WO2001068822A2 - Method of treating phenylketonuria and means therefor - Google Patents

Method of treating phenylketonuria and means therefor Download PDF

Info

Publication number
WO2001068822A2
WO2001068822A2 PCT/DK2001/000172 DK0100172W WO0168822A2 WO 2001068822 A2 WO2001068822 A2 WO 2001068822A2 DK 0100172 W DK0100172 W DK 0100172W WO 0168822 A2 WO0168822 A2 WO 0168822A2
Authority
WO
WIPO (PCT)
Prior art keywords
phenylalanine hydroxylase
hydroxylase activity
phenylalanine
nucleic acid
gene product
Prior art date
Application number
PCT/DK2001/000172
Other languages
French (fr)
Other versions
WO2001068822A3 (en
Inventor
Mads Johnsen
Peter Ravn
Søren Michael MADSEN
Astrid Vrang
Hans Israelsen
Lars Bredmose
José ARNAU
Stein Højmark JENSEN
Torben Gjetting
Egon Nielsen
Original Assignee
Nilab Aps
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Nilab Aps filed Critical Nilab Aps
Priority to AU2001242302A priority Critical patent/AU2001242302A1/en
Publication of WO2001068822A2 publication Critical patent/WO2001068822A2/en
Publication of WO2001068822A3 publication Critical patent/WO2001068822A3/en

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004Oxidoreductases (1.)
    • C12N9/0071Oxidoreductases (1.) acting on paired donors with incorporation of molecular oxygen (1.14)
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23LFOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L33/00Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
    • A23L33/10Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
    • A23L33/17Amino acids, peptides or proteins
    • A23L33/18Peptides; Protein hydrolysates
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23LFOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L33/00Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
    • A23L33/10Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
    • A23L33/17Amino acids, peptides or proteins
    • A23L33/19Dairy proteins
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23VINDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
    • A23V2002/00Food compositions, function of food ingredients or processes for food or foodstuffs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide

Definitions

  • the invention relates to the field of treating the condition generally referred to as phenylketonuria that is an inherited metabolic disorder in humans and animals resulting i.a. in an accumulation in the body of L-phenylalanine and metabolites derived therefrom.
  • novel cells expressing phenylalanine hydroxylase activity and novel fusion proteins comprising, in addition to the phenylalanine hydroxylase activity, a polypeptide enhancing and/or stabilising the phenylalanine hydroxylase activity.
  • Phenylalanine is an essential amino acid for humans and animals. In the organism, this amino acid is used as a component in the synthesis of proteins including structural proteins, enzymes and hormones. Additionally, L-phenylalanine is converted to L-tyrosine in a reaction catalysed by enzymes having phenylalanine hydroxylase activity including the mammalian enzyme generally referred to as PAH (phenylalanine-4-monooxygenase, EC 1.14.16.1) (reviewed by Kaufman, 1993). Consequently, tyrosine is not an essential amino acid as long as the PAH reaction occurs.
  • PAH phenylalanine-4-monooxygenase
  • Tyrosine can be hydroxylated and the resulting substance, DOPA, is a precursor of the neurotransmitters dopamine, nor-adrenaline and adrenaline.
  • the PAH reaction is the first obligatory step in the complete degradation of phenylalanine into CO 2 and water and there are no alternative pathways to break down the phenyl ring of phenylalanine.
  • phenylalanine can also be metabolised into other compounds but the metabolic reactions are restricted to occur on the alanine side chain.
  • the resulting compounds include phenylpyruvate, phenyllactate and o-hydroxyphenylacetate.
  • PKU phenylketonuria
  • the immediate treatment of new-born PKU children includes a phenylalanine-restricted diet preventing the mental retardation.
  • PKU patients must follow an accurate phenylalanine-restricted diet for lifetime in order to avoid that the brain function is affected.
  • a PKU diet consists of food that contains low amounts of natural proteins combined with phenylalanine-free formulas covering the demands of the organism for essential amino acids.
  • fruit, a balanced amount of vegetables and a free intake of fat and starch are allowed.
  • the economy does not allow dietary treatment of PKU children although the screening for PKU may be performed. Consequently, these children inevitably develop mental retardation.
  • children in the Western world be- come teenagers they begin to doubt as to the need for keeping their accurate diet. The doubt is primarily driven by a desire to live a normal life like healthy teenagers eating food with a high content of phenylalanine. Accordingly, their phenylalanine-reduced diet may be compromised which is often accompanied by impaired brain function.
