WO2002057308A2 - Zinc finger polypeptides and their use - Google Patents
Zinc finger polypeptides and their use Download PDFInfo
- Publication number
- WO2002057308A2 WO2002057308A2 PCT/GB2002/000246 GB0200246W WO02057308A2 WO 2002057308 A2 WO2002057308 A2 WO 2002057308A2 GB 0200246 W GB0200246 W GB 0200246W WO 02057308 A2 WO02057308 A2 WO 02057308A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- receptor
- nucleic acid
- polypeptide
- binding
- sequence
- Prior art date
Links
- 229910052725 zinc Inorganic materials 0.000 title claims abstract description 209
- 239000011701 zinc Substances 0.000 title claims abstract description 208
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 206
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 title claims abstract description 186
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 184
- 229920001184 polypeptide Polymers 0.000 title claims abstract description 180
- 108091035707 Consensus sequence Proteins 0.000 claims abstract description 52
- 239000002773 nucleotide Substances 0.000 claims abstract description 41
- 125000003729 nucleotide group Chemical group 0.000 claims abstract description 41
- 238000013518 transcription Methods 0.000 claims abstract description 14
- 230000035897 transcription Effects 0.000 claims abstract description 14
- 238000009739 binding Methods 0.000 claims description 183
- 230000027455 binding Effects 0.000 claims description 181
- 150000007523 nucleic acids Chemical class 0.000 claims description 162
- 108020003175 receptors Proteins 0.000 claims description 159
- 102000005962 receptors Human genes 0.000 claims description 157
- 102000039446 nucleic acids Human genes 0.000 claims description 127
- 108020004707 nucleic acids Proteins 0.000 claims description 127
- 230000014509 gene expression Effects 0.000 claims description 79
- 238000000034 method Methods 0.000 claims description 79
- 108010061299 CXCR4 Receptors Proteins 0.000 claims description 78
- 102000012000 CXCR4 Receptors Human genes 0.000 claims description 77
- 150000001413 amino acids Chemical class 0.000 claims description 73
- 241000700605 Viruses Species 0.000 claims description 49
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 44
- 239000013604 expression vector Substances 0.000 claims description 25
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 claims description 22
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 claims description 21
- 201000010099 disease Diseases 0.000 claims description 21
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 21
- 241000725303 Human immunodeficiency virus Species 0.000 claims description 20
- 230000003612 virological effect Effects 0.000 claims description 20
- 208000015181 infectious disease Diseases 0.000 claims description 18
- 238000002823 phage display Methods 0.000 claims description 15
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 14
- 102100031650 C-X-C chemokine receptor type 4 Human genes 0.000 claims description 11
- 102100033733 Tumor necrosis factor receptor superfamily member 1B Human genes 0.000 claims description 11
- 230000028993 immune response Effects 0.000 claims description 11
- 238000002360 preparation method Methods 0.000 claims description 11
- 101710187830 Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 claims description 10
- 239000000203 mixture Substances 0.000 claims description 10
- 208000036142 Viral infection Diseases 0.000 claims description 9
- 230000009385 viral infection Effects 0.000 claims description 9
- -1 IL-IR Proteins 0.000 claims description 8
- 230000002222 downregulating effect Effects 0.000 claims description 8
- 102100035875 C-C chemokine receptor type 5 Human genes 0.000 claims description 7
- 101710149870 C-C chemokine receptor type 5 Proteins 0.000 claims description 7
- 101710082513 C-X-C chemokine receptor type 4 Proteins 0.000 claims description 6
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 claims description 6
- 102000003675 cytokine receptors Human genes 0.000 claims description 6
- 108010057085 cytokine receptors Proteins 0.000 claims description 6
- 102000003298 tumor necrosis factor receptor Human genes 0.000 claims description 6
- 102100024167 C-C chemokine receptor type 3 Human genes 0.000 claims description 5
- 101710149862 C-C chemokine receptor type 3 Proteins 0.000 claims description 5
- 239000003814 drug Substances 0.000 claims description 5
- 230000002265 prevention Effects 0.000 claims description 5
- 208000023275 Autoimmune disease Diseases 0.000 claims description 4
- 230000002103 transcriptional effect Effects 0.000 claims description 4
- 230000029812 viral genome replication Effects 0.000 claims description 4
- 239000012636 effector Substances 0.000 claims description 3
- 230000007502 viral entry Effects 0.000 claims description 3
- 238000009510 drug design Methods 0.000 claims description 2
- 238000004806 packaging method and process Methods 0.000 claims description 2
- 239000002245 particle Substances 0.000 claims description 2
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 2
- 230000007501 viral attachment Effects 0.000 claims description 2
- 230000008478 viral entry into host cell Effects 0.000 claims description 2
- 230000006490 viral transcription Effects 0.000 claims description 2
- 102100029469 WD repeat and HMG-box DNA-binding protein 1 Human genes 0.000 claims 2
- 101710097421 WD repeat and HMG-box DNA-binding protein 1 Proteins 0.000 claims 2
- 229910052739 hydrogen Inorganic materials 0.000 claims 2
- 239000003085 diluting agent Substances 0.000 claims 1
- 210000004027 cell Anatomy 0.000 description 146
- 108090000623 proteins and genes Proteins 0.000 description 118
- 235000001014 amino acid Nutrition 0.000 description 63
- 102000004169 proteins and genes Human genes 0.000 description 61
- 235000018102 proteins Nutrition 0.000 description 60
- 108020004414 DNA Proteins 0.000 description 59
- 239000013598 vector Substances 0.000 description 54
- 108700020942 nucleic acid binding protein Proteins 0.000 description 39
- 102000044158 nucleic acid binding protein Human genes 0.000 description 36
- 230000004568 DNA-binding Effects 0.000 description 30
- 210000001744 T-lymphocyte Anatomy 0.000 description 25
- 230000003828 downregulation Effects 0.000 description 25
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 24
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 24
- 239000005090 green fluorescent protein Substances 0.000 description 24
- 102000040945 Transcription factor Human genes 0.000 description 21
- 108091023040 Transcription factor Proteins 0.000 description 21
- 239000013612 plasmid Substances 0.000 description 21
- 208000031886 HIV Infections Diseases 0.000 description 20
- 102100033732 Tumor necrosis factor receptor superfamily member 1A Human genes 0.000 description 20
- 230000006870 function Effects 0.000 description 20
- 239000003446 ligand Substances 0.000 description 18
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 17
- 230000000694 effects Effects 0.000 description 17
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 16
- 101710185494 Zinc finger protein Proteins 0.000 description 16
- 102100023597 Zinc finger protein 816 Human genes 0.000 description 16
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 15
- 101710187743 Tumor necrosis factor receptor superfamily member 1A Proteins 0.000 description 15
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 14
- 238000000338 in vitro Methods 0.000 description 14
- 238000004519 manufacturing process Methods 0.000 description 14
- 238000002965 ELISA Methods 0.000 description 13
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 13
- 239000004480 active ingredient Substances 0.000 description 13
- 230000035772 mutation Effects 0.000 description 12
- 239000003550 marker Substances 0.000 description 11
- 230000010076 replication Effects 0.000 description 11
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 10
- 102000014914 Carrier Proteins Human genes 0.000 description 10
- 102000004127 Cytokines Human genes 0.000 description 10
- 108090000695 Cytokines Proteins 0.000 description 10
- 108091008324 binding proteins Proteins 0.000 description 10
- 239000012634 fragment Substances 0.000 description 10
- 210000004962 mammalian cell Anatomy 0.000 description 10
- 238000011144 upstream manufacturing Methods 0.000 description 10
- 241000894006 Bacteria Species 0.000 description 9
- 102000019034 Chemokines Human genes 0.000 description 9
- 108010012236 Chemokines Proteins 0.000 description 9
- 101150009046 Tnfrsf1a gene Proteins 0.000 description 9
- 239000003623 enhancer Substances 0.000 description 9
- 238000010186 staining Methods 0.000 description 9
- 108010008951 Chemokine CXCL12 Proteins 0.000 description 8
- 206010037660 Pyrexia Diseases 0.000 description 8
- 102100021669 Stromal cell-derived factor 1 Human genes 0.000 description 8
- 238000004458 analytical method Methods 0.000 description 8
- 238000003556 assay Methods 0.000 description 8
- 239000000872 buffer Substances 0.000 description 8
- 238000010367 cloning Methods 0.000 description 8
- 238000004520 electroporation Methods 0.000 description 8
- 208000006454 hepatitis Diseases 0.000 description 8
- 210000000987 immune system Anatomy 0.000 description 8
- 230000001939 inductive effect Effects 0.000 description 8
- 230000003993 interaction Effects 0.000 description 8
- 239000000047 product Substances 0.000 description 8
- 230000002829 reductive effect Effects 0.000 description 8
- 230000001105 regulatory effect Effects 0.000 description 8
- 239000000243 solution Substances 0.000 description 8
- 238000001890 transfection Methods 0.000 description 8
- 241000588724 Escherichia coli Species 0.000 description 7
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 7
- 101000922348 Homo sapiens C-X-C chemokine receptor type 4 Proteins 0.000 description 7
- 241001465754 Metazoa Species 0.000 description 7
- 238000010276 construction Methods 0.000 description 7
- 238000013461 design Methods 0.000 description 7
- 238000010790 dilution Methods 0.000 description 7
- 239000012895 dilution Substances 0.000 description 7
- 230000004927 fusion Effects 0.000 description 7
- 239000001963 growth medium Substances 0.000 description 7
- 231100000283 hepatitis Toxicity 0.000 description 7
- 239000000825 pharmaceutical preparation Substances 0.000 description 7
- 208000011580 syndromic disease Diseases 0.000 description 7
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 6
- 101150066398 CXCR4 gene Proteins 0.000 description 6
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 6
- 206010061192 Haemorrhagic fever Diseases 0.000 description 6
- 241000700588 Human alphaherpesvirus 1 Species 0.000 description 6
- 125000000539 amino acid group Chemical group 0.000 description 6
- 230000003321 amplification Effects 0.000 description 6
- 230000001580 bacterial effect Effects 0.000 description 6
- 230000000295 complement effect Effects 0.000 description 6
- 206010014599 encephalitis Diseases 0.000 description 6
- 238000005516 engineering process Methods 0.000 description 6
- 230000004048 modification Effects 0.000 description 6
- 238000012986 modification Methods 0.000 description 6
- 238000003199 nucleic acid amplification method Methods 0.000 description 6
- 230000004044 response Effects 0.000 description 6
- 208000030507 AIDS Diseases 0.000 description 5
- 208000006740 Aseptic Meningitis Diseases 0.000 description 5
- 108010035563 Chloramphenicol O-acetyltransferase Proteins 0.000 description 5
- 241000701022 Cytomegalovirus Species 0.000 description 5
- 102000052510 DNA-Binding Proteins Human genes 0.000 description 5
- 238000012286 ELISA Assay Methods 0.000 description 5
- 102000004190 Enzymes Human genes 0.000 description 5
- 108090000790 Enzymes Proteins 0.000 description 5
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 5
- 206010061218 Inflammation Diseases 0.000 description 5
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 5
- 206010027201 Meningitis aseptic Diseases 0.000 description 5
- 206010035664 Pneumonia Diseases 0.000 description 5
- 230000004913 activation Effects 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 5
- 230000004054 inflammatory process Effects 0.000 description 5
- 238000005304 joining Methods 0.000 description 5
- 239000007788 liquid Substances 0.000 description 5
- 210000004698 lymphocyte Anatomy 0.000 description 5
- 239000013600 plasmid vector Substances 0.000 description 5
- 229920001223 polyethylene glycol Polymers 0.000 description 5
- 150000003839 salts Chemical class 0.000 description 5
- 239000000523 sample Substances 0.000 description 5
- 230000008685 targeting Effects 0.000 description 5
- 238000013519 translation Methods 0.000 description 5
- 241001529453 unidentified herpesvirus Species 0.000 description 5
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 4
- 208000037357 HIV infectious disease Diseases 0.000 description 4
- 101000739160 Homo sapiens Secretoglobin family 3A member 1 Proteins 0.000 description 4
- 101000818735 Homo sapiens Zinc finger protein 10 Proteins 0.000 description 4
- 241000701074 Human alphaherpesvirus 2 Species 0.000 description 4
- 108010050904 Interferons Proteins 0.000 description 4
- 102000014150 Interferons Human genes 0.000 description 4
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 4
- 101100240347 Mus musculus Nectin2 gene Proteins 0.000 description 4
- 102100023064 Nectin-1 Human genes 0.000 description 4
- 101710043845 Nectin-1 Proteins 0.000 description 4
- 206010028980 Neoplasm Diseases 0.000 description 4
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 4
- 108020004511 Recombinant DNA Proteins 0.000 description 4
- 108700008625 Reporter Genes Proteins 0.000 description 4
- 102100037268 Secretoglobin family 3A member 1 Human genes 0.000 description 4
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N Sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 4
- 229920002472 Starch Polymers 0.000 description 4
- 238000007792 addition Methods 0.000 description 4
- 230000033228 biological regulation Effects 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- 210000000349 chromosome Anatomy 0.000 description 4
- 230000001684 chronic effect Effects 0.000 description 4
- 239000002131 composite material Substances 0.000 description 4
- 150000001875 compounds Chemical class 0.000 description 4
- 230000034994 death Effects 0.000 description 4
- 238000012217 deletion Methods 0.000 description 4
- 230000037430 deletion Effects 0.000 description 4
- 239000008298 dragée Substances 0.000 description 4
- 201000002491 encephalomyelitis Diseases 0.000 description 4
- 210000003527 eukaryotic cell Anatomy 0.000 description 4
- 108020001507 fusion proteins Proteins 0.000 description 4
- 102000037865 fusion proteins Human genes 0.000 description 4
- 208000033519 human immunodeficiency virus infectious disease Diseases 0.000 description 4
- 230000036737 immune function Effects 0.000 description 4
- 230000001965 increasing effect Effects 0.000 description 4
- 208000014018 liver neoplasm Diseases 0.000 description 4
- 230000004807 localization Effects 0.000 description 4
- 108020004999 messenger RNA Proteins 0.000 description 4
- 201000009240 nasopharyngitis Diseases 0.000 description 4
- 230000036961 partial effect Effects 0.000 description 4
- 244000052769 pathogen Species 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 230000006798 recombination Effects 0.000 description 4
- 238000005215 recombination Methods 0.000 description 4
- 206010039073 rheumatoid arthritis Diseases 0.000 description 4
- 235000019698 starch Nutrition 0.000 description 4
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 238000006467 substitution reaction Methods 0.000 description 4
- 239000007940 sugar coated tablet Substances 0.000 description 4
- 241001430294 unidentified retrovirus Species 0.000 description 4
- 102000009410 Chemokine receptor Human genes 0.000 description 3
- 108050000299 Chemokine receptor Proteins 0.000 description 3
- 108091062157 Cis-regulatory element Proteins 0.000 description 3
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 3
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 3
- 101710096438 DNA-binding protein Proteins 0.000 description 3
- 102100029671 E3 ubiquitin-protein ligase TRIM8 Human genes 0.000 description 3
- 208000010201 Exanthema Diseases 0.000 description 3
- 101710140958 Formimidoyltetrahydrofolate cyclodeaminase Proteins 0.000 description 3
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 description 3
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 description 3
- 108010010803 Gelatin Proteins 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 241000709721 Hepatovirus A Species 0.000 description 3
- 101000795300 Homo sapiens E3 ubiquitin-protein ligase TRIM8 Proteins 0.000 description 3
- 101000611023 Homo sapiens Tumor necrosis factor receptor superfamily member 6 Proteins 0.000 description 3
- 241000701085 Human alphaherpesvirus 3 Species 0.000 description 3
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 3
- 241000713340 Human immunodeficiency virus 2 Species 0.000 description 3
- 102100034349 Integrase Human genes 0.000 description 3
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 3
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 3
- 241000713666 Lentivirus Species 0.000 description 3
- 102100035304 Lymphotactin Human genes 0.000 description 3
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 3
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 3
- 108010061593 Member 14 Tumor Necrosis Factor Receptors Proteins 0.000 description 3
- 208000009525 Myocarditis Diseases 0.000 description 3
- 108010057466 NF-kappa B Proteins 0.000 description 3
- 102000003945 NF-kappa B Human genes 0.000 description 3
- 102100035488 Nectin-2 Human genes 0.000 description 3
- 239000004698 Polyethylene Substances 0.000 description 3
- 108010076504 Protein Sorting Signals Proteins 0.000 description 3
- 241000700584 Simplexvirus Species 0.000 description 3
- 108700026226 TATA Box Proteins 0.000 description 3
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 description 3
- 102100040403 Tumor necrosis factor receptor superfamily member 6 Human genes 0.000 description 3
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 3
- 239000003242 anti bacterial agent Substances 0.000 description 3
- 229940088710 antibiotic agent Drugs 0.000 description 3
- 239000000427 antigen Substances 0.000 description 3
- 108091007433 antigens Proteins 0.000 description 3
- 102000036639 antigens Human genes 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 230000009286 beneficial effect Effects 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 239000001506 calcium phosphate Substances 0.000 description 3
- 239000002775 capsule Substances 0.000 description 3
- 210000000170 cell membrane Anatomy 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 238000000576 coating method Methods 0.000 description 3
- 238000012258 culturing Methods 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000004069 differentiation Effects 0.000 description 3
- 201000005884 exanthem Diseases 0.000 description 3
- 239000008273 gelatin Substances 0.000 description 3
- 229920000159 gelatin Polymers 0.000 description 3
- 229940014259 gelatin Drugs 0.000 description 3
- 235000019322 gelatine Nutrition 0.000 description 3
- 235000011852 gelatine desserts Nutrition 0.000 description 3
- 238000001415 gene therapy Methods 0.000 description 3
- 230000012010 growth Effects 0.000 description 3
- 102000053523 human CXCR4 Human genes 0.000 description 3
- 238000010348 incorporation Methods 0.000 description 3
- 238000003780 insertion Methods 0.000 description 3
- 230000037431 insertion Effects 0.000 description 3
- 230000010354 integration Effects 0.000 description 3
- 229940047124 interferons Drugs 0.000 description 3
- 239000008101 lactose Substances 0.000 description 3
- 210000000265 leukocyte Anatomy 0.000 description 3
- 210000002540 macrophage Anatomy 0.000 description 3
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Substances [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 230000002503 metabolic effect Effects 0.000 description 3
- 238000010369 molecular cloning Methods 0.000 description 3
- 210000001616 monocyte Anatomy 0.000 description 3
- 238000002703 mutagenesis Methods 0.000 description 3
- 231100000350 mutagenesis Toxicity 0.000 description 3
- 238000007911 parenteral administration Methods 0.000 description 3
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 3
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 3
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 3
- 230000023603 positive regulation of transcription initiation, DNA-dependent Effects 0.000 description 3
- 108020003519 protein disulfide isomerase Proteins 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 206010037844 rash Diseases 0.000 description 3
- 230000003362 replicative effect Effects 0.000 description 3
- 238000012216 screening Methods 0.000 description 3
- 235000004400 serine Nutrition 0.000 description 3
- 238000002741 site-directed mutagenesis Methods 0.000 description 3
- 239000000600 sorbitol Substances 0.000 description 3
- 239000003381 stabilizer Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 230000002195 synergetic effect Effects 0.000 description 3
- 239000003826 tablet Substances 0.000 description 3
- 239000000454 talc Substances 0.000 description 3
- 235000012222 talc Nutrition 0.000 description 3
- 229910052623 talc Inorganic materials 0.000 description 3
- 230000010474 transient expression Effects 0.000 description 3
- 238000003146 transient transfection Methods 0.000 description 3
- 102000027257 transmembrane receptors Human genes 0.000 description 3
- 108091008578 transmembrane receptors Proteins 0.000 description 3
- 150000003626 triacylglycerols Chemical class 0.000 description 3
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 3
- 241001515965 unidentified phage Species 0.000 description 3
- 239000011592 zinc chloride Substances 0.000 description 3
- JIAARYAFYJHUJI-UHFFFAOYSA-L zinc dichloride Chemical compound [Cl-].[Cl-].[Zn+2] JIAARYAFYJHUJI-UHFFFAOYSA-L 0.000 description 3
- DIGQNXIGRZPYDK-WKSCXVIASA-N (2R)-6-amino-2-[[2-[[(2S)-2-[[2-[[(2R)-2-[[(2S)-2-[[(2R,3S)-2-[[2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2R)-2-[[(2S,3S)-2-[[(2R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2R)-2-[[2-[[2-[[2-[(2-amino-1-hydroxyethylidene)amino]-3-carboxy-1-hydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1,5-dihydroxy-5-iminopentylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]hexanoic acid Chemical compound C[C@@H]([C@@H](C(=N[C@@H](CS)C(=N[C@@H](C)C(=N[C@@H](CO)C(=NCC(=N[C@@H](CCC(=N)O)C(=NC(CS)C(=N[C@H]([C@H](C)O)C(=N[C@H](CS)C(=N[C@H](CO)C(=NCC(=N[C@H](CS)C(=NCC(=N[C@H](CCCCN)C(=O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)N=C([C@H](CS)N=C([C@H](CO)N=C([C@H](CO)N=C([C@H](C)N=C(CN=C([C@H](CO)N=C([C@H](CS)N=C(CN=C(C(CS)N=C(C(CC(=O)O)N=C(CN)O)O)O)O)O)O)O)O)O)O)O)O DIGQNXIGRZPYDK-WKSCXVIASA-N 0.000 description 2
- OSJPPGNTCRNQQC-UWTATZPHSA-N 3-phospho-D-glyceric acid Chemical compound OC(=O)[C@H](O)COP(O)(O)=O OSJPPGNTCRNQQC-UWTATZPHSA-N 0.000 description 2
- 102000013563 Acid Phosphatase Human genes 0.000 description 2
- 108010051457 Acid Phosphatase Proteins 0.000 description 2
- 208000009746 Adult T-Cell Leukemia-Lymphoma Diseases 0.000 description 2
- 208000016683 Adult T-cell leukemia/lymphoma Diseases 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 206010006448 Bronchiolitis Diseases 0.000 description 2
- 102100036153 C-X-C motif chemokine 6 Human genes 0.000 description 2
- 108010041397 CD4 Antigens Proteins 0.000 description 2
- 108050006947 CXC Chemokine Proteins 0.000 description 2
- 102000019388 CXC chemokine Human genes 0.000 description 2
- 108091008928 CXC chemokine receptors Proteins 0.000 description 2
- 102000054900 CXCR Receptors Human genes 0.000 description 2
- PHEDXBVPIONUQT-UHFFFAOYSA-N Cocarcinogen A1 Natural products CCCCCCCCCCCCCC(=O)OC1C(C)C2(O)C3C=C(C)C(=O)C3(O)CC(CO)=CC2C2C1(OC(C)=O)C2(C)C PHEDXBVPIONUQT-UHFFFAOYSA-N 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 108020004635 Complementary DNA Proteins 0.000 description 2
- 206010010356 Congenital anomaly Diseases 0.000 description 2
- 206010011224 Cough Diseases 0.000 description 2
- 108700020911 DNA-Binding Proteins Proteins 0.000 description 2
- 102100024746 Dihydrofolate reductase Human genes 0.000 description 2
- 101100044298 Drosophila melanogaster fand gene Proteins 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 2
- 241000206602 Eukaryota Species 0.000 description 2
- 201000005866 Exanthema Subitum Diseases 0.000 description 2
- 101150064015 FAS gene Proteins 0.000 description 2
- 206010016654 Fibrosis Diseases 0.000 description 2
- 102100031132 Glucose-6-phosphate isomerase Human genes 0.000 description 2
- 108010070600 Glucose-6-phosphate isomerase Proteins 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 241000711549 Hepacivirus C Species 0.000 description 2
- 206010019695 Hepatic neoplasm Diseases 0.000 description 2
- 241000700721 Hepatitis B virus Species 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000804764 Homo sapiens Lymphotactin Proteins 0.000 description 2
- 101000801228 Homo sapiens Tumor necrosis factor receptor superfamily member 1A Proteins 0.000 description 2
