WO2002090387A1 - Reproductive cancer diagnosis and therapy - Google Patents
Reproductive cancer diagnosis and therapy Download PDFInfo
- Publication number
- WO2002090387A1 WO2002090387A1 PCT/AU2002/000582 AU0200582W WO02090387A1 WO 2002090387 A1 WO2002090387 A1 WO 2002090387A1 AU 0200582 W AU0200582 W AU 0200582W WO 02090387 A1 WO02090387 A1 WO 02090387A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cancer
- ghrelin
- ghs
- nucleic acid
- tissue
- Prior art date
Links
- 206010028980 Neoplasm Diseases 0.000 title claims abstract description 67
- 201000011510 cancer Diseases 0.000 title claims abstract description 47
- 230000001850 reproductive effect Effects 0.000 title description 8
- 238000002560 therapeutic procedure Methods 0.000 title description 8
- 238000003745 diagnosis Methods 0.000 title description 4
- GNKDKYIHGQKHHM-RJKLHVOGSA-N ghrelin Chemical compound C([C@H](NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)CN)COC(=O)CCCCCCC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C1=CC=CC=C1 GNKDKYIHGQKHHM-RJKLHVOGSA-N 0.000 claims abstract description 142
- 101800001586 Ghrelin Proteins 0.000 claims abstract description 133
- 238000000034 method Methods 0.000 claims abstract description 80
- 210000001519 tissue Anatomy 0.000 claims abstract description 59
- 230000014509 gene expression Effects 0.000 claims abstract description 51
- 206010060862 Prostate cancer Diseases 0.000 claims abstract description 45
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims abstract description 44
- 210000004994 reproductive system Anatomy 0.000 claims abstract description 42
- 206010006187 Breast cancer Diseases 0.000 claims abstract description 20
- 208000026310 Breast neoplasm Diseases 0.000 claims abstract description 20
- 206010033128 Ovarian cancer Diseases 0.000 claims abstract description 9
- 206010061535 Ovarian neoplasm Diseases 0.000 claims abstract description 9
- 206010008342 Cervix carcinoma Diseases 0.000 claims abstract description 7
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 claims abstract description 7
- 201000010881 cervical cancer Diseases 0.000 claims abstract description 7
- 208000002495 Uterine Neoplasms Diseases 0.000 claims abstract description 6
- 206010046766 uterine cancer Diseases 0.000 claims abstract description 6
- 102000039446 nucleic acids Human genes 0.000 claims description 64
- 108020004707 nucleic acids Proteins 0.000 claims description 64
- 150000007523 nucleic acids Chemical class 0.000 claims description 64
- 108090000623 proteins and genes Proteins 0.000 claims description 62
- 102000004169 proteins and genes Human genes 0.000 claims description 58
- 239000005557 antagonist Substances 0.000 claims description 26
- 230000000694 effects Effects 0.000 claims description 24
- 238000002965 ELISA Methods 0.000 claims description 15
- 239000002773 nucleotide Substances 0.000 claims description 9
- 125000003729 nucleotide group Chemical group 0.000 claims description 9
- 208000006332 Choriocarcinoma Diseases 0.000 claims description 8
- 241000124008 Mammalia Species 0.000 claims description 8
- 230000000692 anti-sense effect Effects 0.000 claims description 8
- 239000013604 expression vector Substances 0.000 claims description 8
- 230000001105 regulatory effect Effects 0.000 claims description 8
- 238000001262 western blot Methods 0.000 claims description 8
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 7
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 7
- 238000011532 immunohistochemical staining Methods 0.000 claims description 7
- 239000008194 pharmaceutical composition Substances 0.000 claims description 7
- -1 ghrelin nucleic acid Chemical class 0.000 claims description 5
- 206010004446 Benign prostatic hyperplasia Diseases 0.000 claims description 4
- 208000004403 Prostatic Hyperplasia Diseases 0.000 claims description 4
- 208000035475 disorder Diseases 0.000 claims description 4
- 239000003937 drug carrier Substances 0.000 claims description 4
- 239000003085 diluting agent Substances 0.000 claims description 3
- 230000003463 hyperproliferative effect Effects 0.000 claims description 3
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 2
- 238000003757 reverse transcription PCR Methods 0.000 claims description 2
- 102000012004 Ghrelin Human genes 0.000 claims 13
- 102100039256 Growth hormone secretagogue receptor type 1 Human genes 0.000 claims 10
- 101710202385 Growth hormone secretagogue receptor type 1 Proteins 0.000 claims 10
- 125000003275 alpha amino acid group Chemical group 0.000 claims 2
- 102000000393 Ghrelin Receptors Human genes 0.000 abstract description 142
- 108010016122 Ghrelin Receptors Proteins 0.000 abstract description 142
- 238000001514 detection method Methods 0.000 abstract description 23
- 102000005962 receptors Human genes 0.000 abstract description 11
- 108020003175 receptors Proteins 0.000 abstract description 11
- 239000003324 growth hormone secretagogue Substances 0.000 abstract description 7
- 102100033367 Appetite-regulating hormone Human genes 0.000 abstract description 5
- 101710111255 Appetite-regulating hormone Proteins 0.000 abstract description 2
- 210000004027 cell Anatomy 0.000 description 126
- 102400000442 Ghrelin-28 Human genes 0.000 description 118
- 210000002307 prostate Anatomy 0.000 description 25
- 108090000765 processed proteins & peptides Proteins 0.000 description 21
- 150000001413 amino acids Chemical class 0.000 description 20
- 239000002299 complementary DNA Substances 0.000 description 16
- 108020004999 messenger RNA Proteins 0.000 description 16
- 108010051696 Growth Hormone Proteins 0.000 description 15
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 15
- 102100038803 Somatotropin Human genes 0.000 description 15
- 239000000122 growth hormone Substances 0.000 description 15
- 239000000047 product Substances 0.000 description 15
- 102000001708 Protein Isoforms Human genes 0.000 description 14
- 108010029485 Protein Isoforms Proteins 0.000 description 14
- 210000000481 breast Anatomy 0.000 description 13
- 239000013642 negative control Substances 0.000 description 12
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 11
- 239000002953 phosphate buffered saline Substances 0.000 description 11
- 238000000338 in vitro Methods 0.000 description 10
- 239000000243 solution Substances 0.000 description 10
- 238000010186 staining Methods 0.000 description 10
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 9
- 239000003795 chemical substances by application Substances 0.000 description 9
- 238000003364 immunohistochemistry Methods 0.000 description 9
- 238000012340 reverse transcriptase PCR Methods 0.000 description 9
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 8
- 230000003321 amplification Effects 0.000 description 8
- 229940098773 bovine serum albumin Drugs 0.000 description 8
- 238000001415 gene therapy Methods 0.000 description 8
- 210000004907 gland Anatomy 0.000 description 8
- 239000012528 membrane Substances 0.000 description 8
- 238000003199 nucleic acid amplification method Methods 0.000 description 8
- 238000009396 hybridization Methods 0.000 description 7
- 230000005764 inhibitory process Effects 0.000 description 7
- 238000011282 treatment Methods 0.000 description 7
- 239000013598 vector Substances 0.000 description 7
- 241001465754 Metazoa Species 0.000 description 6
- 238000002835 absorbance Methods 0.000 description 6
- 238000000137 annealing Methods 0.000 description 6
- 238000005516 engineering process Methods 0.000 description 6
- 230000004927 fusion Effects 0.000 description 6
- 239000003446 ligand Substances 0.000 description 6
- 239000000523 sample Substances 0.000 description 6
- 238000012163 sequencing technique Methods 0.000 description 6
- 101800001415 Bri23 peptide Proteins 0.000 description 5
- 102400000107 C-terminal peptide Human genes 0.000 description 5
- 101800000655 C-terminal peptide Proteins 0.000 description 5
- 108020004414 DNA Proteins 0.000 description 5
- 206010014733 Endometrial cancer Diseases 0.000 description 5
- 206010014759 Endometrial neoplasm Diseases 0.000 description 5
- 102000004190 Enzymes Human genes 0.000 description 5
- 108090000790 Enzymes Proteins 0.000 description 5
- 108091034117 Oligonucleotide Proteins 0.000 description 5
- 241000283973 Oryctolagus cuniculus Species 0.000 description 5
- 102220497176 Small vasohibin-binding protein_T47D_mutation Human genes 0.000 description 5
- 230000003305 autocrine Effects 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 230000004663 cell proliferation Effects 0.000 description 5
- 229940088598 enzyme Drugs 0.000 description 5
- 239000012634 fragment Substances 0.000 description 5
- 239000007788 liquid Substances 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 210000002784 stomach Anatomy 0.000 description 5
- 239000003890 substance P antagonist Substances 0.000 description 5
- 102000038461 Growth Hormone-Releasing Hormone Human genes 0.000 description 4
- 239000000095 Growth Hormone-Releasing Hormone Substances 0.000 description 4
- 102100020948 Growth hormone receptor Human genes 0.000 description 4
- 101710099093 Growth hormone receptor Proteins 0.000 description 4
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 4
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 4
- 241000700159 Rattus Species 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- 101710142969 Somatoliberin Proteins 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 230000009702 cancer cell proliferation Effects 0.000 description 4
- 238000007385 chemical modification Methods 0.000 description 4
- 238000010790 dilution Methods 0.000 description 4
- 239000012895 dilution Substances 0.000 description 4
- 239000000975 dye Substances 0.000 description 4
- 230000003993 interaction Effects 0.000 description 4
- 239000003550 marker Substances 0.000 description 4
- 238000002703 mutagenesis Methods 0.000 description 4
- 231100000350 mutagenesis Toxicity 0.000 description 4
- 230000001817 pituitary effect Effects 0.000 description 4
- 102000004196 processed proteins & peptides Human genes 0.000 description 4
- 230000035755 proliferation Effects 0.000 description 4
- 238000002708 random mutagenesis Methods 0.000 description 4
- 210000002966 serum Anatomy 0.000 description 4
- 230000001629 suppression Effects 0.000 description 4
- 102000005720 Glutathione transferase Human genes 0.000 description 3
- 108010070675 Glutathione transferase Proteins 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 102000004218 Insulin-Like Growth Factor I Human genes 0.000 description 3
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 3
- 206010052399 Neuroendocrine tumour Diseases 0.000 description 3
- 239000012980 RPMI-1640 medium Substances 0.000 description 3
- 230000009471 action Effects 0.000 description 3
- 239000011543 agarose gel Substances 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 230000000295 complement effect Effects 0.000 description 3
- 238000013211 curve analysis Methods 0.000 description 3
- 230000001086 cytosolic effect Effects 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 201000010099 disease Diseases 0.000 description 3
- 239000003814 drug Substances 0.000 description 3
- 210000002919 epithelial cell Anatomy 0.000 description 3
- 239000000499 gel Substances 0.000 description 3
- 230000012010 growth Effects 0.000 description 3
- 238000003119 immunoblot Methods 0.000 description 3
- 238000012744 immunostaining Methods 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 238000010348 incorporation Methods 0.000 description 3
- 230000003076 paracrine Effects 0.000 description 3
- 239000008188 pellet Substances 0.000 description 3