  • the PAH catalysed conversion of phenylalanine to tyrosine is accompanied by several ancillary reactions ensuring the regeneration of the essential co-factor tetrahydrobiopterin (BH ) (Kaufman, 1993).
  • the reactions are shown in Fig. 1.
  • Phenylalanine is hydroxylated at carbon position 4 in the aromatic ring with the concomitant conversion of BH 4 to 4a- carbinolamine.
  • the 4a-carbinolamine dehydratase subsequently catalyses the formation of quinonoid dihydrobiopterine (qBH 2 ) accompanied by the dissociation of water and, finally, dihydropterine reductase reduces qBH 2 to BH 4 using NADH as an electron donor.
  • qBH 2 quinonoid dihydrobiopterine
  • a peroxidase active enzyme is essential when the PAH mediated reaction is carried out in vitro since PAH is inactivated by H 2 O 2 formed by non-enzymatic oxidation of BH 4 .
  • the BH 4 can be replaced by other substances including flavins and pyrimidines (Kaufman, 1993). The molecular properties of phenylalanine hydroxylased from higher organisms and pro- karyotes
  • PAH phenylalanine hydroxylase from rat and man
  • the two major forms of phenylalanine hydroxylase from rat and man (PAH) have mo- lecular weights of 110 and 210 kD, respectively (Woo et al. , 1974).
  • the molecular weight of the subunit is 52 kDa and catalytically active PAH has a homo-dimeric and homo- tetrameric structure (Woo et al., 1974).
  • Human PAH is a 452 amino acid protein produced and located intracellularly in liver cells. It is an unstable enzyme which causes difficulties when PAH is used in in vitro experiments or analysis.
  • the enzyme activity is activated by the presence of phenylalanine and it has been shown that the amino terminal region of PAH is involved in the regulation of the catalytic activity (Hufton et al., 1998). The region has been shown to contain a domain necessary for the oligomerisation of the mature PAH. The carboxy-terminal end of PAH contains the catalytic domain of the enzyme (Dickson et a/., 1994).
  • hPAH Human PAH
  • E. coli Human PAH
  • Rat PAH has been expressed recombinantly in E. coli (Martinez et al., 1995, Kowlessur e al., 1996) and in Saccharomyces cerevisiae (Hufton et al., 1998).
  • Rat PAH has been expressed in mouse LTK " cells (Choo et al., 1986) and in E. coli (Dickson et a/., 1994).
  • Prokaryotic phenylalanine hydroxylases have been identified in Gram-negative bacteria including Pseudomonas aeruginosa and Chromobacterium violeans (Zhao et al., 1994, Onishi et al., 1991). In contrast to the eukaryotic PAH, the bacterial counterpart is catalytically active in a monomeric form.
  • Fig. 2 shows an alignment analysis of the primary structure of human PAH, tryptophan hydroxylase, tyrosine hydroxylase and phenylalanine hydroxylases from P. aeruginosa and C. violeans, respectively.
  • the three human hydroxylases share a high homology throughout the polypeptides while the bacterial phenylalanine hydroxylases are shorter and correspond to the carboxy-terminal end of the human PAH. Thus, the regulatory region is lacking, which explains the monomeric structure of the mature bacterial enzyme.
  • the phhA is a 789 bp gene encoding the phenylalanine hydroxylase (PhhA) from P. aeruginosa.
  • the gene has been cloned and characterised by R.A. Jensen and co-workers (Zhao et al., 1994).
  • PhhA is a 262 amino acid protein having a molecular weight of 30 kDa.
  • the G+C content of phhA is 64%, which is typical for the P. aeruginosa genome.
  • the gene is part of an operon that also contains the genes phhB and phhC encoding 4a- carbinolamine dehydratase (PhhB) and aromatic am inotransf erase (PhhC).
  • the bacterial PhhB catalyses the conversion of 4a-carbinolamine to quinonoid dihydrobiopterine as shown in Fig. 1 and PhhC catalyses the conversion of tyrosine to 4-hydroxyphenylpyru- vate.
  • PhhB is playing a key role in controlling the phenylalanine hydroxylase reaction catalysed by PhhA.
  • PhhB has been shown to regulate the expression of phhA at the posttranscriptional level (Song et al., 1999). Additionally, PhhB stimulates the PhhA catalysed reaction by regenerating the essential pterin co-factor.
