WO2004013165A1 - Pegylated t1249 polypeptide - Google Patents

Pegylated t1249 polypeptide Download PDF

Info

Publication number
WO2004013165A1
WO2004013165A1 PCT/EP2003/007711 EP0307711W WO2004013165A1 WO 2004013165 A1 WO2004013165 A1 WO 2004013165A1 EP 0307711 W EP0307711 W EP 0307711W WO 2004013165 A1 WO2004013165 A1 WO 2004013165A1
Authority
WO
WIPO (PCT)
Prior art keywords
nht1249
pharmaceutical composition
compound
pegylated
polypeptide
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2003/007711
Other languages
French (fr)
Inventor
Pascal Sebastian Bailon
Chee-Youb Won
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
F Hoffmann La Roche AG
Original Assignee
F Hoffmann La Roche AG
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to BR0312841-5A priority Critical patent/BR0312841A/en
Priority to EP03766191A priority patent/EP1546193A1/en
Priority to CA002492954A priority patent/CA2492954C/en
Priority to IL16603703A priority patent/IL166037A0/en
Priority to JP2004525220A priority patent/JP4381302B2/en
Priority to HR20050025A priority patent/HRP20050025A2/en
Priority to AU2003250079A priority patent/AU2003250079B2/en
Priority to MXPA05000798A priority patent/MXPA05000798A/en
Priority to NZ537493A priority patent/NZ537493A/en
Application filed by F Hoffmann La Roche AG filed Critical F Hoffmann La Roche AG
Publication of WO2004013165A1 publication Critical patent/WO2004013165A1/en
Priority to NO20050067A priority patent/NO20050067L/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • C07K14/08RNA viruses
    • C07K14/15Retroviridae, e.g. bovine leukaemia virus, feline leukaemia virus human T-cell leukaemia-lymphoma virus
    • C07K14/155Lentiviridae, e.g. human immunodeficiency virus [HIV], visna-maedi virus or equine infectious anaemia virus
    • C07K14/16HIV-1 ; HIV-2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/18Antivirals for RNA viruses for HIV
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/15011Lentivirus, not HIV, e.g. FIV, SIV
    • C12N2740/15022New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16111Human Immunodeficiency Virus, HIV concerning HIV env
    • C12N2740/16122New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes

Definitions

  • fusion the outer membrane of the virus fuses with the membrane of the host cell.
  • the outer membrane of the HIV virus fuses with the membrane of the CD4+ T cell during reproduction.
  • T1249 is a member of a new class of antiviral agents that inhibit virus/membrane fusion. In the case of HIV, this provides two salutary effects: the reproduction of HIV is blocked and resultant death of the CD4+ T cells does not
  • T1249 dose-ranging in a clinical trial suggests that daily dose of T1249, and not prior antiretroviral treatment experience, including mutations to all approved classes of HIV drugs, is the only variable that is associated with the viral load reduction among treatment-experienced patients. Additional experiments show that the in vitro activity of T1249 is not affected by mutations associated with resistance to reverse transcriptase inhibitors and protease inhibitors.
  • T1249 is generally administered by injection. Current therapeutic protocols often involve more than one daily injection.
  • the present invention provides a compound of formula:
  • R 1 is methoxy, m is 1 , n is from 100 to 750, and p is 3.
  • composition comprising, in admixture with a pharmaceutically acceptable excipient, a compound of formula (I), wherein R 1 ⁇ m, n, p, and NHT1249 are defined as above.
  • R t is methoxy
  • m is 1
  • n is from 100 to 750
  • p is 3.
  • the present invention further provides a method of inhibiting HIV infection comprising administering a pharmaceutical composition comprising, in admixture with a pharmaceutically acceptable excipient, a compound of formula (I), wherein R-i, m, n, p, and NHT1249 are defined as above. If the present invention relates to a "method of inhibiting HIV infection comprising a compound", a "use of a compound for the preparation, of a medicament for the inhibition of HIV" is meant.
  • R ⁇ is methoxy, m is 1 , n is from 100 to 750, and p is 3.
  • a method for making a pegylated T1249 polypeptide comprising reacting a T1249 polypeptide with a polyethylene glycol aldehyde of formula:
  • Figure 3 shows N-terminal (Edman) sequencing of the collected HPLC fraction PEG-34 ( Figure 1).
  • Figure 4 shows the concentration-time profile of mPEG20k-CMAB-T1249 in rats after a single subcutaneous dose administration.
  • Figure 5 shows the concentration-time profile of T1249 in rats after a single subcutaneous dose administration.
  • Figure 6 shows the effect of T1249 and mPEG 2 o k -CMAB-T1249 dosing on the HIV-1 viral load in SCID mice.
  • T1249 is a "fusion inhibitor" polypeptide.
  • T1249 consists of 39 amino acids.
  • the polypeptide sequence of T1249 is:
  • the N-terminus (or amino terminus) amino acid is tryptophane (W).
  • the C- terminus (or carboxy terminus) amino acid is phenyalanine (F).
  • T1249 shall be understood to mean [SEQ.ID.NO:1], optionally blocked at the phenylalanine C-terminus with an amino group.
  • the phenylalanine C-terminus is either -COOH or -CONH 2 .
  • the present invention provides pegylated T1249 compounds of the following formula:
  • Ri is a capping group
  • m is from 1 to 17
  • n is from 10 to 1 ,000
  • p is from 1 to 3
  • NHT1249 is a T1249 polypeptide covalently bonded through its terminal ⁇ - amino group.
  • the Ri "capping group” is any suitable chemical group which, depending upon preference, is generally unreactive or generally reactive with other chemical moieties.
  • the polyethylene glycol is covalently bonded to the ⁇ -amino group of T1249.
  • the Ri capping group is selected to permit or prevent bifunctionality, e.g., covalent attachment to a second chemical moiety of interest.
  • R capping groups include: hydrogen, hydroxyl, lower alkyl, lower alkoxy, lower cycloalkyl, lower alkenyl, lower cycloalkenyl, aryl, and heteroaryl.
  • lower alkyl means a straight-chain or branched- chain alkyl group containing from 1 to 7, preferably from 1 to 4, carbon atoms, such as methyl, ethyl, n-propyl, isopropyl, n-butyl, sec.butyl, tert.butyl, n-pentyl, n-hexyl, n-heptyl and the like.
  • the "lower alkyl” is optionally substituted with one or more groups independently selected from halogen, lower alkyl, lower alkoxy, lower cycloalkyl, lower alkenyl, lower cycloalkenyl, aryl, and heteroaryl.
  • lower alkoxy means a lower alkyl group as defined earlier which is bonded via an oxygen atom, with examples of lower alkoxy groups being methoxy, ethoxy, n-propoxy, isopropoxy, n-butoxy, sec.butoxy, tert.butoxy, n- pentoxy and the like.
  • the "lower alkoxy” is optionally substituted with one or more groups independently selected from halogen, lower alkyl, lower alkoxy, lower cycloalkyl, lower alkenyl, lower cycloalkenyl, aryl, and heteroaryl.
  • lower cycloalkyl means cycloalkyl group containing from 3 to 7, preferably from 4 to 6, carbon atoms, i.e., cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl or cycloheptyl.
  • the "lower cycloalkyl” is optionally substituted with one or more groups independently selected from halogen, lower alkyl, lower alkoxy, lower cycloalkyl, lower alkenyl, lower cycloalkenyl, aryl, and heteroaryl.
  • lower alkenyl means straight-chain or branched- chain alkenyl group containing from 2 to 7, preferably from 2 to 5, carbon atoms, e.g., ethenyl, butenyl, pentenyl, hexenyl and the like.
  • the "lower alkenyl” is
  • lower cycloalkenyl means a cycloalkenyl group containing from 4 to 7 carbon atoms, e.g., cyclobutenyl, cyclopentenyl, cyclohexenyl and the like.
  • the "lower cycloalkenyl” is optionally substituted with one or more groups independently selected from halogen, lower alkyl, lower alkoxy, lower cycloalkyl, lower alkenyl, lower cycloalkenyl, aryl, and heteroaryl.
  • aryl means a phenyl or naphthyl group which is unsubstituted or optionally mono- or multiple-substituted by halogen, lower alkyl, lower alkoxy, trifluoromethyi, hydroxyl, carboxylic acid, carboxylic ester, nitro, amino, or phenyl, particularly by halogen, lower alkyl, lower alkoxy, trifluoromethyi, hydroxyl, nitro, amino and phenyl.
  • heteroaryl means a 5- or 6-membered heteroaromatic group which contains one or more hetero atoms selected from N, S, and O and which may be benz-fused and/or substituted in the same manner as “aryl” defined earlier.
  • Preferred generally unreactive Ri capping groups include methoxy, hydroxy, or benzyloxy.
  • An especially preferred, Ri capping group is methoxy.
  • Ri is methoxy the pegylated polypeptide compounds are sometimes referred to herein, in part, as “mPEG” compounds, wherein the "m” stands for methoxy.
  • Ri capping group is generally reactive with other chemical moieties
  • Ri is a functional group capable of reacting with some functional group, such as an amine and/or sulfhydryl in a peptide and/or protein.
  • Ri may be a functional group that is capable of reacting readily with electrophilic or nucleophilic groups on other molecules, in contrast to those groups that require strong catalysts or highly impractical reaction conditions in order to react.
  • the polyethylene glycol aldehyde may covalently bond with another chemical moiety.
  • halogen means fluorine, chlorine, bromine, or iodine.
  • a preferred generally reactive Ri capping group is O
  • the first m, n, and/or p may be the same or different from the second m, n, and/or p in the formula. It is preferred, however, that both m's have the same value, both n's have the same value, and both the p's have the same value.
  • m is from 1 to 17. In a preferred embodiment, m is from 1 to 14. More preferably m is from 1 to 7, and even more preferably, m is from 1 to 4. Most preferably, m is 1.
  • n is from 10 to 1 ,000. In a preferred embodiment of the present invention n is from 20 to 1 ,000. Preferably, n is from 50 to 1 ,000, even more preferably n is from 75 to 1 ,000. Most preferably, n is from 100 to 750.
  • p is from 1 to 3.
  • p is 3.
  • p is 3, Ri is methoxy, m is 1 , and n is from 100 to 750; or p is 2, Ri is methoxy, m is 1 , and n is from 100 to 750; or p is 1 , Ri is methoxy, m is 1 , and n is from 100 to 750.
  • the pegylated T1249 compounds of the invention covalently link the ⁇ -amino group of T1249 to a polyethylene glycol derivative having a particular structure.
  • These pegylated compounds may be made in any manner desired, but generally they are prepared by reacting T1249 with separately prepared polyethylene glycol derivatives.
  • the T1249 polypeptide may be pegylated by blocking all lysine residues and reacting this blocked T1249 with a polyethylene glycol derivative. The blocked lysine residues of the T1249 polypeptide are then deblocked, resulting in a terminally pegylated T1249.
  • T1249 may be produced by incorporating cDNA coding compounds of the invention into functional viral or circular plasmid DNA vectors.
  • the vectors or plasmids can be used to transfect or transform selected microorganisms.
  • the transformed or transfected microorganisms can be cultured under conditions that are conducive to express vector-borne DNA sequences and isolation of the desired peptides from the growth medium can be achieved.
  • T1249 may also be prepared by standard recombinant DNA technology using techniques that are well known in the art. For example, the procedures outlined in Sambrook et al. Molecular Cloning: A Laboratory Manual, 2nd edition, (Cold Spring Harbor Press, Cold Spring Harbor, N.Y.) or Ausubel et al., Current
  • T1249 A particular method for making T1249 is described in U.S. Patent 6,258,7872 and U.S. Patent 6,348,568, each of which is hereby incorporated by reference.
  • T1249 may be purified by any suitable means.
  • ion exchange, gel filtration chromatography and/or a reverse- phase column/HPLC system can be used to purify full length T1249 from fragments thereof.
  • a blocking/protecting group attached to the N-terminus e.g., acyl group
  • the C-terminus e.g., amino group
  • T1249 The amino acid sequence of T1249 may be confirmed and identified using standard amino acid analysis as well as manual and automated Edman degradation and determination of each amino acid. HPLC analysis and mass spectrometry may also be used to verify the production of T1249.
  • Polyethylene glycol aldehyde compounds which may be reacted with T1249 may also be made in any desired manner. It is preferred, however, that the polyethylene glycol be made in accordance with the methods described in U.S. Patent Application Serial No. 60/398,196, filed July 24, 2002, entitled “Polyethylene Glycol Aldehydes,” the entirety of which is hereby incorporated by reference.
  • the polyethylene glycol aldehyde used to pegylated the T1249 may be prepared by any suitable means.
  • One preferred polyethylene glycol aldehyde is prepared as follows:
  • Polyethylene glycol aldehydes of varying size may be prepared by following the general reaction scheme above.
  • the pegylated T1249 compounds of the present invention may be prepared by any suitable means. Further provided by the invention, however, is a method for pegylating a T1249 polypeptide comprising reacting a T1249 polypeptide, NHT1249, with a polyethylene glycol aldehyde of formula: O
  • the pegylated T1249 is prepared by adding T1249 and the PEG reagent in a molar ratio range of 1 :1 to 1 :100.
  • the T1249 has a free ⁇ -amino group (any acyl group is removed) and either a free carboxy group or an amino-protected carboxy group, as discussed above.
  • the reaction mixture is placed in a borate or phosphate buffer at room temperature or 4 degrees Celsius for about .5 to 24 hours at a pH range of 5.5 to 7.4.
  • the molar ratio of PEG reagent to peptide/proteins is between 1 :1 to 100:1.
  • the concentration of peptide/proteins is between 1 to 10 mg/ml.
  • the concentration of buffer is usually 10 to 500 mM.
  • the pegylated T1249 is purified by taking the reaction mixture of pegylated T1249 and diluting it with an equilibration buffer (20mM Tris, pH 7.5). The resulting mixture is then applied on a Q-Sepharose column. After the mixture is applied on the QA column, it is washed with the equilibration buffer eluted with 75 M NaCl; eluted with 200 mM NaCl; eluted with 1 M NaCl; and regenerated with 1 M HOAC + 1 M NaCl and 0.5 NaOH.
  • reverse phase HPLC it is possible to readily separate and isolate the N-terminal, monopegylated product from other byproducts in the mixture.
  • pegylated T1249 polypeptide of the following formula:
  • n is from 10 to 1 ,000 and NHT1249 is a T1249 polypeptide covalently bonded through its terminal ⁇ -amino group.
  • n is approximately 225, for example, 227. In another embodiment, n is approximately 450.
  • This pegylated T1249 polypeptide may be made in any desired manner, preferably, it is made by the method described in Example 7.
  • the pharmaceutical compositions of the invention comprise, in admixture with a pharmaceutically acceptable excipient, a compound of formula (I), wherein Ri, m, n, p, and NHT1249 are defined as above
  • compositions of the present invention comprising pegylated T1249 polypeptides, or the salts thereof, may be manufactured in any desired manner, e.g., by means of conventional mixing, encapsulating, dissolving,
  • Suitable excipients for injection include water, alcohols, polyols, glycerine, vegetable oils, phospholipids and surfactants.
  • intraperitoneally, intramuscularly, subcutaneously, intravenously, or by continuous infusion may conveniently be presented in unit dosage form and may be prepared by conventional pharmaceutical techniques.
  • Such techniques include the step of bringing into association the pegylated T1249 polypeptides and the pharmaceutical carrier(s) or excipient(s).
  • the formulations are prepared by uniformly and intimately bringing into association the pegylated T1249 polypeptides with liquid carriers.
  • Preferred unit dosage formulations are those containing a daily dose, daily sub-dose, weekly dose, weekly sub-dose, as herein above recited, or an appropriate fraction thereof, of the administered ingredient.
  • the pegylated T1249 polypeptide is in unit dosage form.
  • unit dosage form means that an amount appropriate for a single dose the pegylated T1249 polypeptide is in a premeasured and/or prepackaged form. This allows for convenient preparation of the pegylated T1249 polypeptide for administration, and may even allow for self-administration by the patient.
  • the unit dosage amount will obviously depend on the amount of pegylated T1249 polypeptide to be delivered, and the frequency of dosing.
  • the pegylated T1 49 polypeptide may also be provided in a lyophilized powder form in a unit dosage amount, suitable for reconstitution with a pharmaceutically acceptable excipient just prior to the time of administration.