- 210000002826 placenta Anatomy 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 150000003230 pyrimidines Chemical class 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 238000010839 reverse transcription Methods 0.000 description 3
- 230000028327 secretion Effects 0.000 description 3
- 230000004936 stimulating effect Effects 0.000 description 3
- 239000003826 tablet Substances 0.000 description 3
- 230000014616 translation Effects 0.000 description 3
- 239000011534 wash buffer Substances 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- 102000007469 Actins Human genes 0.000 description 2
- 108010085238 Actins Proteins 0.000 description 2
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 2
- 102100037852 Insulin-like growth factor I Human genes 0.000 description 2
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 2
- 238000012408 PCR amplification Methods 0.000 description 2
- 238000010222 PCR analysis Methods 0.000 description 2
- 102000007079 Peptide Fragments Human genes 0.000 description 2
- 108010033276 Peptide Fragments Proteins 0.000 description 2
- 229920001213 Polysorbate 20 Polymers 0.000 description 2
- 241000283984 Rodentia Species 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 2
- 238000002105 Southern blotting Methods 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 238000001261 affinity purification Methods 0.000 description 2
- 230000032683 aging Effects 0.000 description 2
- 108010004469 allophycocyanin Proteins 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 230000006907 apoptotic process Effects 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 230000006287 biotinylation Effects 0.000 description 2
- 238000007413 biotinylation Methods 0.000 description 2
- OSGAYBCDTDRGGQ-UHFFFAOYSA-L calcium sulfate Chemical compound [Ca+2].[O-]S([O-])(=O)=O OSGAYBCDTDRGGQ-UHFFFAOYSA-L 0.000 description 2
- 244000309466 calf Species 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 231100000504 carcinogenesis Toxicity 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000009087 cell motility Effects 0.000 description 2
- 239000001913 cellulose Substances 0.000 description 2
- 229920002678 cellulose Polymers 0.000 description 2
- 235000010980 cellulose Nutrition 0.000 description 2
- 238000013375 chromatographic separation Methods 0.000 description 2
- 238000013270 controlled release Methods 0.000 description 2
- 238000012303 cytoplasmic staining Methods 0.000 description 2
- 238000002405 diagnostic procedure Methods 0.000 description 2
- 239000002552 dosage form Substances 0.000 description 2
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 2
- 229960005542 ethidium bromide Drugs 0.000 description 2
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 2
- 108010077689 gamma-aminobutyryl-2-methyltryptophyl-2-methyltryptophyl-2-methyltryptophyl-lysinamide Proteins 0.000 description 2
- 210000003016 hypothalamus Anatomy 0.000 description 2
- 238000002991 immunohistochemical analysis Methods 0.000 description 2
- 238000001114 immunoprecipitation Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 238000007834 ligase chain reaction Methods 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 229910001629 magnesium chloride Inorganic materials 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 238000002493 microarray Methods 0.000 description 2
- 230000003472 neutralizing effect Effects 0.000 description 2
- 238000003499 nucleic acid array Methods 0.000 description 2
- 210000004940 nucleus Anatomy 0.000 description 2
- WWZKQHOCKIZLMA-UHFFFAOYSA-N octanoic acid Chemical compound CCCCCCCC(O)=O WWZKQHOCKIZLMA-UHFFFAOYSA-N 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 238000001543 one-way ANOVA Methods 0.000 description 2
- 210000001672 ovary Anatomy 0.000 description 2
- 230000002018 overexpression Effects 0.000 description 2
- 229940056360 penicillin g Drugs 0.000 description 2
- 230000002093 peripheral effect Effects 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 238000003752 polymerase chain reaction Methods 0.000 description 2
- 108091033319 polynucleotide Proteins 0.000 description 2
- 102000040430 polynucleotide Human genes 0.000 description 2
- 239000002157 polynucleotide Substances 0.000 description 2
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 2
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 230000009145 protein modification Effects 0.000 description 2
- 150000003212 purines Chemical class 0.000 description 2
- 238000012207 quantitative assay Methods 0.000 description 2
- 238000003259 recombinant expression Methods 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 238000002741 site-directed mutagenesis Methods 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 210000000130 stem cell Anatomy 0.000 description 2
- QTENRWWVYAAPBI-YCRXJPFRSA-N streptomycin sulfate Chemical compound OS(O)(=O)=O.OS(O)(=O)=O.OS(O)(=O)=O.CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](N=C(N)N)[C@H](O)[C@@H](N=C(N)N)[C@H](O)[C@H]1O.CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](N=C(N)N)[C@H](O)[C@@H](N=C(N)N)[C@H](O)[C@H]1O QTENRWWVYAAPBI-YCRXJPFRSA-N 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 238000006467 substitution reaction Methods 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- MPLHNVLQVRSVEE-UHFFFAOYSA-N texas red Chemical compound [O-]S(=O)(=O)C1=CC(S(Cl)(=O)=O)=CC=C1C(C1=CC=2CCCN3CCCC(C=23)=C1O1)=C2C1=C(CCC1)C3=[N+]1CCCC3=C2 MPLHNVLQVRSVEE-UHFFFAOYSA-N 0.000 description 2
- 229940124597 therapeutic agent Drugs 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- 239000003656 tris buffered saline Substances 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- 239000013603 viral vector Substances 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- WZUVPPKBWHMQCE-XJKSGUPXSA-N (+)-haematoxylin Chemical compound C12=CC(O)=C(O)C=C2C[C@]2(O)[C@H]1C1=CC=C(O)C(O)=C1OC2 WZUVPPKBWHMQCE-XJKSGUPXSA-N 0.000 description 1
- MXYRZDAGKTVQIL-IOSLPCCCSA-N (2r,3r,4s,5r)-2-(6-aminopurin-9-yl)-5-(hydroxymethyl)-2-methyloxolane-3,4-diol Chemical compound C1=NC2=C(N)N=CN=C2N1[C@]1(C)O[C@H](CO)[C@@H](O)[C@H]1O MXYRZDAGKTVQIL-IOSLPCCCSA-N 0.000 description 1
- WZHKXNSOCOQYQX-FUAFALNISA-N (2s)-6-amino-2-[[(2r)-2-[[(2s)-2-[[(2s)-2-[[(2r)-2-[[(2s)-2-amino-3-(1h-imidazol-5-yl)propanoyl]amino]-3-(1h-indol-3-yl)propanoyl]amino]propanoyl]amino]-3-(1h-indol-3-yl)propanoyl]amino]-3-phenylpropanoyl]amino]hexanamide Chemical compound C([C@H](N)C(=O)N[C@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCCN)C(N)=O)C1=CN=CN1 WZHKXNSOCOQYQX-FUAFALNISA-N 0.000 description 1
- GEYOCULIXLDCMW-UHFFFAOYSA-N 1,2-phenylenediamine Chemical compound NC1=CC=CC=C1N GEYOCULIXLDCMW-UHFFFAOYSA-N 0.000 description 1
- HWPZZUQOWRWFDB-UHFFFAOYSA-N 1-methylcytosine Chemical compound CN1C=CC(N)=NC1=O HWPZZUQOWRWFDB-UHFFFAOYSA-N 0.000 description 1
- NVKAWKQGWWIWPM-ABEVXSGRSA-N 17-β-hydroxy-5-α-Androstan-3-one Chemical compound C1C(=O)CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CC[C@H]21 NVKAWKQGWWIWPM-ABEVXSGRSA-N 0.000 description 1
- ZLOIGESWDJYCTF-XVFCMESISA-N 4-thiouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=S)C=C1 ZLOIGESWDJYCTF-XVFCMESISA-N 0.000 description 1
- WOVKYSAHUYNSMH-RRKCRQDMSA-N 5-bromodeoxyuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(Br)=C1 WOVKYSAHUYNSMH-RRKCRQDMSA-N 0.000 description 1
- PXBWLHQLSCMJEM-IOSLPCCCSA-N 9-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)-2-methyloxolan-2-yl]-3h-purin-6-one Chemical compound C1=NC2=C(O)N=CN=C2N1[C@]1(C)O[C@H](CO)[C@@H](O)[C@H]1O PXBWLHQLSCMJEM-IOSLPCCCSA-N 0.000 description 1
- 239000004925 Acrylic resin Substances 0.000 description 1
- 229920000178 Acrylic resin Polymers 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 108700028369 Alleles Proteins 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 239000004971 Cross linker Substances 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- AHCYMLUZIRLXAA-SHYZEUOFSA-N Deoxyuridine 5'-triphosphate Chemical compound O1[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)C[C@@H]1N1C(=O)NC(=O)C=C1 AHCYMLUZIRLXAA-SHYZEUOFSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 102400000242 Dynorphin A(1-17) Human genes 0.000 description 1
- 108010065372 Dynorphins Proteins 0.000 description 1
- 241000283074 Equus asinus Species 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 description 1
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 239000001828 Gelatine Substances 0.000 description 1
- 239000004366 Glucose oxidase Substances 0.000 description 1
- 108010015776 Glucose oxidase Proteins 0.000 description 1
- WZUVPPKBWHMQCE-UHFFFAOYSA-N Haematoxylin Natural products C12=CC(O)=C(O)C=C2CC2(O)C1C1=CC=C(O)C(O)=C1OC2 WZUVPPKBWHMQCE-UHFFFAOYSA-N 0.000 description 1
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- AVXURJPOCDRRFD-UHFFFAOYSA-N Hydroxylamine Chemical compound ON AVXURJPOCDRRFD-UHFFFAOYSA-N 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- 150000008575 L-amino acids Chemical class 0.000 description 1
- 241001254607 Leander Species 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 102000013460 Malate Dehydrogenase Human genes 0.000 description 1
- 108010026217 Malate Dehydrogenase Proteins 0.000 description 1
- NPPQSCRMBWNHMW-UHFFFAOYSA-N Meprobamate Chemical compound NC(=O)OCC(C)(CCC)COC(N)=O NPPQSCRMBWNHMW-UHFFFAOYSA-N 0.000 description 1
- 102000016943 Muramidase Human genes 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 241000204031 Mycoplasma Species 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- GXCLVBGFBYZDAG-UHFFFAOYSA-N N-[2-(1H-indol-3-yl)ethyl]-N-methylprop-2-en-1-amine Chemical compound CN(CCC1=CNC2=C1C=CC=C2)CC=C GXCLVBGFBYZDAG-UHFFFAOYSA-N 0.000 description 1
- 230000004988 N-glycosylation Effects 0.000 description 1
- 108090000189 Neuropeptides Proteins 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 230000004989 O-glycosylation Effects 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 208000007913 Pituitary Neoplasms Diseases 0.000 description 1
- 206010035104 Pituitary tumour Diseases 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 108010066717 Q beta Replicase Proteins 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 238000010240 RT-PCR analysis Methods 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 102000005157 Somatostatin Human genes 0.000 description 1
- 108010056088 Somatostatin Proteins 0.000 description 1
- 241000191940 Staphylococcus Species 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 238000000692 Student's t-test Methods 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 108010006785 Taq Polymerase Proteins 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 206010046865 Vaccinia virus infection Diseases 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- HMNZFMSWFCAGGW-XPWSMXQVSA-N [3-[hydroxy(2-hydroxyethoxy)phosphoryl]oxy-2-[(e)-octadec-9-enoyl]oxypropyl] (e)-octadec-9-enoate Chemical compound CCCCCCCC\C=C\CCCCCCCC(=O)OCC(COP(O)(=O)OCCO)OC(=O)CCCCCCC\C=C\CCCCCCCC HMNZFMSWFCAGGW-XPWSMXQVSA-N 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 238000013103 analytical ultracentrifugation Methods 0.000 description 1
- 239000003098 androgen Substances 0.000 description 1
- 229960003473 androstanolone Drugs 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 230000008485 antagonism Effects 0.000 description 1
- 230000000118 anti-neoplastic effect Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 210000000628 antibody-producing cell Anatomy 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- UDSAIICHUKSCKT-UHFFFAOYSA-N bromophenol blue Chemical compound C1=C(Br)C(O)=C(Br)C=C1C1(C=2C=C(Br)C(O)=C(Br)C=2)C2=CC=CC=C2S(=O)(=O)O1 UDSAIICHUKSCKT-UHFFFAOYSA-N 0.000 description 1