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 2
- 241001502974 Human gammaherpesvirus 8 Species 0.000 description 2
- 241000701027 Human herpesvirus 6 Species 0.000 description 2
- 206010061598 Immunodeficiency Diseases 0.000 description 2
- 208000029462 Immunodeficiency disease Diseases 0.000 description 2
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 2
- 108010061833 Integrases Proteins 0.000 description 2
- 102000000589 Interleukin-1 Human genes 0.000 description 2
- 108010002352 Interleukin-1 Proteins 0.000 description 2
- 108010017537 Interleukin-18 Receptors Proteins 0.000 description 2
- 102000015696 Interleukins Human genes 0.000 description 2
- 108010063738 Interleukins Proteins 0.000 description 2
- 208000007766 Kaposi sarcoma Diseases 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- 102000003792 Metallothionein Human genes 0.000 description 2
- 108090000157 Metallothionein Proteins 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 208000000112 Myalgia Diseases 0.000 description 2
- 101710163270 Nuclease Proteins 0.000 description 2
- 108091007494 Nucleic acid- binding domains Proteins 0.000 description 2
- 108010035042 Osteoprotegerin Proteins 0.000 description 2
- 102000008108 Osteoprotegerin Human genes 0.000 description 2
- 229930182555 Penicillin Natural products 0.000 description 2
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 2
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 2
- 108010047620 Phytohemagglutinins Proteins 0.000 description 2
- 101100335198 Pneumocystis carinii fol1 gene Proteins 0.000 description 2
- 206010035742 Pneumonitis Diseases 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 229920001213 Polysorbate 20 Polymers 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 108010025832 RANK Ligand Proteins 0.000 description 2
- 239000012980 RPMI-1640 medium Substances 0.000 description 2
- 108020005091 Replication Origin Proteins 0.000 description 2
- 241000283984 Rodentia Species 0.000 description 2
- 208000036485 Roseola Diseases 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 108010090804 Streptavidin Proteins 0.000 description 2
- 101710137500 T7 RNA polymerase Proteins 0.000 description 2
- 102000006467 TATA-Box Binding Protein Human genes 0.000 description 2
- 108010044281 TATA-Box Binding Protein Proteins 0.000 description 2
- 101150006914 TRP1 gene Proteins 0.000 description 2
- GWEVSGVZZGPLCZ-UHFFFAOYSA-N Titan oxide Chemical compound O=[Ti]=O GWEVSGVZZGPLCZ-UHFFFAOYSA-N 0.000 description 2
- 241000960387 Torque teno virus Species 0.000 description 2
- 108010068068 Transcription Factor TFIIIA Proteins 0.000 description 2
- 102100028509 Transcription factor IIIA Human genes 0.000 description 2
- 102100024568 Tumor necrosis factor ligand superfamily member 11 Human genes 0.000 description 2
- 108010003533 Viral Envelope Proteins Proteins 0.000 description 2
- 108010067390 Viral Proteins Proteins 0.000 description 2
- 108070000030 Viral receptors Proteins 0.000 description 2
- 240000008042 Zea mays Species 0.000 description 2
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 2
- 102100021112 Zinc finger protein 10 Human genes 0.000 description 2
- 230000001154 acute effect Effects 0.000 description 2
- 201000006966 adult T-cell leukemia Diseases 0.000 description 2
- 229960000723 ampicillin Drugs 0.000 description 2
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 2
- 230000001363 autoimmune Effects 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 230000008827 biological function Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 230000036755 cellular response Effects 0.000 description 2
- 239000001913 cellulose Substances 0.000 description 2
- 229920002678 cellulose Polymers 0.000 description 2
- 208000015114 central nervous system disease Diseases 0.000 description 2
- 230000001889 chemoattractive effect Effects 0.000 description 2
- 230000002759 chromosomal effect Effects 0.000 description 2
- 230000007882 cirrhosis Effects 0.000 description 2
- 208000019425 cirrhosis of liver Diseases 0.000 description 2
- 239000013078 crystal Substances 0.000 description 2
- 108020001096 dihydrofolate reductase Proteins 0.000 description 2
- 238000001976 enzyme digestion Methods 0.000 description 2
- 239000010685 fatty oil Substances 0.000 description 2
- 239000012894 fetal calf serum Substances 0.000 description 2
- 239000000945 filler Substances 0.000 description 2
- 238000000684 flow cytometry Methods 0.000 description 2
- 210000004051 gastric juice Anatomy 0.000 description 2
- 239000007903 gelatin capsule Substances 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 102000006602 glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 2
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 2
- 239000008187 granular material Substances 0.000 description 2
- 102000044778 human ZNF10 Human genes 0.000 description 2
- 229930195733 hydrocarbon Natural products 0.000 description 2
- 150000002430 hydrocarbons Chemical class 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 230000008105 immune reaction Effects 0.000 description 2
- 230000007813 immunodeficiency Effects 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 230000002757 inflammatory effect Effects 0.000 description 2
- 206010022000 influenza Diseases 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 229940047122 interleukins Drugs 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 201000007270 liver cancer Diseases 0.000 description 2
- 239000000314 lubricant Substances 0.000 description 2
- 235000019359 magnesium stearate Nutrition 0.000 description 2
- 206010025482 malaise Diseases 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- 238000010172 mouse model Methods 0.000 description 2
- 201000006417 multiple sclerosis Diseases 0.000 description 2
- 210000000066 myeloid cell Anatomy 0.000 description 2
- 210000002569 neuron Anatomy 0.000 description 2
- 210000000440 neutrophil Anatomy 0.000 description 2
- 235000015097 nutrients Nutrition 0.000 description 2
- XXUPLYBCNPLTIW-UHFFFAOYSA-N octadec-7-ynoic acid Chemical compound CCCCCCCCCCC#CCCCCCC(O)=O XXUPLYBCNPLTIW-UHFFFAOYSA-N 0.000 description 2
- 230000002018 overexpression Effects 0.000 description 2
- 238000012261 overproduction Methods 0.000 description 2
- 239000012188 paraffin wax Substances 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 229940049954 penicillin Drugs 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 2
- PHEDXBVPIONUQT-RGYGYFBISA-N phorbol 13-acetate 12-myristate Chemical compound C([C@]1(O)C(=O)C(C)=C[C@H]1[C@@]1(O)[C@H](C)[C@H]2OC(=O)CCCCCCCCCCCCC)C(CO)=C[C@H]1[C@H]1[C@]2(OC(C)=O)C1(C)C PHEDXBVPIONUQT-RGYGYFBISA-N 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- XNGIFLGASWRNHJ-UHFFFAOYSA-L phthalate(2-) Chemical compound [O-]C(=O)C1=CC=CC=C1C([O-])=O XNGIFLGASWRNHJ-UHFFFAOYSA-L 0.000 description 2
- 230000001885 phytohemagglutinin Effects 0.000 description 2
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 2
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 2
- 230000001124 posttranscriptional effect Effects 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 230000001737 promoting effect Effects 0.000 description 2
- 230000002685 pulmonary effect Effects 0.000 description 2
- 102000016914 ras Proteins Human genes 0.000 description 2
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 2
- 230000000754 repressing effect Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 108091008146 restriction endonucleases Proteins 0.000 description 2
- 238000009738 saturating Methods 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 238000010187 selection method Methods 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 239000002511 suppository base Substances 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 239000003053 toxin Substances 0.000 description 2
- 231100000765 toxin Toxicity 0.000 description 2
- 108700012359 toxins Proteins 0.000 description 2
- 230000005030 transcription termination Effects 0.000 description 2
- 230000001052 transient effect Effects 0.000 description 2
- 230000007306 turnover Effects 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- 230000003827 upregulation Effects 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- LGLVVVCSQBZONM-HCCLCSBVSA-N (2r)-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-acetamido-5-(diaminomethylideneamino)pentanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]-5-(diaminomethylideneamino)pentano Chemical compound NC(N)=NCCC[C@@H](NC(=O)C)C(=O)N[C@H](CCCN=C(N)N)C(=O)N[C@H](CCCN=C(N)N)C(=O)N[C@H](CCCN=C(N)N)C(=O)N[C@H](CCCN=C(N)N)C(=O)N[C@H](CCCN=C(N)N)C(=O)N[C@H](CCCN=C(N)N)C(=O)N[C@H](CCCN=C(N)N)C(=O)N[C@H](CCCN=C(N)N)C(N)=O LGLVVVCSQBZONM-HCCLCSBVSA-N 0.000 description 1
- IXPNQXFRVYWDDI-UHFFFAOYSA-N 1-methyl-2,4-dioxo-1,3-diazinane-5-carboximidamide Chemical compound CN1CC(C(N)=N)C(=O)NC1=O IXPNQXFRVYWDDI-UHFFFAOYSA-N 0.000 description 1
- GZCWLCBFPRFLKL-UHFFFAOYSA-N 1-prop-2-ynoxypropan-2-ol Chemical compound CC(O)COCC#C GZCWLCBFPRFLKL-UHFFFAOYSA-N 0.000 description 1
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 1
- 108700025333 4'-azido-Phe(6)- herpes simplex virus H2 (6-15) Proteins 0.000 description 1
- 102100030310 5,6-dihydroxyindole-2-carboxylic acid oxidase Human genes 0.000 description 1
- 101710097892 50S ribosomal protein L1, chloroplastic Proteins 0.000 description 1
- 244000215068 Acacia senegal Species 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 241000701242 Adenoviridae Species 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 241000710929 Alphavirus Species 0.000 description 1
- 241000712891 Arenavirus Species 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 241000416162 Astragalus gummifer Species 0.000 description 1
- 101710192393 Attachment protein G3P Proteins 0.000 description 1
- 241000972773 Aulopiformes Species 0.000 description 1
- 208000032116 Autoimmune Experimental Encephalomyelitis Diseases 0.000 description 1
- 241000713842 Avian sarcoma virus Species 0.000 description 1
- 208000003950 B-cell lymphoma Diseases 0.000 description 1
- 241000304886 Bacilli Species 0.000 description 1
- 231100000699 Bacterial toxin Toxicity 0.000 description 1
- 102100030981 Beta-alanine-activating enzyme Human genes 0.000 description 1
- 241000701021 Betaherpesvirinae Species 0.000 description 1
- 108010029692 Bisphosphoglycerate mutase Proteins 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 241000724653 Borna disease virus Species 0.000 description 1
- 108050005711 C Chemokine Proteins 0.000 description 1
- 102000017483 C chemokine Human genes 0.000 description 1
- 102100039398 C-X-C motif chemokine 2 Human genes 0.000 description 1
- 102100036189 C-X-C motif chemokine 3 Human genes 0.000 description 1
- 102100036150 C-X-C motif chemokine 5 Human genes 0.000 description 1
- 101710085504 C-X-C motif chemokine 6 Proteins 0.000 description 1
- 102100036170 C-X-C motif chemokine 9 Human genes 0.000 description 1
- 102000001902 CC Chemokines Human genes 0.000 description 1
- 108010040471 CC Chemokines Proteins 0.000 description 1
- 102000004497 CCR2 Receptors Human genes 0.000 description 1
- 108010017312 CCR2 Receptors Proteins 0.000 description 1
- 102000004499 CCR3 Receptors Human genes 0.000 description 1
- 108010017316 CCR3 Receptors Proteins 0.000 description 1
- 108010017088 CCR5 Receptors Proteins 0.000 description 1
- 102000004274 CCR5 Receptors Human genes 0.000 description 1
- ODINCKMPIJJUCX-UHFFFAOYSA-N Calcium oxide Chemical compound [Ca]=O ODINCKMPIJJUCX-UHFFFAOYSA-N 0.000 description 1
- 241000714198 Caliciviridae Species 0.000 description 1
- 101710132601 Capsid protein Proteins 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 201000006082 Chickenpox Diseases 0.000 description 1
- 208000017667 Chronic Disease Diseases 0.000 description 1
- 241001533399 Circoviridae Species 0.000 description 1
- 241001533384 Circovirus Species 0.000 description 1
- 101710094648 Coat protein Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 241000204955 Colorado tick fever virus Species 0.000 description 1
- 241000709687 Coxsackievirus Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 102100035298 Cytokine SCM-1 beta Human genes 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- 238000012287 DNA Binding Assay Methods 0.000 description 1
- 230000004544 DNA amplification Effects 0.000 description 1
- 238000007399 DNA isolation Methods 0.000 description 1
- 230000004543 DNA replication Effects 0.000 description 1
- 241001663879 Deltaretrovirus Species 0.000 description 1
- 241000725619 Dengue virus Species 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 206010012735 Diarrhoea Diseases 0.000 description 1
- 108090000204 Dipeptidase 1 Proteins 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 108010051542 Early Growth Response Protein 1 Proteins 0.000 description 1
- 102100023226 Early growth response protein 1 Human genes 0.000 description 1
- 241001115402 Ebolavirus Species 0.000 description 1
- 241001466953 Echovirus Species 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 102100038132 Endogenous retrovirus group K member 6 Pro protein Human genes 0.000 description 1
- 102100031702 Endoplasmic reticulum membrane sensor NFE2L1 Human genes 0.000 description 1
- 241000702374 Enterobacteria phage fd Species 0.000 description 1
- 241000991587 Enterovirus C Species 0.000 description 1
- 101710121417 Envelope glycoprotein Proteins 0.000 description 1
- 208000000832 Equine Encephalomyelitis Diseases 0.000 description 1
- 208000007985 Erythema Infectiosum Diseases 0.000 description 1
- 241001198387 Escherichia coli BL21(DE3) Species 0.000 description 1
- 241001646716 Escherichia coli K-12 Species 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 108010008165 Etanercept Proteins 0.000 description 1
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 1
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 1
- 108010039471 Fas Ligand Protein Proteins 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 241000724791 Filamentous phage Species 0.000 description 1
- 241000700662 Fowlpox virus Species 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 108091006027 G proteins Proteins 0.000 description 1
- 241000531123 GB virus C Species 0.000 description 1
- 102000030782 GTP binding Human genes 0.000 description 1
- 108091000058 GTP-Binding Proteins 0.000 description 1
- 101710115997 Gamma-tubulin complex component 2 Proteins 0.000 description 1
- 208000005577 Gastroenteritis Diseases 0.000 description 1
- 108010021582 Glucokinase Proteins 0.000 description 1
- 102100025591 Glycerate kinase Human genes 0.000 description 1
- 102100021181 Golgi phosphoprotein 3 Human genes 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 description 1
- 101150009006 HIS3 gene Proteins 0.000 description 1
- 208000037952 HSV-1 infection Diseases 0.000 description 1
- 241000150562 Hantaan orthohantavirus Species 0.000 description 1
- 241000711557 Hepacivirus Species 0.000 description 1
- 241000700739 Hepadnaviridae Species 0.000 description 1
- 108010007712 Hepatitis A Virus Cellular Receptor 1 Proteins 0.000 description 1
- 102100034459 Hepatitis A virus cellular receptor 1 Human genes 0.000 description 1
- 241000724709 Hepatitis delta virus Species 0.000 description 1
- 206010019799 Hepatitis viral Diseases 0.000 description 1
- 208000001688 Herpes Genitalis Diseases 0.000 description 1
- 208000004898 Herpes Labialis Diseases 0.000 description 1
- 208000009889 Herpes Simplex Diseases 0.000 description 1
- 108010068250 Herpes Simplex Virus Protein Vmw65 Proteins 0.000 description 1
- 208000007514 Herpes zoster Diseases 0.000 description 1
- 241000700586 Herpesviridae Species 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 102000005548 Hexokinase Human genes 0.000 description 1
- 108700040460 Hexokinases Proteins 0.000 description 1
- 102000008949 Histocompatibility Antigens Class I Human genes 0.000 description 1
- 101000889128 Homo sapiens C-X-C motif chemokine 2 Proteins 0.000 description 1
- 101000947193 Homo sapiens C-X-C motif chemokine 3 Proteins 0.000 description 1
- 101000947186 Homo sapiens C-X-C motif chemokine 5 Proteins 0.000 description 1
- 101000947177 Homo sapiens C-X-C motif chemokine 6 Proteins 0.000 description 1
- 101000947172 Homo sapiens C-X-C motif chemokine 9 Proteins 0.000 description 1
- 101000804771 Homo sapiens Cytokine SCM-1 beta Proteins 0.000 description 1
- 101001055222 Homo sapiens Interleukin-8 Proteins 0.000 description 1
- 101000947178 Homo sapiens Platelet basic protein Proteins 0.000 description 1
- 101000582950 Homo sapiens Platelet factor 4 Proteins 0.000 description 1
- 101100369992 Homo sapiens TNFSF10 gene Proteins 0.000 description 1
- 101000801232 Homo sapiens Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 1
- 244000309467 Human Coronavirus Species 0.000 description 1
- 108010070875 Human Immunodeficiency Virus tat Gene Products Proteins 0.000 description 1
- 241000598436 Human T-cell lymphotropic virus Species 0.000 description 1
- 241000598171 Human adenovirus sp. Species 0.000 description 1
- 241001479210 Human astrovirus Species 0.000 description 1
- 241000701041 Human betaherpesvirus 7 Species 0.000 description 1
- 241000713673 Human foamy virus Species 0.000 description 1
- 241000701806 Human papillomavirus Species 0.000 description 1
- 241000702617 Human parvovirus B19 Species 0.000 description 1
- 241000430519 Human rhinovirus sp. Species 0.000 description 1
- 241000617996 Human rotavirus Species 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 241001500351 Influenzavirus A Species 0.000 description 1
- 241001500350 Influenzavirus B Species 0.000 description 1
- 108010014726 Interferon Type I Proteins 0.000 description 1
- 102000002227 Interferon Type I Human genes 0.000 description 1
- 102100026016 Interleukin-1 receptor type 1 Human genes 0.000 description 1
- 108050001109 Interleukin-1 receptor type 1 Proteins 0.000 description 1
- 102000004557 Interleukin-18 Receptors Human genes 0.000 description 1
- 102100026236 Interleukin-8 Human genes 0.000 description 1
- 241000701460 JC polyomavirus Species 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- 229930182816 L-glutamine Natural products 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- 101150007280 LEU2 gene Proteins 0.000 description 1
- 241000712902 Lassa mammarenavirus Species 0.000 description 1
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 1
- 108010074338 Lymphokines Proteins 0.000 description 1
- 102000008072 Lymphokines Human genes 0.000 description 1
- 108010091221 Lymphotoxin beta Receptor Proteins 0.000 description 1
- 102000018170 Lymphotoxin beta Receptor Human genes 0.000 description 1
- 102000003959 Lymphotoxin-beta Human genes 0.000 description 1
- 108090000362 Lymphotoxin-beta Proteins 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 108091054437 MHC class I family Proteins 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 101710125418 Major capsid protein Proteins 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 241001115401 Marburgvirus Species 0.000 description 1
- 201000005505 Measles Diseases 0.000 description 1
- 241000712079 Measles morbillivirus Species 0.000 description 1
- 102000012750 Membrane Glycoproteins Human genes 0.000 description 1
- 108010090054 Membrane Glycoproteins Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 102000005741 Metalloproteases Human genes 0.000 description 1
- 108010006035 Metalloproteases Proteins 0.000 description 1
- 241000700627 Monkeypox virus Species 0.000 description 1
- 102000013967 Monokines Human genes 0.000 description 1
- 108010050619 Monokines Proteins 0.000 description 1
- 208000034486 Multi-organ failure Diseases 0.000 description 1
- 208000005647 Mumps Diseases 0.000 description 1
- 241000711386 Mumps virus Species 0.000 description 1
- 241000714177 Murine leukemia virus Species 0.000 description 1
- 101100264116 Mus musculus Xcl1 gene Proteins 0.000 description 1
- 108010021466 Mutant Proteins Proteins 0.000 description 1
- 102000008300 Mutant Proteins Human genes 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 1
- 206010028594 Myocardial fibrosis Diseases 0.000 description 1
- 208000033214 Myopericarditis Diseases 0.000 description 1
- 108010056642 N-alpha-acetyl-nona-D-arginine amide acetate Proteins 0.000 description 1
- 108010071380 NF-E2-Related Factor 1 Proteins 0.000 description 1
- 238000005481 NMR spectroscopy Methods 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 241000714209 Norwalk virus Species 0.000 description 1
- 108010016592 Nuclear Respiratory Factor 1 Proteins 0.000 description 1
- 101710141454 Nucleoprotein Proteins 0.000 description 1
- 208000001388 Opportunistic Infections Diseases 0.000 description 1
- 206010067152 Oral herpes Diseases 0.000 description 1
- 241000700635 Orf virus Species 0.000 description 1
- 241000150452 Orthohantavirus Species 0.000 description 1
- 241000150218 Orthonairovirus Species 0.000 description 1
- 241000702244 Orthoreovirus Species 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- 101150012394 PHO5 gene Proteins 0.000 description 1
- 102100035593 POU domain, class 2, transcription factor 1 Human genes 0.000 description 1
- 101710084414 POU domain, class 2, transcription factor 1 Proteins 0.000 description 1
- 108010067372 Pancreatic elastase Proteins 0.000 description 1
- 102000016387 Pancreatic elastase Human genes 0.000 description 1
- 239000005662 Paraffin oil Substances 0.000 description 1
- 241000711504 Paramyxoviridae Species 0.000 description 1
- 208000002606 Paramyxoviridae Infections Diseases 0.000 description 1
- 206010033885 Paraparesis Diseases 0.000 description 1
- 206010034038 Parotitis Diseases 0.000 description 1
- 241000701945 Parvoviridae Species 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 241000150350 Peribunyaviridae Species 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 102000001105 Phosphofructokinases Human genes 0.000 description 1
- 108010069341 Phosphofructokinases Proteins 0.000 description 1
- 102000011025 Phosphoglycerate Mutase Human genes 0.000 description 1
- 102000012288 Phosphopyruvate Hydratase Human genes 0.000 description 1
- 108010022181 Phosphopyruvate Hydratase Proteins 0.000 description 1
- 102100036154 Platelet basic protein Human genes 0.000 description 1
- 102100030304 Platelet factor 4 Human genes 0.000 description 1
- 208000000474 Poliomyelitis Diseases 0.000 description 1
- 102100029740 Poliovirus receptor Human genes 0.000 description 1
- 241001505332 Polyomavirus sp. Species 0.000 description 1
- 241000700625 Poxviridae Species 0.000 description 1
- 101710083689 Probable capsid protein Proteins 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102000009092 Proto-Oncogene Proteins c-myc Human genes 0.000 description 1
- 108010087705 Proto-Oncogene Proteins c-myc Proteins 0.000 description 1
- 241000125945 Protoparvovirus Species 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 108010011939 Pyruvate Decarboxylase Proteins 0.000 description 1
- 108020005115 Pyruvate Kinase Proteins 0.000 description 1
- 102000013009 Pyruvate Kinase Human genes 0.000 description 1
- 206010037742 Rabies Diseases 0.000 description 1
- 241000711798 Rabies lyssavirus Species 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 241000725643 Respiratory syncytial virus Species 0.000 description 1
- 206010057190 Respiratory tract infections Diseases 0.000 description 1
- 102000002278 Ribosomal Proteins Human genes 0.000 description 1
- 108010000605 Ribosomal Proteins Proteins 0.000 description 1
- 241000713124 Rift Valley fever virus Species 0.000 description 1
- 241000710799 Rubella virus Species 0.000 description 1
- 206010040047 Sepsis Diseases 0.000 description 1
- 206010040070 Septic Shock Diseases 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- 101000965899 Simian virus 40 Large T antigen Proteins 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 108010053551 Sp1 Transcription Factor Proteins 0.000 description 1
- 241000710888 St. Louis encephalitis virus Species 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 208000037065 Subacute sclerosing leukoencephalitis Diseases 0.000 description 1
- 206010042297 Subacute sclerosing panencephalitis Diseases 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 241000701093 Suid alphaherpesvirus 1 Species 0.000 description 1
- 108010000449 TNF-Related Apoptosis-Inducing Ligand Receptors Proteins 0.000 description 1
- 102000002259 TNF-Related Apoptosis-Inducing Ligand Receptors Human genes 0.000 description 1
- 108700012411 TNFSF10 Proteins 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 108010022394 Threonine synthase Proteins 0.000 description 1
- 102000006601 Thymidine Kinase Human genes 0.000 description 1
- 108020004440 Thymidine kinase Proteins 0.000 description 1
- 206010044248 Toxic shock syndrome Diseases 0.000 description 1
- 231100000650 Toxic shock syndrome Toxicity 0.000 description 1
- 229920001615 Tragacanth Polymers 0.000 description 1
- 102100030246 Transcription factor Sp1 Human genes 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- 101800001690 Transmembrane protein gp41 Proteins 0.000 description 1
- 102000005924 Triose-Phosphate Isomerase Human genes 0.000 description 1
- 108700015934 Triose-phosphate isomerases Proteins 0.000 description 1
- 235000021307 Triticum Nutrition 0.000 description 1
