or transdermal means.
- penetrants appropriate to the barrier to be permeated are used in the formulation.
- penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives.
- Transmucosal administration can be accomplished through the use of nasal sprays or suppositories.
- the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art.
- the compounds can also be prepared in the form of suppositories (e.g., with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
- the active compounds are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems.
- Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art.
- the materials can also be obtained commercially from Alza Corporation and Nova Pharmaceuticals, Inc.
- Liposomal suspensions can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in U.S. Pat. No. 4,522,811.
- Dosage unit form refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.
- the compositions can be included in a container, pack, or dispenser together with instructions for administration.
- a modified peptide can be produced in which the amino acid sequence has been altered, such as by amino acid substitution, deletion, or addition, to modify immunogenicity and/or reduce allergenicity, or to which a component has been added for the same purpose.
- the amino acid residues essential to T cell epitope function can be determined using known techniques (e.g., substitution of each residue and determination of presence or absence of T cell reactivity).
- residues shown to be essential can be modified (e.g., replaced by another amino acid whose presence is shown to enhance T cell reactivity), as can those which are not required for T cell reactivity (e.g., by being replaced by another amino acid whose incorporation enhances T cell reactivity but does not diminish binding to relevant MHC molecules).
- Another example of a modification of peptides is substitution of cysteine residues preferably with alanine, or alternatively with serine or threonine to minimize dimerization via disulfide linkages.
- peptides can also be modified to incorporate one or more polymorphisms in the amino acid sequence of a protein allergen resulting from natural allelic variation.
- D-amino acids, non-natural amino acids or non-amino acid analogues can be substituted or added to produce a modified synthetic peptide within the scope of this invention.
- the peptides can be synthesized as retro-inverso peptides.
- Evolution has ensured the almost exclusive occurrence of L-amino acids in naturally occurring proteins. Virtually all proteases therefore cleave peptide bonds between adjacent L- amino acids; thus, artificial proteins or peptides composed of D-amino acids are largely resistant to proteolytic breakdown. This resistance has been attractive to drug designers, but the exclusivity of biological systems for proteins made of L-amino acids means that such proteins cannot interact with the mirror image surface formed by enantiomeric proteins. Thus, an all D-amino acid protein usually has no biological effect or activity.
- Jameson et al. engineered an analogue of the hairpin loop of the CD4 receptor by combining these two properties: reverse synthesis and a change in chirality. See Jameson et al., Nature 368:744-746, 1994 and Brady et al, Nature, 368:692-693, 1994.
- the net result of combining D-enantiomers and reverse synthesis is that the positions of carbonyl and amino groups in each amide bond are exchanged, while the position of the side-chain groups at each alpha carbon is preserved.
- Jameson et al. demonstrated an increase in biological activity for their reverse D peptide, which contrasts to the limited activity in vivo of its conventional all-L enantiomer (due to its susceptibility to proteolysis).
- Retro-inverso peptides are prepared for peptides of known sequence in the following manner.
- a peptide having a known sequence e.g., a tumor antigen peptide
- a model peptide for designing and synthesizing a retro-inverso peptide analog.
- the analog is synthesized using D-amino acids by attaching the amino acids in a peptide chain such that the sequence of amino acids in the retro-inverso peptide analog is exactly opposite of that in the selected peptide which serves as the model.
- the peptide model is a peptide formed of L-amino acids having the sequence ABC
- the retro-inverso peptide analog formed of D-amino acids would have the sequence CBA.
- the procedures for synthesizing a chain of D-amino acids to form the retro-inverso peptides are known in the art and are illustrated in the above-noted references.
- the peptides of the invention may be prepared to include the "retro-inverso isomer" of the desired peptide. Protecting the peptide from natural proteolysis should therefore increase the effectiveness of the specific heterobivalent or heteromultivalent compound.
- a higher biological activity is predicted for the retro-inverso containing peptide when compared to the non-retro-inverso containing analog owing to protection from degradation by native proteinases.
- peptides can be modified to produce a peptide-PEG conjugate. Modifications of peptides can also include reduction/alkylation (Tarr in: Methods of Protein Microcharacterization, J.E. Silver, ed. Humana Press, Clifton, NJ, pp 155-194, 1986); acylation (Tarr, supra); esterification (Tarr, supra); chemical coupling to an appropriate carrier (Mishell and Shiigi, eds., Selected Methods in Cellular Immunology, WH Freeman, San Francisco, CA; U.S. Patent 4,939,239, 1980); or mild formalin treatment (Marsh International Archives of Allergy and Applied Immunology, 41 :199, 1971).
- reporter group(s) to the peptide backbone.
- poly-histidine can be added to a peptide to purify the peptide on immobilized metal ion affinity chromatography.
- specific endoprotease cleavage sites can be introduced, if desired, between a reporter group and amino acid sequences of a peptide to facilitate isolation of peptides free of irrelevant sequences.
- canonical protease sensitive sites can be recombinantly or synthetically engineered between regions, each comprising at least one T cell epitope.
- charged amino acid pairs such as KK or RR, can be introduced between regions within a peptide during synthesis.
- the invention further encompasses at least one therapeutic composition useful in treating a condition which involves an immune response to a protein antigen (e.g., an allergen, an autoantigen, etc.) comprising at least one peptide having a sufficient percentage of the T cell epitopes of the protein antigen such that in a substantial percentage of a population of individuals sensitive to the protein antigen, the response of such individuals to the protein antigen is substantially diminished, with the provision that the at least one peptide does not comprise the entire protein antigen.
- a protein antigen e.g., an allergen, an autoantigen, etc.
- BV Bee venom
- Antigens that can include one or more toxic polypeptides. Many of these polypeptides are hypersensitizing agents and can additionally have hemolytic or neurotoxic effects.
- IgE antibodies from BV hypersensitive individuals recognize several BV toxic polypeptides.
- BV polypeptides often referred to as allergens, recognized by IgE in BV hypersentive individuals can include, e.g., phospholipase A 2 (PLA 2 ), acid phosphatase, hyaluronidase, allergen C, and other, high molecular weight (MW) proteins.
- BV hypersensitive individuals can be at high risk of an adverse reaction to a bee sting.
- One recognized method for preventing or minimizing serious adverse reactions resulting from a bee sting is to desensitize the individual to the allergens present in BV. This protection can be induced by a process termed venom immunotherapy (VIT).
- VIT venom immunotherapy
- Birch pollen is a major source of type I allergies observed in early spring. An estimated 100 million individuals suffer from birch pollen allergy. Cross-linking of two IgE receptors on the surface of mast cells and basophilic leucocytes, by allergen binding, initiates the release of a number of physiologically active substances such as histamine, PAF (platelet activating factor), heparin, chemotactic factors for eosinophilic and neutrophilic granulocytes, leucotrienes, prostaglandins and thromboxanes. It is these mediators which cause the direct symptoms of IgE-mediated allergic reactions (Type I hypersensitivity).
- Bet v 1 the major birch pollen allergen, is composed of 160 amino acid residues with a molecular weight of approximately 17 kDa. To date, eleven Bet v 1 protein sequence isoforms have been identified, with amino acid identities ranging from 84.4% (25/160 amino acid exchanges) to 99.4% (a single amino acid exchange). (See, Swoboda et al, J. Biol. Chem. 270(6):2607. 1995).
- Major three-dimensional structural features of Bet v 1 include a seven-stranded antiparallel beta-sheet that wraps around a long C-terminal alpha-helix, thereby forming a large cavity in the interior of the protein.
- Birch pollen profilin Bet v 2
- Bet v 2 is composed of 133 amino acid residues with a molecular weight of approximately 15 kDa. It is a structurally well conserved actin- and phosphoinositide-binding protein and a cross-reactive allergen. Structural features include three ⁇ -helices and seven ⁇ -strands, as determined by NMR.
- the peptide is preferably derived from a protein allergen of the genus Betula verrucosa.