  • PhhA and PhhB co-precipitates when a crude extract of E. coli (pJZ9-3a), which produces PhhA and PhhB, is treated with antibodies raised against PhhB.
  • the anti-PhhB antibodies do not recognise PhhA alone and, therefore, it was concluded that PhhA and PhhB can exist as a dissociable complex. The conclusion was supported by affinity chromatography where immobilised anti-PhhB antibodies resulted in a separation of both PhhA and PhhB from the crude extract.
  • PhhA from Chromobacterium violaceum has been expressed recombinantly in E. coli (Onishi et al., 1991) and that from Pseudomonas aeruginosa in £ coli (Zhao et al., 1994, Song et a/., 1999).
  • the mammalian phenylalanine hydroxylation activity in vivo is dependent on the regeneration of the co-factor tetrahydrobiopterin (BH 4 ).
  • BH 4 co-factor tetrahydrobiopterin
  • PHS phenylalanine hydroxylase stimulating protein
  • Enzyme substitution therapy may constitute another potential treatment of PKU.
  • PKU phenylalanine ammonia lyase
  • PAL phenylalanine ammonia lyase
  • Observation of diet requirement could be avoided, if efficient and cost effective means for reducing the phenylalanine content in normal diets could be provided.
  • one possibility could be to administer effective amounts of phenylalanine hydroxylases or GRAS (generally recognised as safe) organisms expressing or containing such enzymes to PKU patients.
  • Another approach would be to provide palatable phenylalanine reduced diets at a reasonable cost level by treating proteinaceous food products having a high content of phenylalanine with phenylalanine hydroxylase or an organism producing such enzyme.
  • the invention pertains to a recombinant cell comprising a nucleic acid derived from a prokaryotic organism, said nucleic acid coding for a gene product having phenylalanine hydroxylase activity, subject to the limitation that the cell is not an £. coli cell.
  • a recombinant lactic acid bacterial cell comprising a nucleic acid sequence coding for a gene product having phenylalanine hydroxylase activ- ity.
  • the invention provides a fusion protein comprising an amino acid sequence having phenylalanine hydroxylase activity and a polypeptide enhancing or stabilising the phenylalanine hydroxylase activity.
  • the invention relates to a method of producing phenylalanine hydroxylase, comprising providing a cell as defined above, cultivating said cell under conditions where the gene coding for the gene product having phenylalanine hydroxylase activity is expressed, and harvesting the phenylalanine hydroxylase active gene product.
  • compositions comprising cells as defined above and a pharmaceutical composition comprising such cells, and a pharmaceutically acceptable carrier.
  • the invention relates in other aspects to a composition comprising a fusion protein as also defined above and a pharmaceutical composition comprising such a fusion protein, and a pharmaceutically acceptable carrier.
  • the invention relates to a phenylalanine hydroxylase active enzyme for use as a medicament and to the use of a phenylalanine hydroxylase active enzyme for the manufacturing of a medicament for the treatment of phenylketonuria.
  • the invention provides means of treating phenylketonuria. Accordingly, the invention provides in another aspect a method of treating phenylketonuria in a mammal, comprising administering to said mammal an effective amount of any of the above compositions.
  • the present invention provides in yet a further aspect a method of preparing a proteinaceous food product having a reduced content of phenylalanine, the method comprising contacting a proteinaceous food product starting material with a cell or a fusion protein as defined hereinbefore, under conditions where the gene product having phenylalanine hydroxylase activity is enzymatically active for a period of time that is sufficient to convert at least part of the phenylalanine content of the starting material into compounds that do not cause phenylketonuria.
  • a primary objective of the present invention to provide novel means for treating phenylketonuria. Accordingly, in a first aspect, there is provided a recombinant host cell in which a nucleic acid derived from a prokaryotic organism and coding for a gene product having phenylalanine hydroxylase activity is expressed.
  • nucleic acid coding for phenylalanine hydroxylase activity refers to any nucleic acid sequences including DNA and RNA that codes for a polypeptide having the ability to catalyse the conversion of L-phenylalanine into L-tyrosine using tetra- hydropterin (BH 4 ) or other factors as reducing agents. It will be appreciated that such a nucleic acid can be a wild-type nucleic acid isolated from a prokaryotic organism naturally containing such a nucleic acid.
  • the nucleic acid may also be a coding nucleic acid sequence derived from a wild-type nucleic acid, but still coding for a polypeptide at least partially having the phenylalanine hydroxylase activity of the gene product of the parent nucleic acid sequence.