- 244000098338 Triticum aestivum Species 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 102100024598 Tumor necrosis factor ligand superfamily member 10 Human genes 0.000 description 1
- 102100031988 Tumor necrosis factor ligand superfamily member 6 Human genes 0.000 description 1
- 108050007852 Tumour necrosis factor Proteins 0.000 description 1
- 102000018594 Tumour necrosis factor Human genes 0.000 description 1
- 101150050575 URA3 gene Proteins 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- 206010046980 Varicella Diseases 0.000 description 1
- 108020005202 Viral DNA Proteins 0.000 description 1
- 102000018265 Virus Receptors Human genes 0.000 description 1
- 108010066342 Virus Receptors Proteins 0.000 description 1
- IXKSXJFAGXLQOQ-XISFHERQSA-N WHWLQLKPGQPMY Chemical compound C([C@@H](C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)NC(=O)[C@@H](N)CC=1C2=CC=CC=C2NC=1)C1=CNC=N1 IXKSXJFAGXLQOQ-XISFHERQSA-N 0.000 description 1
- 238000002441 X-ray diffraction Methods 0.000 description 1
- 241000710772 Yellow fever virus Species 0.000 description 1
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 1
- 235000016383 Zea mays subsp huehuetenangensis Nutrition 0.000 description 1
- SMEGJBVQLJJKKX-HOTMZDKISA-N [(2R,3S,4S,5R,6R)-5-acetyloxy-3,4,6-trihydroxyoxan-2-yl]methyl acetate Chemical compound CC(=O)OC[C@@H]1[C@H]([C@@H]([C@H]([C@@H](O1)O)OC(=O)C)O)O SMEGJBVQLJJKKX-HOTMZDKISA-N 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 239000000205 acacia gum Substances 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 229940081735 acetylcellulose Drugs 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 239000008186 active pharmaceutical agent Substances 0.000 description 1
- 231100000354 acute hepatitis Toxicity 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 108700010877 adenoviridae proteins Proteins 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 235000010419 agar Nutrition 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 230000001668 ameliorated effect Effects 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 230000001188 anti-phage Effects 0.000 description 1
- 239000003443 antiviral agent Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 238000010420 art technique Methods 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 239000000688 bacterial toxin Substances 0.000 description 1
- 102000006635 beta-lactamase Human genes 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- FUFJGUQYACFECW-UHFFFAOYSA-L calcium hydrogenphosphate Chemical compound [Ca+2].OP([O-])([O-])=O FUFJGUQYACFECW-UHFFFAOYSA-L 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- CJZGTCYPCWQAJB-UHFFFAOYSA-L calcium stearate Chemical compound [Ca+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CJZGTCYPCWQAJB-UHFFFAOYSA-L 0.000 description 1
- 235000013539 calcium stearate Nutrition 0.000 description 1
- 239000008116 calcium stearate Substances 0.000 description 1
- 210000000234 capsid Anatomy 0.000 description 1
- 150000001720 carbohydrates Chemical group 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 125000002057 carboxymethyl group Chemical group [H]OC(=O)C([H])([H])[*] 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000006041 cell recruitment Effects 0.000 description 1
- 230000006364 cellular survival Effects 0.000 description 1
- 229920002301 cellulose acetate Polymers 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 210000002230 centromere Anatomy 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 210000003483 chromatin Anatomy 0.000 description 1
- 239000013611 chromosomal DNA Substances 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 238000000975 co-precipitation Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 235000005822 corn Nutrition 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 230000005860 defense response to virus Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 235000019700 dicalcium phosphate Nutrition 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 102000004419 dihydrofolate reductase Human genes 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 230000012202 endocytosis Effects 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 229960000403 etanercept Drugs 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 208000012997 experimental autoimmune encephalomyelitis Diseases 0.000 description 1
- 210000002744 extracellular matrix Anatomy 0.000 description 1
- 210000001723 extracellular space Anatomy 0.000 description 1
- 108010052621 fas Receptor Proteins 0.000 description 1
- 102000018823 fas Receptor Human genes 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 231100000562 fetal loss Toxicity 0.000 description 1
- 101150073818 gap gene Proteins 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 201000004946 genital herpes Diseases 0.000 description 1
- 238000012268 genome sequencing Methods 0.000 description 1
- 102000018146 globin Human genes 0.000 description 1
- 108060003196 globin Proteins 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- LXJXRIRHZLFYRP-UHFFFAOYSA-N glyceraldehyde 3-phosphate Chemical compound O=CC(O)COP(O)(O)=O LXJXRIRHZLFYRP-UHFFFAOYSA-N 0.000 description 1
- 108010086476 glycerate kinase Proteins 0.000 description 1
- 230000002414 glycolytic effect Effects 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 208000019622 heart disease Diseases 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 230000002008 hemorrhagic effect Effects 0.000 description 1
- 208000010710 hepatitis C virus infection Diseases 0.000 description 1
- 201000010284 hepatitis E Diseases 0.000 description 1
- 208000029564 hepatitis E virus infection Diseases 0.000 description 1
- 230000003284 homeostatic effect Effects 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 230000037451 immune surveillance Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000007901 in situ hybridization Methods 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 210000003000 inclusion body Anatomy 0.000 description 1
- 201000006747 infectious mononucleosis Diseases 0.000 description 1
- 229960000598 infliximab Drugs 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 239000003999 initiator Substances 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- 231100000518 lethal Toxicity 0.000 description 1
- 230000001665 lethal effect Effects 0.000 description 1
- 238000002898 library design Methods 0.000 description 1
- 238000012917 library technology Methods 0.000 description 1
- 108020001756 ligand binding domains Proteins 0.000 description 1
- 238000009630 liquid culture Methods 0.000 description 1
- 230000000527 lymphocytic effect Effects 0.000 description 1
- 210000005210 lymphoid organ Anatomy 0.000 description 1
- 108010019677 lymphotactin Proteins 0.000 description 1
- 101150109301 lys2 gene Proteins 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 235000009973 maize Nutrition 0.000 description 1
- 230000007257 malfunction Effects 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 230000013011 mating Effects 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 210000004779 membrane envelope Anatomy 0.000 description 1
- 210000003071 memory t lymphocyte Anatomy 0.000 description 1
- 230000007102 metabolic function Effects 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- 229960002900 methylcellulose Drugs 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 210000000274 microglia Anatomy 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000003032 molecular docking Methods 0.000 description 1
- 208000029744 multiple organ dysfunction syndrome Diseases 0.000 description 1
- 208000010805 mumps infectious disease Diseases 0.000 description 1
- DDOVBCWVTOHGCU-QMXMISKISA-N n-[(e,2s,3r)-3-hydroxy-1-[(2r,3r,4s,5r,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxynonadec-4-en-2-yl]octadecanamide Chemical compound CCCCCCCCCCCCCCCCCC(=O)N[C@H]([C@H](O)\C=C\CCCCCCCCCCCCCC)CO[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O DDOVBCWVTOHGCU-QMXMISKISA-N 0.000 description 1
- 230000007524 negative regulation of DNA replication Effects 0.000 description 1
- 230000006491 negative regulation of transport Effects 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 210000000653 nervous system Anatomy 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 230000003546 nucleic acid damage Effects 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- 201000005737 orchitis Diseases 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 239000003791 organic solvent mixture Substances 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 230000001769 paralizing effect Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 230000001991 pathophysiological effect Effects 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 210000001322 periplasm Anatomy 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- XEBWQGVWTUSTLN-UHFFFAOYSA-M phenylmercury acetate Chemical compound CC(=O)O[Hg]C1=CC=CC=C1 XEBWQGVWTUSTLN-UHFFFAOYSA-M 0.000 description 1
- 239000003016 pheromone Substances 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 239000000049 pigment Substances 0.000 description 1
- 239000004014 plasticizer Substances 0.000 description 1
- YIQPUIGJQJDJOS-UHFFFAOYSA-N plerixafor Chemical compound C=1C=C(CN2CCNCCCNCCNCCC2)C=CC=1CN1CCCNCCNCCCNCC1 YIQPUIGJQJDJOS-UHFFFAOYSA-N 0.000 description 1
- 229960002169 plerixafor Drugs 0.000 description 1
- 108010048507 poliovirus receptor Proteins 0.000 description 1
- 230000029279 positive regulation of transcription, DNA-dependent Effects 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 229940116317 potato starch Drugs 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000001915 proofreading effect Effects 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 230000012846 protein folding Effects 0.000 description 1
- 238000007420 radioactive assay Methods 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- 108700015048 receptor decoy activity proteins Proteins 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 238000009877 rendering Methods 0.000 description 1
- 230000003252 repetitive effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- 229940100486 rice starch Drugs 0.000 description 1
- 235000019515 salmon Nutrition 0.000 description 1
- 201000000980 schizophrenia Diseases 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 150000003355 serines Chemical class 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 239000013605 shuttle vector Substances 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- RMAQACBXLXPBSY-UHFFFAOYSA-N silicic acid Chemical compound O[Si](O)(O)O RMAQACBXLXPBSY-UHFFFAOYSA-N 0.000 description 1
- 235000012239 silicon dioxide Nutrition 0.000 description 1
- 210000004927 skin cell Anatomy 0.000 description 1
- 206010040882 skin lesion Diseases 0.000 description 1
- 231100000444 skin lesion Toxicity 0.000 description 1
- 229940083538 smallpox vaccine Drugs 0.000 description 1
- 235000010413 sodium alginate Nutrition 0.000 description 1
- 239000000661 sodium alginate Substances 0.000 description 1
- 229940005550 sodium alginate Drugs 0.000 description 1
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- 235000002639 sodium chloride Nutrition 0.000 description 1
- 239000007901 soft capsule Substances 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 230000001148 spastic effect Effects 0.000 description 1
- 108010068698 spleen exonuclease Proteins 0.000 description 1
- 230000003019 stabilising effect Effects 0.000 description 1
- 238000012409 standard PCR amplification Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 208000003265 stomatitis Diseases 0.000 description 1
- 210000002536 stromal cell Anatomy 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 238000009495 sugar coating Methods 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000003319 supportive effect Effects 0.000 description 1
- 208000010648 susceptibility to HIV infection Diseases 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 238000009492 tablet coating Methods 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 235000008521 threonine Nutrition 0.000 description 1
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 239000004408 titanium dioxide Substances 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 235000010487 tragacanth Nutrition 0.000 description 1
- 239000000196 tragacanth Substances 0.000 description 1
- 229940116362 tragacanth Drugs 0.000 description 1
- 230000037426 transcriptional repression Effects 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 229940078499 tricalcium phosphate Drugs 0.000 description 1
- 235000019731 tricalcium phosphate Nutrition 0.000 description 1
- 229910000391 tricalcium phosphate Inorganic materials 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 230000010415 tropism Effects 0.000 description 1
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 208000009421 viral pneumonia Diseases 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
- 238000005303 weighing Methods 0.000 description 1
- 229940100445 wheat starch Drugs 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
- 150000003751 zinc Chemical class 0.000 description 1
- 206010048282 zoonosis Diseases 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
- C07K14/4703—Inhibitors; Suppressors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the present invention relates to molecules.
- the present invention relates to molecules capable of binding to receptor nucleotide sequences.
- viruses subvert host proteins to gain entry into cells, exploit their metabolic functions for replication, and evade immune surveillance. Furthermore, immune reactions that may be beneficial for clearing pathogens can be deleterious to the host if they persist or if they are triggered inappropriately, such as in autoimmune syndromes.
- the present invention seeks to overcome one or more problem(s) associated with the prior art.
- Figures 1 A, IB and IC show DNA-binding by the six-finger CXCR4 constructs using an in vitro (TNT) fluorescence ELISA assay.
- Figure 1 A Binding of the six-zinc fmger peptide, CXCR4-5-1, to its preferred target site and to 5 control sites containing base mutations (underlined).
- Figure IB Binding of the six-zinc finger peptide, CXCR4-10-1, to its preferred target site and to a control site containing base mutations (underlined).
- Figure IC Binding of the six-zinc finger peptide, CXCR4-10- 3, to its preferred target site and to a control site containing base mutations (underlined).
- Figures 2A, 2B and 2C show specific down-regulation of endogenous CXCR4 by selected zinc fmger protein.
- Figure 2A Expression of CXCR4 at the surface of Jurkat cells.
- Figure 2B Expression of CXCR4 as assessed by FACS analysis on different population: non-transfected Jurkat cells which represent an internal control (Rl) and sub populations R2, R3 and R4 exhibit 10, 100- and 1000- fold higher GFP fluorescence intensity relative to background, respectively.
- Figure 2C Down- regulation of CXCR4 observed with Jurkat cells transfected with zinc finger proteins 10-1 and 10-3.
- Figures 3A, 3B and 3C show binding by the TNF six-zinc finger peptides using an in vitro (TNT) fluorescence ELISA assay.
- Figure 3 A Binding of TNFR1-4-2 to its preferred target, a control site, and no binding site (nbs).
- Figure 3B Binding of the six- zinc finger peptide TNFR1-7-9 to its preferred target, an overlapping site, a control site, and no binding site.
- Figure 3C Binding of the six-zinc fmger peptide TNFR1-9- 12 to its preferred target, an overlapping site, a control site, and no binding site. Sequences of target sites 4-2, 7-9 and 9-12 are shown under Figure 3A. The target sites of TNFR1-9-12 and TNFR1-7-9 overlap over a distance corresponding to 4 1/2 of the 6 fingers binding region.
- Figures 4A and 4B show specific down-regulation of endogenous TNFR1 expression by four distinct zinc finger proteins, as assayed by FACS analysis.
- Figure 4A Expression of TNFR1 on Jurkat T cells is indicated by the filled area, while the open area represents a negative staining control.
- Figure 4B Expression of TNFR1 after transient transfection with expression vectors encoding GFP only (pTracer, Invitrogen), or GFP and four different zinc fmger proteins targetted at the TNFR1 promoter.
- An expression vector encoding the CXCR4 zinc finger protein used in Fig. 2A,B is used as a control.
- the left panel depicts GFP fluorescence, which serves to identify transfected cells. Electronic gates are applied for GFP+ tranfected cells (GI).
- the second panel shows TNFR1 expression on the total cell population. TNFR1 expression on the GI, GFP+ sub-population is depicted in the third panel.
- Figure 5 shows down-regulation of expression from a TNFR promoter as assayed by a CAT assay.
- the figure demonstrates down-regulation with TNFRl-4-2 (A), TNFR1-9-12 (B), TNFR1-7-9 (C), TNFR1-7-10 (D), as well as a combination of all four of these (A+B+C+D). No down-regulation is seen with a pTracer only control.
- Figure 6 shows the specific down-regulation of TNFR- 1 and CXCR4 by TNFRl-4-2 -Kox and CXCR4-5-l-Kox, respectively.
- Column 1 total cell population, with proportion of cells expressing GFP from the transfected plasmid indicated under the horizontal line; column 2, expression levels of TNFR-1 in cells also expressing GFP; column 3, expression levels of CXCR4 in cells also expressing GFP; column 4, expression levels of ICAM in cells also expressing GFP.
- Data in rows A, B, C and D is for cells transfected with empty pTracer vector; pTracer containing TNFR1 -4-2-
- the invention provides a polypeptide capable of binding to a nucleic acid comprising a receptor nucleotide sequence.
- Polypeptides according to preferred embodiments of the invention include those which are capable of binding to receptor nucleotide sequences, in which the receptor is involved in any aspect of viral function, for example, viral binding, viral infection, etc.
- a viral receptor maybe capable of mediating or facilitating etc the viral function.
- the receptor may be involved in viral infection of any kind, including HIV infection, for example, CD4, CXCR4, CCR5, CCR3 or CCR2b.
- the invention includes polypeptides capable of binding receptor nucleotide sequences in which the receptor is capable of binding to one or more other molecules ("ligands").
- ligands receptor nucleotide sequences in which the receptor is capable of binding to one or more other molecules
- Such a receptor may be involved in any form of signal transduction, and may in particular, be involved in an immune reaction (whether appropriate or inappropriate) against any agent, including pathogens or other insults. It will be appreciated that receptors may have plural activities or functions, such that the above preferred embodiments are not to be considered mutually exclusive.
- the receptor is involved in transmitting signals upon binding of a ligand.
- a ligand may include proteins, or other chemical compounds that can act as agonists or antagonists of such molecules.
- the receptor is involved in regulation of the immune system, preferably TNFR1 and other members of the TNF receptor family (TNFR2, Fas/Apo-l/CD95, lymphotoxin beta receptor, TRAIL receptor, osteoprotegerin, RANK), the IL-1 and IL- 18 receptors, and the receptors for Type I and II Interferons.
- Nucleic acid binding polypeptides according to the invention preferably comprise zinc finger polypeptides.
- the nucleic acid binding polypeptide is capable of downregulating a receptor, preferably capable of transcriptional down- regulation of a receptor.
- Highly preferred embodiments include zinc finger polypeptides selected from the group consisting of consensus sequences 1 to 18 (see Table 1), a variant of one or more thereof, and polypeptides comprising combinations of two or more thereof.
- Preferred zinc fingers include those comprising three fingers, i.e., selected from the group consisting of zinc fingers comprising consensus sequences 1 to 3, zinc fingers comprising consensus sequences 4 to 6, zinc fingers comprising consensus sequences 7 to 9, zinc fingers comprising consensus sequences 10 to 12, zinc fingers comprising consensus sequences 13 to 15, and zinc fingers comprising consensus sequences 16 to 18 (see Table 1).
- the zinc finger polypeptides comprise six zinc fingers, viz, zinc fingers comprising consensus sequences 1 to 6, consensus sequences 7 to 12 or consensus sequences 13 to 18 (see Table 1).
- the individual finger modules may be linked by canonical, structured or flexible linkers (as described in further detail below), preferably, linkers comprising GERP, GGGGSGGSGGSERP or GGGGSGGSGGSGGSGGSERP.
- the nucleic acid binding polypeptides may further comprise one or more repressor domains, preferably, a KOX domain, as described below.
- the term "receptor" as used in the present document is intended to refer to a molecule which is capable of binding to another molecule (the ligand).
- the receptor is located in the plasma membrane of a cell (a cell surface receptor). More preferably, the receptor is a transmembrane receptor.
- the receptor may be a chemokine receptor or a cytokine receptor. Most preferably, the receptor is a G-protein coupled receptor.
- the receptor may be involved in the regulation (repression or activation) of a downstream a transcription factor.
- a transcription factor may for example include members of the NF-kB or STAT families of transcription factors.
- Transmembrane receptors, including G-protein coupled and cytokine receptors, their properties and sequences, are known in the art.
- Binding of the ligand to the receptor may lead to the activation of one or more biological activities, such as a post-transcriptional modification (for example, phosphorylation), dimerisation, nuclear (or other subcellular) localisation, binding to a third molecule, etc.
- a post-transcriptional modification for example, phosphorylation
- dimerisation for example, dimerisation
- nuclear (or other subcellular) localisation binding to a third molecule, etc.
- a nucleic acid binding polypeptide is capable of binding to a nucleic acid comprising a nucleotide sequence of a receptor involved in a viral function.
- the viral function is preferably selected from the group consisting of: viral titre, viral infectivity, viral replication, viral packaging, viral transcription, viral entry, viral attachment and viral penetration. Most preferably, the receptor is involved in viral infection.
- a single receptor appears to be necessary and sufficient for entry of many retroviruses, but there exist exceptions to this simple model.
- HIV requires two proteins for cell entry, neither of which alone is sufficient; 10A1 murine leukemia virus can enter cells by using either of two distinct receptors; two retroviruses can use different receptors in some cells but use the same receptor for entry into other cells.
- co-receptor is used here to refer any one of two or more polypeptides which contribute to, or are necessary for, cellular entry of the virus.
- the invention thus encompasses use of one or more nucleic acid binding polypeptides capable of binding nucleic acid sequences comprising a co-receptor, where more than one receptor is necessary and/or sufficient for viral entry into the cell.
- nucleic acid binding polypeptides may be used, each one capable of targeting one or more co-receptors.
- a nucleic acid binding polypeptide capable of targeting CD4 may be used in conjunction with a nucleic acid binding polypeptide capable of targeting CXCR4.
- receptor where the context admits includes reference to a "co-receptor”.
- the receptor is capable of binding a ligand which is a viral protein, preferably a viral envelope protein.
- binding of the receptor to the viral protein is involved in, results in, or leads to, infection of a cell with the virus.
- the receptor is capable of binding a polypeptide ligand of a lentivirus, preferably Human Immunodeficiency Virus, preferably, HIN-1.
- the polypeptide ligand is a gp 120 protein of HIN.
- the receptor is involved in infection by HIN, for example, CD4, CXCR4, CCR5, CCR3, CCR2b, etc.
- the receptor is a CXCR4 receptor, as discussed in further detail below.
- the nucleic acid binding polypeptide comprises a zinc finger polypeptide capable of binding to a CXCR4 receptor promoter sequence.
- the CXCR4 receptor promoter sequence comprises a sequence selected from the group consisting of: 5 ' -Tccccgccccagcggcgcatgcgccgcgctcggagcgtgtttttata-3 ' , 5 ' -CCGCCCCAGCGGCGCATGCGCCGCGCTCGGAGCGTGTT-3 '
- the receptor is involved in regulation of a biological function.
- the receptor is capable of binding a ligand which is either diffusible in bodily fluids, or integrated into or bound covalently or noncovalently to cell membranes or viral envelopes, the extracellular matrix, or any other substrate.
- binding of the receptor to ligand is involved in, results in, or leads to, metabolic responses of a cell to the ligand.
- the receptor is capable of binding a polypeptide ligand associated with an immune response, typically classified as cytokines or interleukins.
- the biological function which is capable of being regulated by the receptor may include an immune function, for example, an immune response.
- the immune function is preferably associated with activation of cells associated with the immune system.