- 239000008366 buffered solution Substances 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 235000011132 calcium sulphate Nutrition 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 239000003054 catalyst Substances 0.000 description 1
- 230000004709 cell invasion Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 210000003855 cell nucleus Anatomy 0.000 description 1
- 238000001516 cell proliferation assay Methods 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 210000003679 cervix uteri Anatomy 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 108091006116 chimeric peptides Proteins 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 229910017052 cobalt Inorganic materials 0.000 description 1
- 239000010941 cobalt Substances 0.000 description 1
- GUTLYIVDDKVIGB-UHFFFAOYSA-N cobalt atom Chemical compound [Co] GUTLYIVDDKVIGB-UHFFFAOYSA-N 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- SUYVUBYJARFZHO-RRKCRQDMSA-N dATP Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-RRKCRQDMSA-N 0.000 description 1
- SUYVUBYJARFZHO-UHFFFAOYSA-N dATP Natural products C1=NC=2C(N)=NC=NC=2N1C1CC(O)C(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-UHFFFAOYSA-N 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 238000002716 delivery method Methods 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- BFMYDTVEBKDAKJ-UHFFFAOYSA-L disodium;(2',7'-dibromo-3',6'-dioxido-3-oxospiro[2-benzofuran-1,9'-xanthene]-4'-yl)mercury;hydrate Chemical compound O.[Na+].[Na+].O1C(=O)C2=CC=CC=C2C21C1=CC(Br)=C([O-])C([Hg])=C1OC1=C2C=C(Br)C([O-])=C1 BFMYDTVEBKDAKJ-UHFFFAOYSA-L 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 238000006073 displacement reaction Methods 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- JMNJYGMAUMANNW-FIXZTSJVSA-N dynorphin a Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O)NC(=O)CNC(=O)CNC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=CC=C1 JMNJYGMAUMANNW-FIXZTSJVSA-N 0.000 description 1
- 230000002500 effect on skin Effects 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 230000002124 endocrine Effects 0.000 description 1
- 239000006274 endogenous ligand Substances 0.000 description 1
- 210000004696 endometrium Anatomy 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 201000010255 female reproductive organ cancer Diseases 0.000 description 1
- 210000004996 female reproductive system Anatomy 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 238000011049 filling Methods 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 230000037433 frameshift Effects 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 230000000762 glandular Effects 0.000 description 1
- 210000001703 glandular epithelial cell Anatomy 0.000 description 1
- 229940116332 glucose oxidase Drugs 0.000 description 1
- 235000019420 glucose oxidase Nutrition 0.000 description 1
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 108010015153 growth hormone releasing hexapeptide Proteins 0.000 description 1
- 230000009422 growth inhibiting effect Effects 0.000 description 1
- 229920001600 hydrophobic polymer Polymers 0.000 description 1
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 1
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 1
- UFVKGYZPFZQRLF-UHFFFAOYSA-N hydroxypropyl methyl cellulose Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)O)C(CO)O1 UFVKGYZPFZQRLF-UHFFFAOYSA-N 0.000 description 1
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 229940027941 immunoglobulin g Drugs 0.000 description 1
- 238000012308 immunohistochemistry method Methods 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 238000009830 intercalation Methods 0.000 description 1
- 238000000185 intracerebroventricular administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 150000002540 isothiocyanates Chemical class 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 239000012160 loading buffer Substances 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- 210000004995 male reproductive system Anatomy 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 239000000203 mixture Substances 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004001 molecular interaction Effects 0.000 description 1
- 238000000302 molecular modelling Methods 0.000 description 1
- VMGAPWLDMVPYIA-HIDZBRGKSA-N n'-amino-n-iminomethanimidamide Chemical class N\N=C\N=N VMGAPWLDMVPYIA-HIDZBRGKSA-N 0.000 description 1
- 206010061311 nervous system neoplasm Diseases 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 239000002853 nucleic acid probe Substances 0.000 description 1
- 239000007764 o/w emulsion Substances 0.000 description 1
- 229920002113 octoxynol Polymers 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 210000002394 ovarian follicle Anatomy 0.000 description 1
- 210000003101 oviduct Anatomy 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000013610 patient sample Substances 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 230000003169 placental effect Effects 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000009696 proliferative response Effects 0.000 description 1
- 235000019833 protease Nutrition 0.000 description 1
- 229940076372 protein antagonist Drugs 0.000 description 1
- 239000012474 protein marker Substances 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 238000000163 radioactive labelling Methods 0.000 description 1
- 238000003653 radioligand binding assay Methods 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 239000003161 ribonuclease inhibitor Substances 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 238000005096 rolling process Methods 0.000 description 1
- 230000007727 signaling mechanism Effects 0.000 description 1
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 238000010532 solid phase synthesis reaction Methods 0.000 description 1
- NHXLMOGPVYXJNR-ATOGVRKGSA-N somatostatin Chemical compound C([C@H]1C(=O)N[C@H](C(N[C@@H](CO)C(=O)N[C@@H](CSSC[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CC=2C3=CC=CC=C3NC=2)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N1)[C@@H](C)O)NC(=O)CNC(=O)[C@H](C)N)C(O)=O)=O)[C@H](O)C)C1=CC=CC=C1 NHXLMOGPVYXJNR-ATOGVRKGSA-N 0.000 description 1
- 229960000553 somatostatin Drugs 0.000 description 1
- 210000001875 somatotroph Anatomy 0.000 description 1
- 210000004989 spleen cell Anatomy 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 238000009168 stem cell therapy Methods 0.000 description 1
- 238000009580 stem-cell therapy Methods 0.000 description 1
- 239000004575 stone Substances 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 238000005382 thermal cycling Methods 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 230000000381 tumorigenic effect Effects 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 210000004291 uterus Anatomy 0.000 description 1
- 208000007089 vaccinia Diseases 0.000 description 1
- 210000001215 vagina Anatomy 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/60—Growth hormone-releasing factor [GH-RF], i.e. somatoliberin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/72—Receptors; Cell surface antigens; Cell surface determinants for hormones
- C07K14/723—G protein coupled receptor, e.g. TSHR-thyrotropin-receptor, LH/hCG receptor, FSH receptor
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2869—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against hormone receptors
Definitions
- THIS INVENTION relates to diagnosis and treatment of cancers of the reproductive system such as prostate cancer, breast cancer, ovarian cancer, cervical cancer and uterine cancer. More particularly, this invention relates to detection of ghrelin, an exon 3-deleted form of preproghrelin and growth hormone secretagogue type lb receptor expression by cancer cells and tissues of the reproductive system, and to interventionist strategies that target ghrelin and/or growth hormone secretagogue receptors in treating cancers of the reproductive system.
- IGF-I Insulin-like growth factor-I
- GH tissue biomediator of growth hormone
- Antagonistic analogues of growth hormone releasing hormone inhibit the growth of androgen-independent human prostate cancer cell lines both in vivo and in vitro (Schally & Varga, 1999, Endocrinol. & Metab. 10 383).
- the expression of GH receptor (GH-R) mRNA has been demonstrated in normal and cancerous human prostate tissue (Ballesteros et al., 2000 J. Clin. Endocrinol. Metab. 85 2865).
- There have been reports of an increased in vitro proliferation rate in human LNCaP prostate cancer cells in response to GH (Schser et al., 1999, Exp. Gerontol.
- GLSs GH receptors
- IGF Res. 9 340 Friend et al., 1999, J. Neurosurg. 91 93.
- Synthetic growth hormone secretagogues (GHSs) are potent inducers of
- GHSs exert their effects via activation of the growth hormone secretagogue receptor (GHS-R).
- GHS-R growth hormone secretagogue receptor
- Ghrelin A recently identified endogenous ligand for the GHS-R, ghrelin, is a 28 amino acid peptide originally isolated from rat stomach tissue and subsequently from human stomach (Kojima et al., 1999, Nature 402 656). Ghrelin was found to stimulate pituitary GH release in vitro and in vivo with a potency and specificity comparable to Growth Hormone Releasing Hormone (GHRH Kojima et ah, 1999, supra).
- GHS-R expression has been associated with certain tumours such as pituitary adenomas and other neuroendocrine tumours (Korbonits et al., 1998, J. Clin. Endocrinol. Metab. 83 3624) and thyroid carcinomas (Cassoni et al., 2000, J. Endocrinol. 165 139).
- a non-defined ghrelin binding site has been reported in breast cancer tissue which may mediate growth inhibitory effects on breast cancer cell lines in vitro (Cassoni et al, 2001, J. Clin. Endocrinol. Metab. 86 1738).
- the present inventors have unexpectedly discovered expression of ghrelin, GHS-R la and GHS-R lb by cancer cells and tissues of the reproductive system. Furthermore, expression of ghrelin and/or GHS-R lb distinguishes cancer cells from normal cells, particularly in the case of prostate and breast cells and tissues.
- the present inventors have also identified a novel, exon 3-deleted form of preproghrelin, the expression of which distinguishes cancer cells and tissues from normal cells and tissues of the reproductive system. It is therefore an object of the invention to provide a method of detection of cancer cells and tissues of the reproductive system.
- the invention provides a method of identifying a cancer cell or tissue of the reproductive system, said method including the step of detecting expression of ghrelin, an exon 3-deleted form of preproghrelin and or GHS-R lb by a cell or tissue of the reproductive system, wherein at least the presence of said ghrelin or said GHS-R lb indicates that said cell or tissue is a cancer cell or tissue.
- expression of ghrelin, an exon 3-deleted preproghrelin and/or GHS-R lb protein is detected.
- expression of ghrelin, an exon 3-deleted preproghrelin and/or GHS-R lb nucleic acid is detected.
- the expression of GHS-R lb protein or nucleic acid is detected as an indication that said cell or tissue is a cancer cell or tissue. In another particular embodiment, the expression of ghrelin protein or nucleic acid is detected as an indication that said cell or tissue is a cancer cell or tissue.
- an exon 3-deleted form of preproghrelin protein or nucleic acid is detected as an indication that said cell or tissue is a breast cancer or prostate cancer cell or tissue.
- expression of ghrelin, exon3-deleted preproghrelin or GHS-R lb protein or nucleic acid is higher in said cancer cell or tissue than in a corresponding normal cell or tissue of the reproductive system.
- the present invention provides an isolated protein that includes the amino acid sequence RPQPTSDRPQALLTSL (SEQ ID NO: 1).