  • a derived sequence can be provided by modifying a nucleic acid sequence coding for the polypeptide, e.g. by modifying the parent sequence by substitution, deletion and/or addition of one or more nucleotides.
  • a nucleic acid coding for phenylalanine hydroxylase can be synthesised using conventional techniques which are well-known in the art.
  • a nucleic acid coding for phenyl alanine hydroxylase activity may be provided by substituting one or more wild-type codon(s) with different codon(s). The substitution of codons may be appropriate when the nucleic acid is to be expressed in a heterologous species, such as a lactic acid bacterium.
  • nucleic acid coding for phenylalanine hydroxylase activity encompasses any derivative, homologue or mutant of any naturally occurring coding sequences for the enzyme including the PhhA encoding sequences of Chromobacterium violaceans and Pseudomanas species including Pseudomonas aeruginosa and Pseu- domonas acidovorans.
  • the nucleic acids also include coding sequences that are capable of hybridising under stringent conditions to any of the above PhhA encoding sequences.
  • derivative indicates a sequence that is modified relative to any of these PhhA sequences, e.g.
  • a “homologue” refers to a nucleic acid sequence that differs from any of the above PhhA sequences in at least one nucleotide. Accordingly, a “homologue” is a coding sequence that is at least 50% homologous to any of the PhhA sequences as determined by a FASTA using the GCG Wisconsin package version 8, Genetic Computer Group including at least 60%, 70%, 80% or 90% similarity.
  • the expression "gene product having phenylalanine hydroxylase activity” refers to a polypeptide that is capable of converting the amino acid L-phenylalanine into L- tyrosine optionally using pterins as reducing agents.
  • This phenylalanine hydroxylation reaction is, as it is mentioned above, the first step in the catabolic pathway that leads to complete oxidation of phenylalanine to CO 2 and water. Phenylalanine hydroxylase activities are found in mammals including humans and rodents.
  • the mammalian phenylalanine hydroxylase enzyme L-phenylalanine-4-monooxygenase (EC.1.14.16.1), a mixed function oxidoreductase, is generally referred to as PheOH or PAH.
  • oxidoreduc- tases having similar phenylalanine hydroxylase activity and also classified as L-phenyl- alanine-4-monooxygenases have been found in prokaryotic organisms including the Gram negative bacterial species, Chromobacterium violaceans and Pseudo- manas species including Pseudomonas aeruginosa and Pseudomonas acidovorans (Zhao et al., 1994).
  • prokaryotic L-phenylalanine-4-monooxygenases are generally referred to as PhhAs.
  • the expression "gene product having phenylalanine hydroxylase activity” encompasses derivatives, mutants or fragments of any naturally occurring phenylalanine hydroxylases including the prokaryotic enzymes having such an activity of Chromobacterium violaceans and Pseudomanas species including Pseudomonas aerugi- nosa and Pseudomonas acidovorans.
  • derivative refers to modifications of the above polypeptides that has retained at least part of the enzymatic activity of the parent polypeptide. Such modifications can be substitutions, additions and/or deletions of at least one amino acid in such polypeptides.
  • “derivative” is a polypeptide having, at the amino acid level, an identity with any of the above naturally occurring enzymes which is at least 30%, including at least 40%, 50%, 60%, 70%, 80%, 90% or 99% identity.
  • “Derivative” also encompasses polypeptides with phenylalanine hydroxylase activity that show at least 30% similarity to a naturally occurring phenylalanine hydroxylase including at least 40%, 50%, 60%, 70%, 80%, 90% or 99% similarity with any of the above naturally occurring polypeptides, the term “similarity” in- eluding not only strict amino acid identity, but also congruence in respect of amino acids having similar physico-chemical characteristics such as electric charge as it is generally appreciated by the person skilled in the art.
  • the present invention is i.a. based on the discovery that isolated prokaryotic nucleic acids coding for PhhA can be inserted into host cells and expressed therein.
  • isolated prokaryotic nucleic acids coding for PhhA can be inserted into host cells and expressed therein.
  • such coding nucleic acids can be expressed effectively in organisms that are generally referred to as GRAS organisms as defined hereinbelow. This opens up for safe and cost effective dietary and pharmaceutical applications of PhhA in PKU patients.
  • host cells can be used in the invention for recombinant production of PhhA and similar prokaryotic enzymes having phenylalanine hydroxylase activity, including any eukaryotic cells and prokaryotic cells that are capable of expressing genes coding for such activity.