- Such cells may include B, T , NK, macrophages, neutrophils, and other lymphoid and myeloid cell types.
- the receptor may also be involved in any of the various metabolic responses of cells in the body to molecules in the circulation. Such molecules may be expressed and/or released by a variety of cell types, for example, lymphoid, myeloid, or stromal cells in response, to an immune stimulus.
- the receptor may in particular be involved in one or more anti- viral responses of the immune system.
- Preferred receptors include those which are involved in an autoimmune disease.
- Preferred receptors of this aspect of the invention include TNFR1, TNFR2, IL-
- the receptor comprises a TNFR1 receptor.
- the nucleic acid binding polypeptide comprises a zinc finger polypeptide capable of binding to a TNFR1 receptor promoter sequence.
- the TNFR1 receptor promoter sequence comprises a sequence selected from the group consisting of: 5 ' GTCGGATTGGTGGG TTGGGGGCACAAGGCA-3 ' ( TNFRl-4-2 ) ;
- a nucleic acid binding polypeptide according to the invention is preferably capable of down-regulating the receptor.
- the receptor may be down-regulated by a number of ways, including down-regulation of DNA replication of a sequence comprising the receptor, down-regulation of transcription of a gene encoding the receptor, down-regulation of RNA processing of a receptor transcript, down-regulation of transcript RNA turnover, down-regulation of translation, down-regulation of transport and or intracellular localisation of polypeptide and/or RNA within the cell, down-regulation of post-transcriptional modification, down-regulation of protease or other activity which activates the receptor, down-regulation of receptor cofactors, down-regulation of activity of the receptor, up-regulation of breakdown of the receptor, etc.
- the invention encompasses any nucleic acid binding polypeptide capable of any of these activities through binding to its target.
- down-regulation of the receptor is achieved through transcriptional regulation, as described below.
- a "receptor nucleotide sequence” is intended to refer to any nucleotide sequence comprising, derived from, including or associated with, etc a gene encoding a receptor.
- the receptor nucleotide sequence comprises a gene, or a portion of a gene, for the receptor.
- the receptor nucleotide sequence may comprise a nucleic acid sequence capable of encoding a receptor, or it may comprise any of the control sequences of the receptor gene, for example, a promoter sequence, an enhancer sequence, a transcription factor binding site, a splice site, a sequence controlling transcription termination, etc. What is important is that the sequence is in some way involved in the regulation of expression of the receptor gene.
- binding of the nucleic acid binding polypeptide to its target results in down-regulation of expression of the receptor.
- chemokines are a family of chemoattractive polypeptides, that are classified into 4 groups, depending on the position of conserved cysteine residues. Chemokines attract leukocyte subsets to inflammation sites and/or have homeostatic functions in regulating lymphocyte trafficking between and within lymphoid organs.
- chemokines and receptors for them include the following: C Chemokines such as SCYC1, Lptn, CL1, Lymphotactin, SCM-la, ATAC, SCYC2, CL2, SCM-lb; CC Chemokines, CXC Chemokines, CXXXC Chemokines and virus-encoded chemokines.
- the receptor is a CXC chemokine receptor.
- CXC chemokine receptors include receptors for SCYB 1 , SCYB2, SCYB3, SCYB4,, SCYB4N1, SCYB5, SCYB6, (GCP-2, like, SCYB7, SPBPBP, SCYB8, SCYB9, SCYB 10, SCYB 11, (SCYB9B), SCYB 12, SCYB 13, SCYB 14, SCYB 15, SCYB 16, SCYB IP, ⁇ AP-4 and LFCA-1.
- the receptor may be chosen from the group consisting of: a CCR3 receptor, a CCR2b receptor, a CCR5 receptor, and a CXCR-4 receptor.
- the receptor is a receptor capable of binding a SDF-1 ligand.
- the receptor is a CXCR4 receptor.
- Stromal cell- derived factor- 1 (SDF-1) is a CXC chemokine that binds to a unique transmembrane G protein-coupled receptor called CXCR4, is chemoattractive for hematopoietic progenitor cells, B lymphocytes, T lymphocytes, and monocytes.
- SDF-1 has been shown to regulates B lymphopoiesis and myelopoiesis by confimng precursors within the supportive bone marrow microenvironment before further maturation.
- CXCR4 also acts as a co-receptor for the human immunodeficiency virus (HIV)-l and 2.
- the invention therefore relates in a particularly preferred embodiment to a molecule capable of binding to a nucleic acid comprising a CXCR4 receptor sequence, preferably a CXCR4 promoter sequence.
- the molecule is capable of binding to and downregulating the expression of the CXCR4 gene.
- CXCR4 (CXC chemokine receptor 4) is a co-receptor for T-cell-tropic HIV-1 strains, known also as X4 viruses (1, 6, reviewed in 7).
- CXCR4 is a G-protein-coupled, 7-transmembrane domain receptor whose physiological ligand is the Stromal Cell- Derived Factor-1 (SDF-1) chemokine (2, 13).
- SDF-1 Stromal Cell- Derived Factor-1
- CXCR4 is also known as CMKAR4, LCR1, NPY3R (systematic Human Genome nomenclature), fusin, HM89, LESTR, NPYRL, SDF-1R, D2S201E, CXCR4-Lo.
- CXCR4 is expressed in dendritic cells (9), naive, non-memory T-cells (3), neurons and microglia (11), fresh primary monocytes (5, 16), endothelial cells (10, 15), neutrophils and B -cells (8).
- CXCR4 expression is induced by phytohemagglutinin (PHA) stimulation of peripheral blood mononuclear cells (PBMCs) (3).
- PHA phytohemagglutinin
- PBMCs peripheral blood mononuclear cells
- X4 strains differ significantly in their use of CXCR4 extracellular domains (4,12); for example: HIN-1(NDK) and HIV-2(ROD) are unable to use CXCR-4 in which most of the amino-terminal domain is deleted, while HIV-l(LAI) is able to use the truncated receptor (4).
- the invention comprises a method of treatment or prevention of a viral disease, comprising administering to a patient a polypeptide as described here, together with a molecule capable of disrupting the interaction of a viral envelope protein with a viral receptor.
- HIV-1 human immunodeficiency virus type 1
- primary isolates of HIV-1 show distinct differences in their biological properties, including differences in replication kinetics, tropism, and syncytium-inducing capacity.
- Cellular entry of HIV-1 requires binding to both CD4 and to one transmembrane chemokine co-receptors.
- CXCR-4 has been shown to mediate entry of T cell line- adapted syncytium-inducing (SI) strains of HIN-1 into CD4 + T cells, but does not permit entry of ⁇ SI isolates whereas CCR5 has been identified as a coreceptor for macrophage-tropic, nonsyncytium-inducing ( ⁇ SI) strains of HIV-1.
- SI syncytium-inducing
- CCR5 Isolates of HIV-1 from early in the course of infection predominantly used CCR5.
- the virus however expanded its co- receptor use to include other chemokine receptor such as CCR3, CCR2b, and CXCR- 4. More importantly, the emergence of variants using the CXCR-4 co-receptor is associated with a switch from ⁇ SI to SI phenotype, a decreasing CD4 + T cell counts and therefore a progression to AIDS.
- a highly preferred embodiment of a polypeptide according to the invention comprises a polypeptide which is capable of binding to a nucleic acid sequence comprising a CXCR4 nucleotide sequence or a nucleotide sequence from a promoter or enhancer of CXCR4.
- the CXCR4 receptor is a human CXCR4 receptor. More preferably, the CXCR4 receptor is the human CXCR4 receptor having GenBank accession number X71635 (Loetscher, M., Geiser, T., O'Reilly, T., Z inchesen, R., Baggiolini, M., and Moser, B. (1994) J. Biol. Chem. 269, 232-237).
- GenBank accession number X71635 GenBank accession number X71635
- the nucleotide sequence is chosen from the non-coding upstream region of the CXCR4 gene, for example, positions 1 to 68 of the above sequence.
- nucleic acid binding polypeptides of the present invention are capable of binding to nucleotide sequences of receptors or co- receptors involved in viral infection, preferably leading to their downreguloation.
- they are capable of reducing, preventing, or alleviating the spread of infection of a number of viruses, and may hence be used for treating or preventing diseases associated with or caused by such viruses.
- the virus may be an RNA virus or a DNA virus.
- the virus is an integrating virus.
- the virus is selected from a lentivirus and a herpesvirus. More preferably, the virus is an HIN virus or a HSN virus.
- the methods described here can therefore be used to prevent the development and establishment of diseases caused by or associated with any of the above viruses, including human immunodeficiency virus, such as HIV-1 and HIV-2, and herpesvirus, for example HSV-1, HSV-2, HSV-7 and HSV-8, as well as human cytomegalovirus, varicella-zoster virus, Epstein-Barr virus and human herpesvirus 6. in humans.
- viruses which may be targeted using the present invention are given in the tables below.
- Herpesviridae Alphaherpes- Herpes simplex virus type 1 virinae
- Herpes simplex virus type 2 (aka HHV-1) Herpes simplex virus type 2
- Human cytomegalovirus aka Mononucleosis, hepatitis, pneumonitis,
- Adenoviridae Human herpesvirus 7 Some cases of roseola? Papovaviridae Mastadenovirus Human adenoviruses 50 serotypes (species); respiratory infections
- Hepadnaviridae Polyomavirus JC BK viruses Mild usually; JC causes PML in AIDS Poxviridae Orthohepadnavirus Hepatitis B virus (HBV) Hepatitis (chronic), cirrhosis, liver tumors
- HBV Hepatitis B virus
- chronic cirrhosis
- HCV Hepatitis C virus
- Circoviridae Dependovirus Adeno-associated virus chromosome Circovirus TT virus (TTV) Linked to hepatitis of unknown etiology
- Echoviruses 30 types Aseptic meningitis, rashes
- Coxsackieviruses 30 types Aseptic meningitis, myopericarditis
- Hepatovirus Hepatitis A virus Acute hepatitis (fecal-oral spread) Rh ⁇ novirus Human rhinoviruses 115 types; Common cold
- Mumps parotitis, aseptic meningitis (rare: Rubulavirus Mumps virus orchitis, encephalitis)
- Measles fever, rash (rare: encephalitis, Morbillivirus Measles virus SSPE) Common cold (adults), bronchiolitis,
- Orthomyxo- Flu fever, myalgia, malaise, cough,
- Influenzavirus B Influenza virus B pneumonia
- Lentivirus AIDS Lentivirus AIDS, CNS disease virus type-1 and -2
- receptors for HIV infection include CD4, CCR5, CXCR4, etc.
- HveA Herpes Simplex Virus infection
- HveB HveC
- HveC allows both HSV-1 and -2 to enter skin cells at the site of infection and to spread into ells of the nervous system.
- this receptor permits entry of other closely related forms of herpesvirus, porcine pseudorabies virus, and bovine herpesvirus, into cells.
- HveA is a member of the tumor necrosis factor receptor family
- HveB and HveC belong to tl e immunoglobulin gene superfamily and are closely related to the poliovirus receptor (Pvr).
- HAVcr-1 is a simian cellular receptor for the hepatitis A virus (HAV).
- the nucleic acid binding polypeptides of the present invention are capable of binding to nucleic acid sequences capable of encoding Human Immunodeficiency Virus (HIV) receptors and/or co-receptors such as CD4, CXCR4, CCR5 contour CCR2b, CCR3 etc.
- HIV Human Immunodeficiency Virus
- co-receptors such as CD4, CXCR4, CCR5 suitcase CCR2b, CCR3 etc.
- the methods described here can therefore be used to prevent the development and establishment of diseases caused by or associated with human immunodeficiency virus, such as HIV-1 and HIV-2.
- HIV Human Immunodeficiency Virus
- CD4 + T lymphocytes are important, not only in terms of their direct role in immune function, but also in stimulating normal function in other components of the immune system, including CD8 + T-lymphocytes.
- CD8 + T-lymphocytes These HIV infected cells have their function disturbed by several mechanisms and/or are rapidly killed by viral replication. The end result of chronic HIV infection is gradual depletion of CD4 + T lymphocytes, reduced immune capacity, and ultimately the development of AIDS, leading to death.
- HIV infection typically begins when an HTV particle, which contains two copies of the HIV RNA, encounters a cell with a surface molecule CD4.
- Cells with this molecule are known as CD4 positive (CD4+) cells.
- CD4 positive (CD4+) cells One or more of the virus's gpl20 molecules binds tightly to CD4 molecule(s) on the cell's surface. The membranes of the virus and the cell fuse, a process that probably involves both gp41 and a second "fusion cofactor" molecule on the cell surface. Following fusion, the virus's RNA, proteins and enzymes are released into the cell.
- CD4+ T cells appear to be HIV's main target, other immune system cells with CD4 molecules on their surfaces are infected as well.
- HIN may also may infect cells without CD4 on their surfaces, using other docking molecules.
- cells of the central nervous system may be infected via a receptor known as galactosyl ceramide.
- galactosyl ceramide The use of such receptors as targets is also encompassed by the present invention.
- Cell-to-cell spread of HIN also can occur through the CD4-mediated fusion of an infected cell with an uninfected cell.
- a polypeptide capable of binding to a nucleic acid comprising a cytokine receptor nucleotide sequence.
- Cytokines are polypeptides, typically but not exclusively produced by cells involved in the immune system, and for the purposes of this invention include those referred to as lymphokines, monokines, interleukins, and interferons. They are a diverse group of proteins, although sub-groups can be identified by virtue of sequence or structural homologies. The cellular responses elicited by the interaction of cytokines with their cognate receptors are also diverse, and even for a given cytokine can differ according to the responding cell type, its differentiation stage, or its history of stimulation by other cytokines. Broadly, cytokines can regulate cell survival, proliferation, differentiation, morphology, and trancriptional and translational activities. Collectively these responses serve to establish metabolic states that protect the organism against infection by pathogens such as bacteria or viruses. However, although the production of cytokines is highly regulated, inappropriate or excessive levels can cause life-threatening inflammatory episodes or lead to chronic disease.
- Preferred cytokines and receptors for them include the following: members of the TNF family (TNF ⁇ / ⁇ , lymphotoxin cc/ ⁇ , TRANCE/ RANKL, TRAIL, FasL and all combinations of subunits that compose biologically active multimeric ligands) and their receptors; Interleukin-1 (IL-1) and its receptors; IL-18 and its receptors; type I interferons (all ⁇ forms, ⁇ , and ⁇ ) and their receptors; type TJ interferon ( ⁇ ) and its receptors.
- the receptor is a TNF receptor.
- TNF family receptors include TNFRl (also p55, p60), TNFRII (also p75, p80), KTLLER/DR5, Fas/CD95, RANK, and osteoprotegerin.
- a preferred TNFRl receptor has the accession number X69810; a preferred TNFR2 receptor has the accession number U53481 and a preferred CD95/Fas receptor has the accession number HSFASX1. It will however be appreciated that tlie sequences referred to using such accession numbers may only include cDNA
- upstream sequences may be used as target sequences for designing zinc fingers capable of binding to these sequences and thereby regulating expression of the receptors under their control or influence.
- upstream sequences may be used as target sequences for designing zinc fingers capable of binding to these sequences and thereby regulating expression of the receptors under their control or influence.
- determination of a corresponding genomic sequence enables identification of promoter and enhancer or other control regions. Sequences identified in the various genome sequencing projects currently being conducted, including the Human Genome Sequence Project, will also enable the skilled person to choose sequences for targetting.
- TNF ⁇ is a homo-trimeric molecule formed by specific association of three polypeptide chains endoded by the TNF ⁇ gene locus. The protein is produced as a transmembrane complex, and when expressed at the cell surface the receptor-interacting domains are exposed to the extracellular space and are capable of interacting with their cognate receptor on adjacent cells. Although biologically active in this membrane-bound form, TNF ⁇ is generally found as a secreted product that is produced by specific cleavage of the membrane form by metalloproteinases.
- TNF ⁇ is regarded as a key cytokine for inducing immune responses, particularly those associated with inflammation. When it binds to its receptors it can induce expression of MHC class I molecules that present antigen to cytotoxic T cells, and adhesion molecules such as ICAM that promote recruitment of cells of the immune system to sites of inflammation. Importantly, TNF ⁇ often induces transcription of genes for these molecules in a synergistic fashion with other cytokines, particularly the interferons. While TNF ⁇ serves an important function in promoting inflammation in order to neutralise pathogens, it is often associated with a range of clinical problems (19, 24). Acute over-production of TNF ⁇ in response to bacterial toxins can cause septicaemia, toxic shock syndrome, and other forms of immune damage.
- TNF ⁇ chronic autoimmune diseases and other syndromes including inflammatory bowel disease, rheumatoid arthritis, psoriasis, myocarditis, myelodysplasia, multiple sclerosis, and type II diabetes are also linked to TNF ⁇ .
- Murine models have shown that over- expression of TNF ⁇ can lead to myocardial fibrosis, and this could be ameliorated with adenoviral gene therapy with a decoy TNF receptor (23).
- the pivotal role of TNF ⁇ in rheumatoid arthritis is illustrated by the favourable clinical responses of patients to treatment with an antibody to TNF ⁇ , Infliximab (20), or a recombinant decoy receptor, Etanercept (21).
- the receptor is capable of binding a ligand that is a member of the TNF family.
- the ligand is TNF ⁇ .
- the receptor is TNFRl (also p55, p60, CD120a). More preferably, the TNFRl receptor comprises a receptor having accession number TNFRl is X69810.
- TNF ⁇ is recognised by two distinct cell-surface, transmembrane receptors: TNFRl (p55,p60, CD120a), and TNFRl 1 (p75,p80, CD120b). Each appears to function as a homotrimer (17). They have strong homology in their extracellular ligand-binding domains, but diverge in their intracellular domains and thereby transmit overlapping but distinct patterns of signals when engaged by TNF ⁇ (17). Consequently TNFRl and TNFRII have distinct immunological functions, as found in smdies of mouse strains where genes for one or both have been knocked-out. Mouse strains susceptible to myocarditis do not develop inflammatory heart disease when TNFRl is not expressed but TNFRII is still present (22). In a murine model of experimental autoimmune encephalomyelitis (EAE), knock-out of TNFRl prevented EAE, while knockout of TNFRII exacerbated the disease (18).
- EAE experimental autoimmune encephalomyelitis
- the polypeptides provided here may be used to target any cytokine receptor, including the TNFRl receptor, and to regulate their expression. Such polypeptides may therefore be used to treat or prevent various diseases or syndromes associated with or caused by malfunction (in particular, up-regulation or over-expression or inappropriate activation, etc) of the receptor such as the TNFRl receptor.
- diseases and syndromes include autoimmune diseases such as inflammation, autoimmune encephalomyelitis (EAE), rheumatoid arthritis, myocarditis, etc.
- a nucleic acid binding polypeptide molecule as provided by the present invention includes splice variants encoded by mRNA generated by alternative splicing of a primary transcript, amino acid mutants, glycosylation variants and other covalent derivatives of said molecule which retain the physiological and/or physical properties of said molecule, such as its nucleic acid binding activity.
- Exemplary derivatives include molecules wherein the protein of the invention is covalently modified by substitution, chemical, enzymatic, or other appropriate means with a moiety other than a naturally occurring amino acid. Such a moiety may be a detectable moiety such as an enzyme or a radioisotope, or may be a molecule capable of facilitating crossing of cell membrane(s) etc.
- Derivatives can be fragments of the nucleic acid binding molecule. Fragments of said molecule comprise individual domains thereof, as well as smaller polypeptides derived from the domains. Preferably, smaller polypeptides derived from the molecule according to the invention define a single epitope which is characteristic of said molecule. Fragments may in theory be almost any size, as long as they retain one characteristic of the nucleic acid binding molecule. Preferably, fragments maybe at least 3 amino acids and in length.
- Derivatives of the nucleic acid binding molecule also comprise mutants thereof, which may contain amino acid deletions, additions or substitutions, subject to the requirement to maintain at least one feature characteristic of said molecule.
- nucleic acid binding molecule mutants may be produced from a DNA encoding a nucleic acid binding protein which has been subjected to in vitro mutagenesis resulting e.g. in an addition, exchange and/or deletion of one or more amino acids.
- substitutional, deletional or insertional variants of the molecule can be prepared by recombinant methods and screened for nucleic acid binding activity as described herein.
- the fragments, mutants and other derivatives of the polypeptide nucleic acid binding molecule preferably retain substantial homology with said molecule.
- "homology” means that the two entities share sufficient characteristics for the skilled person to determine that they are similar in origin and/or function.
- homology is used to refer to sequence identity.
- the derivatives of the molecule preferably retain substantial sequence identity with the sequence of said molecule. Examples of such sequences are presented as consensus sequences 1 to 8.
- Substantial homology where homology indicates sequence identity, means more than 75% sequence identity and most preferably a sequence identity of 90% or more. Amino acid sequence identity may be assessed by any suitable means, including the BLAST comparison technique which is well known in the art, and is described in Ausubel et al, Short Protocols in Molecular Biology (1999) 4 th Ed, John Wiley & Sons, Inc. MUTATIONS
- Mutations may be performed by any method known to those of skill in the art. Preferred, however, is site-directed mutagenesis of a nucleic acid sequence encoding the protein of interest.
- a number of methods for site-directed mutagenesis are known in the art, from methods employing single-stranded phage such as M13 to PCR-based techniques (see “PCR Protocols: A guide to methods and applications", M.A. Innis, D.H. Gelfand, J.J. Sninsky, TJ. White (eds.). Academic Press, New York, 1990).
- the commercially available Altered Site II Mutagenesis System (Promega) may be employed, according to the directions given by the manufacturer.
- Screening of the proteins produced by mutant genes is preferably performed by expressing the genes and assaying the binding ability of the protein product.
- a simple and advantageously rapid method by which this may be accomplished is by phage display, in which the mutant polypeptides are expressed as fusion proteins with the coat proteins of filamentous bacteriophage, such as the minor coat protein p ⁇ of bacteriophage ml3 or gene III of bacteriophage Fd, and displayed on the capsid of bacteriophage transformed with the mutant genes.
- the target nucleic acid sequence is used as a probe to bind directly to the protein on the phage surface and select the phage possessing advantageous mutants, by affinity purification.
- the phage are then amplified by passage through a bacterial host, and subjected to further rounds of selection and amplification in order to enrich the mutant pool for the desired phage and eventually isolate the preferred clone(s).
- Detailed methodology for phage display is known in the art and set forth, for example, in US Patent 5,223,409; Choo and Klug, (1995) Current Opinions in Biotechnology 6:431-436; Smith, (1985) Science 228:1315-1317; and McCafferty et al, (1990) Nature 348:552-554; all incorporated herein by reference.
- Vector systems and kits for phage display are available commercially, for example from Pharmacia.
- amino acid particularly in the context where "any amino acid” is referred to, means any sort of natural or artificial amino acid or amino acid analogue that may be employed in protein construction according to methods known in the art.
- amino acid particularly in the context where "any amino acid” is referred to, means any sort of natural or artificial amino acid or amino acid analogue that may be employed in protein construction according to methods known in the art.
- any specific amino acid referred to herein may be replaced by a functional analogue thereof, particularly an artificial functional analogue.
- the nomenclature used herein therefore specifically comprises within its scope functional analogues of the defined amino acids.
- polypeptides which comprise the libraries according to the invention may comprise zinc fmger polypeptides. In other words, they comprise a Cys2-His2 zinc finger motif.
- Molecules according to the invention may advantageously comprise multiple zinc finger motifs.
- molecules according to the invention may comprise any number of motifs, such as three zinc finger motifs, or may comprise four or five such motifs, or may comprise six zinc finger motifs, or even more.