- the isolated protein is an exon 3-deleted form of preproghrelin or proghrelin
- the exon 3-deleted form of preproghrelin has the amino acid sequence: MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQ PRALAGWLRPEDGGQAEGAEDELEVRRPQPTSDRPQALLTSL (SEQ ID NO:2).
- the invention also provides an isolated nucleic acid that encodes the exon 3-deleted form of preproghrelin or proghrelin.
- the isolated nucleic acid has the nucleotide sequence shown in
- the invention provides a method of treating cancer of the reproductive system, said method including the step of administering to an individual an agent that suppresses or inhibits ghrelin activity.
- ghrelin activity is meant the biological activity of any component of the ghrelin system. That is, ghrelin itself, GHS-R la or GHS-R lb and homologous or structurally and functionally related ligands or receptors that are associated with cancers of the reproductive system.
- suppression or inhibition of ghrelin activity inhibits or reduces cancer cell proliferation, motility and/or invasiveness or promotes cancer cell apoptosis.
- the cancer of the reproductive system includes, but is not limited to, prostate cancer, ovarian cancer, breast cancer, cervical cancer, choriocarcinoma and uterine cancer.
- the present invention also contemplates hyperproliferative disorders of the reproductive system such as benign prostatic hyperplasia.
- the reproductive cancer is prostate cancer.
- said individual is a mammal.
- the invention provides an antibody that binds ghrelin, an exon 3-deleted form of preproghrelin, GHS-R la or GHS-R lb.
- the antibody may be useful according to the aforementioned method of detection, or to neutralize ghrelin binding to GHS-R la, for example.
- the antibody is a GHS- R lb-specific antibody.
- the antibody is capable of distinguishing between the aforementioned exon 3-deleted form of preproghrelin and preproghrelin or ghrelin.
- the antibody is capable of binding the amino acid sequence RPQPTSDRPQALLTSL (SEQ ID NO:l), an antigenic fragment thereof or a larger peptide that includes this sequence.
- the invention provides a method of identifying an antagonist of ghrelin activity, said method including the step of determining' whether a candidate molecule inhibits or suppresses ghrelin activity. h a still further aspect, the invention provides nucleic acids and expression constructs comprising same that may be useful in gene therapy methods of treatment of cancer of the reproductive system.
- said nucleic acid encodes a protein antagonist of ghrelin/GHS-R la receptor binding. In another embodiment, said nucleic acid encodes ghrelin, GHS-R la, and/or GHS-R lb such as may be useful in antisense inhibition of ghrelin and/or GHS-R la expression.
- the invention provides a pharmaceutical composition
- a pharmaceutical composition comprising an agent that suppresses ghrelin activity together with a pharmaceutically-acceptable carrier, diluent or excipient.
- Figure 1 Nucleotide sequence of exon 3-deleted preproghrelin mRNA (SEQ ID NO:3) and encoded protein (SEQ ID NO:2).
- the novel C-terminal peptide sequence RPQPTSDRPQALLTSL (SEQ ID NO:l) is bolded within the SEQ ID NO:2 sequence.
- the wild type precursor mRNA (SEQ ID NO:4) and encoded preproghrelin protein (SEQ ID NO:5) are also shown.
- Figure 2 Structure of wild type preproghrelin, proghrelin and ghrelin mRNA (a) and the exon structure of the exon 3-deleted isoform (b) that would allow for the translation of a truncated form of preproghrelin with an alternative, novel C-terminal peptide sequence RPQPTSDRPQALLTSL (SEQ ID NO:l).
- Figure 4 Agarose gel stained with ethidium bromide showing specific RT- PCR products of the expected size generated using GHS-R lb specific primers. The nature of these transcripts was confirmed using cDNA sequencing.
- 1-3 JAR choriocarcinoma cell line 4-5. normal term human placenta 6-8. JEG choriocarcinoma cell line 9. normal human stomach 10 -12. Hecla endometrial cancer cell line 13-14. Hec lb human endometrial cancer cell line. 16. normal human prostate 17. negative control.
- M molecular weight marker.
- GHSR lb RT-PCRs were also positive for the MCF7, T47D, and MDA-MB 231 breast cancer cell lines, in the Ishikawa and KLE endometrial cancer cell lines, in the OvCar3 ovarian cancer cell line and in the ALVA-41, DU145, PC3 and LNCaP prostate cancer cell lines (data not shown).
- Figure 5 Ethidium bromide stained agarose gels showing RT-PCR products in prostate cancer cell lines and normal cDNA and female reproductive cancer cell lines and normal breast cDNA using primers specific for the exon 3-deleted isoform of preproghrelin. 1. Molecular weight marker 2. normal prostate cDNA 3. DU-145 4. LNCaP 5. PC-3 6. normal breast cDNA 7. MCF-7 8. T47D 9. Jar 10. LCCS 11. KLE 12. Hec lb 13. Ishikawa 14 negative control.
- FIG. 6 Immunohistochemistry performed on ALVA41 (a,f), DU145 (b,g), LNCaP (c,l) and PC3 (d,i) cells using GHS-R la antibodies (a-d) and ghrelin antibodies (f-i). Positive staining is indicated by the brown cytoplasmic staining. All cell nuclei are non-immunoreactive. Representative ghrelin negative control (e) demonstrates lack of immunoreactivity in LNCaP cells.
- GHS-Rlb in prostate cancer glands as opposed to negative staining in glands from normal prostate tissue (a).
- Figure 9 Immunohistochemical staining of normal and histopathological prostate specimens using anti-ghrelin antibody, (a) Normal prostate tissue demonstrating weak epithelial (arrow) cytoplasmic immunostaining for ghrelin. (b) Prostate cancer glands demonstrating strong cytoplasmic immunoreactivity for ghrelin.
- E epithelial cells
- S stroma
- L lumen
- G gland Figure 10: Immunohistochemical staining of normal prostate and histopathological specimens using the exon 3-deleted ghrelin antibody,
- E epithelial cells
- S stroma
- G gland
- L - lumen gland
- Figure 11 Western blot of cell extracts from the ALVA41, BPH-1 and DU145 prostate cancer cell lines using the GHSRlb specific antibody reveals a single band of 45kda representing the lb protein.
- Figure 12 Western immunoblot of cell lysates from LNCaP (L), PC3 (P), ALVA41 (A) and DU145 (D) prostate cancer cell lines (24 h exposure to X-ray film) using anti-human ghrelin antibody showing bands of approximately 3KDa, identical to synthetic human w-octanoylated ghrelin (l ⁇ g, lane G) which was exposed for a shorter time (5 min).
- Figure 13 The effect of ghrelin on PC3 cells.
- Figure 14 The effect of ghrelin on MDA-MB231 and Ishikawa cells. Cell proliferation was determined using the MTT dye method. Absorbance readings for each were converted to percentages above control + SEM, indicated by error bars. * denotes P values ⁇ 0.01, ** PO.001 (one-way ANOVA with Tukey's post hoc comparisons).
- the present invention arises from the discovery that ghrelin, GHS-R la and GHS-R lb are expressed in prostate cancer cells. More particularly, ghrelin and GHS-R lb protein and nucleic acid are expressed at higher levels in prostate cancer and breast cancer cells compared to the levels observed in normal prostate and normal breast. Another feature of the present invention is the discovery of a novel, exon 3-deleted form of preproghrelin the expression of which distinguishes prostate cancer and breast cancer cells from their normal counterparts.
- the present invention therefore provides methods that allow cancer cells and tissues of the reproductive system to be distinguished from normal cells and tissues, and therapeutic methods and novel agents for treating cancer by inhibition or suppression of ghrelin activity. That is, by suppression or inhibition of ghrelin itself, GHS-R la or GHS-R lb and homologous ligands or receptors that are associated with cancers of the reproductive system.
- the present inventors propose that these methods and novel agents may well be useful in treating cancers of the reproductive system where ghrelin is expressed, or more particularly in reproductive cancers where both ghrelin, GHS-R la and GHS-R lb are co- expressed, given that GHS-R la is known to bind ghrelin.
- Cancers of the reproductive system include, but are not limited to, prostate cancer, breast cancer, ovarian cancer, cervical cancer, choriocarcinoma and uterine cancer.
- the present invention also contemplates hyperproliferative disorders of the reproductive system such as benign prostatic hyperplasia.
- One aspect of the invention provides a novel isoform of an isolated preproghrelin protem that could be of functional significance in cancer and may be useful in cancer diagnosis and therapy.
- This novel form of preproghrelin is set forth in SEQ ID NO:2 ( Figure 1) and is characterized by a novel C-terminal peptide sequence RPQPTSDRPQALLTSL (SEQ ID NO: 1).
- isolated material that has been removed from its natural state or otherwise been subjected to human manipulation. Isolated material may be substantially or essentially free from components that normally accompany it in its natural state, or may be manipulated so as to be in an artificial state together with components that normally accompany it in its natural state. Isolated material may be in native or recombinant form.
- protein is meant an amino acid polymer.
- the amino acids may be natural, non-natural D- or L-amino acids as are well understood in the art.
- a “peptide” is a protein having no more than fifty (50) amino acids.
- a “polypeptide” is a protem having fifty (50) or more amino acids.
- the C-terminal sequence RPQPTSDRPQALLTSL (SEQ ID NO: 1) of exon 3-deleted preproghrelin is a novel peptide fragment that may be produced through the application of standard recombinant nucleic acid techniques or synthesized using conventional liquid or solid phase synthesis techniques.
- peptides can be produced by digestion of exon 3-deleted preproghrelin with proteinases such as trypsin or staphylococcus V8- ⁇ rotease.
- the digested fragment can be purified by, for example, high performance liquid chromatographic (HPLC).
- exon 3-deleted preproghrelin in which one or more amino acids have been replaced by different amino acids or non-natural amino acids, for example. It is well understood in the art that some amino acids may be changed to others with broadly similar properties without changing the nature of the activity of the protein (conservative substitutions). The invention also contemplates chemical modification of exon 3-deleted preproghrelin.
- fusion partners may be employed, typically at the N- or C-tenninus of the expressed protein together with an appropriate affinity matrix.
- fusion partners are glutathione-S-transferase (GST), Fc portion of human IgG, maltose binding protein (MBP) and hexahistidine (HIS 6 ), which are particularly useful for isolation of the fusion protein by affinity chromatography with glutathione-, Protein-A or -G, amylose-, and nickel- or cobalt-conjugated resins respectively.
- GST glutathione-S-transferase
- MBP maltose binding protein
- HIS 6 hexahistidine
- Many such matrices are available in "kit” form, such as the QIAexpressTM system (Qiagen) useful with (HIS 6 ) fusion partners and the Pharmacia GST purification system.
- Fusion partners according to the invention also include within their scope
- epitope tags which are usually short peptide sequences for which a specific antibody is available.
- epitope tags for which specific monoclonal antibodies are readily available include c-myc, influenza virus haemagglutinin and FLAG tags.
- Recombinant protein expression and vectors suitable therefor are well known in the art such as described in Chapters 10 and 16 of CURRENT PROTOCOLS IN PROTEIN SCIENCE Eds. Coligan et al. (John Wiley & Sons NY USA 1995-2001).