- the immunogenic features of rBet v 1 fragments/variants have been shown. (See, Vrtala et al, J. Immunol. 165:6653, 2000; van Hage-Hamsten et al, J. Allergy Clin. Immunol. 104(5):969, 1999; Vrtala et al, Int. Arct Allergy Immun. 113:246, 1997; and Wiedermann et al., Int. Arch. Allergy Immun. 126:68 2001). Dust Mite Allergens:
- the dust mite (DM) is a common cause of allergic rhinitis and asthma.
- a dust mite is a microscopic, eight-legged insect. More than 100,000 dust mites can be in a single gram of dust. People are not allergic to the dust mite itself, but to dust mite feces. Dust mites eat the microscopic skin dander found on people and animals, and then leave droppings. Each dust mite can produce approximately 20 droppings each day. Dust mite are found on people, animals and on almost every surface in homes, including carpet, upholstered furniture, mattresses and box springs, sheets and blankets, pillows and stuffed animals. When dead dust mites and dust mite droppings become airborne and are inhaled, they may produce an allergic reaction.
- Dermatophagoides Two species of the mite genus Dermatophagoides, D. pteronyssinus and D. farinae, are important sources of house dust allergens. Two groups of major allergens, Der 1 (Der p 1 and DER f 1) and Der 2 (Der p 2 and Der f 2), have been purified from these Dermatophagoides species.
- sequences and corresponding SEQ ID NOs discussed herein include the following:
- SEQ ID NO: 1 PLA fragment amino acid sequence (60 aa)
- KYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKAS (SEQ ID NO: 6) KEMGETLLRAVESYLLAHSDAYN
- MSWQTYVDEHLMSDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIM (SEQ ID NO: 10)
- AIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNS (SEQ ID NO: 13) WDTNWGDNGYGYFAANIDLMMIEEYPYWIL
- the present invention further provides compositions and kits for diagnostic use that are comprised of one or more containers containing a chimeric allergen protein and contiguous overlapping peptide fragments.
- the chimeric allergen protein and peptide fragments are comprised of peptide fragments from different allergens (e.g. one or more from allergen one with one or more from allergen two from the same class of allergen (e.g. bee venom, birch pollen, dust mite, etc.)).
- the kit may, optionally, further comprise a series of compositions of known concentration, a positive-control and a negative-control in the aforementioned assays.
- the chimeric protein comprises peptide fragments wi"thin a specified allergen class.
- chimeric proteins comprising Bet v 1 (SEQ ID N " O:5 and 6) and Bet v 2 (SEQ ID NO:8 and 9) peptide fragments or Der p 1 (SEQ ID NO:l 1- 13) and Der p 2 (SEQ ID NO: 15 and 16).
- These peptide fragments would be contiguous, however the fragments can be distant from each other and in various orientations and may include overlapping peptides.
- the schematic below shows an example of overlapping peptide fragments:
- OR 123456ABCDEF OPF (Chimeric fragment 3)
- the chimeric protein comprises peptide fragments from different allergen classes.
- chimeric proteins comprising PLA (SEQ ID NO:l- 3) and Bet v 1 (SEQ ID NO:5 and 6) or Bet v 2 (SEQ ID NO:8 and 9) peptide fragments or chimeric proteins comprising PLA 2 (SEQ ID NO: 1-3) and Der p 1 (SEQ ID NO:l 1-13) or Der p 2 (SEQ ID NO: 15 and 16).
- Chimeric peptide fragments from different allergens are useful in diagnosing patients with different allergies.
- chimeric proteins comprising PLA 2 and Bet v 1 or Bet v 2 would be applicable to patients allergic to both bee venom and birch pollen.
- SEQ ID NO: 18 comprises (in line ar arrangement) SEQ ID NOs:5 and 8;
- SEQ ID NO: 19 comprises SEQ ID NOs:9 and 6;
- SEQ ID NO:20 comprises SEQ ID NOs:8 and 5;
- SEQ ID NO:21 comprises SEQ ID NOs:6 and 9;
- SEQ ID NO:22 comprises SEQ ID NOs: 15 and 11 and
- SEQ ID NO:23 comprises SEQ ID NOs: 13 and 16.
- MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKK (SEQ ID NO: 18) ISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGHPVTGCGERTEGRCLHYTV DKSKPKVYQWFDLRKYMSWQTYVDEH MSDIDGQASNSLASAIVGHDGSVWA QSSSFPQFKPQEITGIMKDFEEPGHLAPTGLHLG
- kits for diagnostic use are comprised of one or more containers containing a specific allergen protein and contiguous overlapping peptide fragments.
- the kit may, optionally, further comprise a series of compositions of known concentration, a positive-control and a negative-control in the aforementioned assays.
- allergens can be treated with the compositions and methods of the invention.
- allergens include, but are not limited to:
- Example 1 Bee Venom Specific T Cell Tolerance Induction with Allergen-Derived Overlapping Peptide Fragments. This study was designed to evaluate the safety and immunogenicity of an allergen- derived overlapping peptide fragment (OPF) immunotherapy.
- OPF allergen- derived overlapping peptide fragment
- BV hypersensitive patients Sixteen bee venom (BV) hypersensitive patients were recruited from the Outpatient Clinic of the Division of Allergy and Immunology, Lausanne, Switzerland (9 males/ 7 females). Criteria for enrollment were grade I to IV systemic hypersensitivity reaction to honey bee field sting (M ⁇ ller J. Asthma Res.
- the peptide mixture was reconstituted in an 0.3 mg/ml albumin solution (containing 4 mg/ml of phenol) (ALK Abello, Horsholm, Denmark) and injected subcutaneously in the deltoid area.
- BV and PLA 2 were purchased from Latoxan (Rosans, France). For cell culture, PLA 2 was further purified by HPLC. Its cytotoxicity was inhibited by overnight reduction at 37° C with a 100 molar excess of dithiothreitol, followed by alkylation with a 1000 molar excess of N-ethylmaleimide. PLA 2 was finally purified on a Sephadex G-25 column (Pharmacia, Uppsala, Sweden). PMA and ionomycin were purchased from Calbiochem, San Diego, CA.
- PBMC peripheral blood mononuclear cells
- T cell lines were derived from PBMC that were isolated before each injection and stimulated in 24 well plates (Nunc) (10 ⁇ cells/well) with a mixture of the three OPFs ( 10 ⁇ g/ml) for 7 days in supplemented 10% AB + RPMI 1640 medium as described above.
- the short term T cell lines obtained were washed and restimulated for 24 h (for IL-4, IL-5, IL-13 and TGF ⁇ secretion) or 48 h (for IFN ⁇ and IL-10) with plastic crosslinked OKT3 (1 ⁇ g/ml) (see Jutel et al, Clin. Experiment. Allergy 25:1108-1117, 1995).
- IL-4 , IL-10 and IFN ⁇ were titrated using commercially available ELISA kits (Mabtech AG, Nacka, Sweden, for IL-4, IL-10 and IFN ⁇ .and R&DSystem for IL-5, IL-13 and TGF ⁇ ), according to manufacturer's recommendations.
- Immunoblotting and dot blot analysis Anti-BV or -PLA immunoblots were processed as described in Kettner et al, Clin. Experiment. Allergy 29:394-401, 1999.
- dot blot analysis 1 ⁇ g of whole BV, PLA , OPFs or human albumin was diluted 1/4 in DMSO, spotted on PVDF membranes and dried for 30 min. at 37 C. After blocking in non-fat milk 5%, further steps were performed as described in Kettner et al, Clin. Experiment. Allergy 29:394-401 1999. Dot densities were analyzed by scanning densitometry using an Advanced American Biotechnology scanner, Fullerton, CA.
- Patients' data Patients were randomly assigned to the OPF or control (albumin) groups. In the OPF group, mean age of patients was 39 ⁇ 14 yrs (5 males/4 females). One patient had a previous history of grade I hypersensitivity to BV, 7 a grade III and one a grade
- EPC for ID tests to BV was 10 " ⁇ g/ml (geometric mean).
- Mean serum anti-BV specific IgE level was 21.5 ⁇ 33.9 kU/1.
- mean age was 40 ⁇ 10 yrs (4 males/3 females).
- One patient had previously developed a grade I hypersensitivity reaction to bee venom, three a grade II and three a grade III.
- EPC for ID tests to BV was 10 " ⁇ g/ml (geometric mean).