- molecules according to the invention may comprise zinc finger motifs in multiples of three, such as three, six, nine or even more zinc fmger motifs.
- molecules according to the invention may comprise about three to about six zinc finger motifs.
- polypeptide and the terms “peptide” and “protein” are used interchangeably to refer to a polymer of amino acid residues, preferably including naturally occurring amino acid residues. Artificial analogues of amino acids may also be used in the nucleic acid binding polypeptides, to impart the proteins with desired properties or for other reasons.
- amino acid particularly in the context where "any amino acid” is referred to, means any sort of natural or artificial amino acid or amino acid analogue that may be employed in protein construction according to methods known in tlie art.
- any specific amino acid referred to herein may be replaced by a functional analogue thereof, particularly an artificial functional analogue.
- Polypeptides may be modified, for example by the addition of carbohydrate residues to form glycoproteins.
- nucleic acid includes both RNA and DNA, constructed from natural nucleic acid bases or synthetic bases, or mixtures thereof.
- the binding polypeptides of the invention are DNA binding polypeptides.
- nucleic acid binding polypeptides are Cys2-His2 zinc finger binding proteins which, as is well known in the art, bind to target nucleic acid sequences via ⁇ -helical zinc metal atom co-ordinated binding motifs known as zinc fingers.
- Each zinc finger in a zinc finger nucleic acid binding protein is responsible for determining binding to a nucleic acid triplet, or an overlapping quadruplet, in a nucleic acid binding sequence.
- there are 2 or more zinc fingers for example 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18 or more zinc fingers, in each binding protein.
- the number of zinc fingers in each zinc finger binding protein is a multiple of 2.
- the present invention is in one aspect concerned with the production of what are essentially artificial DNA binding proteins.
- artificial analogues of amino acids may be used, to impart the proteins with desired properties or for other reasons.
- amino acid particularly in the context where "any amino acid” is referred to, means any sort of natural or artificial amino acid or amino acid analogue that may be employed in protein construction according to methods known in the art.
- any specific amino acid referred to herein may be replaced by a functional analogue thereof, particularly an artificial functional analogue.
- the nomenclature used herein therefore specifically comprises within its scope functional analogues or mimetics of the defined amino acids.
- the ⁇ -helix of a zinc finger binding protein aligns antiparallel to the nucleic acid strand, such that the primary nucleic acid sequence is arranged 3' to 5' in order to correspond with the N terminal to C-terminal sequence of the zinc finger. Since nucleic acid sequences are conventionally written 5' to 3', and amino acid sequences N-terminus to C-terminus, the result is that when a nucleic acid sequence and a zinc finger protein are aligned according to convention, the primary interaction of the zinc finger is with the - strand of the nucleic acid, since it is this strand which is aligned 3' to 5'. These conventions are followed in the nomenclature used herein.
- the present invention may be integrated with the rules set forth for zinc finger polypeptide design in our copending European or PCT patent applications having publication numbers; WO 98/53057, WO 98/53060, WO 98/53058, WO 98/53059, describe improved techniques for designing zinc finger polypeptides capable of binding desired nucleic acid sequences. In combination with selection procedures, such as phage display, set forth for example in WO 96/06166, these techniques enable the production of zinc finger polypeptides capable of recognising practically any desired sequence.
- the invention provides a method for preparing a nucleic acid binding polypeptide of the Cys2-His2 zinc finger class capable of binding to a target DNA sequence comprising a receptor nucleotide sequence, in which binding to each base of a DNA triplet by an ⁇ -helical zinc finger DNA binding module in the polypeptide is determined as follows: if the 5' base in the triplet is G, then position +6 in the ⁇ -helix is Arg and or position +4-2 is Asp; if the 5' base in the triplet is A, then position +6 in the ⁇ -helix is Gin or Glu and ++2 is not Asp; if the 5' base in the triplet is T, then position +6 in the ⁇ -helix is Ser or Thr and position ++2 is Asp; or position +6 is a hydrophobic amino acid other than Ala; if the 5' base in the triplet is C, then position +6 in the ⁇ -helix may be any amino acid, provided that position position
- the foregoing represents a set of rules which permits the design of a zinc finger binding protein specific for any given target DNA sequence, in particular a receptor nucleotide sequence.
- a zinc finger binding motif is a structure well known to those in the art and defined in, for example, Miller et al, (1985) EMBO J. 4:1609-1614; Berg (1988) PNAS (USA) 85:99-102; Lee et al, (1989) Science 245:635-637; see International patent applications WO 96/06166 and WO 96/32475, corresponding to USSN 08/422,107, incorporated herein by reference.
- a preferred zinc finger framework has the structure:
- zinc finger nucleic acid binding motifs may be represented as motifs having the following primary structure:
- X (including X a , X and X c ) is any amino acid.
- X ⁇ and X 2 . 3 refer to the presence of 2 or 4, or 2 or 3, amino acids, respectively.
- the Cys and His residues, which together co-ordinate the zinc metal atom, are marked in bold text and are usually invariant, as is the Leu residue at position +4 in the ⁇ -helix.
- the linker may comprise a canonical, structured or flexible linker.
- Modifications to this representation may occur or be effected without necessarily abolishing zinc finger function, by insertion, mutation or deletion of amino acids.
- the second His residue may be replaced by Cys (Krizek et al, (1991) J. Am. Chem. Soc.113:4518-4523) and that Leu at +4 can in some circumstances be replaced with Arg.
- the Phe residue before X c may be replaced by any aromatic other than Trp.
- experiments have shown that departure from the preferred structure and residue assignments for the zinc finger are tolerated and may even prove beneficial in binding to certain nucleic acid sequences.
- structures (A) and (B) above are taken as an exemplary structure representing all zinc fmger structures of the Cys2-His2 type.
- X a is F / ⁇ -X or P- F / ⁇ -X.
- X is any amino acid.
- X is E, K, T or S. Less preferred but also envisaged are Q, V, A and P. The remaining amino acids remain possible.
- X 2 . 4 consists of two amino acids rather than four.
- the first of these amino acids may be any amino acid, but S, E, K, T, P and R are preferred.
- P or R is preferred.
- the second of these amino acids is preferably E, although any amino acid may be used.
- X b is T or I.
- X c is S or T.
- X 2 . 3 is G-K-A, G-K-C, G-K-S or G-K-G.
- X 2 . 3 is G-K-A, G-K-C, G-K-S or G-K-G.
- departures from the preferred residues are possible, for example in the form of M-R-N or M-R.
- amino acids -1, +3 and +6 amino acids +4 and +7 are largely invariant.
- the remaining amino acids may be essentially any amino acids.
- position +9 is occupied by Arg or Lys.
- positions +1, 4-5 and +8 are not hydrophobic amino acids, that is to say are not Phe, Tip or Tyr.
- position ++2 is any amino acid, and preferably serine, save where its nature is dictated by its role as a ++2 amino acid for an N-terminal zinc finger in the same nucleic acid binding molecule.
- the code provided by the present invention is not entirely rigid; certain choices are provided. For example, positions +1, +5 and +8 may have any amino acid allocation, whilst other positions may have certain options: for example, the present rules provide that, for binding to a central T residue, any one of Ala, Ser or Val may be used at +3. In its broadest sense, therefore, the present invention provides a very large number of proteins which are capable of binding to every defined target DNA triplet.
- the number of possibilities may be significantly reduced.
- the non-critical residues +1, +5 and +8 may be occupied by the residues Lys, Thr and Gin respectively as a default option.
- the first-given option may be employed as a default.
- Zinc fingers may be based on naturally occurring zinc fingers and consensus zinc fingers.
- naturally occurring zinc fingers may be selected from those fingers for which the DNA binding specificity is known.
- these may be the fingers for which a crystal structure has been resolved: namely Zif 268 (Elrod-Erickson et al, (1996) Structure 4:1171-1180), GLI (Pavletich and Pabo, (1993) Science 261:1701-1707), Tramtrack (Fairall et al, (1993) Nature 366:483-487) and YYl (Houbaviy et al, (1996) PNAS (USA) 93: 13577-13582).
- the modified nucleic acid binding polypeptide is derived from Zif 268, GAC, or a Zif- GAC fusion comprising three fingers from Zif linked to three fingers from GAC.
- GAC-clone we mean a three-finger variant of ZIF268 which is capable of binding the sequence GCGGACGCG, as described in Choo & Klug (1994), Proc. Natl. Acad. Sci USA, 91, 11163-11167.
- the naturally occurring zinc finger 2 in Zif 268 makes an excellent starting point from which to engineer a zinc finger and is preferred.
- Consensus zinc finger structures may be prepared by comparing the sequences of known zinc fingers, irrespective of whether their binding domain is known.
- the consensus structure is selected from the group consisting of the consensus structure PYKCPECGKSFSQKSDLVKHQRTHT,andthe consensus structure PYKCSECGKAFSQKSNLTRHQRIHT.
- the consensuses are derived from the consensus provided by Krizek et al, (1991) J. Am. Chem. Soc. 113: 4518-4523 and from Jacobs, (1993) PhD thesis, University of Cambridge, UK. In both cases, canonical, structured or flexible linker sequences, as described below, may be formed on the ends of the consensus for joining two zinc finger domains together.
- the mutation of the finger in order to modify its specificity to bind to the target DNA may be directed to residues known to affect binding to bases at which the natural and desired targets differ. Otherwise, mutation of the model fingers should be concentrated upon residues -1, +3, +6 and ++2 as provided for in the foregoing rules.
- the rules provided by the present invention may be supplemented by physical or virtual modelling of the protein/DNA interface in order to assist in residue selection.
- the invention provides a method for producing a zinc finger polypeptide capable of binding to a target DNA sequence comprising a receptor nucleotide sequence, the method comprising: a) providing a nucleic acid library encoding a repertoire of zinc finger domains or modules, the nucleic acid members of the library being at least partially randomised at one or more of the positions encoding residues -1, 2, 3 and 6 of the ⁇ -helix of the zinc finger modules; b) displaying the library in a selection system and screening it against the target DNA sequence; and c) isolating the nucleic acid members of the library encoding zinc finger modules or domains capable of binding to the target sequence.
- Randomisation may be total, or partial; in the case of partial randomisation, the selected codons preferably encode options for amino acids as set forth in the rules above.
- Zinc finger polypeptides may be designed which specifically bind to nucleic acids incorporating the base U, in preference to the equivalent base T.
- the invention comprises a method for producing a zinc finger polypeptide capable of binding to a target DNA sequence comprising a receptor nucleotide sequence, the method comprising: a) providing a nucleic acid library encoding a repertoire of zinc finger polypeptides each possessing more than one zinc finger, the nucleic acid members of the library being at least partially randomised at one or more of the positions encoding residues -1, 2, 3 and 6 of the ⁇ -helix in a first zinc finger and at one or more of the positions encoding residues -1, 2, 3 and 6 of the ⁇ -helix in a further zinc finger of the zinc finger polypeptides; b) displaying the library in a selection system and screening it against the target DNA sequence; and d) isolating the nucleic acid members of the library encoding zinc finger polypeptides capable of binding to the target sequence.
- WO 98/53057 describes the production of zinc fmger polypeptide libraries in which each individual zinc finger polypeptide comprises more than one, for example two or three, zinc fingers; and wherein within each polypeptide partial randomisation occurs in at least two zinc fingers.
- This allows for the selection of the "overlap" specificity, wherein, within each triplet, the choice of residue for binding to the third nucleotide (read 3' to 5 ' on the + strand) is influenced by the residue present at position +2 on the subsequent zinc finger, which displays cross- strand specificity in binding.
- the selection of zinc finger polypeptides incorporating cross-strand specificity of adjacent zinc fingers enables the selection of nucleic acid binding proteins more quickly, and/or with a higher degree of specificity than is otherwise possible.
- rules allow the engineering of a zinc finger capable of binding to a given nucleotide sequence.
- Engineering of zinc fingers which involves applying rules which specify the choice of amino acid residues based on the identity of residues in a target nucleic acid sequence is referred to here as "rule based” or “rational” design.
- rules based or “rational” design.
- rational design provides a great deal of versatility in zinc finger design, and may be used instead of, or to complement zinc finger production by selection from libraries.
- Zinc finger binding motifs designed according to the invention may be combined into nucleic acid binding polypeptide molecules having a multiplicity of zinc fingers.
- the proteins Preferably, the proteins have at least two zinc fingers. The presence of at least three zinc fingers is preferred.
- Nucleic acid binding proteins may be constructed by joining the required fingers end to end, N-terminus to C-terminus, with canonical, flexible or structured linkers, as described below. Preferably, this is effected by joining together the relevant nucleic acid sequences which encode the zinc fingers to produce a composite nucleic acid coding sequence encoding the entire binding protein.
- the invention therefore provides a method for producing a DNA binding protein as defined above, wherein the DNA binding protein is constructed by recombinant DNA technology, the method comprising the steps of: preparing a nucleic acid coding sequence encoding a plurality of zinc fmger domains or modules defined above, inserting the nucleic acid sequence into a suitable expression vector; and expressing the nucleic acid sequence in a host organism in order to obtain the DNA binding protein.
- a "leader" peptide may be added to the N-terminal finger.
- the leader peptide is MAEEKP.
- the nucleic acid binding polypeptides according to the invention may comprise one or more linker sequences.
- the linker sequences may comprise one or more flexible linkers, one or more structured linkers, or any combination of flexible and structured linkers.
- Such linkers are disclosed in our co-pending British Patent Application Numbers 0001582.6, 0013102.9, 0013103.7, 0013104.5 and International Patent Application Number PCT/GB01/00202 (WOO 1/53480), which are incorporated by reference.
- linker sequence we mean an amino acid sequence that links together two nucleic acid binding modules.
- the linker sequence is the amino acid sequence lacking secondary structure which lies between the last residue of the ⁇ -helix in a zinc finger and the first residue of the ⁇ - sheet in the next zinc finger.
- the linker sequence therefore joins together two zinc fingers.
- the last amino acid in a zinc finger is a threonine residue, which caps the ⁇ -helix of the zinc finger, while a tyrosine/phenylalanine or another hydrophobic residue is the first amino acid of the following zinc finger.
- glycine is the first residue in the linker
- proline is the last residue of the linker.
- the linker sequence is G(E/Q)(K/R)P.
- a “flexible” linker is an amino acid sequence which does not have a fixed structure (secondary or tertiary structure) in solution. Such a flexible linker is therefore free to adopt a variety of conformations.
- An example of a flexible linker is the canonical linker sequence GERP/GEKP/GQRP/GQKP.
- Flexible linkers are also disclosed in WO99/45132 (Kim and Pabo).
- structured linker we mean an amino acid sequence which adopts a relatively well-defined conformation when in solution. Structured linkers are therefore those which have a particular secondary and/or tertiary structure in solution.
- Determination of whether a particular sequence adopts a structure may be done in various ways, for example, by sequence analysis to identify residues likely to participate in protein folding, by comparison to amino acid sequences which are known to adopt certain conformations (e.g., known alpha-helix, beta-sheet or zinc finger sequences), by NMR spectroscopy, by X-ray diffraction of crystallised peptide containing the sequence, etc as known in the art.
- the structured linkers of our invention preferably do not bind nucleic acid, but where they do, then such binding is not sequence specific. Binding specificity may be assayed for example by gel-shift as described below.
- the linker may comprise any amino acid sequence that does not substantially hinder interaction of the nucleic acid binding modules with their respective target subsites. Preferred amino acid residues for flexible linker sequences include, but are not limited to, glycine, alanine, serine, threonine proline, lysine, arginine, glutamine and glutamic acid..
- the linker sequences between the nucleic acid binding domains preferably comprise five or more amino acid residues.
- the flexible linker sequences according to our invention consist of 5 or more residues, preferably, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 or more residues. In a highly preferred embodiment of the invention, the flexible linker sequences consist of 5, 7 or 10 residues.
- the sequence of the linker may be selected, for example by phage display technology (see for example United States Patent No. 5,260,203) or using naturally occurring or synthetic linker sequences as a scaffold (for example, GQKP and GEKP, see Liu et al., 1997, Proc. Natl. Acad. Sci. USA 94, 5525-5530 and Whitlow et al., 1991, Methods: A Companion to Methods in Enzymology 2: 97-105).
- the linker sequence may be provided by insertion of one or more amino acid residues into an existing linker sequence of the nucleic acid binding polypeptide.
- the inserted residues may include glycine and/or serine residues.
- the existing linker sequence is a canonical linker sequence selected from GEKP, GERP, GQKP and GQRP. More preferably, each of the linker sequences comprises a sequence selected from GGEKP, GGQKP, GGSGEKP, GGSGQKP, GGSGGSGEKP, and GGSGGSGQKP.
- Structured linker sequences are typically of a size sufficient to confer secondary or tertiary structure to the linker; such linkers may be up to 30, 40 or 50 amino acids long.
- the structured linkers are derived from known zinc fingers which do not bind nucleic acid, or are not capable of binding nucleic acid specifically.
- An example of a structured linker of the first type is TFIIIA finger IN; the crystal structure of TFIIIA has been solved, and this shows that finger IV does not contact the nucleic acid ( ⁇ olte et al, 1998, Proc. Natl. Acad. Sci. USA 95, 2938-2943.).
- An example of the latter type of structured linker is a zinc finger which has been mutagenised at one or more of its base contacting residues to abolish its specific nucleic acid binding capability.
- a ZIF fmger 2 which has residues -1, 2, 3 and 6 of the recognition helix mutated to serines so that it no longer specifically binds DNA may be used as a structured linker to link two nucleic acid binding domains.
- the linkers are made using recombinant nucleic acids encoding the linker and the nucleic acid binding modules, which are fused via the linker amino acid sequence.
- the linkers may also be made using peptide synthesis and then linked to the nucleic acid binding modules. Methods of manipulating nucleic acids and peptide synthesis methods are known in the art (see, for example, Maniatis, et al., 1991. Molecular Cloning: A Laboratory Manual Cold Spring Harbor, New York, Cold Spring Harbor Laboratory Press).
- the nucleic acid binding polypeptides according to our invention maybe linked to one or more transcriptional effector domains, such as an activation domain or a repressor domain.
- transcriptional activation domains include the VP16 and VP64 transactivation domains of Herpes Simplex Virus.
- Alternative transactivation domains are various and include the maize Cl transactivation domain sequence (Sainz et al, 1997, Mol. Cell. Biol. 17: 115-22) and PI (Goff et al, 1992, Genes Dev. 6: 864-75; Estruch et al, 1994, Nucleic Acids Res.
- a repressor of gene expression can be fused to the nucleic acid binding polypeptide and used to down regulate the expression of a gene contiguous or incorporating the nucleic acid binding polypeptide target sequence.
- repressors are known in the art and include, for example, the KRAB-A domain (Moosmann et al, Biol. Chem. 378: 669-677 (1997)) the engrailed domain (Han et al., Embo J. 12: 2723-2733 (1993)) and the snag domain (Grimes et al, Mol Cell. Biol. 16: 6263-6272 (1996)). These can be used alone or in combination to down-regulate gene expression.
- zinc finger proteins may be fused to transcriptional repression domains such as the Kruppel-associated box (KRAB) domain to form powerful repressors. These fusions are known to repress expression of a reporter gene even when bound to sites a few kilobase pairs upstream from the promoter of the gene (Margolin et al., 1994, PNAS USA 91, 4509-4513).
- KRAB Kruppel-associated box
- the nucleic acid binding polypeptides comprise a plurality of binding domains or motifs.
- a preferred zinc finger polypeptide according the invention comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, etc or more zinc finger binding domains or motifs.
- Highly preferred embodiments are zinc finger polypeptides which comprise three zinc finger motifs and those which comprise six fmger motifs.
- Zinc fmger polypeptides comprising multiple fingers may be constructed by joining together two or more zinc finger polypeptides (which may themselves be selected using phage display, as described elsewhere in this document) with suitable linker sequences.
- Means of joining polypeptide sequences, for example, by recombinant DNA technology are known in the art, and are for example disclosed in Sambrook et al (supra) and Ausubel et al (supra).
- other sequences such as nuclear localisation sequences and "tag" sequences for purification may be included as known in the art.
- a specific example of production of a six finger protein 6F6 is described in the Examples below.
- vector refers to discrete elements that are used to introduce heterologous nucleic acid into cells for either expression or replication thereof. Selection and use of such vehicles are well within the skill of the person of ordinary skill in the art. Many vectors are available, and selection of appropriate vector will depend on the intended use of the vector, i.e. whether it is to be used for DNA amplification or for nucleic acid expression, the size of the DNA to be inserted into the vector, and the host cell to be transformed with the vector. Each vector contains various components depending on its function (amplification of DNA or expression of DNA) and the host cell for which it is compatible.
- the vector components generally include, but are not limited to, one or more of the following: an origin of replication, one or more marker genes, an enhancer element, a promoter, a transcription termination sequence and a signal sequence.
- Both expression and cloning vectors generally contain nucleic acid sequence that enable the vector to replicate in one or more selected host cells.
- this sequence is one that enables the vector to replicate independently of the host chromosomal DNA, and includes origins of replication or autonomously replicating sequences.
- origins of replication or autonomously replicating sequences are well known for a variety of bacteria, yeast and viruses.
- the origin of replication from the plasmid pBR322 is suitable for most Gram-negative bacteria, the 2 ⁇ plasmid origin is suitable for yeast, and various viral origins (e.g. SV 40, polyoma, adenovirus) are useful for cloning vectors in mammalian cells.
- the origin of replication component is not needed for mammalian expression vectors unless these are used in mammalian cells competent for high level DNA replication, such as COS cells.
- Most expression vectors are shuttle vectors, i.e. they are capable of replication in at least one class of organisms but can be transfected into another class of organisms for expression.
- a vector is cloned in E. coli and then the same vector is transfected into yeast or mammalian cells even though it is not capable of replicating independently of the host cell chromosome.
- DNA may also be replicated by insertion into the host genome.
- the recovery of genomic DNA encoding the nucleic acid binding protein is more complex than that of exogenously replicated vector because restriction enzyme digestion is required to excise nucleic acid binding protein DNA.
- DNA can be amplified by PCR and be directly transfected into the host cells without any replication component.
- an expression and cloning vector may contain a selection gene also referred to as selectable marker.
- This gene encodes a protein necessary for the survival or growth of transformed host cells grown in a selective culture medium. Host cells not transformed with the vector containing the selection gene will not survive in the culture medium.
- Typical selection genes encode proteins that confer resistance to antibiotics and other toxins, e.g. ampicillin, neomycin, methotrexate or tetracycline, complement auxotrophic deficiencies, or supply critical nutrients not available from complex media.
- any marker gene can be used which facilitates the selection for transformants due to the phenotypic expression of the marker gene.
- Suitable markers for yeast are, for example, those conferring resistance to antibiotics G418, hygromycin or bleomycin, or provide for prototrophy in an auxotrophic yeast mutant, for example the URA3, LEU2, LYS2, TRP1, or HIS3 gene. Since the replication of vectors is conveniently done in E. coli, an E. coli genetic marker and anE. coli origin of replication are advantageously included. These can be obtained from E. coli plasmids, such as pBR322, Bluescript ⁇ vector or a pUC plasmid, e.g. pUC18 or pUC19, which contain both E. coli replication origin and E. coli genetic marker conferring resistance to antibiotics, such as ampicillin.
- Suitable selectable markers for mammalian cells are those that enable the identification of cells competent to take up nucleic acid binding protein nucleic acid, such as dihydrofolate reductase (DHFR, methotrexate resistance), thymidine kinase, or genes conferring resistance to G418 or hygromycin.