- Suitable host cells for recombinant expression may be prokaryotic or eukaryotic, such as Escherichia coli (DH5 ⁇ , SURE and XLl-Blue for example,), yeast cells, Sf9 cells utilized with a baculovirus expression system, CHO cells, COS, CV-1 and 293 cells, without limitation thereto.
- the invention also provides an isolated nucleic acid that encodes said exon 3-deleted preproghrelin protein.
- nucleic acid has a nucleotide sequence as set forth in Figure 1 (SEQ ID NO:3).
- the mRNA encoding this isoform has a complete deletion of exon 3 of the pro- form of ghrelin, which was first described by Kojima et al., 1999, Nature 402 656. Translation of this isoform would lead to the production of wild-type, mature ghrelin coded by exon 1 and part of exon 2 ( Figures 1 and 2). The deletion would lead to a frameshift, however, that would disrupt the original stop codon within exon 4 and would lead to the production of a novel C-terminal peptide sequence (RPQPTSDRPQALLTSL stop).
- nucleic acid encompasses single- or double-stranded mRNA, RNA, cRNA and DNA inclusive of cDNA and genomic DNA.
- a "polynucleotide” is a nucleic acid having eighty (80) or more contiguous nucleotides, while an “oligonucleotide” has up to eighty (80) contiguous nucleotides.
- a “probe” may be a single or double-stranded oligonucleotide or polynucleotide, suitably labeled for the purpose of detecting complementary sequences in Northern or Southern hybridization, for example.
- a “primer” is usually a single-stranded oligonucleotide, preferably having
- annealing to a complementary nucleic acid template and being extended in a template-dependent fashion by the action of a DNA polymerase such as Taq polymerase, RNA-dependent DNA polymerase or SequenaseTM.
- a DNA polymerase such as Taq polymerase, RNA-dependent DNA polymerase or SequenaseTM.
- anneal is used herein in relation to the formation of bimolecular complexes by base-pairing between complementary or partly-complementary nucleic acids in the sense commonly understood in the art.
- isolated nucleic acids encoding variants and derivatives of exon 3-deleted preproghrelin and proghrelin and proteins homologous thereto.
- isolated nucleic acids may be isolated, for example, by nucleic acid sequence amplification using degenerate primers or by hybridization with SEQ ID NO: 3 under appropriate stringency conditions as hereinbefore described. Detection Methods
- the present invention provides methods of detecting ghrelin, the exon 3- deleted form of preproghrelin and/or GHS-R lb expression by a cell or tissue of the reproductive system as an indicator that said cell or tissue of the reproductive system is cancerous.
- the data from prostate cancer cells suggest that ghrelin and/or GHS-R lb expression may be particularly useful as diagnostic indicators of prostate cancer.
- Also contemplated by the invention is detection of exon-3 deleted preproghrelin nucleic acid and protein.
- reproductive system includes and encompasses the male and female reproductive system including organs and tissues such as prostate, testis, breast, ovary, ovarian follicles, vagina, fallopian tubes, cervix and uterus.
- a nucleic acid-based detection method is performed.
- nucleic acid detection is performed by PCR analysis.
- PCR amplification is provided hereinafter, although the skilled person is referred to Chapter 15 of CURRENT PROTOCOLS IN MOLECULAR BIOLOGY (Eds. Ausubel et al. John Wiley & Sons NY 1995- 2000) for a general discussion of PCR methodology.
- PCR amplification may be combined with other methods such as Southern hybridization and nucleic acid sequencing to identify ghrelin and GHS-R lb nucleic acids. These methods are well known to persons skilled in the art. Specific examples of Southern analysis and sequencing of PCR products are provided hereinafter in the Examples.
- nucleic acid sequence amplification techniques other than PCR may be useful according to the invention.
- Potentially suitable nucleic acid amplification techniques other than PCR are well known to the skilled addressee and include strand displacement amplification (SDA); rolling circle replication (RCR) as for example described in Liu et al, 1996, J. Am. Chem. Soc.
- nucleic acid sequence-based amplification as for example described by Sooknanan et al., 1994, Biotechniques 17 1077
- ligase chain reaction LCR
- Q- ⁇ replicase amplification as for example described by Tyagi et al. 1996, Proc. Natl. Acad. Sci. USA 93 5395.
- an "amplification product” refers to a nucleic acid product generated by any nucleic acid amplification technique.
- ghrelin the exon 3-deleted form of preproghrlein and/or GHS-R lb nucleic acids
- detection of ghrelin, the exon 3-deleted form of preproghrlein and/or GHS-R lb nucleic acids may be performed using any of a variety of techniques such as RNA detection, fluorescence-based melt curve analysis, nucleic acid arrays (e.g. microarrays) and other methods that utilize hybridization of nucleic acid probes.
- RNA detection may be performed by methods such as Northern blotting, RNAse protection and primer extension as are well known in the art, although skilled persons are referred to Chapter 4 of CURRENT PROTOCOLS IN MOLECULAR BIOLOGY (Eds. Ausubel et al. John Wiley & Sons NY 1995- 2000) for exemplary methods relating to RNA detection.
- Melt curve analysis can be performed using fluorescent DNA-intercalating dyes to detect PCR product formation either as an end-product or in "real time". Fluorochrome-labeled probes can also be used to detect formation of specific products either during or after completion of PCR. A useful example of melt curve analysis can be found, for example, in International Publication No. WO97/46714. Microarrays also utilize hybridization-based technology that, for example, may allow allele detection by way of hybridization of a nucleic acid sample to ghrelin, exon 3-deleted preproghrelin and/or GHS-R lb-specific probes immobilized on an appropriate substrate as is well understood in the art.
- detection of ghrelin, exon 3-deleted preproghrelin and/or GHS-R lb expression by reproductive cancer cells is performed by protein analysis according to methods well known in the art.
- Suitable methods include ELISA, immunohistochemistry, immunoblotting, immunoprecipitation and any of a variety of chromatographic separation/identification methods without limitation thereto.
- a preferred ELISA method utilizes a GHS-R lb-specific polyclonal antibody produced as will be described hereinafter.
- a sample is subjected to a "sandwich" ELISA where the GHS-R lb-specific antibody is immobilized to an ELISA plate.
- GHS-R lb protein in the fluid sample binds the immobilized antibody and non-bound material is washed away.
- a second antibody that recognizes both GHS-R la and lb is then added to the ELISA plate. Detection of GHS-R lb-containing complexes is then performed either by virtue of the second antibody being labeled, or by addition of a labeled tertiary antibody that specifically binds an unlabeled second antibody.
- the invention also provides an antibody capable of binding ghrelin, exon 3-deleted preproghrelin, GHS-R la or GHS-R lb.
- said antibody is capable of inhibiting binding between ghrelin and said GHS-R la.
- non-neutralizing antibodies are also contemplated as being useful in detection methods as hereinbefore described.
- Such antibodies may be polyclonal, obtained for example by immunizing an animal with ghrelin, GHS-R la, GHS-R lb, exon 3-deleted preproghrelin or a fragment thereof.
- said antibody is capable of distinguishing between the aforementioned exon 3-deleted form of preproghrelin and preproghrelin.
- the antibody is capable of binding the amino acid sequence RPQPTSDRPQALLTSL, an antigenic fragment thereof and/or a protein comprising same.
- said animal could be a mouse, rat, rabbit, sheep, chicken or goat.
- the animal is a rabbit.
- monoclonal antibodies may be produced by standard methods such as described in CURRENT PROTOCOLS IN IMMUNOLOGY (Eds. Coligan et al. John Wiley & Sons. 1995-2000) and Harlow, E. & Lane, D. Antibodies: A Laboratory Manual (Cold Spring Harbour, Cold Spring Harbour Laboratory, 1988).
- Such methods generally involve obtaining antibody-producing cells, such as spleen cells, from an animal immunized as described above, and immortalizing said cell, such as by fusion with an immortalized fusion partner cell.
- antibodies may be conjugated with labels selected from a group including a chromogen, a catalyst, an enzyme, a fluorophore, a chemiluminescent molecule, biotin and a radioisotope.
- labels selected from a group including a chromogen, a catalyst, an enzyme, a fluorophore, a chemiluminescent molecule, biotin and a radioisotope.
- Suitable enzyme labels useful in the present invention include alkaline phosphatase, horseradish peroxidase, luciferase, ⁇ -galactosidase, glucose oxidase, lysozyme, malate dehydrogenase and the like.
- the enzyme label may be used alone or in combination with a second enzyme in solution.
- Fluorophores may be selected from a group including fluorescein isothiocyanate (FITC), tetramethykhodamine isothiocyanate (TRITC), allophycocyanin (APC), Texas Red (TR), Cy5 or R-Phycoerythrin (RPE). Examples of useful fluorophores may be found, for example, in United States Patent No. 4,520,110 and United States Patent No. 4,542,104 which are herein incorporated by reference.
- GHS-R la and lb proteins have common domains and to date there has been no antibody described that can distinguish GHS-R lb from GHS-R la.
- GHS-R la is a 366 amino acid peptide with 7 transmembrane domains.
- the GHS-R lb mRNA arises from alternative splicing of the gene encoding GHS-R la. This mRNA encodes a 289 amino acid peptide that lacks the 6 th and 7 th transmembrane domains.
- the GHS-R lb mRNA incorporates additional intronic sequence that encodes a 24 amino acid sequence that would be a useful target for GHS-R lb-specific antibodies.
- the present inventors have designed a peptide: H-GGSQRALRLSLAGPILSLC-NH2, based on the amino acid sequence disclosed in Howard et al., 1996, Science 273 974). This peptide has been conjugated to a carrier, injected into rabbits and polyclonal antiserum raised. Following affinity purification, this antibody was used for detection of GHS-R lb as hereinafter described in detail.
- Ghrelin antagonists H-GGSQRALRLSLAGPILSLC-NH2
- the present invention contemplates antagonists that suppress or inhibit the ghrelin system, and use of such agents in therapy of cancers of the reproductive system.
- Such antagonists may disrupt or prevent binding of ghrelin to GHS-R la or GHS-R lb, for example.
- the present inventors propose that expression of ghrelin, GHS-R la and GHS-R lb by prostate cancer cells may constitute a paracrine/autocrine loop whereby unchecked cancer cell proliferation is maintained. Inhibition of this cell proliferation by targeting the ghrelin system (inclusive of ghrelin, GHS-R la and GHS-R lb and related or homologous ligands and receptors) is contemplated by the present invention.
- ghrelin is known to bind GHS-R la, this is the preferred target for interventionist strategies aimed at suppressing ghrelin activity and thereby treating cancers of the reproductive system. Suppression or inhibition of ghrelin activity can readily be monitored at the cellular level by measuring cancer cell proliferation (such as by BrdU incorporation), in vitro cancer cell invasion and motility (as for example described in Leavesley et al., 1993, J. Cell. Biol. 121 163; Melchiori et al., 1992, Cancer Res. 52 2353) and by detecting cell apoptosis.
- cancer cell proliferation such as by BrdU incorporation
- in vitro cancer cell invasion and motility as for example described in Leavesley et al., 1993, J. Cell. Biol. 121 163; Melchiori et al., 1992, Cancer Res. 52 2353
- Such methods are applicable to reproductive cancers including prostate cancer, breast cancer, ovarian cancer and cervical cancer, without limitation thereto.