- Mean serum anti-BV specific IgE level was 29.8 ⁇ 26.1 kU/1. There was no significant difference between groups at inclusion regarding sex, ages, severity of initial clinical reaction, anti-BV IgE and anti-PLA 2 specific IgE and IgG4 antibody levels.
- Overlapping peptide immunotherapy induces T cell anergy: In both groups, PBMC collected before each OPF or albumin injection were stimulated with the three OPF mixture (10 ⁇ g/ml). As reported in Kammerer et al, J. Allergy Clin. Immunol. 100:96-103, 1997, T cell proliferation in response to the three OPFs (expressed as the ratio of T cell response to PMA (100 ng/ml)/Ionomycine (1 ⁇ M) used as internal control) before the first injection at day 0 was low in either group all along the study, and persisted so in the control group (Friedman, p>0.05) ( Figure 1).
- T cell cytokine production PBMC collected before each injection were stimulated with a mixture of the three OPFs for 7 days, then activated with OKT3 (1 ⁇ g/ml) for 24 to 48 hr, following previously described protocols (Jutel et al., Clin. Experiment Allergy 25:1 108- 1117, 1995).
- OKT3 (1 ⁇ g/ml) for 24 to 48 hr, following previously described protocols (Jutel et al., Clin. Experiment Allergy 25:1 108- 1117, 1995).
- IL-4 secretion by PBMCs maximally stimulated with OKT3 remained low in the peptide group ( Figure 2 A).
- Figure 2 A A similar pattern was observed for IL-5 and IL-13 secretion.
- Serum anti-PLA2 serum IgE and IgG 4 Serum anti-PLA IgE were measured at screening visit, at days 14, 42 and 80 using a CAP assay. Though the difference between the anti-PLA IgE levels overtime in the peptide versus the control group indicated a trend towards higher IgE value in the peptide group (Fisher's exact test, T14, T42, T80,/? ⁇ 0.03), comparison within the groups showed that there was no significant variation of anti-PLA2 IgE levels overtime (Friedman, p>0.05) ( Figure 3 A, B).
- a maintenance dose of 300 ⁇ g OPF was initially injected to two patients.
- the late occurrence (>2 hrs) of local skin reaction and upper trunk flush at day 42 led to the interruption of the treatment.
- the other patient for safety reasons, was subsequently allocated to the 100 ⁇ g OPF treatment group, though the 300 ⁇ g dosage was well tolerated.
- OPFs could be injected without any local or systemic adverse events at day 0, though cumulative doses of each peptide were reaching more than 250 ⁇ g (550 ⁇ g in the two patients injected with 300 ⁇ g OPFs) demonstrates the high safety profile of OPF- ' s. Mild local reactions (pruritus and erythema) occurred in only two patients at day 14, 42 and 70 more than 120 min. after the injection and did not last for more than one hour. In the same patients, the ultimate peptide injection led to late (>3 h) systemic reactions characterized by hand pruritus and a flash of the upper trunk.
- IgE binding activity to peptides was clearly limited and plateaued after day 42. It was not reflected by in vivo skin testing at initiation of the study. During the course of the trial, four patients developed mildly positive ID tests to OPFs at 0.1 ⁇ g/ml, whereas the five others were still negative at 1 ⁇ g /ml. This difference was certainly significant since in the control group none of the patients had positive ID tests at 0.1 ⁇ g/ml concentration at the end of the trial. The clinical significance of these positive ID tests is however difficult to appreciate: the two patients who developed mild systemic reactions after day 70 injection were among those four patients. However, clinical tolerance to OPF injection was good in the two others. Longer term studies on larger study population will be necessary to assess the long term safety of OPF-based immunotherapy.
- IL-10 has also prominent anti-inflammatory properties (de Waal Malefyt et al, J. Immunol. 150:4754-4765, 1993). Though by itself an immune deviation to a TH1 type cytokine production may be deleterious (Hansen et al, J. Clin. Invest. 103:175-183, 1999), a combination of an anti-inflammatory cytokine such as IL-10 and IFN ⁇ may re-equilibrate a potentially detrimental cytokine secretion.
- Serum IgG4 levels may be predictive of effective protection in response to immunotherapy (Urbanek et al, Clin. Allergy 16:317-322, 1986 and Lesourd et al, J. Allergy Clin Immunol. 83:563-571, 1989), though this concept may be controversial (M ⁇ ller et al, Allergy 44:412-418, 1989).
- IgE and IgG4 levels obtained after 2 years of specific immunotherapy were specific and sensitive predictors of reactivity post hymenoptera venom challenge, a high IgG4 response being associated with protection and low IgG4 levels with anaphylaxis (Ollert et al, J. Allergy Clin. Immunol. 105:S59, Abstract 178, 2000).
- IgG4 may in part compete with IgE binding on allergen and thus contribute to clinical protection (Schneider et al, J. Allergy Clin. Immunol 94:61-70, 1994).
- Patients eligible for this study include those with a history of seasonal " birch pollen allergy and with an SPT reaction >3+ compared with an albumin 10 mg/mL wheal and a minimal outcome of more than 3 mm wheal to commercial birch pollen extract.
- Study design The study is designed as a double blind, randomized, two-dose, placebo-controlled trial.
- patients from the OPF group are injected at 30 min interval with successively 0.1 ⁇ g, 1 ⁇ g, 10 ⁇ g, 20 ⁇ g, 40 ⁇ g, 80 ⁇ g and 100 ⁇ g of each of the two OPFs.
- Patients are then injected at day 4, 7, 14, 42 and 70 with a maintenance dose of 100 ⁇ g of each of the two OPFs.
- a maintenance dose of 300 ⁇ g of each OPF is initially injected to two patients up to day 42.
- Patients from the control group are injected with an equivalent volume of peptide diluent only (0.3 mg/ml albumin solution, containing 4 mg/ml of phenol) (ALK/Abello, Horsholm, Denmark).
- the peptide mixture On the day of injection, the peptide mixture is reconstituted in an 0.3 mg/ml albumin solution (containing 4 mg/ml of phenol) (ALK Abello, Horsholm, Denmark) and injected subcutaneously in the deltoid area.
- Reagents Whole birch pollen and Bet v 1 is purchased.
- Bet v 1 is further purified by HPLC. Its cytotoxicity can be inhibited by overnight reduction at 37°C with a 100 molar excess of dithiothreitol, followed by alkylation with a 1000 molar excess of N-ethylmaleimide.
- Bet v 1 is finally purified on a Sephadex G-25 column (Pharmacia, Uppsala, Sweden). PMA and ionomycin are purchased from Calbiochem, San Diego, CA.
- Proliferation assays Blood is drawn immediately before each OPF injection and PBMC are isolated from heparinized blood by density gradient centrifugation over Ficoll- Paque (Pharmacia Biotech AB, Uppsala, Sweden). Prior to ⁇ H-thymidine (Du Pont NEN
- PBMC (2x10 ⁇ /well) from each donor is cultured for 6 days in octoplicates in 96 well flat bottom plates (Costar Corning Inc., New York, NY) in RPMI 1640 medium (Gibco, Basel, Switzerland) containing 10% AB + serum (Swiss Red Cross, Bern, Switzerland), 2mM glutamine, 1 % Na-pyruvate, 1 % non-essential amino acids, 1% kanamycine (all from Gibco) with optimal concentration of OPFs (10 ⁇ g/ml) or Bet v 1 (10 ⁇ g/ml). See Kammerer et al, J. Allergy Clin. Immunol. 100:96-103, 1997.
- T cell lines are derived from PBMC that is isolated before each injection and stimulated in 24 well plates (Nunc) (10" cells/well) with a mixture of the two OPFs (10 ⁇ g/ml) for 7 days in supplemented 10% AB + RPMI 1640 medium as described above.
- the short term T cell lines obtained are washed and restimulated for 24 h (for IL-4, IL- 5, IL-13 and TGF ⁇ secretion) or 48 h (for IFN ⁇ and IL-10) with plastic crosslinked OKT3 (1 ⁇ g/ml) (see Jutel et al, Clin. Experiment. Allergy 25:1108-1117, 1995).