- DHFR dihydrofolate reductase
- thymidine kinase or genes conferring resistance to G418 or hygromycin.
- the mammalian cell transformants are placed under selection pressure which only those transformants which have taken up and are expressing the marker are uniquely adapted to survive.
- selection pressure can be imposed by culturing the transformants under conditions in which the pressure is progressively increased, thereby leading to amplification (at its chromosomal integration site) of both the selection gene and the linked DNA that encodes the nucleic acid binding protein.
- Amplification is the process by which genes in greater demand for the production of a protein critical for growth, together with closely associated genes which may encode a desired protein, are reiterated in tandem within the chromosomes of recombinant cells. Increased quantities of desired protein are usually synthesised from thus amplified DNA.
- Expression and cloning vectors usually contain a promoter that is recognised by the host organism and is operably linked to nucleic acid binding protein encoding nucleic acid. Such a promoter may be inducible or constitutive.
- the promoters are operably linked to DNA encoding the nucleic acid binding protein by removing the promoter from the source DNA by restriction enzyme digestion and inserting the isolated promoter sequence into the vector. Both the native nucleic acid binding protein promoter sequence and many heterologous promoters may be used to direct amplification and/or expression of nucleic acid binding protein encoding DNA.
- Promoters suitable for use with prokaryotic hosts include, for example, the ⁇ - lactamase and lactose promoter systems, alkaline phosphatase, the tryptophan (Tip) promoter system and hybrid promoters such as the tac promoter.
- Their nucleotide sequences have been published, thereby enabling the skilled worker operably to ligate them to DNA encoding nucleic acid binding protein, using linkers or adapters to supply any required restriction sites.
- Promoters for use in bacterial systems will also generally contain a Shine-Delgarno sequence operably linked to the DNA encoding the nucleic acid binding protein.
- Preferred expression vectors are bacterial expression vectors which comprise a promoter of a bacteriophage such as phagex or T7 which is capable of functioning in the bacteria.
- the nucleic acid encoding the fusion protein may be transcribed from the vector by T7 RNA polymerase (Studier et al, Methods in Enzymol. 185; 60-89, 1990).
- T7 RNA polymerase In the E. coli BL21(DE3) host strain, used in conjunction with pET vectors, the T7 RNA polymerase is produced from the ⁇ -lysogen DE3 in the host bacterium, and its expression is under the control of the IPTG inducible lac UV5 promoter. This system has been employed successfully for over-production of many proteins.
- the polymerase gene may be introduced on a lambda phage by infection with an int- phage such as the CE6 phage which is commercially available (Novagen, Madison, USA), other vectors include vectors containing the lambda PL promoter such as PLEX (Invitrogen, NL) , vectors containing the trc promoters such as pTrcHisXpressTm (Invitrogen) or pTrc99 (Pharmacia Biotech, SE) or vectors containing the tac promoter such as pKK223-3 (Pharmacia Biotech) or PMAL (New England Biolabs, MA, USA).
- PLEX Invitrogen, NL
- vectors containing the trc promoters such as pTrcHisXpressTm (Invitrogen) or pTrc99 (Pharmacia Biotech, SE)
- vectors containing the tac promoter such as pKK223-3 (Pharmacia Bio
- the nucleic acid binding protein gene according to the invention preferably includes a secretion sequence in order to facilitate secretion of the polypeptide from bacterial hosts, such that it will be produced as a soluble native peptide rather than in an inclusion body.
- the peptide may be recovered from the bacterial periplasmic space, or the culture medium, as appropriate.
- a "leader" peptide may be added to the N-terminal finger.
- the leader peptide is MAEEKP.
- Suitable promoting sequences for use with yeast hosts may be regulated or constitutive and are preferably derived from a highly expressed yeast gene, especially a Saccharomyces cerevisiae gene.
- the promoter of the TRP1 gene, the ADHI or ADHII gene, the acid phosphatase (PH05) gene, a promoter of the yeast mating pheromone genes coding for the a- or ⁇ -factor or a promoter derived from a gene encoding a glycolytic enzyme such as the promoter of the enolase, glyceraldehyde-3- phosphate dehydrogenase (GAP), 3-phospho glycerate kinase (PGK), hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase, 3- phosphoglycerate mutase, pyruvate kinase, triose phosphate isomerase, phosphoglucose isomerase or glucokinase genes, or a promoter from the TATA binding protein (TBP) gene can be used.
- hybrid promoters comprising upstream activation sequences (UAS) of one yeast gene and downstream promoter elements including a functional TATA box of another yeast gene
- a hybrid promoter including the UAS(s) of the yeast PH05 gene and downstream promoter elements including a functional TATA box of the yeast GAP gene PH05-GAP hybrid promoter
- a suitable constitutive PHO5 promoter is e.g. a shortened acid phosphatase PH05 promoter devoid of the upstream regulatory elements (UAS) such as the PH05 (-173) promoter element starting at nucleotide -173 and ending at nucleotide -9 of the PH05 gene.
- Nucleic acid binding protein gene transcription from vectors in mammalian hosts may be controlled by promoters derived from the genomes of viruses such as polyoma virus, adenovirus, fowlpox virus, bovine papiUoma virus, avian sarcoma virus, cytomegalovirus (CMV), a retrovirus and Simian Virus 40 (SV40), from heterologous mammalian promoters such as the actin promoter or a very strong promoter, e.g. a ribosomal protein promoter, and from the promoter normally associated with nucleic acid binding protein sequence, provided such promoters are compatible with the host cell systems.
- viruses such as polyoma virus, adenovirus, fowlpox virus, bovine papiUoma virus, avian sarcoma virus, cytomegalovirus (CMV), a retrovirus and Simian Virus 40 (SV40), from heterologous mammalian promoters such
- Enhancers are relatively orientation and position independent. Many enhancer sequences are known from mammalian genes (e.g. elastase and globin). However, typically one will employ an enhancer from a eukaryotic cell virus. Examples include the SV40 enhancer on the late side of the replication origin (bp 100-270) and the CMV early promoter enhancer. The enhancer may be spliced into the vector at a position 5' or 3' to nucleic acid binding protein DNA, but is preferably located at a site 5' from the promoter.
- a eukaryotic expression vector encoding a nucleic acid binding protein according to the invention may comprise a locus control region (LCR).
- LCRs are capable of directing high-level integration site independent expression of transgenes integrated into host cell chromatin, which is of importance especially where the nucleic acid binding protein gene is to be expressed in the context of a permanently-transfected eukaryotic cell line in which chromosomal integration of the vector has occurred, or in transgenic animals.
- Eukaryotic vectors may also contain sequences necessary for the termination of transcription and for stabilising the mRNA. Such sequences are commonly available from the 5' and 3' untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA encoding nucleic acid binding protein.
- An expression vector includes any vector capable of expressing nucleic acid binding protein nucleic acids that are operatively linked with regulatory sequences, such as promoter regions, that are capable of expression of such DNAs.
- an expression vector refers to a recombinant DNA or RNA construct, such as a plasmid, a phage, recombinant virus or other vector, that upon introduction into an appropriate host cell, results in expression of the cloned DNA.
- Appropriate expression vectors are well known to those with ordinary skill in the art and include those that are replicable in eukaryotic and or prokaryotic cells and those that remain episomal or those which integrate into the host cell genome.
- DNAs encoding nucleic acid binding protein may be inserted into a vector suitable for expression of cDNAs in mammalian cells, e.g. a CMV enhancer-based vector such as pEVRF (Matthias, et al., (1989) NAR 17, 6418).
- a CMV enhancer-based vector such as pEVRF (Matthias, et al., (1989) NAR 17, 6418).
- transient expression usually involves the use of an expression vector that is able to replicate efficiently in a host cell, such that the host cell accumulates many copies of the expression vector, and, in turn, synthesises high levels of nucleic acid binding protein.
- transient expression systems are useful e.g. for identifying nucleic acid binding protein mutants, to identify potential phosphorylation sites, or to characterise functional domains of the protein.
- Plasmids employs conventional ligation techniques. Isolated plasmids or DNA fragments are cleaved, tailored, and religated in the form desired to generate the plasmids required. If desired, analysis to confirm correct sequences in the constructed plasmids is performed in a known fashion. Suitable methods for constructing expression vectors, preparing in vitro transcripts, introducing DNA into host cells, and performing analyses for assessing nucleic acid binding protein expression and function are known to those skilled in the art.
- Gene presence, amplification and or expression may be measured in a sample directly, for example, by conventional Southern blotting, Northern blotting to quantitate the transcription of mRNA, dot blotting (DNA or RNA analysis), or in situ hybridisation, using an appropriately labelled probe which may be based on a sequence provided herein. Those skilled in the art will readily envisage how these methods may be modified, if desired.
- cells containing the above-described nucleic acids are provided.
- host cells such as prokaryote, yeast and higher eukaryote cells may be used for replicating DNA and producing the nucleic acid binding protein.
- Suitable prokaryotes include eubacteria, such as Gram-negative or Gram-positive organisms, such as E. coli, e.g. E. coli K-12 strains, DH5a and HB101, or Bacilli.
- Further hosts suitable for the nucleic acid binding protein encoding vectors include eukaryotic microbes such as filamentous fungi or yeast, e.g. Saccharomyces cerevisiae.
- Higher eukaryotic cells include insect and vertebrate cells, particularly mammalian cells including human cells or nucleated cells from other multicellular organisms.
- mammalian host cell lines are epithelial or f ⁇ broblastic cell lines such as Chinese hamster ovary (CHO) cells, NIH 3T3 cells, HeLa cells or 293T cells.
- the host cells referred to in this disclosure comprise cells in in vitro culture as well as cells that are within a host animal.
- DNA may be stably incorporated into cells or may be transiently expressed using methods known in the art.
- Stably transfected mammalian cells may be prepared by transfecting cells with an expression vector having a selectable marker gene, and growing the transfected cells under conditions selective for cells expressing the marker gene. To prepare transient transfectants, mammalian cells are transfected with a reporter gene to monitor transfection efficiency.
- the cells should be transfected with a sufficient amount of the nucleic acid binding protein-encoding nucleic acid to form the nucleic acid binding protein.
- the precise amounts of DNA encoding the nucleic acid binding protein may be empirically determined and optimised for a particular cell and assay.
- Host cells are transfected or, preferably, transformed with the above-captioned expression or cloning vectors of this invention and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
- Heterologous DNA may be introduced into host cells by any method known in the art, such as transfection with a vector encoding a heterologous DNA by the calcium phosphate coprecipitation technique or by electroporation. Numerous methods of transfection are known to the skilled worker in the field. Successful transfection is generally recognised when any indication of the operation of this vector occurs in the host cell. Transformation is achieved using standard techniques appropriate to the particular host cells used.
- Transfected or transformed cells are cultured using media and culturing methods known in the art, preferably under conditions, whereby the nucleic acid binding protein encoded by the DNA is expressed.
- media and culturing methods known in the art, preferably under conditions, whereby the nucleic acid binding protein encoded by the DNA is expressed.
- suitable media is known to those in the art, so that they can be readily prepared.
- Suitable culturing media are also commercially available.
- Nucleic acid binding molecules according to the invention may be employed in a wide variety of applications, including diagnostics and as research tools.
- they may be employed as diagnostic tools for identifying the presence of nucleic acid molecules in a complex mixture.
- Preferred molecules according to the invention have gene-specific DNA binding activity. These may be constructed by the engineering of DNA-binding polypeptide domains with given DNA sequence-specificity, to target the appropriate gene(s).
- Described herein is a rapid and convenient method that can be used to design zinc finger proteins against an unlimited set of DNA binding sites. This is based on a pair of pre-made zinc fmger phage display libraries, which are used in parallel to select two DNA-binding domains that each recognise given 5 bp sequences, and whose products are recombined to produce a single protein that recognises a composite (10 bp) site of predefined sequence. Engineering using this system can be completed in less than two weeks and yields polypeptide molecules that bind sequence-specifically to DNA with K d S in the nanomolar range. Library selection is therefore suitable for production of zinc fingers capable of binding to sequences comprising receptor nucleotide sequences.
- Our methods enable the production of polypeptides capable of binding to any receptor nucleotide sequence, by identification of a motif or sequence within that sequence, and selection of one or more zinc fingers (or other nucleic acid binding polypeptides) which bind to that sequence or motif.
- the term 'region' may mean part, segment, locus, area, fragment, motif, domain, section, site or similar part of said promoter, and may even include the promoter in its entirety.
- the phrase 'region of the/a ... promoter' includes segment(s), fragments etc. of the promoter, and may include the whole promoter, or motifs therein such as transcription factor binding site(s), or other such parts thereof.
- a zinc finger engineering strategy which (i) yields zinc finger polymers that bind DNA specifically, with good affinity, and without significant sequence restrictions on the generation of such polymer molecules, (ii) can be executed relatively rapidly, and (iii) can be easily adapted to a high-throughput automated format.
- This strategy is based on recent advances in our understanding of zinc finger function, particularly the phenomenon of synergistic DNA recognition by adjacent zinc fingers (11, 18), in combination with certain technical advances in zinc fmger library design as discussed herein.
- the invention thus relates to the construction of a zinc finger library according to the new strategy disclosed herein.
- the recombinant proteins of the present invention to feature idiosyncratic combinations of amino acids that would not necessarily have been predicted by a recognition code. This is particularly true of the combinations of amino acids that are responsible for the inter-finger synergy that allows any base-pair to be specified at the interface of zinc finger DNA subsites (11).
- Zinc finger domains may be made by methods described and/or referred to herein.
- said zinc finger DNA binding domains may be made as discussed in the examples, or as described in one or more of WO96/06166, WO98/53058, WO98/53057, or WO/98/53060.
- the nucleic acid binding polypeptides including zinc finger polypeptides, capable of binding and preferably downregulating nucleic acid sequences comprising receptor nucleotide sequences, may be selected from a library.
- library is used according to its common usage in the art, to denote a collection of polypeptides or, preferably, nucleic acids encoding polypeptides.
- the polypeptides of the invention contain regions of randomisation, such that each library will comprise or encode a repertoire of polypeptides, wherein individual polypeptides differ in sequence from each other.
- the same principle is present in virtually all libraries developed for selection, such as by phage display.
- Randomisation refers to the variation of the sequence of the polypeptides which comprise the library, such that various amino acids may be present at any given position in different polypeptides. Randomisation may be complete, such that any amino acid may be present at a given position, or partial, such that only certain amino acids are present. Preferably, the randomisation is achieved by mutagenesis at the nucleic acid level, for example by synthesising novel genes encoding mutant proteins and expressing these to obtain a variety of different proteins. Alternatively, existing genes can be themselves mutated, such by site-directed or random mutagenesis, in order to obtain the desired mutant genes. THE 'BIPARTITE' LIBRARY STRATEGY
- Nucleic acids encoding nucleic acid binding polypeptides according to the invention may be selected using a 'bipartite-complementary' system for the construction of DNA-binding domains by phage display.
- This system comprises two master libraries, Libl2 and Lib23, each of which encodes variants of a three-finger DNA-binding domain based on that of the transcription factor Zif268 (6, 19).
- the two libraries are complementary because Lib 12 contains randomisations in all the base- contacting positions of FI and certain base-contacting positions of F2, while Lib23 contains randomisations in the remaining base-contacting positions of F2 and all the base-contacting positions of F3.
- the non-randomised DNA-contacting residues carry the nucleotide specificity of the parental Zif268 DNA-binding domain.
- each library contains members that are randomised in the ⁇ -helical DNA-contacting residues from more than one zinc finger.
- the proteins produced by these libraries are therefore not limited to binding DNA sequences of the form GNNGNN..., as is the case with many prior art libraries (eg. 9, 13, 20).
- the repertoire of randomisations does not encode all 20 amino acids, rather representing only those residues that most frequently function in sequence-specific DNA binding from the respective ⁇ -helical positions. Excluding the residues that do not frequently function in DNA recognition advantageously helps to reduce the library size and/or the 'noise' associated with non-specific binding members of the library.
- the bipartite selection strategy allows the recombination in vitro of the complementary portions of the two libraries, without the need for further purification steps.
- the two complementary libraries may therefore be designed with unique sequences at their 5' and 3' termini, and the corresponding primers used to amplify any recombinants of the two libraries. Furthermore, the selection procedure is amenable to a microtitre plate format so that selections and most subsequent manipulations may be automated (e.g., be carried out using liquid handling robots).
- Microtitre plates such as 96 or 384 well microtitre plates, may be used to carry out phage selections, ELISA reactions and PCR preparation on a liquid-handling robotic platform.
- a robotic arm shuttles the microtitre plates between a pipeting station, a plate hotel, a plate washer, a spectrophotometer, and a PCR block.
- a colony picking robot may be used to inoculate micro-cultures of bacteria in microtitre plates in order to provide monoclonal phage for ELISA.
- a robot may be used that interfaces with the spectrophotometer and which is capable of returning to the liquid culture archive in order to 'cherry-pick' particular clones that are suitable for recombination, or which should be archived.
- a bar-coding system may be used to keep track of the various plates used for phage selections, phage ELISAs or for archiving interesting clones.
- the ability to carry out selective PCR implies that the protocol may even be adapted to selecting complementary library portions in the same tube or well.
- both universal libraries may be co-screened in a single well, thereby increasing the efficiency of high throughput applications.
- the output of such combined selections may be monitored by any means, for example, by selective PCR, or by ELISA of samples of isolated clones, etc. This system is further discussed elsewhere in this application, such as in the Examples section.
- the nucleic acid binding molecules of the invention can be incorporated into an ELISA assay.
- phage displaying the molecules of the invention can be used to detect the presence of the target nucleic acid, and visualised using enzyme-linked anti-phage antibodies.
- the sites at which molecules according to the invention bind the target nucleic acid molecule may be determined by methods known in the art for example using binding assays, footprinting, truncation or mutant analysis.
- the engineering of zinc fmger polypeptides according to the invention preferably utilises a strategy of engineering zinc finger DNA-binding domains by phage display which has distinct advantages over the existing methods (1, 2), resulting in an advance in our ability to select and/or produce DNA-binding proteins.
- Another advantage of the methods described here is the speed with which DNA-binding domains may be produced.
- the main reason for the relatively fast turnover is that our new system takes advantage of pre-made phage display libraries, rather than being based on recurring library construction (2) in order to assemble a zinc finger polymer. This in turn allows for parallel (c.f. serial) selection of zinc fingers from phage display libraries, thus saving time beyond that required simply for cloning.
- the selective PCR protocols allow recombination to be advantageously carried out in vitro using a mixed population of zinc finger phage as starting material, thereby circumventing cumbersome clone isolation, DNA preparation and gel purification procedures. It is envisaged that the methods of the present invention may be useful in high-throughput protein engineering, such as via automation using liquid handling robotic systems.
- Nucleic acid binding molecules according to the invention may comprise tag sequences to facilitate studies and/or preparation of such molecules.
- Tag sequences may include flag-tag, myc-tag, 6his-tag or any other suitable tag known in the art.
- nucleic acid sequences which comprise cis-acting elements.
- cis-acting elements include promoters, enhancers, repressors, transcription factor binding sites, initiators, and other such nucleic acid sequences.
- Molecules according to the invention may advantageously be targetted to bind at and/or adjacent and/or near to such cis-acting elements.
- molecules according to the invention may be targetted to transcription factor binding sites.
- Such molecules may be advantageously targeted to bind at sites comprising all or part of, or adjacent to, transcription factor sites such as SP1 sites, NF-kB sites, or any other transcription factor binding sites.
- such molecules are targetted to SP1 sites.
- the DNA-binding domains described herein are highly effective in repressing gene expression from nucleic acid molecules to which they bind. More preferably, the DNA-binding domains described herein are highly effective in repressing gene expression from the HIV-1 promoter. In a highly preferred embodiment, said repression of gene expression involves the binding of said DNA- binding domains to one or more region(s) of the HIV-1 promoter comprising or adjacent to one or more SP1 transcription factor binding site(s).
- molecules according to the invention be used in combination. Use in combination includes both fusion of molecules into a single polypeptide as well as use of two or more discrete polypeptide molecules in solution.
- the transcription factor binding site may be a binding site for a known transcription factor.
- the transcription factor may be an animal, preferably vertebrate, or plant transcription factor.
- Such transcription factors, and their putative or determined binding sites, including any consensus motifs, are known in the art, and may be found in (for example), the "Transcription Factor Database", at http://www.hsc.virginia.edu/achs/molbio/databases/tfd_dat.html. Reference is also made to Nucleic Acids Res 21, 3117-8 (1993), Gene Transcription: A Practical Approach, 321-45 (1993) and Nucleic Acids Res 24, 238-41 (1996).
- the file “tfsites.dat” may be obtained using the GCG command "FETCH tfsites.dat”. Any of these binding sites may be targeted according the invention.
- Preferred transcription factors include those comprising homeodomains.
- NF-kB GGGAAATTCC
- Spl consensus sequence G/T-GGGCGG-G/A-G/A- C/T
- Oct-1 ATTTGCAT
- p53 myC, myB, API etc.
- the invention provides therapeutic agents and methods of therapy involving use of nucleic acid binding proteins as described herein.
- the invention provides the use of polypeptide fusions comprising an integrase, such as a viral integrase, and a nucleic acid binding protein according to the invention to target nucleic acid sequences in vivo (Bushman, (1994) PNAS (USA) 91 :9233-9237).
- the method may be applied to the delivery of functional genes into defective genes, or the delivery of nonsense nucleic acid in order to disrupt undesired nucleic acid.
- genes may be delivered to known, repetitive stretches of nucleic acid, such as centromeres, together with an activating sequence such as an LCR. This would represent a route to the safe and predictable incorporation of nucleic acid into the genome.
- nucleic acid binding proteins according to the invention may be used to specifically knock out cell having mutant vital proteins. For example, if cells with mutant ras are targeted, they will be destroyed because ras is essential to cellular survival.
- the action of transcription factors may be modulated, preferably reduced, by administering to the cell agents which bind to the binding site specific for the transcription factor. For example, the activity of HIV tat may be reduced by binding proteins specific for HIV TAR.
- binding proteins according to the invention may be coupled to toxic molecules, such as nucleases, which are capable of causing irreversible nucleic acid damage and cell death.
- toxic molecules such as nucleases, which are capable of causing irreversible nucleic acid damage and cell death.
- agents are capable of selectively destroying cells which comprise a mutation in their endogenous nucleic acid.
- Nucleic acid binding proteins and derivatives thereof as set forth above may also be applied to the treatment of infections and the like in the form of organism- specific antibiotic or antiviral drugs.
- the binding proteins may be coupled to a nuclease or other nuclear toxin and targeted specifically to the nucleic acids of microorganisms.
- the invention likewise relates to pharmaceutical preparations which contain the compounds according to the invention or pharmaceutically acceptable salts thereof as active ingredients, and to processes for their preparation.
- compositions according to the invention which contain the compound according to the invention or pharmaceutically acceptable salts thereof are those for enteral, such as oral, furthermore rectal, and parenteral administration to (a) warm-blooded animal(s), the pharmacological active ingredient being present on its own or together with a pharmaceutically acceptable carrier.
- enteral such as oral, furthermore rectal, and parenteral administration to (a) warm-blooded animal(s), the pharmacological active ingredient being present on its own or together with a pharmaceutically acceptable carrier.
- the daily dose of the active ingredient depends on the age and the individual condition and also on tl e manner of administration.
- novel pharmaceutical preparations contain, for example, from about 10 % to about 80%, preferably from about 20 % to about 60 %, of the active ingredient.