  • a particular pharmaceutical composition of the invention comprises, in admixture with a pharmaceutically acceptable excipient, a compound of formula (I), wherein Ri is methoxy, m is 1 , n is from 100 to 750, and p is 3.
  • Another pharmaceutical composition of the invention is a pharmaceutical composition comprising, in admixture with a pharmaceutically acceptable excipient, a compound of formula (III), wherein n is from 10 to 1 ,000 and NHT1249 is a T1249 polypeptide covalently bonded through its terminal ⁇ -amino group.
  • n is approximately 225, for example 227.
  • n is approximately 450.
  • the present invention further provides methods of inhibiting HIV infection comprising administering to a patient a pharmaceutical composition comprising, in admixture with a pharmaceutically acceptable excipient, a compound of formula (I), wherein Ri, m, n, p, and NHT1249 are defined as above.
  • the pegylated T1249 polypeptides are generally administered in the manner (unpegylated) T1249 polypeptides are presently administered. Modifications may be made, however, to take advantage of the improved pharmacokinetic properties of the pegylated T1249 polypeptides.
  • the pharmaceutical composition may be administered in any suitable manner and route.
  • the pegylated T1249 polypeptide is administered in the form of an injectable solution or suspension.
  • the injectable solution or suspension is administered by subcutaneous injection or intravenously.
  • the pegylated T1249 polypeptide is administered though a transdermal delivery device, e.g., a transdermal patch.
  • the pharmaceutical composition may be administered in any suitable dosage and schedule.
  • the pharmaceutical compositions of the invention can be administered in any form, and via any route, desired.
  • the pegylated T1249 polypeptides of the present invention are administered parenterally, for example, in the form of injection solutions.
  • a therapeutically effective amount is within the skill in the art, and the therapeutically effective amount or dosage of a pegylated T1249 polypeptide according to this invention may vary and will be adjusted to the individual requirements in each particular case.
  • the dosage may be administered as a single dose, in divided doses, or as continuous infusion.
  • the present invention also provides a method of inhibiting HIV infection comprising administering a pharmaceutical composition comprising, in admixture with a pharmaceutically acceptable excipient, a compound of formula (I), wherein Ri is methoxy, m is 1 , n is from 100 to 750, and p is 3.
  • n is from 10 to 1 ,000 and NHT1249 is a T1249 polypeptide covalently bonded through its terminal ⁇ -amino group.
  • n is approximately 225, for example, 227. In another embodiment, n is approximately 450.
  • Example 1 is provided to further illustrate the compounds, compositions, and methods of the present invention. These examples are illustrative only and are not intended to limit the scope of the invention in any way.
  • Example 1 is provided to further illustrate the compounds, compositions, and methods of the present invention. These examples are illustrative only and are not intended to limit the scope of the invention in any way.
  • Example 1 is provided to further illustrate the compounds, compositions, and methods of the present invention. These examples are illustrative only and are not intended to limit the scope of the invention in any way.
  • mPEGio k t-butyl carboxymethyl ester (26.5 g) was then dissolved in 350 ml of 1 N sodium hydroxide and the solution was stirred at room temperature overnight. The pH of the mixture was adjusted to 2.5 by addition of 6 N hydrochloric acid, and the mixture was extracted with dichloromethane. The organic layer was dried over sodium sulfate, filtered, concentrated, and precipitated into diethyl ether. The product m-PEGio k -carboxymethyl acid was collected by filtration and dried under vacuum. Yield: 24 g.
  • mPEGio k -butanoacetal (2 g, 0.2 mmol) was then dissolved in 20 ml of 80 % CF 3 COOH and the solution was stirred at room temperature overnight.
  • the pH of the mixture was adjusted to 6.0 by addition of 1 N NaOH solution, and sodium chloride (10 wt %) was added and then the pH of the solution was adjusted to 7.0 by addition of 1 N NaOH.
  • the mixture was extracted with dichloromethane. The organic layer was dried over sodium sulfate, filtered, concentrated, and precipitated into diethyl ether.
  • the product mPEGio k -butanoaldehyde was collected by filtration and dried under vacuum. Yield: 1.7 g.
  • Butanoaldehyde of PEG 10kDa (mPEGiorCMAB) prepared according to Example 1 was added to 20 mg of T1249 (purity 93.7 %) in 1.0 ml of buffer (50 mM potassium phosphate pH 6.5) in a molar ratio of 5 moles of reagent per one mole of T1249.
  • the T1249 polypeptide was deacylated at the ⁇ -amino terminus, but protected at the carboxyl terminus by -NH 2 .
  • 10% (v/v) of 0.5 M sodium cyanoborohydride solution in water was added and stirred for 4 hours at room temperature.
  • Pegylated T-1249 was purified from the reaction mixture using ion exchange chromatography (QA). A step gradient with increasing salt concentrations from 65 mM to 1 M NaCl in 20 mM Tris, pH 7.5 was used to separate pegylated T1249 and unmodified T1249.
  • mPEG 20 k t-butyl carboxymethyl ester (28 g) was then dissolved in 750 ml of 1 N sodium hydroxide and the solution was stirred at room temperature overnight. The pH of the mixture was adjusted to 2.5 by addition of 6 N hydrochloric acid, and the mixture was extracted with dichloromethane. The organic layer was dried over sodium sulfate, filtered, concentrated, and precipitated into diethyl ether. The product m-PEG 2 o k -carboxymethyl acid was collected by filtration and dried under vacuum. Yield: 25 g.
  • Butanoaldehyde of PEG 20kDa prepared according to Example 3 was added to 20mg of T1249 (purity 93.7%) which was dissolved in 0.4 ml of 50 mM borate, pH 9.5 buffer and then diluted 10-fold with 100 mM potassium phosphate pH 6.5 in a molar ratio of 10 moles of reagent per one mole of T1249.
  • the T1249 purity 93.76% which was dissolved in 0.4 ml of 50 mM borate, pH 9.5 buffer and then diluted 10-fold with 100 mM potassium phosphate pH 6.5 in a molar ratio of 10 moles of reagent per one mole of T1249.
  • polypeptide was deacylated at the ⁇ -amino terminus, but protected at the carboxyl
  • the % Mono-, % di-, and % tri-pegylated T1249 with mPEG 20 ⁇ - butanoaldehyde was determined through a series of experiments where the T1249:PEG molar ratio, pH of the reaction solution, and reaction time were varied as seen below in Tables 1 , 2, and 3. The purpose of these experiments was to optimize the pegylation parameters.
  • butanoaldehyde of PEG 20kDa (mPEG 20k -CMAB) prepared according to Example 3 was added to 5 mg of T1249 (purity 93.7 %) in 50 mM potassium phosphate pH 6.5.
  • the T1249 polypeptide was deacylated at the ⁇ - amino terminus, but protected at the carboxyl terminus by -NH 2 .
  • the molar ratio of PEG reagent to T1249 was 1 :1 , 1 :2, and 1 :5.
  • 10% (v/v) of 0.5 M sodium cyanoborohydride solution in water was added. An aliquot was removed at the predetermined time interval of 2, 4, 6, and 24 hours at room temperature.
  • butanoaldehyde of PEG 20kDa (mPEG 20k -CMAB) prepared according to Example 3 was added to 5 mg of T1249 (purity 93.7 %) in 50 mM potassium phosphate pH 6.0 in a molar ratio of ten moles of PEG reagent per one mole of T1249.
  • the T1249 polypeptide was deacylated at the ⁇ -amino terminus, but protected at the carboxyl terminus by -NH 2 .
  • 10% (v/v) of 0.5 M sodium cyanoborohydride solution in water was added. An aliquot was removed at the predetermined time interval of 2, 4, 6, and 24 hours at room temperature.
  • butanoaldehyde of PEG 20kDa (mPEG 20k -CMAB) prepared according to Example 3 was added to 5 mg of T1249 (purity 93.7%) in 50 mM potassium phosphate pH 5.5 in a molar ratio of ten moles of PEG reagent per one mole of T1249.
  • the T1249 polypeptide was deacylated at the ⁇ -amino terminus, but protected at the carboxyl terminus by -NH 2 .
  • 10% (v/v) of 0.5 M sodium cyanoborohydride solution in water was added. An aliquot was removed at the predetermined time interval of 2, 4, 6, and 24 hours at room
  • the PEG containing peptide fraction was then subjected to automated N- terminal (Edman) sequencing on a Perkin Elmer (ABI) precise instrument.
  • the MALDI TOF mass spectrum obtained from the intact PEG modified T1249 is shown in figure 2A.
  • the measured molecular weight was 26758 Da. Note the presence of some non modified peptide. The origin of it is currently not known, however it could potentially be caused by the measurement in the mass spectrometer itself.
  • the MALDI TOF mass spectrum obtained from fraction PEG- 34 (figure 1) is shown in figure 2B.
  • the measured molecular weight was 23083 Da.
  • the molecular weight as well as the appearance of the mass spectrum identify this HPLC fraction PEG-34 as the one containing the PEG modified peptide(s).
  • the presence of PEG in this HPLC fraction could also be shown by nano spray ESI mass spectrometry (data not shown). Results from the automated N-terminal sequencing (Edman) are shown in
  • a propionaldehyde of PEG 10kDa having the following structure is used.
  • Pegylated T1249 was purified from the reaction mixture using ion exchange chromatography (QA). The structure of the pegylated T1249 follows:
  • the MAGI cell line was derived from parental HeLa cells by introducing genes for CD4 and an HIV-1 LTR-driven b-gal reporter with an amphotropic retrovirus vector (Kimpton J, Emerman M, J Virol 66:2232-9, 1992).
  • the cMAGI cell line was derived from the MAGI cell line by introduction of the CCR5 gene using the amphotropic retroviral vector, PA317 (Chackerian B, Long EM, Luciw PA, Overbaugh J, J Virol 71 :3932-9, 1997).
  • test compound dilution was tested in duplicate against a virus inoculum adjusted to yield approximately 1500-2000 infected cells/well of a 48 well micro titer plate.
  • the test compound was added to the cMAGI or MAGI cells, followed by the virus inocula, and 24 hrs later, an inhibitor of infection and cell-cell fusion (Wild C, Greenwell T, Matthews T, AIDS Res Hum Retroviruses 9:1051-3, 1993) was added to prevent secondary rounds of infection and cell-cell virus spread.
  • the cells were cultured for 2 more days, fixed and stained with the X-gal substrate to detect infected cells.
  • the number of infected cells for each control and test compound dilution were determined with the CCD-imager.
  • IC50 is defined as the dilution of a test compound resulting in a 50% reduction in infectious virus titer.
  • IC90 is defined as the dilution resulting in a 90% reduction in infectious titer.
  • the mPEG 2 o k -CMAB-T1249 was suspended in water and titrated with NaOH to bring to a pH of 6.8.
  • the mPEG 20k -CMAB-T1249 suspension was then solubilized in a minimum volume of sodium carbonate buffer and diluted with PBS buffer to a pH of 7.3 - 7.4.
  • the amount of PEG-T1249 employed was sufficient to provide a concentration of 150 mg mPEG 20k -CMAB-T1249 per ml in the final formulation.
  • the rats were dosed at 8 mg of active ingredient/kg body weight. After dose administration, about 1 ml of blood was collected from the retro- orbital sinus at each time point. The time points were 0.5, 1 , 3, 6, 8, 16, 24, 32, 48, 72, and 96 hours after dose administration. All blood samples were kept at room temperature for up to 30 minutes and serum was separated with cold centrifugation.
  • the reported pharmacokinetic parameters were derived from pooled serum concentration profiles of mPEG 20k -CMAB-T1249, its metabolite, and the combination of the two, using non-compartmental analysis via WinNonlin, version 3.3 (Pharsight Corporation, Mountain View, CA), a commercial kinetic analysis software package.
  • Results Fig. 4 shows the concentration-time profile of mPEG 20 k-CMAB-T1249 in rats after a single subcutaneous dose administration.
  • no level of mPEG 20k -CMAB-T1249 or a metabolite was detected, indicating a slow absorption process from the injection site.
  • the first detectable concentration was found at 6 hours post dosing, which represents a slow course of metabolite formation.
  • the lowest serum concentrations of mPEG 20k -CMAB-T1249 and its metabolite were detected at 48 and 72 hours post dosing, respectively.
  • Each treatment group consisted of 9 Sprague-Dawley rats (Charles River
  • T1249 subcutaneous or intravenous dose of T1249 (batch 2 referenced in Example 9/Table 5).
  • the rats were dosed at either 1.2 or 15 mg of the active ingredient/kg of body weight.
  • the blood samples were analyzed using a T1249 PcAb ECLIA assay.
  • Fig. 5 shows the concentration-time profile of T1249 in rats after a single subcutaneous or intravenous dose administration.
  • mPEG 2 o k -CMAB- T1249 exhibits a 4.5-fold increase in terminal half-life.
  • the higher Tmax reflects a slower clearance for mPEG 20k -CMAB-T1249 compared to T1249 while having a similar C max .
  • HuPBMC-SCID mice per treatment group (except PEG control which had 6 mice) were employed. On Day 0, each treatment group received a p.m. treatment after infection with HIV isolate. Thereafter, each treatment group received 2 treatments a day (a.m. and p.m.) from day 1 to day 6. The mice were harvested on day 7. See Table 8 for dosing details. Plasma samples for T1249 analysis were collected about 14 hours after last dose administration.
  • HIV-1 in plasma was determined by real-time quantitative PCR. Plasma was harvested for T1249 compound quantification. Frozen plasma samples then underwent compound analysis.
  • T1249 and mPEG 20k ⁇ CMAB-T1249 are equally active in vivo.
  • the results show no discernable difference in in vivo viral suppression activity as measured
  • Trp Gin Glu Trp Glu Gin Lys lie Thr Ala Leu Leu Glu Gin Ala Gin 1 5 10 15
  • ⁇ 400> 3 lie Thr Ala Leu Leu Glu Gin Ala Gin lie Gin Gin Glu Lys 1 5 10
  • Residue No. 8 is modified with an amino group.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Communicable Diseases (AREA)
  • Genetics & Genomics (AREA)
  • Oncology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Epidemiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • AIDS & HIV (AREA)
  • Immunology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Hematology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Medicinal Preparation (AREA)