- neutralizing antibodies that disrupt ghrelin binding by GHS- Rl a constitute an embodiment of an antagonist according to the invention.
- antagonists may be "mimetics” that mimic the binding interaction between ghrelin and GHS-R la or GHS-R lb and thereby block ghrelin binding.
- ghrelin may be peptides, polypeptides or other organic molecules, preferably small organic molecules, with a desired biological activity and half-life.
- One particular antagonist contemplated by the present invention is a non- n-octanoylated form of ghrelin which is known to be inactive in terms of stimulating GH secretion. N-octanoylation is a natural post-translational modification of ghrelin that appears to be necessary for the function of this ligand.
- GHRP growth hormone releasing peptide
- dynorphin A and des-tyr-dynorphin Codd et al., 1990, Neuropeptides 15 133
- L-756,867 growth hormone releasing peptide
- a further example of a ghrelin antagonist is a substance P antagonist also known as Antagonist D and also commercially available from Sigma (catalogue number S3144; Cheng et al, 1997, J. Endocrinol. 152 155). It should also be appreciated that there are a number of other substance P antagonists that could be readily assayed for antagonism of the ghrelin system by methods such as those described above. In this regard the skilled person is referred to Caranikas et al, 1982, J. Med. Chem. 25 1313, Lundberg et al, 1983, Proc. Natl. Acad. Sci.
- anti-ghrelin immunoglobulin G inhibits ghrelin activity (Nakazato et al, 2001, Nature 409 194) and that GH release can be inhibited by a chimeric peptide consisting of GHRP-6 and somatostatin (Dasgupta et al, 1999, Biochem. Biophys. Res. Comm. 259 379). These are also candidate antagonists contemplated by the present invention.
- substance P antagonists such as those described above may be useful as antagonists in their own right, or as starting points for developing antagonists that negatively influence ghrelin activity in cancer cells and tissues of the reproductive system.
- the present invention is not limited to use of the aforementioned antagonists. There are a variety of other ways that ghrelin system antagonists may be identified.
- Mutagenesis of ghrelin is contemplated as being a potentially useful way of producing an antagonist of the invention. This can be performed by mutagenizing ghrelin protein or by mutagenizing an encoding nucleic acid, such as by random mutagenesis or site-directed mutagenesis. Examples of nucleic acid mutagenesis methods are provided in Chapter 9 of CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, Ausubel et al, supra.
- Mutagenesis methods include chemical modification of proteins by hydroxylamine (Ruan et al, 1991, Gene 188 35), incorporation of dNTP analogs into nucleic acids (Zaccolo et al, 1996, J. Mol. Biol. 255 589) and PCR-based random mutagenesis such as described in Stemmer, 1994, Proc. Natl. Acad. Sci. USA 91 10747 or Shafikhani et al, 1991, Biotechniques 23 304, each of which references is incorporated herein.
- Computer-assisted structural database searching is becoming increasingly utilized as a procedure for identifying mimetics.
- these methods create space-filling models of a ligand (such as ghrelin) and receptor (GHS-R la, for example) interaction so as to search for candidate structures that may interrupt this binding interaction.
- GHS-R la receptor
- Database searching methods which, in principle, could be • suitable for identifying mimetics, may be found in International Publication WO
- Other methods include a variety of biophysical techniques which identify molecular interactions, such as GHS-R la or GHS-R lb receptor/ligand binding events. These may allow for the screening of candidate molecules according to whether said candidate molecule affects binding between ghrelin and GHS-R la, for example.
- Methods applicable to potentially useful techniques such as competitive radioligand binding assays, analytical ultracentrifugation, microcalorimetry, surface plasmon resonance and optical biosensor-based methods are provided in Chapter 20 of CURRENT PROTOCOLS IN PROTEIN
- the present invention also contemplates isolation of antagonists by way of screening libraries of molecules such as synthetic chemical libraries, including combinatorial libraries, by methods such as described in Nestler & Liu, 1998,
- libraries of naturally-occurring molecules may be screened by methodology such as reviewed in Kolb, 1998, Prog. Drug. Res. 51 185.
- the invention includes pharmaceutical compositions comprising agents that suppress or inhibit ghrelin activity.
- the pharmaceutical composition comprises a pharmaceutically-acceptable carrier.
- pharmaceutically-acceptable carrier is meant a solid or liquid filler, diluent or encapsulating substance that may be safely used in systemic administration. Depending upon the particular route of administration, a variety of carriers, well known in the art may be used.
- These carriers may be selected from a group including sugars, starches, cellulose and its derivatives, malt, gelatine, talc, calcium sulfate, vegetable oils, synthetic oils, polyols, alginic acid, phosphate buffered solutions, emulsifiers, isotonic saline, and pyrogen-free water.
- Any suitable route of administration may be employed for providing a patient with the composition of the invention.
- oral, rectal, parenteral, sublingual, buccal, intravenous, intra-articular, intra-muscular, intra- dermal, subcutaneous, inhalational, intraocular, intraperitoneal, intracerebroventricular, transdermal and the like may be employed.
- Dosage forms include tablets, dispersions, suspensions, injections, solutions, syrups, troches, capsules, suppositories, aerosols, transdermal patches and the like. These dosage forms may also include injecting or implanting controlled releasing devices designed specifically for this purpose or other forms of implants modified to act additionally in this fashion. Controlled release of the therapeutic agent may be effected by coating the same, for example, with hydrophobic polymers including acrylic resins, waxes, higher aliphatic alcohols, polylactic and polyglycolic acids and certain cellulose derivatives such as hydroxypropylmethyl cellulose. In addition, the controlled release may be effected by using other polymer matrices, liposomes and/or microspheres.
- compositions of the present invention suitable for oral or parenteral administration may be presented as discrete units such as capsules, sachets or tablets each containing a pre-determined amount of one or more therapeutic agents of the invention, as a powder or granules or as a solution or a suspension in an aqueous liquid, a non-aqueous liquid, an oil-in-water emulsion or a water-in-oil liquid emulsion.
- the present invention provides methods and agents for treating cancers of the reproductive system, preferably prostate cancer or breast cancer.
- Such methods may utilize ghrelin, GHS-R la and or GHS-R lb antagonists as hereinbefore described, preferably in the form of appropriate pharmaceutical compositions. Also contemplated by the present invention are methods and agents utilizing nucleic acids that encode ghrelin, GHS-R la and/or GHS-R lb.
- gene therapy methods are contemplated whereby a ghrelin, GHS-R la or GHS-R lb nucleic acid are oriented in an antisense (3' 5') orientation in an expression vector suitable for administration to mammals such as humans.
- an "expression vector” is a nucleic acid comprising appropriate regulatory sequences that direct expression of a nucleic acid operably linked thereto.
- Expression vectors may either be a self-replicating extra-chromosomal vector or a vector that integrates into a host genome.
- operably linked is meant that said regulatory nucleotide sequence(s) is/are positioned relative to the nucleic acid to be expressed to thereby initiate, regulate or otherwise control transcription. Regulatory nucleotide sequences will generally be appropriate for the host cell used for expression. Numerous types of appropriate expression vectors and suitable regulatory sequences are known in the art for a variety of host cells.
- said one or more regulatory nucleotide sequences may include, but are not limited to, promoter sequences, leader or signal sequences, ribosomal binding sites, transcriptional start and termination sequences, translational start and termination sequences, and enhancer or activator sequences.
- promoters may be either naturally occurring promoters, or hybrid promoters that combine elements of more than one promoter.
- the expression vector contains a selectable marker gene to allow the selection of transformed host cells. Selectable marker genes are well known in the art and will vary with the host cell used.
- expression vector also includes within its scope vectors generally known as "gene therapy vectors” such as vaccinia, and viral vectors useful in gene therapy.
- the latter include adenovirus and adenovirus-associated viruses (AAV) such as described in Braun-Falco et al, 1999, Gene Ther. 6 432, retroviral and lentiviral vectors such as described in Buchshacher et al, 2000, Blood 95 2499 and vectors derived from herpes simplex virus and cytomegalo virus.
- a general overview of viral vectors useful in endocrine gene therapy is provided in Stone et al, 2000, J. Endocrinol. 164 103.
- Administration of the gene therapy construct to an animal, preferably a human individual may include delivery via direct oral intake, systemic injection, or delivery to selected tissue(s) or cells, or indirectly via delivery to cells isolated from the mammal or a compatible donor.
- An example of the latter approach would be stem-cell therapy, wherein isolated stem cells having potential for growth and differentiation are transfected with a gene therapy construct which includes, for example, a ghrelin, GHS-R la or GHS-R lb antisense nucleic acid. The stem cells are cultured for a period and then transferred to the animal being treated.
- Delivery of said gene therapy construct to cells or tissues of said mammal or said compatible donor may be facilitated by microprojectile bombardment, liposome mediated transfection (e.g. lipofectin or lipofectamine), electroporation, calcium phosphate or DEAE-dextran-mediated transfection, for example.
- liposome mediated transfection e.g. lipofectin or lipofectamine
- electroporation calcium phosphate
- DEAE-dextran-mediated transfection for example.
- ALVA41 cells were obtained from Dr P Leedman (Royal Perth Hospital, Perth, Australia) and DU145, LNCaP, and PC3 cells from the American Type Culture Collection (Rockville, MD). ALVA41 cells were cultured in RPMI 1640 medium (pH 7.4) (Life Technologies, Rockville MD) with 5% foetal calf serum (FCS) (CSL Biosciences, Melbourne, Australia) and DU145, LNCaP and PC3 cells in RPMI 1640 10% FCS.
- RPMI 1640 medium pH 7.4
- FCS foetal calf serum
- MCF7, MDAMB231, T47D breast cancer cell lines, KLE, Ishikawa, Hec IA and HeclB endometrial cancer cell lines, JEG and JAR choriocarcinoma cell lines and the OvCar3 ovarian cancer cell line were cultured in DMEM/F12 (Life Technologies) with 10% FCS.
- RNA was incubated in a 50 ⁇ l solution containing 20nM MgCl 2; 2mM DTT, 0.5mg Dnase (Rnase free, Roche, Basel Switzerland), 5.0 units of Rnase Inhibitor (Roche) and incubated for 30min at 37°C then heated at 90°C for 5min. Reverse transcription was achieved by the addition of 0.5 ⁇ g oligo dT 18 primer, 5 ⁇ g total RNA at 70°C for lOmin.
- a normal human prostate cDNA library was also obtained from Clontech, Palo Alto CA. Normal human breast, ovarian, prostate and placental mRNA was also purchased from Clontech. PCR using ⁇ -actin primers - sense primer 5'GTGGGGCGCCCCAGGCACCA3' (SEQ ID NO:6); antisense primer 5'TTGGCCTTGGGGTTCAGGGG3' (annealing temp: 50°C; SEQ ID NO:7) demonstrated the absence of genomic DNA contamination (330bp product) in all cDNA samples.
- PCR was performed for GHS-R (la and lb) using sense primer 5'TCTTCCTTCCTGTCTTCTGTC3' (SEQ ID NO:8) and antisense primers 5 ⁇ AGTCTGAACACTGCCACC3' (type la, annealing temp: 50°C; SEQ ID NO:9) and 5'CCTTCTCCCTTCTCTCTGA3' (type lb, annealing temp: 58°C; SEQ ID NO: 10) and for ghrelin using sense primer 5'GAGGATGAACTGGAAGTCCG3' (SEQ ID NO: 11) and antisense primer 5'CATTTATTCGCCTCCTGAGC3' (annealing temp: 59°C; SEQ ID NO:12).