- Cell culture supernatants are collected for cytokine quantification and stored at -80 C.
- Cytokine quantification IL-4, IL-10 and IFN ⁇ are titrated using commercially available ELISA kits (Mabtech AG, Nacka, Sweden, for IL-4, IL-10 and IFN ⁇ .and R&DSystem for IL-5, IL-13 and TGF ⁇ ), according to manufacturer's recommendations.
- Example 3 Birch Pollen Profilin (Bet v 2) Specific T Cell Tolerance Induction with Allergen-Derived Overlapping Peptide Fragments.
- Patients eligible for this study include those with a history of seasonal birch pollen allergy and with an SPT reaction >3+ compared with an albumin 10 mg/mL wheal and a minimal outcome of more than 3 mm wheal to commercial birch pollen extract.
- Skin testing Concentrations tested range from 10 "3 ⁇ g/ml to 1 ⁇ g/ml (10-fold dilution series). An ID test result will be considered positive when a wheal reaction superior to 5 mm (for birch pollen profilin, Bet v 2 and peptides) in diameter and an erythema were present at a concentration ⁇ O.l ⁇ g/ml.
- Study design The study is designed as a double blind, randomized, two-dose, placebo-controlled trial.
- patients from the OPF group are injected at 30 min interval with successively 0.1 ⁇ g, 1 ⁇ g, 10 ⁇ g, 20 ⁇ g, 40 ⁇ g, 80 ⁇ g and 100 ⁇ g of each of the two OPFs.
- Patients are then injected at day 4, 7, 14, 42 and 70 with a maintenance dose of 100 ⁇ g of each of the two OPFs.
- a maintenance dose of 300 ⁇ g of each OPF is initially injected to two patients up to day 42.
- Patients from the control group are injected with an equivalent volume of peptide diluent only (0.3 mg/ml albumin solution, containing 4 mg/ml of phenol) (ALK Abello, Horsholm, Denmark).
- Bet v 2 Whole birch pollen profilin and Bet v 2 is purchased.
- Bet v 2 is further purified by HPLC. Its cytotoxicity can be inhibited by overnight reduction at 37°C with a 100 molar excess of dithiothreitol, followed by alkylation with a 1000 molar excess of N-ethylmaleimide.
- Bet v 1 is finally purified on a Sephadex G-25 column (Pharmacia, Uppsala, Sweden). PMA and ionomycin are purchased from Calbiochem, San Diego, CA.
- PBMC Proliferation assays: Blood is drawn immediately before each OPF injection and PBMC are isolated from heparinized blood by density gradient centrifugation over Ficoll- Paque (Pharmacia Biotech AB, Uppsala, Sweden). Prior to 3 H-thymidine (Du Pont NEN Products Boston, MA, USA) incorporation, PBMC (2x10 ⁇ /well) from each donor is cultured for 6 days in octoplicates in 96 well flat bottom plates (Costar Corning Inc., New York, JY) in RPMI 1640 medium (Gibco, Basel, Switzerland) containing 10% AB + serum (Swiss Red Cross, Bern, Switzerland), 2mM glutamine, 1% Na-pyruvate, 1% non-essential amino acids, 1% kanamycine (all from Gibco) with optimal concentration of OPFs (10 ⁇ g/ml) or Bet v 1 (10 ⁇ g/ml). See Kammerer et al, J. Allergy Clin
- T cell lines are derived from PBMC that is isolated before each injection and stimulated in 24 well plates (Nunc) (10° cells/well) with a mixture of the two OPFs (10 ⁇ g/ml) for 7 days in supplemented 10% AB + RPMI 1640 medium as described above.
- the short term T cell lines obtained are washed and restimulated for 24 h (for IL-4, IL- 5, IL-13 and TGF ⁇ secretion) or 48 h (for IFN ⁇ and IL-10) with plastic crosslinked OKT3 (1 ⁇ g/ml) (see Jutel et al, Clin. Experiment. Allergy 25:1108-1117, 1995).
- Cell culture supematants are collected for cytokine quantification and stored at -80° C.
- Cytokine quantification IL-4 , IL-10 and IFN ⁇ are titrated using commercially available ELISA kits (Mabtech AG, Nacka, Sweden, for IL-4, IL-10 and IFN ⁇ .and R&DSystem for IL-5, IL-13 and TGF ⁇ ), according to manufacturer's recommendations.
- Plates are washed thrice, incubated with horseradish peroxidase labelled anti- IgG4 mAb JDC-14 l/10'OOO (Pharmingen, Hamburg, Germany), and revealed in 3,3', 5,5'- tetramethylbenzidine (TMB).
- TMB 3,3', 5,5'- tetramethylbenzidine
- Optical density is determined at 450 nm on a microtiter plate analyzer (MR5000, Dynatech Laboratories). Titers are reported to a standard serum and expressed as arbitrary standard units.
- Immunoblotting and dot blot analysis Anti-birch pollen profilin or -Bet v 2 immunoblots will be processed as described in Kettner et al, Clin. Experiment. Allergy 29:394-401, 1999.
- dot blot analysis 1 ⁇ g of whole birch pollen profilin, Bet v 2, OPFs or human albumin will be diluted 1/4 in DMSO, spotted on PVDF membranes and dried for 30 min. at 37 C. After blocking in non-fat milk 5%, further steps are performed as described in Kettner et al, Clin. Experiment. Allergy 29:394-401, 1999. Dot densities are analyzed by scanning densitometry using an Advanced American Biotechnology scanner, Fullerton, CA.
- Example 4 Dust Mite (Der p 1) Specific T Cell Tolerance Induction with Allergen- Derived Overlapping Peptide Fragments.
- Patients eligible for this study include those with a history of dust mite allergy and with an SPT reaction >3+ compared with an albumin 10 mg/mL wheal and a minimal outcome of more than 3 mm wheal to commercial dust mite extract.
- Study design The study is designed as a double blind, randomized, two-dose, placebo-controlled trial.
- patients from the OPF group are injected at 30 min interval with successively 0.1 ⁇ g, 1 ⁇ g, 10 ⁇ g, 20 ⁇ g, 40 ⁇ g, 80 ⁇ g and 100 ⁇ g of each of the two OPFs.
- Patients are then injected at day 4, 7, 14, 42 and 70 with a maintenance dose of 100 ⁇ g of each of the three OPFs.
- a maintenance dose of 300 ⁇ g of each OPF is initially injected to two patients up to day 42.
- Patients from the control group are injected with an equivalent volume of peptide diluent only (0.3 mg/ml albumin solution, containing 4 mg/ml of phenol) (ALK/Abello, Horsholm, Denmark).
- the peptide mixture On the day of injection, the peptide mixture is reconstituted in an 0.3 mg/ml albumin solution (containing 4 mg/ml of phenol) (ALK/Abello, Horsholm, Denmark) and injected subcutaneously in the deltoid area.
- albumin solution containing 4 mg/ml of phenol
- DM and Der p 1 Whole DM and Der p 1 is purchased. For cell culture, Der p 1 is further purified by HPLC. Its cytotoxicity can be inhibited by overnight reduction at 37°C with a 100 molar excess of dithiothreitol, followed by alkylation with a 1000 molar excess of N- ethylmaleimide. Der p 1 is finally purified on a Sephadex G-25 column (Pharmacia, Uppsala, Sweden). PMA and ionomycin are purchased from Calbiochem, San Diego, CA.
- PBMC peripheral blood mononuclear cells
- PBMC (2x10 ⁇ /well) from each donor is cultured for 6 days in octoplicates in 96 well flat bottom plates (Costar Corning Inc., New York, NY) in RPMI 1640 medium (Gibco, Basel, Switzerland) containing 10% AB + serum (Swiss Red Cross, Bern, Switzerland), 2mM glutamine, 1% Na-pyruvate, 1% non-essential amino acids, 1% kanamycine (all from Gibco) with optimal concentration of OPFs (10 ⁇ g/ml) or Bet v 1 (10 ⁇ g/ml). See Kammerer et al, J. Allergy Clin. Immunol. 100:96-103, 1997.