- Pharmaceutical preparations according to the invention for enteral or parenteral administration are, for example, those in unit dose forms, such as sugar-coated tablets, tablets, capsules or suppositories, and furthermore ampoules. These are prepared in a manner known per se, for example by means of conventional mixing, granulating, sugar-coating, dissolving or lyophilising processes.
- compositions for oral use can be obtained by combining the active ingredient with solid carriers, if desired granulating a mixture obtained, and processing the mixture or granules, if desired or necessary, after addition of suitable excipients to give tablets or sugar- coated tablet cores.
- Suitable carriers are, in particular, fillers, such as sugars, for example lactose, sucrose, mannitol or sorbitol, cellulose preparations and/or calcium phosphates, for example tricalcium phosphate or calcium hydrogen phosphate, furthermore binders, such as starch paste, using, for example, corn, wheat, rice or potato starch, gelatin, tragacanth, methylcellulose and/or polyvinylpyrrolidone, if desired, disintegrants, such as the abovementioned starches, furthermore carboxymethyl starch, crosslinked polyvinylpyrrolidone, agar, alginic acid or a salt thereof, such as sodium alginate; auxiliaries are primarily glidants, flow-regulators and lubricants, for example silicic acid, talc, stearic acid or salts thereof, such as magnesium or calcium stearate, and/or polyethylene glycol.
- fillers such as sugars, for example lactos
- Sugar-coated tablet cores are provided with suitable coatings which, if desired, are resistant to gastric juice, using, inter alia, concentrated sugar solutions which, if desired, contain gum arabic, talc, polyvinylpyrrolidone, polyethylene glycol and or titanium dioxide, coating solutions in suitable organic solvents or solvent mixtures or, for the preparation of gastric juice-resistant coatings, solutions of suitable cellulose preparations, such as acetylcellulose phthalate or hyc oxypropylmethylcellulose phthalate. Colorants or pigments, for example to identify or to indicate different doses of active ingredient, may be added to the tablets or sugar-coated tablet coatings.
- hard gelatin capsules and also soft closed capsules made of gelatin and a plasticiser, such as glycerol or sorbitol.
- the hard gelatin capsules may contain the active ingredient in the form of granules, for example in a mixture with fillers, such as lactose, binders, such as starches, and/or lubricants, such as talc or magnesium stearate, and, if desired, stabilisers.
- the active ingredient is preferably dissolved or suspended in suitable liquids, such as fatty oils, paraffin oil or liquid polyethylene glycols, it also being possible to add stabilisers.
- Suitable rectally utilisable pharmaceutical preparations are, for example, suppositories, which consist of a combination of the active ingredient with a suppository base.
- Suitable suppository bases are, for example, natural or synthetic triglycerides, paraffin hydrocarbons, polyethylene glycols or higher alkanols.
- gelatin rectal capsules which contain a combination of the active ingredient with a base substance may also be used.
- Suitable base substances are, for example, liquid triglycerides, polyethylene glycols or paraffin hydrocarbons.
- Suitable preparations for parenteral administration are primarily aqueous solutions of an active ingredient in water-soluble form, for example a water-soluble salt, and furthermore suspensions of the active ingredient, such as appropriate oily injection suspensions, using suitable lipophilic solvents or vehicles, such as fatty oils, for example sesame oil, or synthetic fatty acid esters, for example ethyl oleate or triglycerides, or aqueous injection suspensions which contain viscosity-increasing substances, for example sodium carboxymethylcellulose, sorbitol and/or dextran, and, if necessary, also stabilisers.
- suitable lipophilic solvents or vehicles such as fatty oils, for example sesame oil, or synthetic fatty acid esters, for example ethyl oleate or triglycerides
- viscosity-increasing substances for example sodium carboxymethylcellulose, sorbitol and/or dextran, and, if necessary, also stabilisers.
- the dose of the active ingredient depends on the warm-blooded animal species, the age and the individual condition and on the manner of administration. In the normal case, an approximate daily dose of about 10 mg to about 250 mg is to be estimated in the case of oral administration for a patient weighing approximately 75 kg EXAMPLES
- Zinc fingers are engineered to bind to the CXCR4 promoter using the
- the bipartite method is based on a pair of pre-made zinc finger phage display libraries, which are used in parallel to select two DNA-binding domains that each recognise given 5 bp sequences, and whose products are recombined to produce a single protein that recognises a composite (9-10 bp) site of predefined sequence.
- Engineering using this system can be completed in less than two weeks and yields three-zinc finger polypeptide molecules that bind sequence-specifically to DNA with Kds in the nanomolar range. Having thus obtained three-zinc finger molecules, the genes for these peptides are linked together to make functional six-zinc fmger proteins. In the present case, we generate three such six-zinc finger proteins, engineered to bind a promoter sequence of the CXCR4 receptor.
- a similar strategy is used to generate three and six finger proteins engineered to bind a promoter sequence of the TNFRl receptor.
- Zinc finger proteins selected to bind to the CXCR4 or the TNFRl promoter regions are then engineered into repressor polypeptides. These repressors contain the zinc finger DNA binding domain at the N-terminus fused in frame to the translation initiation sequence ATG.
- the 7 amino acid nuclear localisation sequence (NLS) of the wild-type Simian Virus 40 large-T antigen (Kalderon et al., Cell 39:499-509 (1984)) is fused to the C-terminus of the zinc finger sequence and the Kruppel-associated box (KRAB) repressor domain from human KOX1 protein (Margolin et al., PNAS 91:4509-4513 (1994)) is fused downstream of the NLS.
- NLS 7 amino acid nuclear localisation sequence
- KRAB Kruppel-associated box
- the sequence of the SV40-NLS-KOXl-c-myc repressor domain is as follows: AARNSGPKKKRKVDGGGA SPQHSAVTQGSIIKNKEGMDAKS TA SRTLVTF KDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNLVSLGYQLT PDVILRLEKG EEPWLVEREIHQETHPDSETAFEIKSSVEQKLISEEDL
- the KOX1 domain contains amino acids 1-97 from the human KOX1 protein (database accession code P21506) in addition to 23 amino acids which act as a linker.
- a 10 amino acid sequence from the c-myc protein (Evan et al., Mol. Cell. Biol. 5: 3610 (1985)) is introduced downstream of the KOX1 domain as a tag to facilitate expression studies of the fusion protein.
- Zinc fmger constructs are then tested for specific target binding using a fluorescence ELISA, and for repression activity using FACS analysis.
- DNA sequences in the promoter region of the CXCR4 gene showing 9-bp binding sites (underlined), that are used as targets for engineering 3-finger proteins using the 'bipartite' protocol, are shown below.
- the resulting three-zinc finger proteins, that bind the 9-bp sites, are paired to generate the six-zinc finger proteins, CXCR4-5-1, CXCR4-10-1 and CXCR4-10-3, that bind 18-bp sites (underlined).
- Amino acid composition of peptide linkers (A and B), used to link the three- finger units shown above into six-finger constructs. Different lengths of linker are used to span different lengths of gap between the binding sites of the subunits.
- LINKER-B TGGGGSGGSGGSGGSGGSERP P. Sequences of CXCR4 Six Finger Domains
- DNA sequences in the promoter region of the TNFRl gene showing 9-bp binding sites (underlined) , that are used as targets for engineering 3-finger proteins using the 'bipartite' protocol, are shown below.
- the resulting three-zinc finger proteins that bind the 9-bp sites are paired to generate the six-zinc finger proteins, TNFRl-4-2, TNFR1-7-9, TNFRl -7-10 and TNFR1-9-12.
- TNFRl-7-9 and TNFR1-7-10 5 ' TGGAGGAGGAGGCCACAGGAGGCGGGAGGA-3 ' (TNFR1-7-9; TNFR1-7-10)
- TNFR-14-2 recognises underlined sites in GGATTGGTGGG TTGGGGGCACA: TNFR1-7-9 and TNFRl -7-10 recognise underlined sites in
- TNFR1-9-12 (Linker TGGGGSERP between F3 and F4)
- TNFR1-7-10 (Linker TGGGGSGGSERP between F3 and F4)
- Amino acid linkers as shown above are used to link the three-finger units shown above into six-finger constructs. Different lengths of linker are used to span different lengths of gap between the binding sites of the subunits.
- the binding properties of the six-finger proteins are assayed using an in vitro zinc fmger fluorescence ELISA DNA-binding assay to assess whether the proteins bind specifically to their respective target sequences.
- Zinc finger constructs are inserted into the protein expression vector pTracer (Invitrogen), downstream of the T7 RNA transcription promoter.
- pTracer Invitrogen
- Suitable templates for in vitro ELISA are created by PCR using the 5' primer
- DNA binding reactions contained the appropriate zinc finger peptide, biotinylated binding site (10 nM) and 5 ⁇ g competitor DNA (sonicated salmon sperm DNA), in a total volume of 50 ⁇ l, which contained: 1 x PBS (pH 7.0), 1.25 x 10 "3 U high affinity anti-HA-Peroxidase antibody (Boehringer Mannheim), 50 ⁇ M ZnCl 2 , 0.01 mg/ml BSA, and 0.5% Tween 20. Incubations are performed at room temperature for 40 minutes. Black streptavidin-coated wells are blocked with 4% wonder for 1 hour. Binding reactions are added to the streptavidin-coated wells and incubated for a further 40 minutes at room temperature.
- Wells are washed 5 times in 100 ⁇ l wash buffer (1 x PBS (pH 7.0), 50 ⁇ M ZnCl 2 , 0.01 mg/ml BSA, and 0.5% Tween 20), and finally 50 ⁇ l QuantaBlu peroxidase substrate solution (Pierce) is added to detect bound HA-tagged zinc finger peptide.
- ELISA signals are read in a SPECTRAmax GeminiXS spectrophotometer (Molecular Devices) and analysed using SOFTmax Pro 3.1.2 (Molecular Devices).
- Jurkat T cells are grown according to supplier instructions in RPMI 1640 L- glutamine containing medium (Life Technology) supplemented with penicillin/streptomycin and fetal calf serum. 5x10 6 cells in 0.2ml of culture medium are transfected in a 0.4cm gap electroporation cuvette at 0.20 kV and 960 ⁇ F with 20 ⁇ g pTracerTM-CMV/Bsd zinc finger expressing plasmid. An empty pTracerTM- CMV/Bsd vector plasmid is used as control. The electroporated samples are transferred to 27 cm 2 cell culture flask containing 30ml Jurkat T cell growth media and incubated for 24 to 72 hours at 37°C and 5% CO 2 .
- Cells are harvested and pelleted at 1000 rpm for 5 minutes at room temperature. Pellets are resuspended in ice-cold 50 ⁇ l staining buffer (PBS, 0.5% BSA, 0.01% sodium azide) and incubated for 30 minutes on ice with saturating amounts of antibodies.
- PBS 0.5% BSA, 0.01% sodium azide
- cells are stained with bitotinylated mouse- anti-human CXCR4 antibody (clone 44716.111 or clone 44717.111, R&Dsystem, diution 1:10 in staining buffer) which is detected with streptavidin-PE (R&Dsystem, diution 1 :20 in staining buffer).
- TNFRl expression cells are stained with a mouse-anti-human TNFRl antibody (550514, Pharmingen, 1 :25 dilution), which is then bound by a biotinylated anti-mouse IgG, Fab-specific (Sigma), and detected with streptavidin- Cychrome (Pharmingen).
- cells are pelleted at lOOOrpm for 5 minutes and washed twice in 150 ⁇ l ice-cold staining buffer.
- Flow cytometric analysis is performed on a FACSCalibur using the CellQuest software package (Becton Dickinson). About 300,000 events corresponding to 15,000 events gated on GFP positive cells are collected per sample.
- Zinc finger peptides are expressed using the T7 TNT Quick Coupled
- Figure IA shows binding of the six-zinc finger peptide, CXCR4-5-1, to its preferred target site and to 5 control sites containing base mutations (underlined).
- Figure IB shows binding of the six-zinc finger peptide, CXCR4-10-1, to its preferred target site and to a control site containing base mutations (underlined).
- Figure IC shows binding of the six-zinc finger peptide, CXCR4-10-3, to its preferred target site and to a control site containing base mutations (underlined).
- the Jurkat T-cell line is a human derived lymphoblast T cell shown to express high levels of CXCR4 receptor. This line is used to validate the ability of selected zinc finger protein to control the expression of CXCR4 receptor. Using fluorescence activated cell sorting (FACS), the Jurkat T-cell line is used in a transient transfection assay to validate the selected zinc fmger constructs.
- FACS fluorescence activated cell sorting
- the zinc finger constructs containing the repressor domain, generated as described above, are subcloned in the pTracerTM-CMV/Bsd plasmid vector (Invitrogen) for expression in Jurkat T cells. Expression of the zinc finger protein in transfected cells is monitored by the co-expression of the green fluorescent protein (GFP) gene also encode by the pTracerTM-CMV/Bsd plasmid vector. An empy pTracerTM-CMV/Bsd plasmid vector are used as a control.
- Jurkat T cells are transfected by electroporation and after 24 to 72 hours, CXCR4 expression is assay by fluorescence activated cell sorting (FACS) analysis.
- FACS fluorescence activated cell sorting
- CXCR4 at the surface of Jurkat cells is first measured, and the results are as shown in Figure 2 A.
- IO 6 cells are stained with bitotinylated mouse-anti- human CXCR4 antibody which is subsequently detected with streptavidin-PE. Unstained cells are used as control (unfilled). 95% of Jurkat expressed CXCR4 at their surface.
- FIG. 2B shows the results of experiments in which Jurkat T-cells are transfected by electroporation with pTracerTM-CMV/Bsd zinc finger expressing plasmid.
- An empty pTracerTM-CMV/Bsd plasmid is used as control.
- the expression of the zinc finger protein 5-1 is monitored by expression of GFP.
- Expression of CXCR4 is assess by FACS analysis on different population: non-transfected Jurkat cells which represent an internal control (Rl) and sub populations R2, R3 and R4 exhibited 10-, 100- and 1000- fold higher GFP fluorescence intensity relative to background, respectively.
- Figure 2C shows that dowregulation of CXCR4 is also observed with Jurkat cells transfected with zinc finger proteins 10-1 and 10-3, compared to the cell transfected with an empty control vector (unfilled). The percentage of cells expressing CXCR4 is shown.
- the expression of zinc fingers 5-1, 10-1 and 10-3, monitored by the GFP expression, in transfected Jurkat cells results in the specific down-regulation of CXCR4 in comparison to the control.
- the down-regulation of CXCR4 on transduced Jurkat cells by the zinc finger protein 5-1 is also observed at low level of expression, relative to GFP expression which presume to high binding specificity of this zinc finger on its endogenous target sequence. Exposure of such transfected cells to HIV results in lower levels of infection and viral titre than in un-transfected cells.
- Example 8 DNA-Binding by TNFRl Constructs Using an in Vitro Fluorescence ELISA Assay
- Zinc finger peptides are expressed using the T7 TNT Quick Coupled Transcription / Translation System for PCR templates (Promega) and assayed for DNA-binding by fluorescence ELISA, as described above in Examples 4 and 6. Sequences of the DNA target sites used in each binding reaction are shown below Figure 3A.
- Figure 3 A shows binding of the six-zinc finger peptide, TNFRl-4-2, to its preferred target site and to a control site from elsewhere in the TNFRl promoter (9- 12).
- Figure 3B shows binding of the six-zinc finger peptide, TNFR1-7-9, to its preferred target site, an overlapping site (9-12), and to a control site from elsewhere in the TNFRl promoter (4-2).
- Figure 3C shows binding of the six-zinc finger peptide, TNFRl -9- 12, to its preferred target site, an overlapping site (7-9), and to a control site from elsewhere in the TNFRl promoter (4-2).
- the Jurkat T-cell line is used in a transient transfection assay to validate the selected zinc finger constructs.
- Expression of TNFRl at the surface of unmanipulated Jurkat cells is measured by FACS analysis as described in Example 7, and the results are as shown in Figure 4 A and 4B.
- Figure 4 shows the results of experiments in which Jurkat T-cells are transfected by electroporation with pTracerTM-CMV/Bsd zinc finger-expressing plasmids.
- An empty pTracer plasmid is used as a general control, and the CXCR4-5-1 zinc finger expression vector described above is used as a control to demonstrate specificity of the zinc fingers.
- Analysis is performed 40 hours post-electroporation, and GFP expression is used to identify the transfected cells (left column, normally 20- 30% of the population). As seen in Fig.
- the region upstream of the TNFRl gene from -163 to -790 (25) is obtained by standard PCR amplification of normal human genomic DNA obtained from peripheral blood.
- a proof-reading polymerase system is used (High Fidelity, Roche) and the recombinant product is sequenced after cloning into the reporter vector to confirm that the orientation is correct and that the product conformed to published TNFRl sequences.
- the control reporter vector used is pMet-CAT (26), with a basal metallothionein promoter upstream of the CAT (chloramphenicol acetyl transferase) gene. This promoter is removed by HinDIII digestion and replaced with the TNFRl PCR product for the specific reporter.
- Jurkat T cells are used for the reporter gene analysis, using the transfection conditions described above. 15 ⁇ g of the CAT reporter is mixed with 3 ⁇ g of pTracer, or 1 ⁇ g of the zinc finger expression vectors plus 2 ⁇ g of pTracer. Cells are harvested 22 hours after electroporation and CAT activities are measured with a radioactive assay (QuanT-CAT, Amersham). As shown in Figure 5 all four zinc fingers directed at the TNFRl sequence substantially reduced promoter activity, and the level of repressed activity is below that generated from the metallothionein minimal promoter. Inclusion of all four zinc finger vectors did not further repress activity, but this is most likely due to the complete repression by constructs rather than by the lack of additive or cooperative repression by multiple finger zinc finger proteins directed at distinct sites associated with the gene.
- Example 11 Down-Regulation of CXCR4 and TNFR-1 in the same Cell.
- Jurkat T cells are grown according to supplier instructions in RPMI 1640 L-glutamine containing medium (Life Technology) supplemented with penicillin streptomycin and fetal calf serum. 5x10 6 cells in 0.2 ml of culture medium are transfected in a 0.4cm gap electroporation cuvette at 0.20 kV and 960 ⁇ F with a total of 20 ⁇ g plasmid DNA, comprising 15 ⁇ g of a 'carrier' plasmid, such as pBluescript (Stratagene), or equivalent, and 5 ⁇ g of the appropriate test expression vector.
- pTracerTM-CMV/Bsd zinc finger expressing plasmid.
- An empty pTracerTM-CMV/Bsd vector plasmid is used as control.
- the electroporated samples are transferred to 25 cm 2 cell culture flask containing 10 ml Jurkat T cell growth media and incubated for 24 to 72 hours at 37°C and 5% CO 2 .
- Cells are harvested and pelleted at 1000 rpm for 5 minutes at room temperature in a desk-top centrifuge. Pellets are resuspended in ice-cold 50 ⁇ l staining buffer (PBS, 0.5% BSA, 0.01% sodium azide) and incubated for 30 minutes on ice with saturating amounts of antibodies.
- staining buffer PBS, 0.5% BSA, 0.01% sodium azide
- TNFR-1 TNFR-1 expression
- cells are stained with a mouse-anti-human TNFRl antibody (550514, Pharmingen, 1:25 dilution), which is then bound by a biotinylated anti-mouse IgG, Fab-specific (1:100 dilution, Sigma), and detected with streptavidin- Cychrome (1:200 dilution, Pharmingen).
- mice are stained with a mouse-anti-human ICAM antibody (MCA532, Serotec, 1:25 dilution), which is then bound by a biotinylated anti-mouse IgG, Fab-specific (1:100 dilution, Sigma), and detected with streptavidin- Cychrome (1:200 dilution, Pharmingen).
- MCA532 mouse-anti-human ICAM antibody
- Serotec Serotec
- Figure 6 shows the results of the experiment described above.
- the first column shows tlie total cell population, analysed according to GFP expression (dark filled area), with the population of cells expressing GFP (and therefore containing the zinc fmger construct) indicated by a horizontal line.
- Columns 2, 3 and 4 show the expression levels of TNFR-1, CXCR4 and ICAM (a non-target cell- surface protein, which acts as a control), respectively, in the cell populations which express GFP.
- the graphs further show that cells expressing only the TNFRl-4-2 -Kox peptide have greatly reduced expression of TNFR-1 while having normal levels of CXCR4 and ICAM.
- Cells expressing only the CXCR4-5-l-Kox protein display greatly reduced levels of CXCR4 and unaltered levels of TNFR-1 and ICAM. More importantly, cells expressing both the CXCR4 and TNFR-1 inhibitory proteins display greatly reduced expression of both CXCR4 and TNFR-1, but do not show a change in the level of the control protein, ICAM.
- Lymphocytes Proc Natl Acad Sci Usa 94(5):1925-1930 (1997).
- O'connor, M.; Hoxie, J.a.; Gonzalez-Scarano, F.; Cxcr-4 (Fusin), a Co-Receptor for the Type 1 Human Immunodeficiency Virus (Hiv-1), is Expressed in the Human Brain in a Variety of Cell Types, Including Microglia and Neurons. Am J Pathol 151(4):1035-1042 (1997).