  • Useful prokaryotic host cells can be selected from Gram negative and Gram positive bacteria.
  • useful Gram negative host cells include Enterobacteriaceae species such as e.g. Salmonella spp. and Serratia spp; Pseudomonas spp., and examples of Gram positive bacteria that can be used in the invention include Bacillus spp. Streptomy- ces spp and lactic acid bacterial species.
  • Suitable eukaryotic host cells can be selected from fungal cells including yeast cells, mammalian cells including human cells and insect cells.
  • Methods for introducing exogenous DNA into such host cells typically include the use of CaCI 2 or other agents such as divalent cations and DMSO.
  • DNA can also be introduced into bacterial cells by electroporation (Holo and Ness, 1989), nuclear injection or proto- plast fusion as described generally in Sambrook et al. ( 989).
  • the host cell should secrete minimal amounts of proteolytic enzymes.
  • in vitro methods of cloning e.g. PCR or other nucleic acid polymerase reactions are suitable.
  • Expression vectors and transformation vectors have been developed for transformation into yeast species including Saccharomyces cerevisiae, Candida albicans, Candida maltosa, Hansenula polymorpha, Kluyveromyces lactis, Pichia pastoris and Schizosaccharomyces pombe, and into species of filamentous fungi such as Aspergillus spp., Trichoderma spp., Neurospora spp. or Penicillium spp.
  • Control sequences for yeast vectors include as examples promoter regions from genes such as alcohol dehydrogenase (ADH), endolase, glucokinase, glucose-6-phosphate iso- merase and pyruvate kinase.
  • Inducible yeast promoters having the additional advantage of transcription controlled by growth conditions are available.
  • Yeast enhancers are also advantageously used with yeast promoters. E.g. can upstream activating sequences (UAS) of one yeast promoter be joined with the transcription activation regions of another yeast promoter to create a synthetic hybrid promoter.
  • a yeast promoter may include naturally occurring promoters of non-yeast origin having the ability to bind yeast RNA polymerase and initiate transcription.
  • Other control elements that may be included in yeast expression vectors are terminators and leader sequences which encode signal sequences for secretion such as e.g. the leader sequence derived form the yeast invertase gene and the ⁇ -factor gene.
  • Methods of introducing exogenous DNA into yeast hosts are well known in the art and typically include transformation of spheroplasts or intact yeast cells treated with alkali cations.
  • the introduction can be carried out by transformation, nuclear injection, electroporation or protoplast fusion as described generally in Sambrook et al., supra.
  • a native signal sequence can be substituted by another leader such as the yeast invertase, ⁇ -factor or acid phosphatase leaders.
  • a sequence encoding a yeast protein can be linked to the coding sequence for the phenylalanine hydroxylase to produce a fusion protein that can be cleaved intra- cellularly upon expression.
  • Baculovirus expression vectors BEVs
  • recombinant insect viruses in which the coding sequence for a foreign gene is inserted behind a baculovirus promoter in place of a viral gene, e.g. polyhedrin such as it is described in US Patent No. 4,745,051.
  • a typical useful insect cell expression vector includes a DNA vector useful as an intermediate for the infection or transformation of an insect cell system, the vector generally containing DNA coding for a baculovirus transcriptional promoter, followed downstream by an insect signal DNA sequence capable of directing secretion of a desired polypeptide, and a site for insertion of the foreign gene encoding the foreign polypeptide and the foreign gene placed under transcriptional control of a baculovirus promoter, the foreign gene herein being the nucleotide sequence coding for the phenylalanine hydroxylase polypeptide of the invention.
  • Useful promoters for an insect cell expression system can be derived from any baculovi- rus infecting cells such as e.g. a baculovirus immediate-early gene IEI or IEN promoter or a strong polyhedrin promoter of baculovirus.
  • the insect expression vector for use herein may also include the polyhedrin polyadenylation signal and a selective marker.
  • DNA encoding suitable signal sequences may also be included such as e.g. the signal sequence of the baculovirus polyhedrin gene or mammalian signal sequences.
  • the prokaryotic phenylalanine hydroxylases may also be expressed in mammalian cells such as e.g. adipocytes, using promoters and enhancers that are functional in such cells.
  • Typical promoters for mammalian cell expression include as examples, the SV40 early promoter, the CMV promoter, the mouse mammary tumor virus LTR promoter, the adeno- virus late promoter and the herpes simplex virus promoter. Mammalian expression may be either constitutive or regulated (inducible).