Abstract

Pegylated T1249 polypeptide compounds are provided. Also provided are pharmaceutical compositions containing pegylated T1249 polypeptide compounds, and processes of making. Further provided is the use of pharmaceutical composition comprising, in admixture with a pharmaceutically acceptable excipient, a compound of formula (I), for the preparation of a medicament for the inhibition of HIV infection.

Description

Pegylated T1249 polypeptide
The present invention relates to pegylated T1249 polypeptide compounds, and to related methods of using and making such compounds, such as in pharmaceutical compositions and therapeutic methods of treatment.
Some viruses, especially HIV, must undergo a complex process called fusion in order to enter the host cell and reproduce. During fusion, the outer membrane of the virus fuses with the membrane of the host cell. In the case of HIV, the outer membrane of the HIV virus fuses with the membrane of the CD4+ T cell during reproduction.
T1249 is a member of a new class of antiviral agents that inhibit virus/membrane fusion. In the case of HIV, this provides two salutary effects: the reproduction of HIV is blocked and resultant death of the CD4+ T cells does not
occur.
Viral resistance to currently approved anti-HIV drugs is a significant issue in the clinical management of HIV today. Many patients who begin combination antiretroviral treatment with currently approved medications will develop resistance to one or more of these agents over time. Research suggests, however, that T1249 may be unaffected by resistance to any of the currently approved antiretroviral classes. (Data presented at the 5th International Workshop on Drug Resistance and Treatment Strategies in Scottsdale, Arizona, June 4-8, 2001).
An analysis of T1249 dose-ranging in a clinical trial suggests that daily dose of T1249, and not prior antiretroviral treatment experience, including mutations to all approved classes of HIV drugs, is the only variable that is associated with the viral load reduction among treatment-experienced patients. Additional experiments show that the in vitro activity of T1249 is not affected by mutations associated with resistance to reverse transcriptase inhibitors and protease inhibitors.
Like many polypeptide therapeutic agents, T1249 is generally administered by injection. Current therapeutic protocols often involve more than one daily injection.
It would, therefore, be advantageous to provide T1249 polypeptides and pharmaceutical compositions having improved performance and pharmacokinetic characteristics. It would be particularly advantageous to provide for lower therapeutic doses of T1249, less frequent administrations, and/or extended duration of action.
These and other objects of the present invention are described in greater detail below. The present invention provides a compound of formula:
O
II
R1-(CH2CH20)n-CH2CH2-0-(CH2)m-C-NH-(CH2)p-CH2-NHT1249 (I)
wherein
Ri is a capping group, m is from 1 to 17, n is from 10 to 1 ,000, p is from 1 to 3, and
NHT1249 is a T1249 polypeptide covalently bonded through its terminal α- amino group.
In one embodiment of the compound of the present invention R1 is methoxy, m is 1 , n is from 100 to 750, and p is 3.
Also provided is a pharmaceutical composition comprising, in admixture with a pharmaceutically acceptable excipient, a compound of formula (I), wherein R1} m, n, p, and NHT1249 are defined as above.
In one embodiment of the pharmaceutical composition of the present invention Rt is methoxy, m is 1 , n is from 100 to 750, and p is 3.
The present invention further provides a method of inhibiting HIV infection comprising administering a pharmaceutical composition comprising, in admixture with a pharmaceutically acceptable excipient, a compound of formula (I), wherein R-i, m, n, p, and NHT1249 are defined as above. If the present invention relates to a "method of inhibiting HIV infection comprising a compound", a "use of a compound for the preparation, of a medicament for the inhibition of HIV" is meant.
In one embodiment of the method of inhibiting HIV infection R^ is methoxy, m is 1 , n is from 100 to 750, and p is 3.
Further provided is a method for making a pegylated T1249 polypeptide comprising reacting a T1249 polypeptide with a polyethylene glycol aldehyde of formula:
O
II
Rr(CH2CH20)n-CH2CH2-0-(CH2)m-C-NH-(CH2)p-CHO (II)
wherein Ri, m, n, n, and p are defined as above; to produce a compound of formula (I), wherein the polyethylene glycol aldehyde molecule is bonded to the N- terminal amino group of the T1249 polypeptide. If the present invention relates to a "method for making" a "process for making" is meant.
Figure 1 shows a comparison of enzymatic digests of PEG-modified and unmodifed T1249. Digestion with endoproteinase Lys-C and subsequent separation with reversed phase HPLC is shown.
Figure 2 shows a matrix assisted laser desorption ionization time of flight (MALDI TOF) mass spectrum of the collected HPLC fraction PEG-34 (Figure 1). Spectra were acquired in linear mode with trans-3-indoleacrylic acid as the matrix.
Figure 3 shows N-terminal (Edman) sequencing of the collected HPLC fraction PEG-34 (Figure 1).
Figure 4 shows the concentration-time profile of mPEG20k-CMAB-T1249 in rats after a single subcutaneous dose administration.
Figure 5 shows the concentration-time profile of T1249 in rats after a single subcutaneous dose administration.
Figure 6 shows the effect of T1249 and mPEG2ok-CMAB-T1249 dosing on the HIV-1 viral load in SCID mice.
As noted above, T1249 is a "fusion inhibitor" polypeptide. T1249 consists of 39 amino acids. The polypeptide sequence of T1249 is:
WQEWEQKITALLEQAQIQQEKNEYELQKLDKWASLWEWF [SEQ.ID.NO:1]
The N-terminus (or amino terminus) amino acid is tryptophane (W). The C- terminus (or carboxy terminus) amino acid is phenyalanine (F).
As described in Table 1 of U.S. Patent No. 6,348,568 (Seq. ID No. 1071), which is hereby incorporated by reference in its entirety, the T1249 polypeptide sequence may be blocked/derivatized at one or both of its amino and carboxy termini. As described in U.S. Patent No. 6,348,568, the tryptophane amino terminus is blocked/derivatized with an acyl group and the phenylalanine carboxy- terminus is blocked/derivatized with an amino group (the latter resulting in a
conversion of the -COOH → -CONH2).
As used herein, "T1249" shall be understood to mean [SEQ.ID.NO:1], optionally blocked at the phenylalanine C-terminus with an amino group. In other words, when reference is made to "T1249," the phenylalanine C-terminus is either -COOH or -CONH2.
The present invention provides pegylated T1249 compounds of the following formula:
O
II
R1-(CH2CH2θ)n-CH2CH2-0-(CH2)rn-C-NH-(CH2)p-CH2-NHT1249 (1)
wherein
Ri is a capping group, m is from 1 to 17, n is from 10 to 1 ,000, p is from 1 to 3, and
NHT1249 is a T1249 polypeptide covalently bonded through its terminal α- amino group.
As used herein the Ri "capping group" is any suitable chemical group which, depending upon preference, is generally unreactive or generally reactive with other chemical moieties. In the above compound the polyethylene glycol is covalently bonded to the α-amino group of T1249. The Ri capping group is selected to permit or prevent bifunctionality, e.g., covalent attachment to a second chemical moiety of interest.
In the case that the capping group is generally unreactive with other chemical moieties, Ri is relatively inert and therefore will not covalently bond with another chemical moiety. Suitable generally unreactive R capping groups include: hydrogen, hydroxyl, lower alkyl, lower alkoxy, lower cycloalkyl, lower alkenyl, lower cycloalkenyl, aryl, and heteroaryl.
As used herein, the term "lower alkyl" means a straight-chain or branched- chain alkyl group containing from 1 to 7, preferably from 1 to 4, carbon atoms, such as methyl, ethyl, n-propyl, isopropyl, n-butyl, sec.butyl, tert.butyl, n-pentyl, n-hexyl, n-heptyl and the like. The "lower alkyl" is optionally substituted with one or more groups independently selected from halogen, lower alkyl, lower alkoxy, lower cycloalkyl, lower alkenyl, lower cycloalkenyl, aryl, and heteroaryl.
The term "lower alkoxy" means a lower alkyl group as defined earlier which is bonded via an oxygen atom, with examples of lower alkoxy groups being methoxy, ethoxy, n-propoxy, isopropoxy, n-butoxy, sec.butoxy, tert.butoxy, n- pentoxy and the like. The "lower alkoxy" is optionally substituted with one or more groups independently selected from halogen, lower alkyl, lower alkoxy, lower cycloalkyl, lower alkenyl, lower cycloalkenyl, aryl, and heteroaryl.
The term "lower cycloalkyl" means cycloalkyl group containing from 3 to 7, preferably from 4 to 6, carbon atoms, i.e., cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl or cycloheptyl. The "lower cycloalkyl" is optionally substituted with one or more groups independently selected from halogen, lower alkyl, lower alkoxy, lower cycloalkyl, lower alkenyl, lower cycloalkenyl, aryl, and heteroaryl.
As used herein, the term "lower alkenyl" means straight-chain or branched- chain alkenyl group containing from 2 to 7, preferably from 2 to 5, carbon atoms, e.g., ethenyl, butenyl, pentenyl, hexenyl and the like. The "lower alkenyl" is
optionally substituted with one or more groups independently selected from halogen, lower alkyl, lower alkoxy, lower cycloalkyl, lower alkenyl, lower cycloalkenyl, aryl, and heteroaryl.
The term "lower cycloalkenyl" means a cycloalkenyl group containing from 4 to 7 carbon atoms, e.g., cyclobutenyl, cyclopentenyl, cyclohexenyl and the like. The "lower cycloalkenyl" is optionally substituted with one or more groups independently selected from halogen, lower alkyl, lower alkoxy, lower cycloalkyl, lower alkenyl, lower cycloalkenyl, aryl, and heteroaryl.
The term "aryl" means a phenyl or naphthyl group which is unsubstituted or optionally mono- or multiple-substituted by halogen, lower alkyl, lower alkoxy, trifluoromethyi, hydroxyl, carboxylic acid, carboxylic ester, nitro, amino, or phenyl, particularly by halogen, lower alkyl, lower alkoxy, trifluoromethyi, hydroxyl, nitro, amino and phenyl.
The term "heteroaryl" means a 5- or 6-membered heteroaromatic group which contains one or more hetero atoms selected from N, S, and O and which may be benz-fused and/or substituted in the same manner as "aryl" defined earlier. Preferred generally unreactive Ri capping groups include methoxy, hydroxy, or benzyloxy. An especially preferred, Ri capping group is methoxy. When Ri is methoxy the pegylated polypeptide compounds are sometimes referred to herein, in part, as "mPEG" compounds, wherein the "m" stands for methoxy.
If the Ri capping group is generally reactive with other chemical moieties, then Ri is a functional group capable of reacting with some functional group, such as an amine and/or sulfhydryl in a peptide and/or protein. In such a case, Ri may be a functional group that is capable of reacting readily with electrophilic or nucleophilic groups on other molecules, in contrast to those groups that require strong catalysts or highly impractical reaction conditions in order to react. If Ri is relatively reactive, the polyethylene glycol aldehyde may covalently bond with another chemical moiety.
Examples of suitable generally reactive Ri capping groups include: halogen, epoxide, maleimide, orthopyridyl disulfide, tosylate, isocyanate, hydrazine hydrate, cyanuric halide, N-succinimidyloxy, sulfo-N-succinimidyloxy, 1 -benzotriazolyloxy, 1- imidazolyloxy, p-nitrophenyloxy, and
O
II -CH2CH2-0-(CH2)m-C-NH-(CH2)p-CHO.
The term "halogen" means fluorine, chlorine, bromine, or iodine. A preferred generally reactive Ri capping group is O
II
-CH2CH2-0-(CH2)m-C-NH-(CH2)p-CHO. When this Ri capping group is present, it will be appreciated that in the compounds of the present invention the first m, n, and/or p may be the same or different from the second m, n, and/or p in the formula. It is preferred, however, that both m's have the same value, both n's have the same value, and both the p's have the same value.
In the present invention, m is from 1 to 17. In a preferred embodiment, m is from 1 to 14. More preferably m is from 1 to 7, and even more preferably, m is from 1 to 4. Most preferably, m is 1.
In the present invention, n is from 10 to 1 ,000. In a preferred embodiment of the present invention n is from 20 to 1 ,000. Preferably, n is from 50 to 1 ,000, even more preferably n is from 75 to 1 ,000. Most preferably, n is from 100 to 750.
In the present invention, p is from 1 to 3. Preferably, p is 3.
In preferred embodiments, p is 3, Ri is methoxy, m is 1 , and n is from 100 to 750; or p is 2, Ri is methoxy, m is 1 , and n is from 100 to 750; or p is 1 , Ri is methoxy, m is 1 , and n is from 100 to 750.
The present invention provides embodiments of formula (I), wherein Ri is methoxy, m is 1 , n is from 100 to 750, p is 3, and NHT1249 is a T1249 polypeptide covalently bonded through its terminal α-amino group.
As noted above, the pegylated T1249 compounds of the invention covalently link the α-amino group of T1249 to a polyethylene glycol derivative having a particular structure. These pegylated compounds may be made in any manner desired, but generally they are prepared by reacting T1249 with separately prepared polyethylene glycol derivatives. For example, the T1249 polypeptide may be pegylated by blocking all lysine residues and reacting this blocked T1249 with a polyethylene glycol derivative. The blocked lysine residues of the T1249 polypeptide are then deblocked, resulting in a terminally pegylated T1249.
The T1249 polypeptide may be prepared in any suitable manner. For example, the compounds may be synthesized using the classic Merrifield solid phase synthesis techniques involving a solid phase method employing Boc-amino acid (Chem. Soc, 85, 2149, 1963), by using manual or automated procedures, using a solid phase method employing an Fmoc-amino acid (Sheppard, R.C. et al., J. Chem. Soc. Chem. Comm., pp. 165-166 (1985)), using an Advanced Chemtech model 200 available from Advanced Chemtech., Louisville, Ky., using a Millipore 9050+ available from Millipore, Bedford Mass, or other available instrumentation.