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Toxicology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
Claims
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU2002225187A AU2002225187A1 (en) | 2001-01-22 | 2002-01-22 | Zinc finger polypeptides and their use |
US10/470,065 US7947469B2 (en) | 2001-01-22 | 2002-01-22 | Modulation of HIV infection |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
GB0101576A GB0101576D0 (en) | 2001-01-22 | 2001-01-22 | Nucleic Acid binding polypeptides |
GB0101576.7 | 2001-01-22 | ||
GB0103032.9 | 2001-02-07 | ||
GB0103032A GB0103032D0 (en) | 2001-02-07 | 2001-02-07 | Nucleic acid binding polypeptides |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2002057308A2 true WO2002057308A2 (en) | 2002-07-25 |
WO2002057308A3 WO2002057308A3 (en) | 2003-02-06 |
Family
ID=26245599
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/GB2002/000246 WO2002057308A2 (en) | 2001-01-22 | 2002-01-22 | Zinc finger polypeptides and their use |
Country Status (3)
Country | Link |
---|---|
US (1) | US7947469B2 (en) |
AU (1) | AU2002225187A1 (en) |
WO (1) | WO2002057308A2 (en) |
Cited By (41)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2007139982A3 (en) * | 2006-05-25 | 2008-10-16 | Sangamo Biosciences Inc | Methods and compositions for gene inactivation |
EP2018424A2 (en) * | 2006-05-19 | 2009-01-28 | Sangamo BioSciences, Inc. | Methods and compositions for inactivation of dihydrofolate reductase |
WO2010107493A2 (en) | 2009-03-20 | 2010-09-23 | Sangamo Biosciences, Inc. | Modification of cxcr4 using engineered zinc finger proteins |
CN102816214A (en) * | 2012-07-27 | 2012-12-12 | 中国人民解放军军事医学科学院生物工程研究所 | Artificial transcription factor of hepatitis B virus (HBx) genes and application of artificial transcription factor |
WO2013012674A1 (en) | 2011-07-15 | 2013-01-24 | The General Hospital Corporation | Methods of transcription activator like effector assembly |
WO2015088643A1 (en) | 2013-12-11 | 2015-06-18 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for the targeted modification of a genome |
WO2015188109A1 (en) | 2014-06-06 | 2015-12-10 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for modifying a targeted locus |
WO2015200805A2 (en) | 2014-06-26 | 2015-12-30 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for targeted genetic modifications and methods of use |
WO2016061374A1 (en) | 2014-10-15 | 2016-04-21 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for generating or maintaining pluripotent cells |
WO2018023014A1 (en) | 2016-07-29 | 2018-02-01 | Regeneron Pharmaceuticals, Inc. | Mice comprising mutations resulting in expression of c-truncated fibrillin-1 |
US9890364B2 (en) | 2012-05-29 | 2018-02-13 | The General Hospital Corporation | TAL-Tet1 fusion proteins and methods of use thereof |
WO2018136758A1 (en) | 2017-01-23 | 2018-07-26 | Regeneron Pharmaceuticals, Inc. | Hsd17b13 variants and uses thereof |
EP3354732A1 (en) | 2014-06-23 | 2018-08-01 | Regeneron Pharmaceuticals, Inc. | Nuclease-mediated dna assembly |
WO2019043082A1 (en) | 2017-08-29 | 2019-03-07 | Kws Saat Se | Improved blue aleurone and other segregation systems |
EP3456831A1 (en) | 2013-04-16 | 2019-03-20 | Regeneron Pharmaceuticals, Inc. | Targeted modification of rat genome |
EP3460063A1 (en) | 2013-12-11 | 2019-03-27 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for the targeted modification of a genome |
WO2019067875A1 (en) | 2017-09-29 | 2019-04-04 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising a humanized ttr locus and methods of use |
WO2019179445A1 (en) | 2018-03-20 | 2019-09-26 | Tsinghua University | Alzheimer's disease animal model and use thereof |
EP3561050A1 (en) | 2013-02-20 | 2019-10-30 | Regeneron Pharmaceuticals, Inc. | Genetic modification of rats |
US10626379B2 (en) | 2015-11-24 | 2020-04-21 | Commonwealth Scientific And Industrial Research Organisation | Production of viruses in cell culture |
EP3653048A1 (en) | 2014-12-19 | 2020-05-20 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for targeted genetic modification through single-step multiple targeting |
US10676749B2 (en) | 2013-02-07 | 2020-06-09 | The General Hospital Corporation | Tale transcriptional activators |
WO2020131632A1 (en) | 2018-12-20 | 2020-06-25 | Regeneron Pharmaceuticals, Inc. | Nuclease-mediated repeat expansion |
WO2020206162A1 (en) | 2019-04-03 | 2020-10-08 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for insertion of antibody coding sequences into a safe harbor locus |
WO2020206139A1 (en) | 2019-04-04 | 2020-10-08 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising a humanized coagulation factor 12 locus |
WO2020206134A1 (en) | 2019-04-04 | 2020-10-08 | Regeneron Pharmaceuticals, Inc. | Methods for scarless introduction of targeted modifications into targeting vectors |
WO2020247452A1 (en) | 2019-06-04 | 2020-12-10 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising a humanized ttr locus with a beta-slip mutation and methods of use |
WO2020247812A1 (en) | 2019-06-07 | 2020-12-10 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising a humanized albumin locus |
WO2020252340A1 (en) | 2019-06-14 | 2020-12-17 | Regeneron Pharmaceuticals, Inc. | Models of tauopathy |
US10907133B2 (en) | 2015-11-24 | 2021-02-02 | Commonwealth Scientific And Industrial Research Organisation | Production of viruses in avian eggs |
WO2021092513A1 (en) | 2019-11-08 | 2021-05-14 | Regeneron Pharmaceuticals, Inc. | Crispr and aav strategies for x-linked juvenile retinoschisis therapy |
WO2021108363A1 (en) | 2019-11-25 | 2021-06-03 | Regeneron Pharmaceuticals, Inc. | Crispr/cas-mediated upregulation of humanized ttr allele |
WO2021178556A1 (en) | 2020-03-04 | 2021-09-10 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for sensitization of tumor cells to immune therapy |
US11606940B2 (en) | 2015-08-07 | 2023-03-21 | Commonwealth Scientific And Industrial Research Organisation | Method for producing an animal comprising a germline genetic modification |
WO2023129974A1 (en) | 2021-12-29 | 2023-07-06 | Bristol-Myers Squibb Company | Generation of landing pad cell lines |
WO2023220603A1 (en) | 2022-05-09 | 2023-11-16 | Regeneron Pharmaceuticals, Inc. | Vectors and methods for in vivo antibody production |
WO2024026474A1 (en) | 2022-07-29 | 2024-02-01 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for transferrin receptor (tfr)-mediated delivery to the brain and muscle |
US11891631B2 (en) | 2012-10-12 | 2024-02-06 | The General Hospital Corporation | Transcription activator-like effector (tale) - lysine-specific demethylase 1 (LSD1) fusion proteins |
WO2024031053A1 (en) | 2022-08-05 | 2024-02-08 | Regeneron Pharmaceuticals, Inc. | Aggregation-resistant variants of tdp-43 |
US11913015B2 (en) | 2017-04-17 | 2024-02-27 | University Of Maryland, College Park | Embryonic cell cultures and methods of using the same |
WO2024107765A2 (en) | 2022-11-14 | 2024-05-23 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for fibroblast growth factor receptor 3-mediated delivery to astrocytes |
Families Citing this family (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7118659B2 (en) * | 2003-02-27 | 2006-10-10 | Combisep, Inc. | Robotic friendly external loading system for electrophoresis instrument and method |
WO2006078431A2 (en) | 2004-12-22 | 2006-07-27 | The University Of Iowa Research Foundation | Compositions and methods related to modified retroviral vectors for restricted, site specific integration |
RU2522810C1 (en) * | 2012-12-21 | 2014-07-20 | Антон Вячеславович КИСЕЛЕВ | Carrier for targeted delivery of nucleic acids to cells expressing receptor cxcr4 |
Citations (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1996006166A1 (en) * | 1994-08-20 | 1996-02-29 | Medical Research Council | Improvements in or relating to binding proteins for recognition of dna |
WO1996032475A2 (en) * | 1995-04-12 | 1996-10-17 | University Of Washington | Methods for preparing dna-binding proteins |
US5789538A (en) * | 1995-02-03 | 1998-08-04 | Massachusetts Institute Of Technology | Zinc finger proteins with high affinity new DNA binding specificities |
WO1998053059A1 (en) * | 1997-05-23 | 1998-11-26 | Medical Research Council | Nucleic acid binding proteins |
WO1998053057A1 (en) * | 1997-05-23 | 1998-11-26 | Gendaq Limited | Nucleic acid binding polypeptide library |
WO1999042474A2 (en) * | 1998-02-20 | 1999-08-26 | Genome Dynamics, Inc. | Method for designing dna-binding proteins of the zinc-finger class |
WO1999045132A1 (en) * | 1998-03-02 | 1999-09-10 | Massachusetts Institute Of Technology | Poly zinc finger proteins with improved linkers |
WO1999047656A2 (en) * | 1998-03-17 | 1999-09-23 | Gendaq Limited | Nucleic acid binding proteins |
WO2000027878A1 (en) * | 1998-11-09 | 2000-05-18 | Gendaq Limited | Screening system for zinc finger polypeptides for a desired binding ability |
WO2000042219A1 (en) * | 1999-01-12 | 2000-07-20 | Sangamo Biosciences, Inc. | Selection of sites for targeting by zinc finger proteins and methods of designing zinc finger proteins to bind to preselected sites |
WO2000041566A1 (en) * | 1999-01-12 | 2000-07-20 | Sanagamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
US6140466A (en) * | 1994-01-18 | 2000-10-31 | The Scripps Research Institute | Zinc finger protein derivatives and methods therefor |
Family Cites Families (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6242568B1 (en) | 1994-01-18 | 2001-06-05 | The Scripps Research Institute | Zinc finger protein derivatives and methods therefor |
US5670399A (en) * | 1995-12-06 | 1997-09-23 | Micron Technology, Inc. | Method of making thin film transistor with offset drain |
US6140081A (en) | 1998-10-16 | 2000-10-31 | The Scripps Research Institute | Zinc finger binding domains for GNN |
US6794136B1 (en) | 2000-11-20 | 2004-09-21 | Sangamo Biosciences, Inc. | Iterative optimization in the design of binding proteins |
US20020061512A1 (en) * | 2000-02-18 | 2002-05-23 | Kim Jin-Soo | Zinc finger domains and methods of identifying same |
US20030082561A1 (en) | 2000-07-21 | 2003-05-01 | Takashi Sera | Zinc finger domain recognition code and uses thereof |
AU2001278496A1 (en) | 2000-07-21 | 2002-02-05 | Syngenta Participations Ag | Zinc finger domain recognition code and uses thereof |
US6689877B2 (en) * | 2000-11-06 | 2004-02-10 | The Board Of Regents Of The University Of Nebraska | Methods and compositions for the treatment of human immunodeficiency virus infection |
US7067317B2 (en) | 2000-12-07 | 2006-06-27 | Sangamo Biosciences, Inc. | Regulation of angiogenesis with zinc finger proteins |
US7067617B2 (en) | 2001-02-21 | 2006-06-27 | The Scripps Research Institute | Zinc finger binding domains for nucleotide sequence ANN |
DE60233555D1 (en) | 2001-02-21 | 2009-10-15 | Novartis Ag | THE NUCLEOTIDE SEQUENCE ANN BINDING ZINC FINGERS DOMAINS |
JP2005500061A (en) | 2001-08-20 | 2005-01-06 | ザ スクリップス リサーチ インスティテュート | Zinc finger binding domain for CNN |
-
2002
- 2002-01-22 US US10/470,065 patent/US7947469B2/en active Active
- 2002-01-22 AU AU2002225187A patent/AU2002225187A1/en not_active Abandoned
- 2002-01-22 WO PCT/GB2002/000246 patent/WO2002057308A2/en not_active Application Discontinuation
Patent Citations (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6140466A (en) * | 1994-01-18 | 2000-10-31 | The Scripps Research Institute | Zinc finger protein derivatives and methods therefor |
WO1996006166A1 (en) * | 1994-08-20 | 1996-02-29 | Medical Research Council | Improvements in or relating to binding proteins for recognition of dna |
US5789538A (en) * | 1995-02-03 | 1998-08-04 | Massachusetts Institute Of Technology | Zinc finger proteins with high affinity new DNA binding specificities |
WO1996032475A2 (en) * | 1995-04-12 | 1996-10-17 | University Of Washington | Methods for preparing dna-binding proteins |
WO1998053059A1 (en) * | 1997-05-23 | 1998-11-26 | Medical Research Council | Nucleic acid binding proteins |
WO1998053057A1 (en) * | 1997-05-23 | 1998-11-26 | Gendaq Limited | Nucleic acid binding polypeptide library |
WO1999042474A2 (en) * | 1998-02-20 | 1999-08-26 | Genome Dynamics, Inc. | Method for designing dna-binding proteins of the zinc-finger class |
WO1999045132A1 (en) * | 1998-03-02 | 1999-09-10 | Massachusetts Institute Of Technology | Poly zinc finger proteins with improved linkers |
WO1999047656A2 (en) * | 1998-03-17 | 1999-09-23 | Gendaq Limited | Nucleic acid binding proteins |
WO2000027878A1 (en) * | 1998-11-09 | 2000-05-18 | Gendaq Limited | Screening system for zinc finger polypeptides for a desired binding ability |
WO2000042219A1 (en) * | 1999-01-12 | 2000-07-20 | Sangamo Biosciences, Inc. | Selection of sites for targeting by zinc finger proteins and methods of designing zinc finger proteins to bind to preselected sites |
WO2000041566A1 (en) * | 1999-01-12 | 2000-07-20 | Sanagamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
Cited By (64)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP2018424A2 (en) * | 2006-05-19 | 2009-01-28 | Sangamo BioSciences, Inc. | Methods and compositions for inactivation of dihydrofolate reductase |
US8524221B2 (en) | 2006-05-25 | 2013-09-03 | Sangamo Biosciences, Inc. | Methods and compositions for gene inactivation |
WO2007139982A3 (en) * | 2006-05-25 | 2008-10-16 | Sangamo Biosciences Inc | Methods and compositions for gene inactivation |
US7951925B2 (en) | 2006-05-25 | 2011-05-31 | Sangamo Biosciences, Inc. | Methods and compositions for gene inactivation |
US11648267B2 (en) | 2006-05-25 | 2023-05-16 | Sangamo Therapeutics, Inc. | Methods and compositions for gene inactivation |
US9434776B2 (en) | 2006-05-25 | 2016-09-06 | Sangamo Biosciences, Inc. | Methods and compositions for gene inactivation |
US8569253B2 (en) | 2006-05-25 | 2013-10-29 | Sangamo Biosciences, Inc. | Methods and compositions for gene inactivation |
US9717759B2 (en) | 2009-03-20 | 2017-08-01 | Sangamo Therapeutics, Inc. | Modification of CXCR4 using engineered zinc finger proteins |
US8871905B2 (en) | 2009-03-20 | 2014-10-28 | Sangamo Biosciences, Inc. | Modification of CXCR4 using engineered zinc finger proteins |
WO2010107493A2 (en) | 2009-03-20 | 2010-09-23 | Sangamo Biosciences, Inc. | Modification of cxcr4 using engineered zinc finger proteins |
EP2408921A4 (en) * | 2009-03-20 | 2012-10-10 | Sangamo Biosciences Inc | Modification of cxcr4 using engineered zinc finger proteins |
EP2408921A2 (en) * | 2009-03-20 | 2012-01-25 | Sangamo BioSciences, Inc. | Modification of cxcr4 using engineered zinc finger proteins |
WO2013012674A1 (en) | 2011-07-15 | 2013-01-24 | The General Hospital Corporation | Methods of transcription activator like effector assembly |
US10273271B2 (en) | 2011-07-15 | 2019-04-30 | The General Hospital Corporation | Methods of transcription activator like effector assembly |
US11472849B2 (en) | 2011-07-15 | 2022-10-18 | The General Hospital Corporation | Methods of transcription activator like effector assembly |
EP3461896A2 (en) | 2011-07-15 | 2019-04-03 | The General Hospital Corporation | Methods of transcription activator like effector assembly |
US10894950B2 (en) | 2012-05-29 | 2021-01-19 | The General Hospital Corporation | TAL-Tet1 fusion proteins and methods of use thereof |
US9890364B2 (en) | 2012-05-29 | 2018-02-13 | The General Hospital Corporation | TAL-Tet1 fusion proteins and methods of use thereof |
CN102816214A (en) * | 2012-07-27 | 2012-12-12 | 中国人民解放军军事医学科学院生物工程研究所 | Artificial transcription factor of hepatitis B virus (HBx) genes and application of artificial transcription factor |
US11891631B2 (en) | 2012-10-12 | 2024-02-06 | The General Hospital Corporation | Transcription activator-like effector (tale) - lysine-specific demethylase 1 (LSD1) fusion proteins |
US10676749B2 (en) | 2013-02-07 | 2020-06-09 | The General Hospital Corporation | Tale transcriptional activators |
US10731167B2 (en) | 2013-02-07 | 2020-08-04 | The General Hospital Corporation | Tale transcriptional activators |
EP3561050A1 (en) | 2013-02-20 | 2019-10-30 | Regeneron Pharmaceuticals, Inc. | Genetic modification of rats |
EP3456831A1 (en) | 2013-04-16 | 2019-03-20 | Regeneron Pharmaceuticals, Inc. | Targeted modification of rat genome |
EP4349980A2 (en) | 2013-12-11 | 2024-04-10 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for the targeted modification of a genome |
EP3460063A1 (en) | 2013-12-11 | 2019-03-27 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for the targeted modification of a genome |
WO2015088643A1 (en) | 2013-12-11 | 2015-06-18 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for the targeted modification of a genome |
EP3708671A1 (en) | 2014-06-06 | 2020-09-16 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for modifying a targeted locus |
WO2015188109A1 (en) | 2014-06-06 | 2015-12-10 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for modifying a targeted locus |
EP3354732A1 (en) | 2014-06-23 | 2018-08-01 | Regeneron Pharmaceuticals, Inc. | Nuclease-mediated dna assembly |
EP3708663A1 (en) | 2014-06-23 | 2020-09-16 | Regeneron Pharmaceuticals, Inc. | Nuclease-mediated dna assembly |
EP3461885A1 (en) | 2014-06-26 | 2019-04-03 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for targeted genetic modifications and methods of use |
WO2015200805A2 (en) | 2014-06-26 | 2015-12-30 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for targeted genetic modifications and methods of use |
EP3561052A1 (en) | 2014-10-15 | 2019-10-30 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for generating or maintaining pluripotent cells |
WO2016061374A1 (en) | 2014-10-15 | 2016-04-21 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for generating or maintaining pluripotent cells |
EP3653048A1 (en) | 2014-12-19 | 2020-05-20 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for targeted genetic modification through single-step multiple targeting |
US11606940B2 (en) | 2015-08-07 | 2023-03-21 | Commonwealth Scientific And Industrial Research Organisation | Method for producing an animal comprising a germline genetic modification |
US10626379B2 (en) | 2015-11-24 | 2020-04-21 | Commonwealth Scientific And Industrial Research Organisation | Production of viruses in cell culture |
US11174466B2 (en) | 2015-11-24 | 2021-11-16 | Commonwealth Scientific And Industrial Research Organisation | Production of viruses in cell culture |
US11118166B2 (en) | 2015-11-24 | 2021-09-14 | Commonwealth Scientific And Industrial Research Organisation | Production of viruses in avian eggs |
US10907133B2 (en) | 2015-11-24 | 2021-02-02 | Commonwealth Scientific And Industrial Research Organisation | Production of viruses in avian eggs |
WO2018023014A1 (en) | 2016-07-29 | 2018-02-01 | Regeneron Pharmaceuticals, Inc. | Mice comprising mutations resulting in expression of c-truncated fibrillin-1 |
WO2018136758A1 (en) | 2017-01-23 | 2018-07-26 | Regeneron Pharmaceuticals, Inc. | Hsd17b13 variants and uses thereof |
US11913015B2 (en) | 2017-04-17 | 2024-02-27 | University Of Maryland, College Park | Embryonic cell cultures and methods of using the same |
WO2019043082A1 (en) | 2017-08-29 | 2019-03-07 | Kws Saat Se | Improved blue aleurone and other segregation systems |
US11697822B2 (en) | 2017-08-29 | 2023-07-11 | KWS SAAT SE & Co. KGaA | Blue aleurone and other segregation systems |
EP4276185A2 (en) | 2017-09-29 | 2023-11-15 | Regeneron Pharmaceuticals, Inc. | Rodents comprising a humanized ttr locus and methods of use |
WO2019067875A1 (en) | 2017-09-29 | 2019-04-04 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising a humanized ttr locus and methods of use |
WO2019179445A1 (en) | 2018-03-20 | 2019-09-26 | Tsinghua University | Alzheimer's disease animal model and use thereof |
WO2020131632A1 (en) | 2018-12-20 | 2020-06-25 | Regeneron Pharmaceuticals, Inc. | Nuclease-mediated repeat expansion |
WO2020206162A1 (en) | 2019-04-03 | 2020-10-08 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for insertion of antibody coding sequences into a safe harbor locus |
WO2020206134A1 (en) | 2019-04-04 | 2020-10-08 | Regeneron Pharmaceuticals, Inc. | Methods for scarless introduction of targeted modifications into targeting vectors |
WO2020206139A1 (en) | 2019-04-04 | 2020-10-08 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising a humanized coagulation factor 12 locus |
WO2020247452A1 (en) | 2019-06-04 | 2020-12-10 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising a humanized ttr locus with a beta-slip mutation and methods of use |
WO2020247812A1 (en) | 2019-06-07 | 2020-12-10 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising a humanized albumin locus |
WO2020252340A1 (en) | 2019-06-14 | 2020-12-17 | Regeneron Pharmaceuticals, Inc. | Models of tauopathy |
WO2021092513A1 (en) | 2019-11-08 | 2021-05-14 | Regeneron Pharmaceuticals, Inc. | Crispr and aav strategies for x-linked juvenile retinoschisis therapy |
WO2021108363A1 (en) | 2019-11-25 | 2021-06-03 | Regeneron Pharmaceuticals, Inc. | Crispr/cas-mediated upregulation of humanized ttr allele |
WO2021178556A1 (en) | 2020-03-04 | 2021-09-10 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for sensitization of tumor cells to immune therapy |
WO2023129974A1 (en) | 2021-12-29 | 2023-07-06 | Bristol-Myers Squibb Company | Generation of landing pad cell lines |
WO2023220603A1 (en) | 2022-05-09 | 2023-11-16 | Regeneron Pharmaceuticals, Inc. | Vectors and methods for in vivo antibody production |
WO2024026474A1 (en) | 2022-07-29 | 2024-02-01 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for transferrin receptor (tfr)-mediated delivery to the brain and muscle |
WO2024031053A1 (en) | 2022-08-05 | 2024-02-08 | Regeneron Pharmaceuticals, Inc. | Aggregation-resistant variants of tdp-43 |
WO2024107765A2 (en) | 2022-11-14 | 2024-05-23 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for fibroblast growth factor receptor 3-mediated delivery to astrocytes |
Also Published As
Publication number | Publication date |
---|---|
WO2002057308A3 (en) | 2003-02-06 |
US7947469B2 (en) | 2011-05-24 |
AU2002225187A1 (en) | 2002-07-30 |
US20040110923A1 (en) | 2004-06-10 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US7947469B2 (en) | Modulation of HIV infection | |
AU737756B2 (en) | Nucleic acid binding polypeptide library | |
Regnier et al. | Identification and characterization of an IκB kinase | |
Nanson et al. | Death, TIR, and RHIM: self-assembling domains involved in innate immunity and cell-death signaling | |
Giam et al. | HTLV-1 Tax and adult T-cell leukemia | |
Hsu et al. | TRADD–TRAF2 and TRADD–FADD interactions define two distinct TNF receptor 1 signal transduction pathways | |
Klug | The discovery of zinc fingers and their development for practical applications in gene regulation and genome manipulation | |
Wulczyn et al. | The NF-κB/Rel and IκB gene families: mediators of immune response and inflammation | |
US7514257B2 (en) | Zinc finger transcription factor differentiation proteins | |
EP1250424B1 (en) | Nucleic acid binding polypeptides characterized by flexible linkers connected nucleic acid binding modules | |
WO2002099084A2 (en) | Composite binding polypeptides | |
AU2001226935A1 (en) | Nucleic acid binding polypeptides characterized by flexible linkers connected nucleic acid binding modules | |
Zong et al. | Rel blocks both anti-Fas-and TNFα-induced apoptosis and an intact Rel transactivation domain is essential for this effect | |
US20040039175A1 (en) | Modulation of viral gene expression by engineered zinc finger proteins | |
WO2001085780A2 (en) | Nucleic acid binding polypeptides | |
US20040170619A1 (en) | Gene regulation | |
Hertlein | Post-translational modification of NF-kB: regulation of stability and gene expression | |
Zhu et al. | CXCR4 Recognition by L-and D-Peptides Containing the Full-Length V3 Loop of HIV-1 gp120. Viruses 2023, 15, 1084 | |
Ruben et al. | I-Rel: a novel rel-related protein that inhibits NF-kappa B | |
Aittomäki | Interferon-gamma-activated gene expression: molecular mechanisms of Stat1-mediated transcription |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ OM PH PL PT RO RU SD SE SG SI SK SL TJ TM TN TR TT TZ UA UG US UZ VN YU ZA ZM ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
AK | Designated states |
Kind code of ref document: A3 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ OM PH PL PT RO RU SD SE SG SI SK SL TJ TM TN TR TT TZ UA UG US UZ VN YU ZA ZM ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A3 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 10470065 Country of ref document: US |
|
122 | Ep: pct application non-entry in european phase | ||
NENP | Non-entry into the national phase |
Ref country code: JP |
|
WWW | Wipo information: withdrawn in national office |
Country of ref document: JP |