  • Mammalian cell lines available as hosts for expression are also known and include many immortalised cell lines available from the ATCC, including Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney (COS) cells, human hepatocellular carcinoma cells, human embryonic kidney cells, human lung cells and human liver cells.
  • CHO Chinese hamster ovary
  • BHK baby hamster kidney
  • COS monkey kidney
  • human hepatocellular carcinoma cells human embryonic kidney cells
  • human lung cells and human liver cells.
  • one preferred group of host cells for expression of the phenylala- nine hydroxylase or as delivery vehicles for phenylalanine hydroxylase activtity to the gastrointestinal tract is the group of organisms generally referred to as GRAS organisms, i.e. organisms that are "generally recognised as safe".
  • GRAS organisms i.e. organisms that are "generally recognised as safe.
  • this expression refers to prokaryotic or eukaryotic micro-organisms that, based on experimental data and practical use experience, have been found not to produce any toxic or otherwise hazard- ous substances or to have any adverse effects when ingested by higher organisms including humans and other mammals.
  • the group of GRAS organisms includes micro-organisms that are conventionally used in the manufacturing of food products.
  • lactic acid bacteria designates a group of Gram positive, catalase negative, non-motile, microaerophilic or anaerobic bacteria which ferment sugar with the production of acids including lactic acid as the predominantly produced acid, acetic acid, formic acid and propionic acid.
  • the industrially most useful lactic acid bacteria are found among Lactococcus species including Lactococcus lactis, Streptococcus species, Enterococcus species, Lactobacillus species, Leuconostoc species, Oenococcus species and Pediococcus species.
  • Lactococcus species including Lactococcus lactis, Streptococcus species, Enterococcus species, Lactobacillus species, Leuconostoc species, Oenococcus species and Pediococcus species.
  • species of the obligate anaerobic bacteria belonging to the Bifidobacterium genus which are taxonomically different from the group of lactic acid bacteria are frequently included in the group of lactic acid bacteria due to their application as dairy starter cultures.
  • GRAS organisms which can be used in the above method according to the invention are yeast species used in food manufacturing such as baker's yeast, brewer's yeast and yeast organisms used in the fermentation of wine and other bever- ages.
  • yeast species that can be considered as GRAS organisms include Saccharomyces cerevisiae and Schizosaccharomyces pombe.
  • filamentous fungi having GRAS status is also contemplated.
  • the gene coding for phenylalanine hydroxylase activity is a gene coding for PhhA or an enzymatically active fragment thereof.
  • a gene can be isolated or derived from a prokaryotic organism including Chromobacterium species such as Chromobacterium violaceans and Pseudomanas species including Pseudomonas aeruginosa and Pseudomonas acidovorans.
  • the recombinant cell of the invention that comprises a nucleic acid derived from a prokaryotic organism and coding for phenylalanine hydroxylase activity, including a cell comprising a nucleic acid coding for PhhA or an enzymatically active fragment thereof, is one that further comprises a gene coding for a gene product having an enhancing or stabilising effect on the phenylalanine hydroxylase activity.
  • the expression "enchancing effect" is used to describe both the situation where the expressed phenylalaline hydroxylase is substantially inactive in the absence of the gene product, but becomes active in the presence of the gene product having an enhancing effect, and the situation where the expressed phenylalaline hydroxylase has an activity in the absence of the enhancing gene product, but this activity is increased in the presence of the activity enhancing gene product.
  • the phenylalanine hy- droxylase enhancing effect may be at least 10% increase of the enzyme activity, such as at least 20% increase including at least 30%, 40%, 50%, 75% or 100% increase.
  • the phenylalanine hydroxylase enhancing effect is increased at least 5-fold, such as at least 10-fold, 20-fold, 50-fold, 100-fold or 1000-fold, 10.000-fold, 100.000-fold or even at least 1000.000-fold.
  • stabilising effect implies that the phenylalanine hydroxylase activity enhancing gene product in addition to its enhancing effect on phenylalanine hydroxylase has a stabilising effect on this enzyme in the sense that the presence of this gene product effects that the activity of the phenylalanine hydroxylase is retained under adverse conditions, where the activity of the phen- ylalanine hydroxylase is reduced overtime in the absence of the gene products.
  • PhhB prokaryotically derived phenylalanine hydroxylase enhancing and/or stabilising gene product
  • PhhB has been found to play a key role in controlling the phenylalanine hydroxylase reaction catalysed by PhhA.