- T cell lines are derived from PBMC that is isolated before each injection and stimulated in 24 well plates (Nunc) (10 ⁇ cells/well) with a mixture of the three OPFs (10 ⁇ g/ml) for 7 days in supplemented 10% AB + RPMI 1640 medium as described above.
- the short term T cell lines obtained are washed and restimulated for 24 h (for IL-4, IL-5, IL- 13 and TGF ⁇ secretion) or 48 h (for IFN ⁇ and IL- 10) with plastic crosslinked OKT3 (1 ⁇ g/ml) (see Jutel et al, Clin. Experiment. Allergy 25:1108-1 1 17, 1995).
- Cell culture supernatants are collected for cytokine quantification and stored at -80° C.
- Cytokine quantification IL-4 , IL-10 and IFN ⁇ are titrated using commercially available ELISA kits (Mabtech AG, Nacka, Sweden, for IL-4, IL-10 and IFN ⁇ .and R&DSystem for IL-5, IL-13 and TGF ⁇ ), according to manufacturer's recommendations.
- Immunoblotting and dot blot analysis Anti-DM or -Der p 1 immunoblots will be processed as described in Kettner et al, Clin. Experiment. Allergy 29:394-401, 1999.
- dot blot analysis 1 ⁇ g of dust mite allergen, Der p 1, OPFs or human albumin will be diluted 1/4 in DMSO, spotted on PVDF membranes and dried for 30 min. at 37 C. After blocking in non-fat milk 5%, further steps are performed as described in Kettner et al, Clin. Experiment. Allergy 29:394-401, 1999. Dot densities are analyzed by scanning densitometry using an Advanced American Biotechnology scanner, Fullerton, CA.
- Example 5 Dust Mite (Der p 2) Specific T Cell Tolerance Induction with Allergen.- Derived Overlapping Peptide Fragments. Materials and Methods
- Patients eligible for this study include those with a history of dust mite allergy and with an SPT reaction >3+ compared with an albumin 10 mg/mL wheal and a minimal outcome of more than 3 mm wheal to commercial dust mite extract.
- Study design The study is designed as a double blind, randomized, two-dose, placebo-controlled trial. At day 0, patients from the OPF group are injected at 30 min interval with successively 0.1 ⁇ g, 1 ⁇ g, 10 ⁇ g, 20 ⁇ g, 40 ⁇ g, 80 ⁇ g and 100 ⁇ g of each of the two
- OPFs OPFs. Patients are then injected at day 4, 7, 14, 42 and 70 with a maintenance dose of 100 ⁇ g of each of the three OPFs. A maintenance dose of 300 ⁇ g of each OPF is initially injected to two patients up to day 42. Patients from the control group are injected with an equivalent volume of peptide diluent only (0.3 mg/ml albumin solution, containing 4 mg/ml of phenol) (ALK Abello, Horsholm, Denmark).
- peptide diluent only 0.3 mg/ml albumin solution, containing 4 mg/ml of phenol
- the peptide mixture On the day of injection, the peptide mixture is reconstituted in an 0.3 mg/ml albumin solution (containing 4 mg/ml of phenol) (ALK Abello, Horsholm, Denmark) and injected subcutaneously in the deltoid area.
- albumin solution containing 4 mg/ml of phenol
- DM and Der p 2 Whole DM and Der p 2 is purchased. For cell culture, Der p 2 is further purified by HPLC. Its cytotoxicity can be inhibited by overnight reduction at 37°C with a 100 molar excess of dithiothreitol, followed by alkylation with a 1000 molar excess of N- ethylmaleimide. Der p 2 is finally purified on a Sephadex G-25 column (Pharmacia, Uppsala, Sweden). PMA and ionomycin are purchased from Calbiochem, San Diego, CA.
- PBMC Proliferation assays: Blood is drawn immediately before each OPF injection and PBMC are isolated from heparinized blood by density gradient centrifugation over Ficoll- Paque (Pharmacia Biotech AB, Uppsala, Sweden). Prior to ⁇ H-thymidine (Du Pont NEN Products Boston, MA, USA) incorporation, PBMC (2x10 ⁇ /well) from each donor is cultured for 6 days in octoplicates in 96 well flat bottom plates (Costar Corning Inc., New York, NY) in RPMI 1640 medium (Gibco, Basel, Switzerland) containing 10% AB + serum (Swiss Red Cross, Bern, Switzerland), 2mM glutamine, 1% Na-pyruvate, 1% non-essential amino acids, 1% kanamycine (all from Gibco) with optimal concentration of OPFs (10 ⁇ g/ml) or Bet v 1 (10 ⁇ g/ml). See Kammerer et al, J. Allergy Clin
- T cell lines are derived from PBMC that is isolated before each injection and stimulated in 24 well plates (Nunc) (10 ⁇ cells/well) with a mixture of the two OPFs (10 ⁇ g/ml) for 7 days in supplemented 10% AB + RPMI 1640 medium as described above.
- the short term T cell lines obtained are washed and restimulated for 24 h (for IL-4, IL- 5, IL-13 and TGF ⁇ secretion) or 48 h (for IFN ⁇ and IL-10) with plastic crosslinked OKT3 (1 ⁇ g/ml) (see Jutel et al, Clin. Experiment. Allergy 25:1108-1117, 1995).
- IL-4 , IL-10 and IFN ⁇ are titrated using commercially available ELISA kits (Mabtech AG, Nacka, Sweden, for IL-4, IL-10 and IFN ⁇ and R&DSystem for IL-5, IL-13 and TGF ⁇ ), according to manufacturer's recommendations.
- Immunoblotting and dot blot analysis Anti-DM or -Der p 2 immunoblots will be processed as described in Kettner et al, Clin. Experiment. Allergy 29:394-401, 1999.