- PCRs contained lOxPCR Buffer, lOO ⁇ M dNTPs, lOOpM primers (Genset Pacific Oligos, Armidale, Australia), 2 ⁇ l cDNA or water (no template negative control) and 1 unit Red Hot Polymerase (Integrated Sciences, Melbourne, Australia).
- An additional "minus RT" negative control was performed with the GHS-R lb PCRs for all cell lines.
- Thermal cycling consisted of 5min at 95°C, 40 cycles of 30s, 95°C, 30s at annealing temperature, 2min at 72°C, followed by lOmin at 72°C on a PTC-200 Thermal cycler (MJ research, Watertown Massachusetts). Southern analysis and sequencing
- RT-PCR products electrophoresed on a 2% gel were capillary blotted overnight in 20 x Standard saline citrate (3M NaCl, 0.3M sodium citrate pH 7) onto Hybond positively charged membranes (Amersham Pharmacia Biotech, Little Chalfont, UK).
- Internal oligonucleotide probes for GHS-R 5'TGATGGCAGCACTGAGGTAG' (SEQ ID NO: 13) and ghrelin 5'TTGAACCGGACTTCCAGTTC3' (Genset Pacific Oligos; SEQ ID NO: 14) were labelled using a DIG dUTP/dATP tailing kit (Roche) and quantified and hybridised according to the DIG user's manual (Roche).
- RNA samples were exposed to X-ray film (Agfa-Gavaert, Morstel, Belgium) for up to 15min and developed using the Curix 60 automatic processor (Agfa-Gavaert).
- RT-PCR products were purified from an agarose gel using the Consert Rapid Gel PCR purification kit (Life Technologies). Sequencing was performed at the Australian Genome Research Facility (University of Queensland) using the Applied Biosystems 377 DN automated DNA sequencer and ABI Big Dye Terminator reagents. Immunohistochemistry
- Immimohistochemistry was performed using cultured cell lines and both normal and cancer histological sections (breast, prostate, endometrium, placenta, ovary). Immunohistochemistry was perforr ⁇ ed using our antibodies to GHSRla, lb, ghrelin and the exon 3-deleted form of proghrelin. Cells were grown to 70% confluence in 96 well plates (Nagle-Nunc), washed in phosphate buffered saline (PBS) and fixed for 5min in 100% methanol.
- PBS phosphate buffered saline
- hnmunodetection was performed using a Histostain-SP plus broad spectrum diaminobenzaniine staining kit (Zymed, San Franscisco, CA), according to the manufacturers instructions.
- Polyclonal anti-GHS-R la primary antibodies were raised in rabbits (IMVS, Sydney, SA) against the C-terminal peptide fragment (RAWTESSINTC; SEQ ID NO: 17) (Feighner et al, 1998, Mol. Endocrinol. 12 137) of the GHS-R la peptide and conjugated to diptheria toxin (Mimotopes, Victoria, Australia).
- Anti-ghrelin antibodies were raised against the whole human ghrelin peptide.
- Serum was diluted 1:100 - 1:3200 in 1% bovine serum albumin in 0.01M PBS, and cells were incubated at 4°C for 24h. Negative controls included the abolition of staining by pre-absorbing the primary antibody with 1.0 mg/ml GHS-R la peptide fragment or with ghrelin or the omission of primary antibody.
- Immunohistochemistry was performed on human sections using an Envision Plus DAB anti-rabbit immunostaining kit (Dako, USA) according to the manufacturer's instructions. Negative controls included the substitution of immune serum with 0.01M PBS 1% BSA and also preabsorption of the antibody with lmg/ml peptide overnight at 4°C. Positive controls consisted of pituitary sections for GHSR la and lb (Peterborough) and human stomach for ghrelin (Peterborough). Sections were counterstained with haematoxylin. Western analysis
- the protein was then transferred to a nitrocellulose membrane (Protran, Schleicher and Schuell, Germany) for 1 h in transfer buffer (lOmM NaHCO 3 , 3mM Na 2 CO 3 , methanol).
- transfer buffer lOmM NaHCO 3 , 3mM Na 2 CO 3 , methanol.
- the membrane was blocked overnight at 4°C in IX Tris Buffered Saline/0.05% Tween 20/ 1% BSA. This was followed by incubation of the membrane in primary anti-ghrelin antibody or anti- GHSRlb antibody solution at 4°C overnight. After washing in TBS/Tween20, the membrane was incubated with an anti-rabbit secondary antibody (1:1000 dilution) (DAKO, Carpintera, CA) at room temperature for lh.
- DAKO anti-rabbit secondary antibody
- PC3, MDAMB231 and Ishikawa cells were cultured in 96 well plates for 3 days at 37°C in the presence of ghrelin (0 - 20nM), in 10% FCS. Negative controls received no treatment. After aspiration of medium, cells were incubated in MTT (Sigma) solution (0.5mg/ml) for 2h. MTT solution was aspirated and formazan salts solubilised in dimethyl sulfoxide (ICN, Costa Mesa, CA). A Biomeck Plate reader (Beckman, QLD, Australia) was used to measure absorbances (550/650nm).
- a novel polyclonal antibody has been raised against the peptide RPQPTSDRPQALLTSL (SEQ ID NO:l).
- This peptide was conjugated to a carrier, injected into rabbits and polyclonal antiserum raised. The antibody was then affinity purified. This isoform of preproghrelin could therefore be specifically detected immunologically using Western blotting, ELISA or immunohistochemistry using this antibody. Detection ofGHS-lb receptor protein by ELISA
- the LNCaP prostate cancer cell line and the benign prostatic hyperplasia cell line (BPH-1) were cultured in vitro to 70% confluency in 96 well plates (Nagle Nunc).
- BPH-1 and LNCaP cells were grown in RPMI 1640 with 10% foetal calf serum, containing 50 units/ml penicillin G and 50 ⁇ l/ml streptomycin sulphate (CSL Biosciences) and incubated at 37°C in 5% CO 2 and 95% air.
- BPH-1 cells were grown in the presence of ITS supplement (Sigma) and 20ng/ml dihydrotestosterone.
- Cells were washed in phosphate buffered saline (PBS) and fixed for 5 min in ice-cold methanol. The methanol was removed and the cells allowed to air dry and were stored at -20°C. Cells were thawed in 50% methanol with 1% hydrogen peroxide and incubated in 2 changes of this solution for 20 min each. The cells were washed 3 x 5mins in ELISA wash buffer (0.01M PBS, 0.05% Tween) and blocked in 0.0-1M PBS with 1% bovine serum albumin (BSA) for 2 hours.
- PBS phosphate buffered saline
- OPD with H 2 0 2 urea buffer (Sigma, SigmaFast o-phenylenediamine dihydroxychloride tablet set) diluted in water (according to the manufacturer's instructions) was incubated with the cells for 2 hours at room temperature, protected from light. The reaction was stopped with 2.5M HC1 and the absorbance read at 490nm. Statistics were performed using Student's t -test and significance was considered to be a P value smaller than 0.05.
- GHS-R lb mRNA transcript contains a short intronic sequence (Howard et al, 1996, supra). GHS-R lb transcripts were also detected in cDNA derived from the
- GHS-R la was found to be equally expressed in normal and cancer tissue (data not shown).
- GHS-R lb protein was found to be expressed in the glandular epithelium of prostate cancer tissues but not in the normal prostate glands ( Figure 7).
- GHS-R lb protein expression was also found in breast cancer glands but not in normal breast tissue ( Figure 8).
- Normal prostate tissue demonstrated weak immunoreactivity for ghrelin and exon 3-deleted preproghrelin protein in the epithelial cells of glands.
- Western blots are therefore a useful method for detecting GHS-R lb, ghrelin and exon 3-deleted proghrelin proteins and may be easily adapted for use as a quantitative assay.
- absorbances were significantly greater (P ⁇ 0.
- the ELISA format is therefore useful for detecting GHS-R lb protein expression directly on prostate cancer cells and may be easily adapted to become a quantitative assay for GHS-R lb. Similar assays can be developed for ghrelin and/or exon 3-deleted preproghrelin expression. Effect of ghrelin upon cell proliferation
- the present inventors have described a novel, exon 3-deleted form of preproghrelin that may have properties in its own right or the RPQPTSDRPQALLTSL (SEQ ID NO: 1) peptide may have significance after it is cleaved from the mature ghrelin ( Figures 1 and 2).
- the present invention also provides functional evidence that ghrelin may have an autocrine/paracrine role in stimulating prostate cancer cell proliferation.
- GHS-R expression has been demonstrated previously in the pituitary and hypothalamus (Howard et al, 1996, supra), in neuroendocrine tumours (de Keyzer et al, 1997, Eur. J. Endocrinol. 137 715) and in vitro in rat pituitary tumour cells (Adams et al, 1998, J. Clin. Endocrinol. Metab. 83 638), but not in prostate cancer.
- GHS-R overexpression may be associated with tumourigenesis in some tissues, as GHS-R mRNA expression is 200 fold higher in somatotroph tumours than in normal pituitary tissue (Skinner et al, 1998, J. Clin. Endocrinol. Metab. 83 4314).
- the type la and lb GHS-R isoforms are co-expressed in central nervous system tumours (Korbonits et al, 1999, IGF Res. 9 93) and in the prostate cancer cell lines studied herein.
- a normal prostate cDNA library did not express GHS-R lb transcripts and this may represent a difference between the normal and cancerous state.
- the isoform may have functional significance in some tissues (Van der Ploeg , 1998, In: GHSs in clinical practice (Eds Bercu & Walker pp59-75. Springer-Verlag NY).
- Ghrelin mRNA expression has been demonstrated in rodent brain, some rodent peripheral tissues, human stomach (Kojima et al, 1999, supra) and human neuroendocrine tumours (Korbonits et al, 2001, J. Clin. Endocrinol. Metab. 86 881).
- No previous studies have examined the expression of ghrelin in peripheral cancers.
- ghrelin mRNA expression was demonstrated by RT-PCR in the four prostate cancer cell lines studied, but not in a normal prostate cDNA library. This could reflect a very low abundance of ghrelin mRNA in normal tissue and a relative over-expression of ghrelin in prostate cancer.
- Ghrelin significantly increases the proliferation of prostate cancer cells in vitro.
- ghrelin activates the (therefore functional) GHS-R la receptor to induce proliferation, either by the autocrine action of secreted prostatic GH or by some other more direct signalling mechanism.
- the bell-shaped proliferation response curve demonstrated by the PC3 cells in response to ghrelin treatment could be a result of down-regulation of GHS-R expression by prostatic GH, as GHS-Rs in the rat hypothalamus are down-regulated by GH (Bennet et al, 1997, Endocrinology 138 4552).
- the discovery that ghrelin induces a proliferative response in PC3 cells is the first demonstration of a proliferative role for ghrelin in any cell type.
- GHRH-GH-IGF axis is a promising target for anti-tumour therapies for GH responsive cancers.