T1249 may be produced by incorporating cDNA coding compounds of the invention into functional viral or circular plasmid DNA vectors. The vectors or plasmids can be used to transfect or transform selected microorganisms. The transformed or transfected microorganisms can be cultured under conditions that are conducive to express vector-borne DNA sequences and isolation of the desired peptides from the growth medium can be achieved. (See, for example United States Patent No. 5,955,422, the entirety of which is incorporated herein by reference as if recited in full.) T1249 may also be prepared by standard recombinant DNA technology using techniques that are well known in the art. For example, the procedures outlined in Sambrook et al. Molecular Cloning: A Laboratory Manual, 2nd edition, (Cold Spring Harbor Press, Cold Spring Harbor, N.Y.) or Ausubel et al., Current
Protocols in Molecular Bioloαv . John Wiley and Sons, New York (1995), both of which are herein incorporated by reference.
A particular method for making T1249 is described in U.S. Patent 6,258,7872 and U.S. Patent 6,348,568, each of which is hereby incorporated by reference.
After cleavage and deprotection, T1249 may be purified by any suitable means. For example, ion exchange, gel filtration chromatography and/or a reverse- phase column/HPLC system can be used to purify full length T1249 from fragments thereof. In the case when a T1249 precursor is first prepared, with a blocking/protecting group attached to the N-terminus (e.g., acyl group) and/or the C-terminus (e.g., amino group), one or both of those groups may be removed using known techniques.
The amino acid sequence of T1249 may be confirmed and identified using standard amino acid analysis as well as manual and automated Edman degradation and determination of each amino acid. HPLC analysis and mass spectrometry may also be used to verify the production of T1249.
Polyethylene glycol aldehyde compounds which may be reacted with T1249 may also be made in any desired manner. It is preferred, however, that the polyethylene glycol be made in accordance with the methods described in U.S. Patent Application Serial No. 60/398,196, filed July 24, 2002, entitled "Polyethylene Glycol Aldehydes," the entirety of which is hereby incorporated by reference.
Generally, a polyethylene glycol aldehyde of the formula:
O
II
Ri-(CH2CH20)n-CH2CH2-0-(CH2)m-C-NH-(CH2)p-CHO (II)
wherein Ri, m, n, and p are defined as above is used to pegylate the T1249. The polyethylene glycol aldehyde used to pegylated the T1249 may be prepared by any suitable means. One preferred polyethylene glycol aldehyde is prepared as follows:
Reaction Scheme for mPEG10k-butanoaldehyde
Potassium t-butoxide t-Butyl bromoacetate
Figure imgf000016_0002
Polyethylene glycol aldehydes of varying size (e.g., varying n values) may be prepared by following the general reaction scheme above.
The pegylated T1249 compounds of the present invention may be prepared by any suitable means. Further provided by the invention, however, is a method for pegylating a T1249 polypeptide comprising reacting a T1249 polypeptide, NHT1249, with a polyethylene glycol aldehyde of formula: O
II
Rι-(CH2CH20)n-CH2CH2-0-(CH2)m-C-NH-(CH2)p-CHO (II)
wherein R1 ( m, n, n, and p are defined as above; to produce a compound of formula:
Ri-(CH2CH20)n-CH2CH2-0-(CH2)m-CO-NH-(CH2)p-CH2-NHT1249 (I) wherein the polyethylene glycol aldehyde molecule is bonded to the N-terminal amino group of the T1249 polypeptide.
The pegylated T1249 is prepared by adding T1249 and the PEG reagent in a molar ratio range of 1 :1 to 1 :100. The T1249 has a free α-amino group (any acyl group is removed) and either a free carboxy group or an amino-protected carboxy group, as discussed above. The reaction mixture is placed in a borate or phosphate buffer at room temperature or 4 degrees Celsius for about .5 to 24 hours at a pH range of 5.5 to 7.4. The molar ratio of PEG reagent to peptide/proteins is between 1 :1 to 100:1. The concentration of peptide/proteins is between 1 to 10 mg/ml. The concentration of buffer is usually 10 to 500 mM.
The pegylated T1249 is purified by taking the reaction mixture of pegylated T1249 and diluting it with an equilibration buffer (20mM Tris, pH 7.5). The resulting mixture is then applied on a Q-Sepharose column. After the mixture is applied on the QA column, it is washed with the equilibration buffer eluted with 75 M NaCl; eluted with 200 mM NaCl; eluted with 1 M NaCl; and regenerated with 1 M HOAC + 1 M NaCl and 0.5 NaOH. By using reverse phase HPLC, it is possible to readily separate and isolate the N-terminal, monopegylated product from other byproducts in the mixture. For example, in a chromatogram of pegylated T-1249, several peaks may form, each with different retention times. The first peak may represent unreacted peptide, at 10.7 minutes, and the second peak may represent monopegylated peptide, at 17.6 minutes, followed by di-pegylated peptide, at 19 minutes. Each collected product was confirmed by Matrix Assisted Laser Desorption/lonization-Time of Flight Mass Spectrometry (MALDI-TOF).
In preferred embodiments of the pegylated T1249 polypeptides of the present invention, p is 3, Ri is methyl, m is 1 , and n is from 100 to 750; or p is 2, Ri is methoxy, m is 1 , and n is from 100 to 750; or p is 1 , Ri is methoxy, m is 1 , and n is from 100 to 750.
Also provided is a pegylated T1249 polypeptide of the following formula:
CH3-0-(CH2-CH2-0)n-CH2-CH2-0-CH2-CH2-CH2-NHT1249 (III)
wherein n is from 10 to 1 ,000 and NHT1249 is a T1249 polypeptide covalently bonded through its terminal α-amino group. In one embodiment n is approximately 225, for example, 227. In another embodiment, n is approximately 450.
This pegylated T1249 polypeptide may be made in any desired manner, preferably, it is made by the method described in Example 7. The pharmaceutical compositions of the invention comprise, in admixture with a pharmaceutically acceptable excipient, a compound of formula (I), wherein Ri, m, n, p, and NHT1249 are defined as above
The pharmaceutical compositions of the present invention comprising pegylated T1249 polypeptides, or the salts thereof, may be manufactured in any desired manner, e.g., by means of conventional mixing, encapsulating, dissolving,
granulating, emulsifying, entrapping, or lyophilizing processes. These pharmaceutical preparations may be formulated with therapeutically inert, inorganic or organic excipients and carriers. Suitable excipients for injection include water, alcohols, polyols, glycerine, vegetable oils, phospholipids and surfactants.
The pharmaceutical preparations may also contain preserving agents, solubilizing agents, stabilizing agents, wetting agents, emulsifying agents, sweetening agents, coloring agents, flavoring agents, salts for varying the osmotic pressure, buffers, coating agents, or antioxidants. They may also contain other therapeutically valuable substances, including additional active ingredients.
The formulations suitable for administration by injection (including injection
intraperitoneally, intramuscularly, subcutaneously, intravenously, or by continuous infusion) may conveniently be presented in unit dosage form and may be prepared by conventional pharmaceutical techniques. Such techniques include the step of bringing into association the pegylated T1249 polypeptides and the pharmaceutical carrier(s) or excipient(s). In general, the formulations are prepared by uniformly and intimately bringing into association the pegylated T1249 polypeptides with liquid carriers. Formulations suitable for administration by injection include: aqueous and non-aqueous sterile injection solutions which may contain antioxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents. The formulations may be presented in unit-dose or multi-dose containers, for example, sealed ampoules and vials, and may be stored in a freeze-dried (lyophilized) conditions requiring only the addition of the sterile liquid carrier, for example, water for injections, immediately prior to use.
Preferred unit dosage formulations are those containing a daily dose, daily sub-dose, weekly dose, weekly sub-dose, as herein above recited, or an appropriate fraction thereof, of the administered ingredient.
Preferably, the pegylated T1249 polypeptide is in unit dosage form. As used herein, "unit dosage form," means that an amount appropriate for a single dose the pegylated T1249 polypeptide is in a premeasured and/or prepackaged form. This allows for convenient preparation of the pegylated T1249 polypeptide for administration, and may even allow for self-administration by the patient. The unit dosage amount will obviously depend on the amount of pegylated T1249 polypeptide to be delivered, and the frequency of dosing.
The pegylated T1 49 polypeptide may also be provided in a lyophilized powder form in a unit dosage amount, suitable for reconstitution with a pharmaceutically acceptable excipient just prior to the time of administration. A particular pharmaceutical composition of the invention comprises, in admixture with a pharmaceutically acceptable excipient, a compound of formula (I), wherein Ri is methoxy, m is 1 , n is from 100 to 750, and p is 3.
Another pharmaceutical composition of the invention is a pharmaceutical composition comprising, in admixture with a pharmaceutically acceptable excipient, a compound of formula (III), wherein n is from 10 to 1 ,000 and NHT1249 is a T1249 polypeptide covalently bonded through its terminal α-amino group. In one embodiment n is approximately 225, for example 227. In another embodiment, n is approximately 450.
The present invention further provides methods of inhibiting HIV infection comprising administering to a patient a pharmaceutical composition comprising, in admixture with a pharmaceutically acceptable excipient, a compound of formula (I), wherein Ri, m, n, p, and NHT1249 are defined as above.
The pegylated T1249 polypeptides are generally administered in the manner (unpegylated) T1249 polypeptides are presently administered. Modifications may be made, however, to take advantage of the improved pharmacokinetic properties of the pegylated T1249 polypeptides.
In the method of inhibiting HIV of the invention, the pharmaceutical composition may be administered in any suitable manner and route. In a preferred method the pegylated T1249 polypeptide is administered in the form of an injectable solution or suspension. Preferably, the injectable solution or suspension is administered by subcutaneous injection or intravenously. In another preferred method, the pegylated T1249 polypeptide is administered though a transdermal delivery device, e.g., a transdermal patch.
In the method of inhibiting HIV of the invention, the pharmaceutical composition may be administered in any suitable dosage and schedule. The pharmaceutical compositions of the invention can be administered in any form, and via any route, desired. Generally, however, the pegylated T1249 polypeptides of the present invention are administered parenterally, for example, in the form of injection solutions.
Determination of a therapeutically effective amount is within the skill in the art, and the therapeutically effective amount or dosage of a pegylated T1249 polypeptide according to this invention may vary and will be adjusted to the individual requirements in each particular case. In general, in the case of administration by injection to adult humans weighing approximately 70 Kg, a daily dosage of about 50 mg to about 300 mg, preferably from about 50 mg to about 200 mg, should be appropriate, although the upper limit may be exceeded when indicated. The dosage may be administered as a single dose, in divided doses, or as continuous infusion.
The pharmaceutical composition may be administered on any convenient dosing schedule. Preferably, the pharmaceutical composition is administered once daily, twice daily, once every other day, once a week, or twice a week. More preferably, the pharmaceutical composition is administered once a week. Preferably, the pharmaceutical composition is administered once a week in the dose of about 300 mg to about 1 ,500 mg. More preferably, the pharmaceutical composition is administered once a week in the dose of about 400 mg to about 1 ,000 mg. Even more preferably, the pharmaceutical composition is administered once a week in the dose of about 100 mg to about 200 mg.
The present invention also provides a method of inhibiting HIV infection comprising administering a pharmaceutical composition comprising, in admixture with a pharmaceutically acceptable excipient, a compound of formula (I), wherein Ri is methoxy, m is 1 , n is from 100 to 750, and p is 3.
Also contemplated within the scope of the invention is a method of inhibiting HIV infection comprising administering a pharmaceutical composition comprising, in admixture with a pharmaceutically acceptable excipient, a compound of formula (III), wherein n is from 10 to 1 ,000 and NHT1249 is a T1249 polypeptide covalently bonded through its terminal α-amino group. In one embodiment n is approximately 225, for example, 227. In another embodiment, n is approximately 450.
The following examples are provided to further illustrate the compounds, compositions, and methods of the present invention. These examples are illustrative only and are not intended to limit the scope of the invention in any way. Example 1
Preparation of mPEGmK-butanoaldehvde
mPEG of molecular weight 10,000 (30.0 g, 3 mmol) in 240 mL of toluene was azeotropically dried by refluxing for 2 hours, followed by the removal of 120 ml of toluene. The resulting solution was cooled to room temperature then potassium tert-butoxide (0.68 g, 6 mmol) in 20 ml of absolute tert-butanol and 20 ml of toluene was added to the PEG solution. The resulting mixture was stirred for two hours at room temperature under argon. Tert-butyl bromoacetate (1.00 mL, 6.75 mmol) was added to the reaction via syringe and the reaction was stirred overnight at room temperature under argon. The reaction solution was then condensed by rotary evaporation. The residue was precipitated by addition to diethyl ether. The precipitated mPEGiok t-butyl carboxymethyl ester product was filtered off and dried in vacuo. Yield: 28 g. NMR (d6-DMSO): 1.40 ppm (t, 9H, -CH3); 3.21 ppm (s, -OCH3); 3.50 ppm (s, -O-CH2CH2-O-); 3.96 ppm (s, 2H, -0-CH2-COO-).