- dot blot analysis 1 ⁇ g of dust mite allergen, Der p 2, OPFs or human albumin will be diluted 1/4 in DMSO, spotted on PVDF membranes and dried for 30 min. at 37 °C. After blocking in non-fat milk 5%, further steps are performed as described in Kettner et al, Clin. Experiment. Allergy 29:394-401, 1999. Dot densities are analyzed by scanning densitometry using an Advanced American Biotechnology scanner, Fullerton, CA.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- Zoology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Insects & Arthropods (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Tropical Medicine & Parasitology (AREA)
- Toxicology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Epidemiology (AREA)
- Botany (AREA)
- Pulmonology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Transplantation (AREA)
- Otolaryngology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Plant Substances (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Abstract
Description
Claims
Priority Applications (9)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CA2519083A CA2519083C (en) | 2003-03-14 | 2004-03-15 | Allergen peptide fragments and use thereof |
JP2006506543A JP5389326B2 (en) | 2003-03-14 | 2004-03-15 | Allergen peptide fragments and uses thereof |
AU2004220274A AU2004220274B2 (en) | 2003-03-14 | 2004-03-15 | Allergen peptide fragments and use thereof |
EP04720678A EP1603591A2 (en) | 2003-03-14 | 2004-03-15 | Allergen peptide fragments and use thereof |
US11/226,162 US8075897B2 (en) | 2003-03-14 | 2005-09-14 | Allergen peptide fragments and use thereof |
AU2010212310A AU2010212310B2 (en) | 2003-03-14 | 2010-08-12 | Allergen peptide fragments and use thereof |
US13/284,383 US8703144B2 (en) | 2003-03-14 | 2011-10-28 | Allergen peptide fragments and use thereof for treatment of dust mite allergies |
US14/206,354 US9193773B2 (en) | 2003-03-14 | 2014-03-12 | Allergen peptide fragments and use thereof for treatment of dust mite allergies |
US14/949,019 US9808503B2 (en) | 2003-03-14 | 2015-11-23 | Allergen peptide fragments and use thereof for treatment of birch pollen allergies |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US45500403P | 2003-03-14 | 2003-03-14 | |
US60/455,004 | 2003-03-14 | ||
US10/799,514 US7923209B2 (en) | 2003-03-14 | 2004-03-12 | Allergen peptide fragments and use thereof |
US10/799,514 | 2004-03-12 |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10/799,514 Continuation US7923209B2 (en) | 2003-03-14 | 2004-03-12 | Allergen peptide fragments and use thereof |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/226,162 Continuation-In-Part US8075897B2 (en) | 2003-03-14 | 2005-09-14 | Allergen peptide fragments and use thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2004081028A2 true WO2004081028A2 (en) | 2004-09-23 |
WO2004081028A3 WO2004081028A3 (en) | 2005-02-17 |
Family
ID=33456828
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/IB2004/001300 WO2004081028A2 (en) | 2003-03-14 | 2004-03-15 | Allergen peptide fragments and use thereof |
Country Status (6)
Country | Link |
---|---|
US (5) | US7923209B2 (en) |
EP (4) | EP1603591A2 (en) |
JP (4) | JP5389326B2 (en) |
AU (2) | AU2004220274B2 (en) |
CA (2) | CA2759072A1 (en) |
WO (1) | WO2004081028A2 (en) |
Cited By (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2009081440A2 (en) * | 2007-12-21 | 2009-07-02 | Lofarma S.P.A. | Allergens and allergoids from bee venom |
WO2010089671A2 (en) * | 2009-02-09 | 2010-08-12 | Anergis S.A. | Contiguous overlapping peptides for treatment of birch pollen allergy |
WO2011098778A3 (en) * | 2010-02-15 | 2011-12-15 | Circassia Limited | Peptides for vaccines against birch allergy |
EP2563316A1 (en) * | 2010-04-30 | 2013-03-06 | Allovate, LLC | Methods, articles and kits for allergic desensitization via the oral mucosa |
WO2013001362A3 (en) * | 2011-06-27 | 2013-07-11 | Anergis S.A. | Contiguous overlapping peptides for treatment of ragweed pollen allergy |
JP2014501514A (en) * | 2010-12-01 | 2014-01-23 | バイオメイ アクツェンゲゼルシャフト | Hypoallergenic polypeptides for the treatment of dust mite allergy |
WO2014195803A2 (en) | 2013-06-06 | 2014-12-11 | Anergis S.A. | Contiguous overlapping peptides for treatment of house dust mites allergy |
US9168295B2 (en) | 2007-06-01 | 2015-10-27 | Circassia Limited | Vaccine peptide combinations |
EP2914286B1 (en) * | 2012-10-30 | 2021-08-18 | Aravax Pty Ltd | Novel immunotherapeutic molecules and uses thereof |
US11266737B2 (en) | 2013-09-25 | 2022-03-08 | Aravax Pty Ltd | Immunotherapeutic composition and uses thereof |
Families Citing this family (22)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7923209B2 (en) | 2003-03-14 | 2011-04-12 | Anergis, S.A. | Allergen peptide fragments and use thereof |
WO2008043157A1 (en) | 2006-10-12 | 2008-04-17 | The University Of Queensland | Compositions and methods for modulating immune responses |
WO2010110454A1 (en) * | 2009-03-26 | 2010-09-30 | 国立大学法人名古屋大学 | Method for diagnosis of allergic disease |
US9724271B2 (en) | 2010-04-30 | 2017-08-08 | Allovate, Llc | Methods and articles for preventing or reducing risk of developing a hyperallergenic immune system |
WO2012058715A1 (en) | 2010-11-01 | 2012-05-10 | University Of Technology, Sydney | Immune-modulating agents and uses therefor |
WO2014031610A1 (en) | 2012-08-21 | 2014-02-27 | Sanofi | Methods for treating or preventing asthma by administering an il-4r antagonist |
TWI697334B (en) | 2013-06-04 | 2020-07-01 | 美商再生元醫藥公司 | Methods for treating allergy and enhancing allergen-specific immunotherapy by administering an il-4r inhibitor |
TWI634900B (en) | 2013-07-11 | 2018-09-11 | 再生元醫藥公司 | Methods for treating eosinophilic esophagitis by administering an il-4r inhibitor |
CA2924714C (en) | 2013-09-19 | 2024-04-09 | Allovate, Llc | Toothpaste for delivering allergens to oral mucosa |
AU2015222951B2 (en) | 2014-02-28 | 2020-06-11 | Regeneron Pharmaceuticals, Inc. | Methods for treating skin infection by administering an IL-4R antagonist |
CA2967602A1 (en) | 2014-11-14 | 2016-05-19 | Sanofi Biotechnology | Methods for treating chronic sinusitis with nasal polyps by administering an il-4r antagonist |
US10232048B1 (en) | 2014-11-18 | 2019-03-19 | Divine Api-Logics, LLC | Apitherapy method and composition |
WO2017179025A1 (en) * | 2016-04-15 | 2017-10-19 | Alk-Abelló A/S | Epitope polypeptides of ragweed pollen allergens |
JP2019531273A (en) | 2016-09-01 | 2019-10-31 | リジェネロン・ファーマシューティカルズ・インコーポレイテッドRegeneron Pharmaceuticals, Inc. | Method for preventing or treating allergy by administering an IL-4R antagonist |
TW202332696A (en) | 2016-12-01 | 2023-08-16 | 美商再生元醫藥公司 | Methods of treating inflammatory conditions |
US11053309B2 (en) | 2017-08-04 | 2021-07-06 | Regeneron Pharmaceuticals, Inc. | Methods for treating active eosinophilic esophagitis |
PT3515465T (en) | 2017-08-18 | 2024-03-04 | Regeneron Pharma | Methods for treating severe atopic dermatitis by administering an il-4r inhibitor |
ES2969049T3 (en) | 2017-10-30 | 2024-05-16 | Sanofi Biotechnology | IL-4R antagonist for use in a method of treating or preventing asthma |
JP2021523188A (en) | 2018-05-13 | 2021-09-02 | リジェネロン・ファーマシューティカルズ・インコーポレイテッドRegeneron Pharmaceuticals, Inc. | Methods for Treating Severe Atopic Dermatitis by Administering IL-4R Inhibitors |
US20200188511A1 (en) | 2018-12-12 | 2020-06-18 | Anergis S.A. | Methods of improving efficacy of allergy vaccines |
EP3941589A1 (en) | 2019-03-21 | 2022-01-26 | Regeneron Pharmaceuticals, Inc. | Combination of il-4/il-13 pathway inhibitors and plasma cell ablation for treating allergy |