  • PhhB has been shown to regulate the expression of phhA at the posttranscriptional level (Song et al., 1999). Additionally, PhhB stimulates the PhhA catalysed reaction by regenerating the essential pterin co-factor.
  • PhhB also stimulates the PhhA reac- tion by catalysing the removal of 4a-carbinolamine and thereby preventing the formation of 7-biopterin.
  • PhhA and PhhB co-precipitates when a crude extract of £. coli (pJZ9-3a), which produces PhhA and PhhB, is treated with antibodies raised against PhhB.
  • the anti-PhhB antibodies do not recognise PhhA alone and, therefore, it was concluded that PhhA and PhhB can exist as a complex. The conclusion was supported by affinity chromatography where immobilised anti-PhhB antibodies resulted in a retention of both PhhA and PhhB from the crude extract.
  • phenylalanine hydroxylase activity enhancing and/or stabilising fragment of PhhB can be used as well.
  • gene product having phenylalanine hydroxylase enhancing or stabilising effect encompasses derivatives, mutants or fragments of any naturally occurring phenylalanine hydroxylase enhancing or stabilising gene products including the above prokaryotic gene products having such an effect which are naturally produced by Chromobacterium violaceans and Pseu- domanas species including Pseudomonas aeruginosa and Pseudomonas acidovorans.
  • derivative refers to modifications of the above gene product that has retained at least part of the enhancing or stabilising effect of the parent polypeptide. Such modifications can be substitutions, additions and/or deletions of at least one amino acid in such polypeptides. More specifically, “derivative” is a polypeptide having, at the amino acid level, an identity with any of the above naturally occurring gene products which is at least 30%, including at least 40%, 50%, 60%, 70%, 80%, 90% or 99% identity.
  • “Derivative” also encompasses gene products having a phenylalanine hydroxylase enhancing effect that show at least 30% similarity to a naturally occurring gene products including at least 40%, 50%, 60%, 70%, 80%, 90% or 99% similarity with any of the above naturally occurring gene products, the term "similarity" being defined as above.
  • the cell expresses the gene product having phenylalanine hydroxylase activity such as the PhhA as defined hereinbefore, and the gene product having an enhancing effect on the phenylalanine hydroxylase activity such as the above defined PhhB, as a fusion protein, i.e. as a monomeric molecule. It was found that such a fusion protein is capable of withstanding otherwise unfavourable conditions, such as pH, essentially without loss of activity. It is assumed that this highly advantageous stability is due to the fact that the protein domains of the two components of the fusion protein are not dissociated.
  • the recombinant cell according to the invention may comprise a signal or secretion sequence operably linked to the gene coding for a gene product having phenylalanine hydroxylase activity.
  • Any signal sequence that is capable of effecting secretion of the gene product across the cell membrane in the particular cell that is used, is encompassed.
  • One useful example of a signal sequence is a secretion signal sequence derived from the Lactococcus lactis strain MG1363 (van Asseldonk et al., 1990).
  • the expression of the gene coding for the gene product having phenylalanine hydroxylase activity can be expressed under the control of its native promotor. However, it may be advantageous to replace the native promoter with a different promoter such a promoter that effects an increased level of expression, relative to the level obtained with a native promoter.
  • the promoter to which the gene coding for phenylalanine hydroxylase activity is operably linked can be a constitutive or a regulatable (inducible) promoter.
  • the factors regulating the latter type of promoters can be selected from physical and chemical factors such as the temperature, composition of the growth medium including the ionic strength, pH and absence/presence of specific regulating substances. Examples of such regulatable promoters are disclosed in WO 94/16086 which is incorporated herein by reference.
  • a particularly useful promoter described in WO 94/16086 is the pH regulatable P170 pro- moter.
  • the gene coding for the gene product having phenylalanine hydroxylase activity may also code for a tagging sequence associated with the gene product.
  • tagging sequences include His tags which are well- known in the art, e.g. the His15-tag as used herein.
  • the gene coding for the gene product having phenylalanine hydroxylase activity can be a wild-type gene or it can be derived from such a wild-type gene by any of the genetic modifications described above.
  • such a gene whether it is a wild-type gene or a gene derived from a wild-type gene, can be part of a nucleic acid sequence coding for a fusion protein comprising the phenylalanine hydroxylase activity and a gene product having an enhancing and/or stabilising effect on the activity of the phenylalanine hydroxylase, including a DNA sequence coding for a fusion gene product comprising PhhA and PhhB or a modified PhhB where the first methionine residue (Met) is substituted with a different amino acid residue such as e.g threonine (Thr).