mPEGiok t-butyl carboxymethyl ester (26.5 g) was then dissolved in 350 ml of 1 N sodium hydroxide and the solution was stirred at room temperature overnight. The pH of the mixture was adjusted to 2.5 by addition of 6 N hydrochloric acid, and the mixture was extracted with dichloromethane. The organic layer was dried over sodium sulfate, filtered, concentrated, and precipitated into diethyl ether. The product m-PEGiok-carboxymethyl acid was collected by filtration and dried under vacuum. Yield: 24 g. NMR (d6-DMSO): 3.21 ppm (s, -OCH3); 3.5 ppm (s, -O- CH2CH2-0-); 3.99 ppm (s, 2H, -0-CH2-COOH). mPEGiok-carboxymethyl acid (6 g, 0.6 mmol) was then dissolved in anhydrous dichloromethane (30 mL) followed by the addition of 4- aminobutylraldehyde diethylacetal (140 ml, 0.9 mmol), 1-hydroxybenzotriazole (80 mg, 0.6 mmol), and dicyclohexylcarbodiimide (160 mg, 0.78 mmol). The mixture was stirred overnight at room temperature under argon. The reaction mixture was filtered, concentrated, and precipitated with mixture of 2-propanol and diethyl ether (1 :1). The product mPEGiok-butanoacetal was dried in vacuo overnight. Yield: 5.4
g. NMR (de-DMSO): 1.07-1.12 ppm (t, 6H, (-0-CH2-CH3)2); 1.46 ppm (m, 4H, -NHCH2CH2CH2-CH-); 3.08-3.11 ppm (q, 2H, -NHCH2CH2CH2-CH-); 3.21 ppm (s, -OCH3); 3.5 ppm (s, -0-CH2CH2-0-); 3.85 ppm (s, 2H, -0-CH2-CO-NH-); 4.44 ppm (t, 1 H, -NHCH2CH2CH2-CH-); 7.67 ppm (-NH-).
mPEGiok-butanoacetal (2 g, 0.2 mmol) was then dissolved in 20 ml of 80 % CF3COOH and the solution was stirred at room temperature overnight. The pH of the mixture was adjusted to 6.0 by addition of 1 N NaOH solution, and sodium chloride (10 wt %) was added and then the pH of the solution was adjusted to 7.0 by addition of 1 N NaOH. The mixture was extracted with dichloromethane. The organic layer was dried over sodium sulfate, filtered, concentrated, and precipitated into diethyl ether. The product mPEGiok-butanoaldehyde was collected by filtration and dried under vacuum. Yield: 1.7 g. NMR (d6-DMSO): 3.21 ppm (s, -OCH3); 3.5 ppm (s, -0-CH2CH2-0-); 3.85 ppm (s, 2H, -0-CH2-CO-NH-); 7.67 ppm (-NH-); 9.66 ppm (-CHO-). Example 2 Peqylation of T1249 with mPEGi -butanoaldenvde
Butanoaldehyde of PEG 10kDa (mPEGiorCMAB) prepared according to Example 1 was added to 20 mg of T1249 (purity 93.7 %) in 1.0 ml of buffer (50 mM potassium phosphate pH 6.5) in a molar ratio of 5 moles of reagent per one mole of T1249. The T1249 polypeptide was deacylated at the α-amino terminus, but protected at the carboxyl terminus by -NH2. To the reaction mixture 10% (v/v) of 0.5 M sodium cyanoborohydride solution in water was added and stirred for 4 hours at room temperature. Pegylated T-1249 was purified from the reaction mixture using ion exchange chromatography (QA). A step gradient with increasing salt concentrations from 65 mM to 1 M NaCl in 20 mM Tris, pH 7.5 was used to separate pegylated T1249 and unmodified T1249.
Example 3
Preparation of mPEGpnκ-butanoaldehvde
mPEG of molecular weight 20,000 (60.0 g, 3 mmol) in 800 ml of toluene was azeotropically dried by refluxing for 2 hours, followed by the removal of 200 ml of toluene. The resulting solution was cooled to room temperature then potassium tert-butoxide (0.68 g, 6 mmol) in 20 ml of absolute tert-butanol and 20 ml of toluene was added to the PEG solution. The resulting mixture was stirred for two hours at room temperature under argon. Tert-butyl bromoacetate (1.00 mL, 6.75 mmol) was added to the reaction via syringe and the reaction was stirred overnight at room temperature under argon. The reaction solution was then condensed by rotary evaporation. The residue was precipitated by addition to diethyl ether. The precipitated product mPEG20k t-butyl carboxymethyl ester was filtered off and dried in vacuo. Yield: 56 g. NMR (d6-DMSO): 1.42 ppm (t, 9H, -CH3); 3.21 ppm (s, -OCH3); 3.50 ppm (s, -0-CH2CH2-0-); 3.98 ppm (s, 2H, -0-CH2-COO-).
mPEG20k t-butyl carboxymethyl ester (28 g) was then dissolved in 750 ml of 1 N sodium hydroxide and the solution was stirred at room temperature overnight. The pH of the mixture was adjusted to 2.5 by addition of 6 N hydrochloric acid, and the mixture was extracted with dichloromethane. The organic layer was dried over sodium sulfate, filtered, concentrated, and precipitated into diethyl ether. The product m-PEG2ok-carboxymethyl acid was collected by filtration and dried under vacuum. Yield: 25 g. NMR (d6-DMSO): 3.21 ppm (s, -OCH3); 3.5 ppm (s, -O- CH2CH2-0-); 4.01 ppm (s, 2H, -0-CH2-COOH).
mPEG2ok-carboxymethyl acid (20 g, 1.0 mmol) was then dissolved in anhydrous dichloromethane (100 mL) followed by the addition of 4-
aminobutylraldehyde diethylacetal (0.77 ml, 4 mmol), 1-hydroxybenzotriazole (270 mg, 2.0 mmol), and dicyclohexylcarbodiimide (620 mg, 3.0 mmol). The mixture was stirred overnight at room temperature under argon. The reaction mixture was filtered, concentrated, and precipitated with mixture of 2-propanol and diethyl ether (1 :1 ). The product mPEG20k-butanoacetal was dried in vacuo overnight. Yield:
18.6 g. NMR (d6-DMSO): 1.07-1.12 ppm (t, 6H, (-0-CH2-CH3)2); 1.46 ppm (m, 4H, -NHCH2CH2CH2-CH-); 3.08-3.11 ppm (q, 2H, -NHCH2CH2CH2-CH-); 3.21 ppm (s, -OCH3); 3.5 ppm (s, -0-CH2CH2-0-); 3.85 ppm (s, 2H, -O-CH2-CO-NH-); 4.44 ppm (t, 1 H, -NHCH2CH2CH2-CH-); 7.67 ppm (-NH-).
mPEG20k-butanoacetal (14.7 g, 0.73 mmol) was then dissolved in 200 ml of 10 % CF3COOH and the solution was stirred at room temperature overnight. The pH of the mixture was adjusted to 6.0 by addition of 1 N NaOH solution, and sodium chloride (10 wt %) was added and then the pH of the solution was adjusted to 7.0 by addition of 1 N NaOH. The mixture was extracted with dichloromethane. The organic layer was dried over sodium sulfate, filtered, concentrated, and precipitated into diethyl ether. The product mPEG2ok-butanoaldehyde was collected by filtration and dried under vacuum. Yield: 13.1 g. NMR (d6-DMSO): 3.21 ppm (s, -OCH3); 3.5 ppm (s, -0-CH2CH2-0-); 3.85 ppm (s, 2H, -0-CH2-CO-NH-); 7.67 ppm (-NH-); 9.65 ppm (-CHO-).
Example 4
Pegylation of T1249 with mPEG?n -butanoaldehyde
Butanoaldehyde of PEG 20kDa prepared according to Example 3 was added to 20mg of T1249 (purity 93.7%) which was dissolved in 0.4 ml of 50 mM borate, pH 9.5 buffer and then diluted 10-fold with 100 mM potassium phosphate pH 6.5 in a molar ratio of 10 moles of reagent per one mole of T1249. The T1249
polypeptide was deacylated at the α-amino terminus, but protected at the carboxyl
terminus by -NH2. To the reaction mixture 0.4 mL (10%, v/v) of 0.5 M sodium cyanoboro-hydride (NaBHsCN) solution in water was added and stirred for 4 hrs at room temperature. The reaction mixture was then diluted 10-fold with equilibration
buffer (20 mM Tris, pH 7.5) and filtered through a 0.45 μm filter. Pegylated T1249
was purified from the reaction mixture using anion exchange chromatography (Q- Sepharose). A step gradient with increasing salt concentrations from 75 mM, 200 mM to 1 M NaCl in the equilibration buffer was used to separate di-pegylated, mono-pegylated and unmodified T1249 from each other, respectively. The above experiment was repeated starting with 70 mg T1249, 1 :10 molar excess of PEG2or butanoaldehyde and purified as described earlier. The mono-pegylated T1249 (200mM NaCl eluate) pools from both experiments were combined, concentrated to approximately 2 mg/mL and diafiltered into the storage buffer (PBS buffer, pH 7.3)
and stored at -20°C until further use. An aliquot of the material was used to assay
for antiviral activity.
Example 5
% Mono-. % Di-. and % Tri-Peqylated T1249 with mPEGpmc-butanoaldehyde
The % Mono-, % di-, and % tri-pegylated T1249 with mPEG20κ- butanoaldehyde was determined through a series of experiments where the T1249:PEG molar ratio, pH of the reaction solution, and reaction time were varied as seen below in Tables 1 , 2, and 3. The purpose of these experiments was to optimize the pegylation parameters.
For example, in Table 1 , butanoaldehyde of PEG 20kDa (mPEG20k-CMAB) prepared according to Example 3 was added to 5 mg of T1249 (purity 93.7 %) in 50 mM potassium phosphate pH 6.5. The T1249 polypeptide was deacylated at the α- amino terminus, but protected at the carboxyl terminus by -NH2. The molar ratio of PEG reagent to T1249 was 1 :1 , 1 :2, and 1 :5. To the reaction mixture 10% (v/v) of 0.5 M sodium cyanoborohydride solution in water was added. An aliquot was removed at the predetermined time interval of 2, 4, 6, and 24 hours at room temperature.
Table 1 Potassium Phosphate Buffer pH 6.5
Figure imgf000030_0001
Figure imgf000031_0001
For Table 2, butanoaldehyde of PEG 20kDa (mPEG20k-CMAB) prepared according to Example 3 was added to 5 mg of T1249 (purity 93.7 %) in 50 mM potassium phosphate pH 6.0 in a molar ratio of ten moles of PEG reagent per one mole of T1249. The T1249 polypeptide was deacylated at the α-amino terminus, but protected at the carboxyl terminus by -NH2. To the reaction mixture 10% (v/v) of 0.5 M sodium cyanoborohydride solution in water was added. An aliquot was removed at the predetermined time interval of 2, 4, 6, and 24 hours at room temperature.
Table 2
Potassium Phosphate Buffer pH 6.0
Figure imgf000031_0002
For Table 3, butanoaldehyde of PEG 20kDa (mPEG20k-CMAB) prepared according to Example 3 was added to 5 mg of T1249 (purity 93.7%) in 50 mM potassium phosphate pH 5.5 in a molar ratio of ten moles of PEG reagent per one mole of T1249. The T1249 polypeptide was deacylated at the α-amino terminus, but protected at the carboxyl terminus by -NH2. To the reaction mixture 10% (v/v) of 0.5 M sodium cyanoborohydride solution in water was added. An aliquot was removed at the predetermined time interval of 2, 4, 6, and 24 hours at room
temperature.
Table 3
Potassium Phosphate Buffer pH 5.5
Figure imgf000032_0001
The percentage of mono-, di-, and tri-pegylated T1249, and unreacted free T1249 were obtained by reverse phase HPLC for every reaction mixture. The data exemplified in Tables 1 , 2, and 3 above illustrates when optimal amounts of monopegylated T1249 is achieved under varying conditions of T1249:PEG molar ratio, pH, and reaction time. For example, in Table 1 an optimal mono-pegylation of 61% is shown at a T1249:PEG Molar Ratio of 1 :5 and a time point of 6h. In Table 2, an optimal mono-pegylation of 61 % is shown at a T1249:PEG Molar Ratio of 1 :10 and a time point of 4h. In Table 3, an optimal mono-pegylation of 60% is shown at a T1249:PEG Molar Ratio of 1 :10 and a time point of 6h. Example 6
Determination of Peqylation Sites
To evaluate the site of PEG attachment to T1249, a series of experiments was performed. The results demonstrate that >95% of the modification is located at the N-terminal tryptophane residue. Additional modification sites may occur to a minor degree (< 5%), but their exact identity is not clearly established.
In order to determine the PEG modification site, a sample was digested with endoproteinase Lys-C and the peptides separated by reverse phase HPLC. Individual peptide peaks were further analyzed with nano spray ESI (electrospray ionization) mass spectrometry, MALDI TOF (matrix assisted laser desorption/ionization-time of flight) mass spectrometry and N-terminal (Edman) sequencing. These procedures are summarized below.
Samples of 20K mono-pegylated-butanoaldehyde-T1249 (20k mPEG- CMAB-T1249) prepared according to Example 4 and T1249 (free α-amino terminus; carboxyl terminus protected by -NH2) were proteolytically digested with endoproteinase Lys-C for 2 hours at ambient temperature with a sample to enzyme ratio of 10/1 (w/w). The reaction was stopped by adding acetic acid to a final concentration of 2% (v/v).
The separation of proteolytic peptides was done by reverse phase HPLC with a HP1100 HPLC system equipped with a Phenomenex Luna reversed phase
column (C-18, 3μ, 150 x 200 mm). The solvent system consisted of water,
acetonitrile and trifluoroacetic acid (0.05%). The gradient was from 5% to 64% organic solvent in 50 minutes at a flow rate of 0.2 ml/min. Peptide containing peaks
were collected for further analysis.
All collected samples were then analyzed with nano spray ESI mass spectrometry on a Finnigan LCQ ion trap instrument. Individual peptides were identified based on experimental molecular weights. The PEG peptide containing fraction was also analyzed with MALDI TOF mass spectrometry on a Bruker Reflex instrument. Matrices used were trans-3-indoleacrylic acid or alpha-4-hdroxycinamic acid.
The PEG containing peptide fraction was then subjected to automated N- terminal (Edman) sequencing on a Perkin Elmer (ABI) precise instrument.
The results of the reverse phase HPLC analysis of the proteolytic fragments of pegylated T1249 are shown in Figure 1. Figure 1 shows the UV trace obtained from the reverse phase HPLC analysis of the two samples. The N-terminal peptide observed in the control T1249 (Peak HT-20 in Figure 1 B) is almost totally absent in the PEG modified T1249 (Figure 1A). Instead one new peak appeared (Peak PEG-34 in Figure 1A). It contains the PEG modified peptide(s).
Mass spectroscopic results obtained from the analysis of individual HPLC fractions are summarized in Table 4. All experimental molecular weights of non- modified peptides were compatible with the calculated ones.
Table 4: Analytical results obtained from collected HPLC fractions (see also Figure 1).
Figure imgf000035_0001
1see also figure 1 ; Calculated exact mass in Da; 3measured mass in Da, nano spray ESI MS of non-modified peptides and MALDI TOF MS of PEG-modified peptides; automated Edman sequencing, n.A. = not available, x = none identified; 5based on MW compatibility and/or Edman sequencing. The amino acid sequence of the unmodified T1249 sample is: WQEWEQKITALLEQAQIQQEKNEYELQKLDKWASLWEWF-NH2.