- Blockade of the GHS-R receptor and/or the inhibition of ghrelin activity could provide future targets for the development of cancer therapies.
- diagnostic methods are contemplated whereby detection of ghrelin or GHS-R lb (or encoding nucleic acids) may assist in identification of reproductive cancer cells in a patient sample.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Endocrinology (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Toxicology (AREA)
- Engineering & Computer Science (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Veterinary Medicine (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Cell Biology (AREA)
- Reproductive Health (AREA)
- Urology & Nephrology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
Claims
Priority Applications (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP02724043A EP1385879A4 (en) | 2001-05-10 | 2002-05-10 | Reproductive cancer diagnosis and therapy |
AU2002254800A AU2002254800B2 (en) | 2001-05-10 | 2002-05-10 | Reproductive cancer diagnosis and therapy |
US10/477,506 US20040157227A1 (en) | 2001-05-10 | 2002-05-10 | Reproductive cancer diagnosis and therapy |
CA002446857A CA2446857A1 (en) | 2001-05-10 | 2002-05-10 | Reproductive cancer diagnosis and therapy |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AUPR4919A AUPR491901A0 (en) | 2001-05-10 | 2001-05-10 | Cancer diagnosis and therapy |
AUPR4919 | 2001-05-10 | ||
AUPR9567 | 2001-12-17 | ||
AUPR9567A AUPR956701A0 (en) | 2001-12-17 | 2001-12-17 | Cancer diagnosis and therapy ii |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2002090387A1 true WO2002090387A1 (en) | 2002-11-14 |
Family
ID=25646683
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/AU2002/000582 WO2002090387A1 (en) | 2001-05-10 | 2002-05-10 | Reproductive cancer diagnosis and therapy |
Country Status (5)
Country | Link |
---|---|
US (1) | US20040157227A1 (en) |
EP (1) | EP1385879A4 (en) |
AU (1) | AU2002254800B2 (en) |
CA (1) | CA2446857A1 (en) |
WO (1) | WO2002090387A1 (en) |
Cited By (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005015208A1 (en) * | 2003-07-17 | 2005-02-17 | Unilever N.V. | Method for testing ghrelin release |
CN1321131C (en) * | 2003-12-26 | 2007-06-13 | 李宁 | Pig Ghrelin derivative, its encoding gene and application |
WO2011053821A1 (en) | 2009-10-30 | 2011-05-05 | Tranzyme Pharma, Inc. | Macrocyclic ghrelin receptor antagonists and inverse agonists and methods of using the same |
WO2011154570A1 (en) * | 2010-06-10 | 2011-12-15 | Universidad de Córdoba | Ghrelin variant and uses thereof |
WO2017089642A1 (en) * | 2015-11-27 | 2017-06-01 | Universidad de Córdoba | Ghrelin o-acyltransferase (goat) and uses thereof |
Families Citing this family (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN1688696A (en) * | 2002-09-18 | 2005-10-26 | 蒙特利尔大学医疗中心 | GHRH analogues |
US20040253274A1 (en) * | 2003-06-11 | 2004-12-16 | Allergan, Inc. | Use of a clostridial toxin to reduce appetite |
EP1928489B1 (en) | 2005-09-28 | 2014-03-26 | Ipsen Pharma | Analogs of ghrelin |
US20150133327A1 (en) * | 2012-04-19 | 2015-05-14 | Hon Sing Leong | Method for detecting or monitoring prostate cancer |
WO2018205023A1 (en) | 2017-05-08 | 2018-11-15 | Glyca Inc. | Methods for diagnosing high-risk cancer using polysialic acid and one or more tissue-specific biomarkers |
WO2021021613A1 (en) * | 2019-07-26 | 2021-02-04 | Hamrah Pedram | A dermal patch for transdermal administration of ghrelin pathway blocker |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2000029011A1 (en) * | 1998-11-16 | 2000-05-25 | Zentaris Ag | Treatment of tumors by administration of growth hormone releasing compounds and their antagonists |
WO2001087335A2 (en) * | 2000-05-17 | 2001-11-22 | Eli Lilly And Company | Method for selectively inhibiting ghrelin action |
WO2002008250A2 (en) * | 2000-07-24 | 2002-01-31 | Ardana Bioscience Limited | Ghrelin antagonists |
-
2002
- 2002-05-10 WO PCT/AU2002/000582 patent/WO2002090387A1/en not_active Application Discontinuation
- 2002-05-10 CA CA002446857A patent/CA2446857A1/en not_active Abandoned
- 2002-05-10 US US10/477,506 patent/US20040157227A1/en not_active Abandoned
- 2002-05-10 AU AU2002254800A patent/AU2002254800B2/en not_active Ceased
- 2002-05-10 EP EP02724043A patent/EP1385879A4/en not_active Withdrawn
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2000029011A1 (en) * | 1998-11-16 | 2000-05-25 | Zentaris Ag | Treatment of tumors by administration of growth hormone releasing compounds and their antagonists |
WO2001087335A2 (en) * | 2000-05-17 | 2001-11-22 | Eli Lilly And Company | Method for selectively inhibiting ghrelin action |
WO2002008250A2 (en) * | 2000-07-24 | 2002-01-31 | Ardana Bioscience Limited | Ghrelin antagonists |
Non-Patent Citations (8)
Title |
---|
BOWERS C.Y.: "Unnatural growth hormone-releasing peptide begets netural Ghrelin", JOURNAL OF CLINICAL ENDOCRINOLOGY AND METABOLISM, vol. 86, no. 4, 2001, pages 1464 - 1469, XP001183409 * |
CASSONI P. ET AL.: "Identification, characterization and biological activity of specific receptors for natural (Ghrelin) and synthetic growth hormone secretagogues and analogs in human breast carcinomas and cell lines", JOURNAL OF CLINICAL ENDOCRINOLOGY AND METABOLISM, vol. 86, no. 4, 2001, pages 1738 - 1745, XP002243976 * |
JEFFERY P.L. ET AL.: "Expression and action of the growth hormone releasing peptide ghrelin and its receptor in prostate cancer cell lines", JOURNAL OF ENDOCRINOLOGY, vol. 172, 2002, pages R7 - R11, XP001182902 * |
KOJIMA M. ET AL.: "Ghrelin is a growth-hormone-releasing acylated peptide from stomach", NATURE, vol. 402, 1999, pages 656 - 660, XP002166936 * |
KORBONITS M. ET AL.: "Expression of the growth hormone secretagogue receptor in pituitary adenomas and other neuroendocrine tumors", JOURNAL OF CLINICAL ENDOCRINOLOGY AND METABOLISM, vol. 83, no. 10, 1998, pages 3624 - 3630, XP001183060 * |
NAKAZATO M. ET AL.: "A role for ghrelin in the central regulation of feeding", NATURE, vol. 409, 2001, pages 194 - 198, XP002268478 * |
PAPOTTI M. ET AL.: "Growth hormone secretagogue binding sites in peripheral human tissues", JOURNAL OF CLINICAL ENDOCRINOLOGY AND METABOLISM, vol. 85, no. 10, 2000, pages 3803 - 3807, XP002224724 * |
See also references of EP1385879A4 * |
Cited By (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005015208A1 (en) * | 2003-07-17 | 2005-02-17 | Unilever N.V. | Method for testing ghrelin release |
AU2004263920B2 (en) * | 2003-07-17 | 2008-01-03 | Unilever Plc | Method for testing ghrelin release |
CN1321131C (en) * | 2003-12-26 | 2007-06-13 | 李宁 | Pig Ghrelin derivative, its encoding gene and application |
WO2011053821A1 (en) | 2009-10-30 | 2011-05-05 | Tranzyme Pharma, Inc. | Macrocyclic ghrelin receptor antagonists and inverse agonists and methods of using the same |
WO2011154570A1 (en) * | 2010-06-10 | 2011-12-15 | Universidad de Córdoba | Ghrelin variant and uses thereof |
ES2372337A1 (en) * | 2010-06-10 | 2012-01-18 | Servicio Andaluz De Salud | Ghrelin variant and uses thereof |
WO2017089642A1 (en) * | 2015-11-27 | 2017-06-01 | Universidad de Córdoba | Ghrelin o-acyltransferase (goat) and uses thereof |
Also Published As
Publication number | Publication date |
---|---|
AU2002254800B2 (en) | 2006-09-28 |
EP1385879A1 (en) | 2004-02-04 |
CA2446857A1 (en) | 2002-11-14 |
EP1385879A4 (en) | 2005-02-02 |
US20040157227A1 (en) | 2004-08-12 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Jeffery et al. | Rapid Communication: Expression and action of the growth hormone releasing peptide ghrelin and its receptor in prostate cancer cell lines | |
US20170184600A1 (en) | Methods for diagnosis and prognosis of cancer | |
JP2004529847A (en) | Expression of Herstatin, an alternative HER-2 / NEU product that expresses p185HER-2 or EGF receptor in cells, suppresses receptor activity and cell growth | |
AU2002254800B2 (en) | Reproductive cancer diagnosis and therapy | |
AU2002254800A1 (en) | Reproductive cancer diagnosis and therapy | |
US7247614B2 (en) | Composition and method for modulating somatolactogenic function | |
US11318158B2 (en) | Pappalysin regulator | |
JP2004501605A (en) | Antagonists that bind to HER-2 | |
WO2004080479A1 (en) | Gonadal function improving agents | |
WO2002077243A1 (en) | Diagnosis of cancer or benign tumour using the aberrant expression product of the klk4 gene | |
JP5317318B2 (en) | Novel polypeptides and uses thereof | |
JP2001517445A (en) | Mutants of thyroid stimulating hormone and methods based thereon | |
KR20020086491A (en) | Screening method | |
WO2001081401A1 (en) | Novel collectins | |
EP1634951B1 (en) | Novel protein | |
EP1275659A1 (en) | Novel physiologically active peptides and use thereof | |
JP4761812B2 (en) | Musclin receptor and use thereof | |
JP4637378B2 (en) | Screening method | |
US7888463B2 (en) | Modulators of antiestrogen pharmacology | |
JP2009249304A (en) | Cancer-restraining factor and its use | |
WO2004072285A1 (en) | “goblin” cancer associated polypeptides, related reagents, and methods of use thereof | |
CA2478790A1 (en) | Polypeptides binding to human syntaxin 1a | |
JP2002000280A (en) | Physiologically active new peptide and its use | |
JP2004073179A (en) | New protein, and dna and use of the same | |
JP2001069996A (en) | New physiologically active substance, its production and use |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A1 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ OM PH PL PT RO RU SD SE SG SI SK SL TJ TM TN TR TT TZ UA UG US UZ VN YU ZA ZM ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
WWE | Wipo information: entry into national phase |
Ref document number: 2446857 Country of ref document: CA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2002254800 Country of ref document: AU |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2002724043 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 529589 Country of ref document: NZ |
|
WWE | Wipo information: entry into national phase |
Ref document number: 10477506 Country of ref document: US |
|
WWP | Wipo information: published in national office |
Ref document number: 2002724043 Country of ref document: EP |
|
REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
NENP | Non-entry into the national phase |
Ref country code: JP |
|
WWW | Wipo information: withdrawn in national office |
Country of ref document: JP |
|
WWW | Wipo information: withdrawn in national office |
Ref document number: 2002724043 Country of ref document: EP |