US11504426B2 (en) | 2019-08-05 | 2022-11-22 | Regeneron Pharmaceuticals, Inc. | Methods for treating allergy and enhancing allergen-specific immunotherapy by administering an IL-4R antagonist |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2000044887A1 (en) * | 1999-01-27 | 2000-08-03 | Commissariat A L'energie Atomique | Peptides and proteins for desensitizing subjects allergic to bee venom and compositions containing same |
Family Cites Families (20)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4522811A (en) | 1982-07-08 | 1985-06-11 | Syntex (U.S.A.) Inc. | Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides |
US4473495A (en) | 1983-07-28 | 1984-09-25 | Northwestern University | Albumin-solubilized hymenoptera venoms for vaccine use |
AU624077B2 (en) | 1987-06-17 | 1992-06-04 | Institute For Child Health Research | Cloning of mite allergens |
JP2594123B2 (en) | 1987-09-12 | 1997-03-26 | 株式会社林原生物化学研究所 | Desensitizer |
US5152980A (en) | 1988-05-19 | 1992-10-06 | The Beth Israel Hospital Association | Induction of tolerance to a foreign antigen IL-2 receptor-binding substances |
US5124249A (en) | 1989-11-28 | 1992-06-23 | Khan Rashid H | Method for evaluating protection to bee venom |
US5565338A (en) | 1990-06-04 | 1996-10-15 | La Jolla Institute For Allergy And Immunology | Suppressor T-cell hybridoma and production of allergen specific glycosylation inhibiting factor |
US5965709A (en) | 1991-08-14 | 1999-10-12 | Genentech, Inc. | IgE antagonists |
IL105153A (en) | 1992-03-25 | 1999-12-22 | Immulogic Pharma Corp | Therapeutic compositions comprising peptides derived from human t cell reactive feline protein |
IT1254360B (en) | 1992-05-11 | 1995-09-14 | San Romanello Centro Fond | IMMUNOLOGICALLY HOMOLOGICAL EPITOPES OF HLA AND VIRUS HIV PROTEINS. |
US5582995A (en) | 1993-06-11 | 1996-12-10 | The General Hospital Corporation | Methods of screening for compounds which inhibit the direct binding of Ras to Raf |
US6074673A (en) | 1996-04-22 | 2000-06-13 | Guillen; Manuel | Slow-release, self-absorbing, drug delivery system |
WO1999018983A1 (en) | 1997-10-15 | 1999-04-22 | Alk-Abelló A/S | Composition and method for treating an encephalomyelopathic, demyelinating or autoimmune disease |
GB2348808B (en) | 1998-01-09 | 2003-03-19 | Circassia Ltd | Methods and compositions for desensitisation |
GB2341389B (en) | 1998-09-14 | 2000-07-12 | Pan Pacific Pharmaceuticals In | Useful properties of a bee venom protein and gene encoding same |
US20030211510A1 (en) | 1999-06-30 | 2003-11-13 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of lung cancer |
US6780416B1 (en) | 2000-02-18 | 2004-08-24 | Ecole Polytechnique Federale De Lausanne | Bee venom polypeptides and methods of use thereof |
US20020193295A1 (en) | 2001-05-04 | 2002-12-19 | Emanuel Calenoff | Immunogenic peptides and uses thereof |
AU2003245729A1 (en) | 2002-06-27 | 2004-01-19 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for modulating a cytotoxic t lymphocyte immune response |
US7923209B2 (en) | 2003-03-14 | 2011-04-12 | Anergis, S.A. | Allergen peptide fragments and use thereof |
-
2004
- 2004-03-12 US US10/799,514 patent/US7923209B2/en not_active Expired - Fee Related
- 2004-03-15 EP EP04720678A patent/EP1603591A2/en not_active Withdrawn
- 2004-03-15 AU AU2004220274A patent/AU2004220274B2/en not_active Ceased
- 2004-03-15 CA CA2759072A patent/CA2759072A1/en not_active Abandoned
- 2004-03-15 EP EP09015109A patent/EP2204189A3/en not_active Ceased
- 2004-03-15 WO PCT/IB2004/001300 patent/WO2004081028A2/en active Application Filing
- 2004-03-15 CA CA2519083A patent/CA2519083C/en not_active Expired - Fee Related
- 2004-03-15 EP EP10011428A patent/EP2368574A1/en not_active Ceased
- 2004-03-15 JP JP2006506543A patent/JP5389326B2/en not_active Expired - Fee Related
- 2004-03-15 EP EP12006034.8A patent/EP2687230A1/en not_active Withdrawn
-
2005
- 2005-09-14 US US11/226,162 patent/US8075897B2/en not_active Expired - Fee Related
-
2006
- 2006-06-14 JP JP2006165170A patent/JP5390742B2/en not_active Expired - Fee Related
-
2010
- 2010-08-12 AU AU2010212310A patent/AU2010212310B2/en not_active Ceased
-
2011
- 2011-04-20 JP JP2011094277A patent/JP2011201886A/en active Pending
- 2011-10-28 US US13/284,383 patent/US8703144B2/en not_active Expired - Fee Related
-
2013
- 2013-08-20 JP JP2013170083A patent/JP2013256520A/en active Pending
-
2014
- 2014-03-12 US US14/206,354 patent/US9193773B2/en not_active Expired - Fee Related
-
2015
- 2015-11-23 US US14/949,019 patent/US9808503B2/en not_active Expired - Fee Related
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2000044887A1 (en) * | 1999-01-27 | 2000-08-03 | Commissariat A L'energie Atomique | Peptides and proteins for desensitizing subjects allergic to bee venom and compositions containing same |
Non-Patent Citations (7)
Title |
---|
ASTORI M ET AL: "Inducing tolerance by intranasal administration of long peptides in naive and primed CBA/J mice." JOURNAL OF IMMUNOLOGY (BALTIMORE, MD. : 1950) 15 SEP 2000, vol. 165, no. 6, 15 September 2000 (2000-09-15), pages 3497-3505, XP002297948 ISSN: 0022-1767 * |
FELLRATH JEAN-MARC ET AL: "Allergen-specific T-cell tolerance induction with allergen-derived long synthetic peptides: Results of a phase I trial." JOURNAL OF ALLERGY AND CLINICAL IMMUNOLOGY, vol. 111, no. 4, April 2003 (2003-04), pages 854-861, XP009037154 ISSN: 0091-6749 * |
KAEMMERER R ET AL: "DELINEATION OF PLA2 EPITOPES USING SHORT OR LONG OVERLAPPING SYNTHETIC PEPTIDES: INTEREST FOR SPECIFIC IMMUNOTHERAPY" CLINICAL AND EXPERIMENTAL ALLERGY, BLACKWELL SCIENTIFIC PUBLICATIONS, LONDON, GB, vol. 27, no. 9, 1997, pages 1016-1026, XP001024230 ISSN: 0954-7894 * |
LARCHÉ M: "Allergen-derived T cell peptides in immunotherapy" REVUE FRANCAISE D'ALLERGOLOGIE ET D'IMMUNOLOGIE CLINIQUE 2003 FRANCE, vol. 43, no. 1, 2003, pages 59-63, XP002297949 ISSN: 0335-7457 * |
PUNNONEN J: "MOLECULAR BREEDING OF ALLERGY VACCINES AND ANTIALLERGIC CYTOKINES" INTERNATIONAL ARCHIVES OF ALLERGY AND IMMUNOLOGY, XX, XX, vol. 121, no. 3, 2000, pages 173-182, XP000979180 ISSN: 1018-2438 * |
SPERTINI FRANCOIS ET AL: "Allergen peptide immunotherapy: Results of a safety and immunogenecity trial with phospholipase A2-derived long peptides in bee venom hypersensitive patients" JOURNAL OF ALLERGY AND CLINICAL IMMUNOLOGY, vol. 105, no. 1 part 2, January 2000 (2000-01), pages S378-S379, XP009037157 & 56TH ANNUAL MEETING OF THE AMERICAN ACADEMY OF ALLERGY, ASTHMA AND IMMUNOLOGY.; SAN DIEGO, CALIFORNIA, USA; MARCH 03-08, 2000 ISSN: 0091-6749 * |
VON GARNIER CHRISTOPHE ET AL: "Allergen-derived long peptide immunotherapy down-regulates specific IgE response and protects from anaphylaxis" EUROPEAN JOURNAL OF IMMUNOLOGY, vol. 30, no. 6, June 2000 (2000-06), pages 1638-1645, XP002297947 ISSN: 0014-2980 * |
Cited By (33)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US9168295B2 (en) | 2007-06-01 | 2015-10-27 | Circassia Limited | Vaccine peptide combinations |
WO2009081440A2 (en) * | 2007-12-21 | 2009-07-02 | Lofarma S.P.A. | Allergens and allergoids from bee venom |
WO2009081440A3 (en) * | 2007-12-21 | 2009-09-17 | Lofarma S.P.A. | Allergens and allergoids from bee venom |
US8637037B2 (en) | 2007-12-21 | 2014-01-28 | Lofarma S.P.A. | Allergens and allergoids from bee venom |
AU2010212039B2 (en) * | 2009-02-09 | 2014-09-18 | Anergis S.A. | Contiguous overlapping peptides for treatment of birch pollen allergy |