The MALDI TOF mass spectrum obtained from the intact PEG modified T1249 is shown in figure 2A. The measured molecular weight was 26758 Da. Note the presence of some non modified peptide. The origin of it is currently not known, however it could potentially be caused by the measurement in the mass spectrometer itself. The MALDI TOF mass spectrum obtained from fraction PEG- 34 (figure 1) is shown in figure 2B. The measured molecular weight was 23083 Da. The molecular weight as well as the appearance of the mass spectrum identify this HPLC fraction PEG-34 as the one containing the PEG modified peptide(s). The presence of PEG in this HPLC fraction could also be shown by nano spray ESI mass spectrometry (data not shown). Results from the automated N-terminal sequencing (Edman) are shown in
figure 3. The observed major sequence was the N-terminal endo Lys-C peptide xQEWEQK. With exception of the first amino acid residue, all other amino acids were recovered in substantial yields. Essentially no tryptophane could be recovered in the first amino acid position (Figure 3, cycle 3). The HPLC UV traces, the MALDI TOF mass spectrum as well as the results from the N-terminal sequencing identify the N-terminal tryptophane as the major PEG modification site.
The results above are consistent with the presence of a linkage between the polyethylene glycol aldehyde and the N-terminal tryptophane of T1249. Although a linkage directly to the tryptophane side chain cannot be entirely excluded, the results from the N-terminal sequencing appears to contradict the presence of a "blocking" PEG moiety at the N-terminal amino group.
Example 7
Peqylation of T1249 with mPEGmk-propionaldehvde
A propionaldehyde of PEG 10kDa, having the following structure is used.
CH3-0-(CH2-CH2-0)227-CH2-CH2-0-CH2-CH2-CHO 200 mg of mPEGI Ok-propionaldehyde was added to 20 mg of T1249 (purity 93.7 %) in 1.0 ml of buffer (50 mM potassium phosphate pH 6.5) in a molar ratio of 5 moles of reagent per one mole of T1249. The T1249 polypeptide was deacylated at the α-amino terminus, but protected at the carboxyl terminus by -NH2.
To the reaction mixture 10% (v/v) of 0.5 M sodium cyanoborohydride solution in water was added and stirred for 4 hours at room temperature. Pegylated T1249 was purified from the reaction mixture using ion exchange chromatography (QA). The structure of the pegylated T1249 follows:
CH3-0-(CH2-CH2-0)n-CH2-CH2-0-CH2-CH2-CH2-NH-T1249 (III)
A linear gradient with increasing salt concentrations from 65 mM to 1 M NaCl in 20 mM Tris, pH 7.5 was used to separate pegylated T1249 and unmodified T1249. The percentage of mono-pegylated T1249 and unreacted free T1249 was then obtained by reverse phase HPLC and determined to be 31.7%.
Example 8 cMAGI/MAGI Antiviral Assays
These assays score for reduction of infectious virus titer employing the indicator cell lines MAGI (Multinuclear Activation of a Galactosidase Indicator) or the CCR5-expressing derivative cMAGI. The MAGI cell line was derived from parental HeLa cells by introducing genes for CD4 and an HIV-1 LTR-driven b-gal reporter with an amphotropic retrovirus vector (Kimpton J, Emerman M, J Virol 66:2232-9, 1992). The cMAGI cell line was derived from the MAGI cell line by introduction of the CCR5 gene using the amphotropic retroviral vector, PA317 (Chackerian B, Long EM, Luciw PA, Overbaugh J, J Virol 71 :3932-9, 1997). The cMAGI cells support replication of primary NSI (R5) isolates and laboratory adapted X4 viruses, while the MAGI cells support replication of only X4 viruses. Both cell lines exploit the ability of HIV-1 tat to transactivate the expression of a b- galactosidase reporter gene driven by the HIV-LTR. The b-gal reporter has been modified to localize in the nucleus and can be detected with the X-gal substrate as intense nuclear staining within a few days of infection. The number of stained nuclei can thus be interpreted as equal to the number of infectious virions in the challenge inoculum if there is only one round of infection prior to staining.
An inhibitor of infection and cell-cell fusion, e.g., T1249 (Wild C, Greenwell
T, Matthews T, AIDS Res Hum Retroviruses 9:1051-3, 1993), was added 24 hrs post-infection in order to permit a readout that confidently represents a single round of infection, infected cells were enumerated using a CCD-imager and both primary and laboratory adapted isolates showed a linear relationship between virus input and the number of infected cells visualized by the imager. In the MAGI and cMAGI assays a 50% reduction in infectious titer (Vr/V0 = 0.5) is significant and provides the primary cutoff value for assessing antiviral activity. A 90% reduction in infectious titer (Vn/V0) is used as an additional cutoff value on assessing antiviral activity.
Each test compound dilution was tested in duplicate against a virus inoculum adjusted to yield approximately 1500-2000 infected cells/well of a 48 well micro titer plate. The test compound was added to the cMAGI or MAGI cells, followed by the virus inocula, and 24 hrs later, an inhibitor of infection and cell-cell fusion (Wild C, Greenwell T, Matthews T, AIDS Res Hum Retroviruses 9:1051-3, 1993) was added to prevent secondary rounds of infection and cell-cell virus spread. The cells were cultured for 2 more days, fixed and stained with the X-gal substrate to detect infected cells. The number of infected cells for each control and test compound dilution were determined with the CCD-imager. IC50 is defined as the dilution of a test compound resulting in a 50% reduction in infectious virus titer. IC90 is defined as the dilution resulting in a 90% reduction in infectious titer.
Example 9 1C50/IC90 for Pegylated T1249
IC 50 and IC 90 results for T1249 and T1 49 pegylated with mPEG20K- butanoaldehyde (Example 4), hereinafter "mPEG20k-CMAB-T1249," is shown in Table 5 below. The IC5o and ICg0 values were determined in accordance with Example 8.
Figure imgf000040_0001
Table 5. IC 50 and IC 90 results.
Reduction (IC50, 13.7-fold and IC90, 9-fold for batch 1) of in vitro anti-viral activity was observed with mPEG20k-CMAB-T1249 compared to the parent T1249 molecule. However, this loss in in vitro activity is not predictive of the in vivo biological activity as demonstrated by the results illustrated in Example 12 (See, Figure 6).
Example 10
Pharmacokinetics of T1249 Pegylated with mPEGgok-propionaldehyde
Study Design
9 male Wistar rats (Charles River Laboratories, Wilmington, DE) (n=3/time
point) received a single subcutaneous dose of T1249 pegylated with mPEG2ok- propionaldehyde (Example 4).
The mPEG2ok-CMAB-T1249 was suspended in water and titrated with NaOH to bring to a pH of 6.8. The mPEG20k-CMAB-T1249 suspension was then solubilized in a minimum volume of sodium carbonate buffer and diluted with PBS buffer to a pH of 7.3 - 7.4. The amount of PEG-T1249 employed was sufficient to provide a concentration of 150 mg mPEG20k-CMAB-T1249 per ml in the final formulation. The rats were dosed at 8 mg of active ingredient/kg body weight. After dose administration, about 1 ml of blood was collected from the retro- orbital sinus at each time point. The time points were 0.5, 1 , 3, 6, 8, 16, 24, 32, 48, 72, and 96 hours after dose administration. All blood samples were kept at room temperature for up to 30 minutes and serum was separated with cold centrifugation.
Bioanalytical Method
All blood samples were separated on a reverse phase HPLC C18 column using a linear gradient consisting of 0.05 M ammonium acetate and acetonitrile. Absorbance was monitored at 280 nm. Concentrations were extrapolated from a plot (area under the curve v. [mPEG20k-CMAB-T1249]) using mPEG20k-CMAB- T1249 spiked serum extracts as calibration standards.
The reported pharmacokinetic parameters were derived from pooled serum concentration profiles of mPEG20k-CMAB-T1249, its metabolite, and the combination of the two, using non-compartmental analysis via WinNonlin, version 3.3 (Pharsight Corporation, Mountain View, CA), a commercial kinetic analysis software package.
Results Fig. 4 shows the concentration-time profile of mPEG20k-CMAB-T1249 in rats after a single subcutaneous dose administration. At the 0.5 hour time point no level of mPEG20k-CMAB-T1249 or a metabolite was detected, indicating a slow absorption process from the injection site. For the metabolite, the first detectable concentration was found at 6 hours post dosing, which represents a slow course of metabolite formation. The lowest serum concentrations of mPEG20k-CMAB-T1249 and its metabolite were detected at 48 and 72 hours post dosing, respectively.
Systemic Cl/F and Vd/F, AUC (0-48 hours or 0-72 hours), Cmaχ, Tmaχ, and half-life are reported in Table 6, below.
Figure imgf000042_0002
Figure imgf000042_0001
Example 11
Pharmacokinetics of T1249
Study Design
Each treatment group, consisted of 9 Sprague-Dawley rats (Charles River
Laboratories, Wilmington, DE) per sex. Each member of the group received a single subcutaneous or intravenous dose of T1249 (batch 2 referenced in Example 9/Table 5). The rats were dosed at either 1.2 or 15 mg of the active ingredient/kg of body weight.
Blood samples were collected from test animals over a twelve hour time period from three rats per sex per group at each time point. The time points were 0.5, 1 , 2, 4, 6, 8, 10, and 12 hours after dose administration.
Bioanalytical Method
The blood samples were analyzed using a T1249 PcAb ECLIA assay.
T1249 PcAb ECLIA is a noncompetitive, two site immunoassay that utilizes two different preparations of rabbit PcAb specific for T1249. In this assay, T1249 determinations are preformed by first incubating the diluted test sample in a tube that also contains biotin-labeled antibody (preparation A) and ruthenium-labeled antibody (preparation B). In the next step, streptavidin-coated magnetic beads are added to the tube in order to capture the antibody-peptide-antibody immune complexes (sandwiches) that have formed. The mixture is then pumped through a flow-cell in the analyzer, after which an electrical current is applied to a magnet adjacent to the flow-cell. Light- is generated through cyclical oxidation-reduction reactions between the ruthenium metal ions that are conjugated to the detector antibodies and tripropylamine ions that are present in excess in the assay buffer.
This light energy is the measured end-point. A sample containing an appreciable amount of T1249 presents a higher signal compared to a sample containing little or no T1249. Results
Fig. 5 shows the concentration-time profile of T1249 in rats after a single subcutaneous or intravenous dose administration.
max, half-life, AUC (0-12 hours and O-∞ hours), and Cmax are reported in
Table 7, below.
Figure imgf000044_0001
Table 7. Pharmacokinetic parameters for T1249 in rats.
Considering the pharmacokinetic data for mPEG20k-CMAB-T1249 (Table 6) and the 15mg/kg subcutaneous dosing with T1249 (Table 7), mPEG2ok-CMAB- T1249 exhibits a 4.5-fold increase in terminal half-life. The higher Tmax reflects a slower clearance for mPEG20k-CMAB-T1249 compared to T1249 while having a similar Cmax. In addition, once the data from Table 7 is normalized for the difference in dose (15 mg/kg normalized to 8 mg/kg as in Example 10), a five-fold increase over T1249 in AUC was observed for mPEG20k-CMAB-T1249 (57.1 μg hr/ml (normalized) for T1249 versus 279 μg hr/ml for mPEG20k-CMAB-T1249). Example 12
Effect of T1249 and mPEGMk-CMAB-T1249 on HIV-1 Viral Load in Mice
9 HuPBMC-SCID mice per treatment group (except PEG control which had 6 mice) were employed. On Day 0, each treatment group received a p.m. treatment after infection with HIV isolate. Thereafter, each treatment group received 2 treatments a day (a.m. and p.m.) from day 1 to day 6. The mice were harvested on day 7. See Table 8 for dosing details. Plasma samples for T1249 analysis were collected about 14 hours after last dose administration.
Figure imgf000045_0001
Figure imgf000046_0001
Table 8. Dosing scheme.
HIV-1 in plasma was determined by real-time quantitative PCR. Plasma was harvested for T1249 compound quantification. Frozen plasma samples then underwent compound analysis.
Figure 6 shows the effect of T1249 and mPEG20k-CMAB-T1249 dosing on the HIV-1 viral load in SCID mice.
T1249 and mPEG20k~CMAB-T1249 are equally active in vivo. The results show no discernable difference in in vivo viral suppression activity as measured
against plasma concentration of the tested compound.
The above results indicate the advantageous properties of the invention, the equivalent in vivo biological activity of mPEG2ok-CMAB-T1249 and T1249 at equal
plasma concentrations (Example 12), and far superior pharmacokinetic profile of mPEG2ok-CMAB-T1249 as demonstrated by the comparison of Examples 10 and 11. The invention being thus described, it will be obvious that the same may be varied in many ways. Such variations are not to be regarded as a departure from the spirit and scope of the invention and all such modifications are intended to be included within the scope of the following claims.
SEQUENCE LISTING
<110> BAILON, Pascal Sebastian WON, Chee-Youb
<120> PEGYLATED T1249 POLYPEPTIDE
<130> 21327US1
<150> US 60/439,213
<151> 2003-01-10
<150> US 60/398,190
<151> 2002-07-24
<160> 5
<170> Patentln version 3.1
<210> 1
<211> 39
<212> PRT
<213> Artificial
<220>
<223> Peptide sequence was synthetically derived.
<220>
<221> MOD_RES
<222> (39).. (39)
<223> Residue No. 39 is optionally modified with an amino group.
<400> 1
Trp Gin Glu Trp Glu Gin Lys lie Thr Ala Leu Leu Glu Gin Ala Gin 1 5 10 15
ie Gin Gin Glu Lys Asn Glu Tyr Glu Leu Gin Lys Leu Asp Lys Trp 20 25 30
Ala ser Leu Trp Glu Trp Phe 35
<210> 2
<211> 7
<212> PRT
<213> Artificial
<220>
<223> Peptide sequence was synthetically derived.
<400> 2
Asn Glu Tyr Glu Leu Gin Lys 1 5
<210> 3
<211> 14
<212> PRT
<213> Artificial 21327USl.txt <220> <223> Peptide sequence was synthetically derived.
<400> 3 lie Thr Ala Leu Leu Glu Gin Ala Gin lie Gin Gin Glu Lys 1 5 10
<210> 4
<211> 7
<212> PRT
<213> Artificial
<220>
<223> Peptide sequence was synthetically derived.
<400> 4
Trp Gin Glu Trp Glu Gin Lys 1 5
<210> 5
<211> 8
<212> PRT
<213> Artificial
<220>
<223> Peptide sequence was synthetically derived.
<220>
<221> MOD_RES
<222> (8) .. (8)
<223> Residue No. 8 is modified with an amino group.
<400> 5
Trp Ala Ser Leu Trp Glu Trp Phe 1 5