US8343503B2 (en) | 2009-02-09 | 2013-01-01 | Anergis S.A. | Contiguous overlapping peptides for treatment of birch pollen allergy |
EP2393511B2 (en) † | 2009-02-09 | 2020-03-25 | Anergis Sa | Contiguous overlapping peptides for treatment of birch pollen allergy |
WO2010089671A3 (en) * | 2009-02-09 | 2010-10-14 | Anergis S.A. | Contiguous overlapping peptides for treatment of birch pollen allergy |
EP2393511B1 (en) | 2009-02-09 | 2016-04-06 | Anergis Sa | Contiguous overlapping peptides for treatment of birch pollen allergy |
WO2010089671A2 (en) * | 2009-02-09 | 2010-08-12 | Anergis S.A. | Contiguous overlapping peptides for treatment of birch pollen allergy |
AU2010212039C1 (en) * | 2009-02-09 | 2015-03-05 | Anergis S.A. | Contiguous overlapping peptides for treatment of birch pollen allergy |
CN102762225A (en) * | 2010-02-15 | 2012-10-31 | 切尔卡西亚有限公司 | Peptides for vaccines against birch allergy |
WO2011098778A3 (en) * | 2010-02-15 | 2011-12-15 | Circassia Limited | Peptides for vaccines against birch allergy |
EP3056213A1 (en) * | 2010-02-15 | 2016-08-17 | Circassia Limited | Peptides for vaccine against birch allergy |
CN102762225B (en) * | 2010-02-15 | 2015-05-13 | 切尔卡西亚有限公司 | Peptides for vaccines against birch allergy |
AU2011214104B2 (en) * | 2010-02-15 | 2015-05-28 | Circassia Limited | Peptides for vaccine against birch allergy |
US9017689B2 (en) | 2010-02-15 | 2015-04-28 | Circassia Limited | Peptides for vaccine against birch allergy |
AU2011245142B2 (en) * | 2010-04-30 | 2016-10-06 | Allovate, Llc | Methods, articles and kits for allergic desensitization via the oral mucosa |
EP4011362A1 (en) * | 2010-04-30 | 2022-06-15 | Allovate, LLC | Methods, articles and kits for allergic desensitization via the oral mucosa |
EP2563316A1 (en) * | 2010-04-30 | 2013-03-06 | Allovate, LLC | Methods, articles and kits for allergic desensitization via the oral mucosa |
EP2563316A4 (en) * | 2010-04-30 | 2014-06-11 | Allovate Llc | Methods, articles and kits for allergic desensitization via the oral mucosa |
JP2014501514A (en) * | 2010-12-01 | 2014-01-23 | バイオメイ アクツェンゲゼルシャフト | Hypoallergenic polypeptides for the treatment of dust mite allergy |
WO2013001362A3 (en) * | 2011-06-27 | 2013-07-11 | Anergis S.A. | Contiguous overlapping peptides for treatment of ragweed pollen allergy |
US9005627B2 (en) | 2011-06-27 | 2015-04-14 | Anergis S.A. | Contiguous overlapping peptides for treatment of ragweed pollen allergy |
EP2914286B1 (en) * | 2012-10-30 | 2021-08-18 | Aravax Pty Ltd | Novel immunotherapeutic molecules and uses thereof |
US11096994B2 (en) | 2012-10-30 | 2021-08-24 | Aravax Pty Ltd | Immunotherapeutic molecules and uses thereof |
US11980658B2 (en) | 2012-10-30 | 2024-05-14 | Aravax Pty Ltd | Immunotherapeutic molecules and uses thereof |
AU2014276484B2 (en) * | 2013-06-06 | 2018-01-25 | Anergis S.A. | Contiguous overlapping peptides for treatment of house dust mites allergy |
CN105307679A (en) * | 2013-06-06 | 2016-02-03 | 阿尼尔吉斯股份公司 | Contiguous overlapping peptides for treatment of house dust mites allergy |
WO2014195803A2 (en) | 2013-06-06 | 2014-12-11 | Anergis S.A. | Contiguous overlapping peptides for treatment of house dust mites allergy |
WO2014195803A3 (en) * | 2013-06-06 | 2015-05-28 | Anergis S.A. | Contiguous overlapping peptides for treatment of house dust mites allergy |
US11266737B2 (en) | 2013-09-25 | 2022-03-08 | Aravax Pty Ltd | Immunotherapeutic composition and uses thereof |
US11986522B2 (en) | 2013-09-25 | 2024-05-21 | Ara Vax Pty Ltd | Immunotherapeutic composition and uses thereof |
Also Published As
Publication number | Publication date |
---|---|
US7923209B2 (en) | 2011-04-12 |
US20160095899A1 (en) | 2016-04-07 |
CA2519083C (en) | 2017-06-13 |
US20120100167A1 (en) | 2012-04-26 |
US9808503B2 (en) | 2017-11-07 |
JP2013256520A (en) | 2013-12-26 |
JP2011201886A (en) | 2011-10-13 |
CA2759072A1 (en) | 2004-09-23 |
AU2010212310B2 (en) | 2012-01-19 |
EP2687230A1 (en) | 2014-01-22 |
AU2004220274B2 (en) | 2010-05-13 |
EP1603591A2 (en) | 2005-12-14 |
US20070110673A1 (en) | 2007-05-17 |
US20140193444A1 (en) | 2014-07-10 |
WO2004081028A3 (en) | 2005-02-17 |
JP2006520380A (en) | 2006-09-07 |
EP2368574A1 (en) | 2011-09-28 |
JP5389326B2 (en) | 2014-01-15 |
EP2204189A3 (en) | 2010-09-29 |
JP2007001975A (en) | 2007-01-11 |
CA2519083A1 (en) | 2004-09-23 |
US9193773B2 (en) | 2015-11-24 |
EP2204189A2 (en) | 2010-07-07 |
JP5390742B2 (en) | 2014-01-15 |
US8703144B2 (en) | 2014-04-22 |
AU2010212310A1 (en) | 2010-09-02 |
US8075897B2 (en) | 2011-12-13 |
US20040241178A1 (en) | 2004-12-02 |
AU2004220274A1 (en) | 2004-09-23 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US9808503B2 (en) | Allergen peptide fragments and use thereof for treatment of birch pollen allergies | |
JP2006520380A5 (en) | ||
Himly et al. | Art v 1, the major allergen of mugwort pollen, is a modular glycoprotein with a defensin‐like and a hydroxyproline‐rich domain | |
Valenta et al. | Genetically engineered and synthetic allergen derivatives: candidates for vaccination against type I allergy | |
Focke et al. | Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination | |
Müller et al. | Type I skin reactivity to native and recombinant phospholipase A2 from honeybee venom is similar | |
US20090130130A1 (en) | Mutant allergen(s) | |
JP5824452B2 (en) | Hypoallergenic hybrid polypeptide for allergy treatment | |
JP3649460B2 (en) | Japanese cedar pollen allergen Cry j II epitope | |
AU2012202084B9 (en) | Allergen peptide fragments and use thereof | |
EP1224215B2 (en) | NON-ANAPHYLACTIC FORMS OF GRASS POLLEN Ph1 p 6 ALLERGEN AND THEIR USE | |
Mohapatra et al. | Therapeutic potential of recombinant allergens | |
Thomas et al. | Recombinant allergens for immunotherapy | |
JP4176820B2 (en) | Cedar pollen allergen CryjII epitope | |
Singh et al. | Immune response to n-terminal and c-terminal deletion mutants of Aspergillus fumigatus major allergen ASP F 3 | |
Zeiler | Immune Response of Cow-asthmatic Patients Against the Major Bovine Allergen Bos d 2, a Lipocalin Protein | |
Saarelainen | Immune Response to Lipocalin Allergens-IgE and T-cell Cross-Reactivity (IgE-ja T-soluvälitteinen ristireaktiivisuus eläinperäisille lipokaliiniallergeeneille) | |
SEHON et al. | PLENARY LECTURES 113 THERAPEUTIC POTENTIAL OF RECOMBINANT ALLERGENS |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG UZ VC VN YU ZA ZM ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): BW GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
DPEN | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed from 20040101) | ||
WWE | Wipo information: entry into national phase |
Ref document number: 2519083 Country of ref document: CA Ref document number: 2006506543 Country of ref document: JP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 11226162 Country of ref document: US |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2004220274 Country of ref document: AU |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2004720678 Country of ref document: EP |
|
ENP | Entry into the national phase |
Ref document number: 2004220274 Country of ref document: AU Date of ref document: 20040315 Kind code of ref document: A |
|
WWP | Wipo information: published in national office |
Ref document number: 2004220274 Country of ref document: AU |
|
WWP | Wipo information: published in national office |
Ref document number: 2004720678 Country of ref document: EP |
|
WWP | Wipo information: published in national office |
Ref document number: 11226162 Country of ref document: US |