Claims

Claims:
1. A compound of formula (I),
O
II
Rr(CH2CH20)n-CH2CH2-0-(CH2)m-C-NH-(CH2)p-CH2-NHT1249 (I)
wherein
Ri is a capping group, m is from 1 to 17, n is from 10 to 1 ,000, p is from 1 to 3, and
NHT1249 is a T1 49 polypeptide covalently bonded through its terminal α- amino group.
2. A compound according to claim 1 , wherein R^ is selected from the group consisting of halogen, epoxide, maleimide, orthopyridyl disulfide, tosylate, isocyanate, hydrazine hydrate, cyanuric halide, N-succinimidyloxy, sulfo-N- succinimidyloxy, 1 -benzotriazolyloxy, 1-imidazolyloxy, p-nitrophenyloxy, and
O
II
-CH2CH2-0-(CH2)m-C-NH-(CH2)p-CH0.
3. A compound according to claim 1 , wherein p is 3.
4. A compound according to claim 1 , wherein p is 3, Ri is methoxy, m is 1 , and n is from 100 to 750.
5. A compound of formula: CH3-0-(CH2-CH2-0)n-CH2-CH2-0-CH2-CH2-CH2-NHT1249 (III)
wherein n is from 10 to 1 ,000 and NHT1249 is a T1249 polypeptide covalently bonded through its terminal α-amino group.
6. A compound according to claim 5, wherein n is approximately 450.
7. A pharmaceutical composition comprising, in admixture with a pharmaceutically acceptable excipient, a compound of formula:
O
II
R1-(CH2CH2θ)n-CH2CH2-0-(CH2)m-C-NH-(CH2)p-CH2-NHT1249 (I)
wherein
R-\ is a capping group, m is from 1 to 17, n is from 10 to 1 ,000, p is from 1 to 3, and
NHT1249 is a T1249 polypeptide covalently bonded through its terminal α- amino group.
8. A pharmaceutical composition according to claim 7, wherein p is 3, Ri is methoxy, m is 1 , and n is from 100 to 750.
9. A pharmaceutical composition according to claim 7 in the form of a lypholized powder.
10. A pharmaceutical composition according to claim 7 in the form of an injectable solution or suspension.
11. Use of pharmaceutical composition comprising, in admixture with a pharmaceutically acceptable excipient, a compound of formula I, for the preparation of a medicament for the inhibition of HIV infection:
O
II
R1-(CH2CH20)n-CH2CH2-0-(CH2)m-C-NH-(CH2)p-CH2-NHT1249 (I)
wherein
R-i is a capping group, m is from 1 to 17, n is from 10 to 1 ,000, p is from 1 to 3, and
NHT1249 is a T1249 polypeptide covalently bonded through its terminal α- amino group.
12. A use according to claim 11 , wherein p is 3, Ri is methoxy, m is 1 , and n is from 100 to 750.
13. A use according to claim 11 , wherein the pharmaceutical composition is injected intraperitoneally, intramuscularly, subcutaneously, intravenously, or by continuous infusion.
14. A use according to claim 11 , wherein the pharmaceutical composition is administered in an amount of from about 50 mg to about 300 mg per administration.
15. Use of a pharmaceutical composition comprising, in admixture with a pharmaceutically acceptable excipient, a compound of formula III, for the preparation of a medicament for the inhibition of HIV infection:
CH3-0-(CH2-CH2-0)n-CH2-CH2-0-CH2-CH2-CH2-NHT1249 (III)
wherein n is from 10 to 1 ,000 and NHT1249 is a T1249 polypeptide covalently bonded through its terminal α-amino group.
16. A use according to claim 15, wherein the pharmaceutical composition is administered in an amount of from about 300 mg to about 1500 mg per week in a single dose.
PCT/EP2003/007711 2002-07-24 2003-07-16 Pegylated t1249 polypeptide Ceased WO2004013165A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
MXPA05000798A MXPA05000798A (en) 2002-07-24 2003-07-16 Pegylated t1249 polypeptide.
EP03766191A EP1546193A1 (en) 2002-07-24 2003-07-16 Pegylated t1249 polypeptide
CA002492954A CA2492954C (en) 2002-07-24 2003-07-16 Pegylated t1249 polypeptide
IL16603703A IL166037A0 (en) 2002-07-24 2003-07-16 Pegylated t1249 polypeptide
JP2004525220A JP4381302B2 (en) 2002-07-24 2003-07-16 PEGylated T1249 polypeptide
BR0312841-5A BR0312841A (en) 2002-07-24 2003-07-16 Pegged t1249 polypeptide
AU2003250079A AU2003250079B2 (en) 2002-07-24 2003-07-16 Pegylated T1249 polypeptide
HR20050025A HRP20050025A2 (en) 2002-07-24 2003-07-16 Pegylated t1249 polypeptide
NZ537493A NZ537493A (en) 2002-07-24 2003-07-16 Pegylated T1249 polypeptide
NO20050067A NO20050067L (en) 2002-07-24 2005-01-06 Pegylated T1249 polypeptide

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US39819002P 2002-07-24 2002-07-24
US60/398,190 2002-07-24
US43921303P 2003-01-10 2003-01-10
US60/439,213 2003-01-10

Publications (1)

Publication Number Publication Date
WO2004013165A1 true WO2004013165A1 (en) 2004-02-12

Family

ID=31498587

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2003/007711 Ceased WO2004013165A1 (en) 2002-07-24 2003-07-16 Pegylated t1249 polypeptide

Country Status (21)

Country Link
US (1) US7084261B2 (en)
EP (1) EP1546193A1 (en)
JP (1) JP4381302B2 (en)
KR (1) KR100630176B1 (en)
CN (1) CN100352837C (en)
AR (1) AR040650A1 (en)
AU (1) AU2003250079B2 (en)
BR (1) BR0312841A (en)
CA (1) CA2492954C (en)
HR (1) HRP20050025A2 (en)
IL (1) IL166037A0 (en)
MX (1) MXPA05000798A (en)
NO (1) NO20050067L (en)
NZ (1) NZ537493A (en)
PA (1) PA8577801A1 (en)
PE (1) PE20040679A1 (en)
PL (1) PL375308A1 (en)
RU (1) RU2294938C2 (en)
TW (1) TW200427697A (en)
UY (1) UY27900A1 (en)
WO (1) WO2004013165A1 (en)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005080418A3 (en) * 2004-02-23 2005-09-22 Borean Pharma As Multimerised hiv fusion inhibitors
WO2005089805A3 (en) * 2004-03-15 2007-07-19 Nektar Therapeutics Al Corp Polymer-based compositions and conjugates of hiv entry inhibitors
JP2009523743A (en) * 2006-01-20 2009-06-25 清華大学 Pharmaceutical products and their use for cancer treatment

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005063282A1 (en) * 2003-12-23 2005-07-14 Centocor, Inc. Anti-retroviral agents, compositions, methods and uses

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6348568B1 (en) * 1998-05-20 2002-02-19 Trimeris, Inc. Hybrid polypeptides with enhanced pharmacokinetic properties

Family Cites Families (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR850004274A (en) * 1983-12-13 1985-07-11 원본미기재 Method for preparing erythropoietin
US5252714A (en) * 1990-11-28 1993-10-12 The University Of Alabama In Huntsville Preparation and use of polyethylene glycol propionaldehyde
US5464933A (en) * 1993-06-07 1995-11-07 Duke University Synthetic peptide inhibitors of HIV transmission
US5795569A (en) * 1994-03-31 1998-08-18 Amgen Inc. Mono-pegylated proteins that stimulate megakaryocyte growth and differentiation
CH690143A5 (en) * 1995-01-27 2000-05-15 Rieter Automotive Int Ag Lambda / 4 sound absorbers.
US5672662A (en) * 1995-07-07 1997-09-30 Shearwater Polymers, Inc. Poly(ethylene glycol) and related polymers monosubstituted with propionic or butanoic acids and functional derivatives thereof for biotechnical applications
US5830879A (en) * 1995-10-02 1998-11-03 St. Elizabeth's Medical Center Of Boston, Inc. Treatment of vascular injury using vascular endothelial growth factor
US5990237A (en) * 1997-05-21 1999-11-23 Shearwater Polymers, Inc. Poly(ethylene glycol) aldehyde hydrates and related polymers and applications in modifying amines
US6281331B1 (en) * 1998-03-23 2001-08-28 Trimeris, Inc. Methods and compositions for peptide synthesis
JO2291B1 (en) * 1999-07-02 2005-09-12 اف . هوفمان لاروش ايه جي Erythopintin derivatives
US6469136B1 (en) * 1999-07-07 2002-10-22 Trimeris, Inc. Methods and composition for peptide synthesis
RU2179980C2 (en) * 2000-03-20 2002-02-27 Государственный научный центр вирусологии и биотехнологии "Вектор" Peptide-simulator of human immunodeficiency type-1 virus protein gp41 conservative epitope recognized by virus-neutralizing monoclonal antibody 2f5 (variants)

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6348568B1 (en) * 1998-05-20 2002-02-19 Trimeris, Inc. Hybrid polypeptides with enhanced pharmacokinetic properties

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005080418A3 (en) * 2004-02-23 2005-09-22 Borean Pharma As Multimerised hiv fusion inhibitors
WO2005089805A3 (en) * 2004-03-15 2007-07-19 Nektar Therapeutics Al Corp Polymer-based compositions and conjugates of hiv entry inhibitors
JP2007529539A (en) * 2004-03-15 2007-10-25 ネクター セラピューティクス アラバマ,コーポレイション Polymeric compositions and complexes of HIV entry inhibitors
AU2005222641B2 (en) * 2004-03-15 2011-04-07 Nektar Therapeutics Polymer-based compositions and conjugates of HIV entry inhibitors
US9446139B2 (en) 2004-03-15 2016-09-20 Nektar Therapeutics Polymer-based compositions and conjugates of HIV entry inhibitors
JP2009523743A (en) * 2006-01-20 2009-06-25 清華大学 Pharmaceutical products and their use for cancer treatment
JP2013163674A (en) * 2006-01-20 2013-08-22 Tsinghua Univ Medicament for treatment of cancer and use thereof

Also Published As

Publication number Publication date
AU2003250079A1 (en) 2004-02-23
CN100352837C (en) 2007-12-05
NZ537493A (en) 2007-05-31
CA2492954A1 (en) 2004-02-12
JP2006515272A (en) 2006-05-25
MXPA05000798A (en) 2005-04-19
CN1671735A (en) 2005-09-21
UY27900A1 (en) 2003-12-31
CA2492954C (en) 2009-12-22
HRP20050025A2 (en) 2006-02-28
EP1546193A1 (en) 2005-06-29
AU2003250079B2 (en) 2006-07-27
AR040650A1 (en) 2005-04-13
IL166037A0 (en) 2006-01-15
NO20050067L (en) 2005-04-22
RU2294938C2 (en) 2007-03-10
PL375308A1 (en) 2005-11-28
KR100630176B1 (en) 2006-10-02
BR0312841A (en) 2005-12-06
KR20050027255A (en) 2005-03-18
PA8577801A1 (en) 2004-05-26
PE20040679A1 (en) 2004-10-06
JP4381302B2 (en) 2009-12-09
RU2005105578A (en) 2005-10-27
US7084261B2 (en) 2006-08-01
US20040171542A1 (en) 2004-09-02
TW200427697A (en) 2004-12-16

Similar Documents

Publication Publication Date Title
AU2003257467B2 (en) Pegylated T20 polypeptide
US20070207952A1 (en) Long Acting Biologically Active Conjugates
AU2003250079B2 (en) Pegylated T1249 polypeptide
US10487121B2 (en) D-peptide inhibitors of HIV entry and methods of use
JP2007529522A (en) Site-specific chemical modification of HIV gp41-derived peptide
ZA200500257B (en) Pegylated T1249 polypeptide
EP1311548A1 (en) T cell binding ligand peptides, peptide constructs containing same and use thereof for treatment of immunological disorders
HK1082952A (en) Pegylated t1249 polypeptide

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A1

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ OM PH PL PT RO RU SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG UZ VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A1

Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LU MC NL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

DFPE Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
121 Ep: the epo has been informed by wipo that ep was designated in this application
WWE Wipo information: entry into national phase

Ref document number: 3127/CHENP/2004

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 537493

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: 2005/00257

Country of ref document: ZA

Ref document number: P20050025A

Country of ref document: HR

Ref document number: 200500257

Country of ref document: ZA

WWE Wipo information: entry into national phase

Ref document number: 2003766191

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2492954

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: PA/a/2005/000798

Country of ref document: MX

Ref document number: 2003250079

Country of ref document: AU

Ref document number: 05003891

Country of ref document: CO

WWE Wipo information: entry into national phase

Ref document number: 375308

Country of ref document: PL

Ref document number: 1-2005-500150

Country of ref document: PH

Ref document number: 1020057001145

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 2004525220

Country of ref document: JP

Ref document number: 20038176793

Country of ref document: CN

ENP Entry into the national phase

Ref document number: 2005105578

Country of ref document: RU

Kind code of ref document: A

WWP Wipo information: published in national office

Ref document number: 1020057001145

Country of ref document: KR

WWP Wipo information: published in national office

Ref document number: 2003766191

Country of ref document: EP

ENP Entry into the national phase

Ref document number: PI0312841

Country of ref document: BR