  • the nucleic acid sequence coding for a fusion protein comprises at least one further coding sequence.
  • the gene coding for a gene product having an enhancing effect on the phenylalanine hy- droxylase activity can be selected from a wild-type gene and a gene that is derived from a wild-type gene.
  • the invention pertains to a recombinant lactic acid bacterial cell comprising a wild-type nucleic acid coding for a gene product having phenylalanine hydroxy- lase activity or a nucleic acid coding for such a gene product that is derived from a wild- type nucleic acid.
  • the coding gene can be derived from a prokaryotic organism such as it is described above. However, it may be preferred to use a coding nucleic acid that is derived from a eukaryotic organism including a mammalian species such as humans or rodents, examples of which are sequences coding for PAH as described hereinbefore.
  • the recombinant lactic acid bacterial of the invention may further comprise a gene coding for a gene product having an enhancing effect on the phenylalanine hydroxylase activity that is selected from a prokaryotic species such as PhhB or a phenylalanine hydroxylase activity enhancing fragment thereof, including modified PhhB where the first Met residue is substituted with a different amino acid residue, and a mammalian gene coding for such an enhancing gene product including the mammalian phenylalanine hydroxylase stimulating (PHS) protein (Citron et al, 1992) which was found to act as pterin 4 ⁇ -carbinolamine dehydratase.
  • PHS mammalian phenylalanine hydroxylase stimulating
  • the two gene products are advantageously expressed in the lactic acid bacterial cell as a fusion protein such as it is described above.
  • the lactic acid bacterial cell expressing the fusion protein may comprise at least one further coding sequence.
  • the recombinant lactic acid bacterial cell can be selected from any lactic acid bacterial species as defined above, including a cell of Lactococcus lactis e.g. the strain designated MG1363 or derivatives hereof.
  • the recombinant lactic acid bacteria may comprise signal sequences operably linked to the gene coding for a gene product having phenylalanine hydroxylase activity, and the gene coding for the gene product having phenylalanine hydroxylase activity may be expressed under the control of a promoter not natively associated with the gene and/or under the control of a regulatable promoter such as described above. Additionally, the gene coding for the gene product having phenylalanine hydroxylase activity may also code for a tagging sequence as defined above.
  • the invention relates to a fusion protein comprising as a first component an amino acid sequence having phenylalanine hydroxylase activity as defined hereinbefore and as a second component, a polypeptide that has an enhancing or stabilising effect on the phenylalanine hydroxylase activity of the fusion protein as it is defined above.
  • Either of the two components may independently be derived from prokaryotic organisms including the PhhA polypeptide and the PhhB polypeptide as described above, or they may be derived from a eukaryotic organism such as a mammal.
  • An example of a polypeptide having phenylalanine hydroxylase activity is the PAH polypeptide that is found i.a.
  • the PHS polypeptide that can also be derived from humans and animal species. It will be appreciated that either of the components of the fusion protein may comprise full length wild-type polypeptides having the above activities or fragment, mutant or derivatives hereof as defined above, having phenylalanine hydroxylase activity or phenylalanine hydroxylase activity enhancing effect, respectively.
  • a fusion protein in which at least one amino acid in at least one of a first and second wild-type component is substituted by a different amino acid is highly effective such as a fusion protein where the first Met residue of the second component is substituted by a different amino acid including a Thr residue.
  • active fusion proteins can be constructed wherein at least 2, such as at least 3, 4, 5, 10 or 20 amino acids of wild- type components have been substituted or deleted or where at least 1 , such as at least 2, 3, 4, 5, 10 or 20 amino acids in addition to any of the first and second wild-type components have been inserted.
  • the two above components of the fusion protein may both be of eukaryotic origin or of prokaryotic origin.
  • one of the components may be of prokaryotic origin and the other one of eukaryotic origin.
  • the phenylalanine hydroxylase enhancing effect of the sec- ond component of the fusion protein may be an at least 10% increase of the phenylalanine hydroxylase, such as at least 20% increase including at least 30%, 40%, 50%, 75% or 100% increase or, in other, preferred embodiments the phenylalanine hydroxylase enhancing effect is increased at least 5-fold, such as at least 10-fold, 20-fold, 50-fold, 100- fold or 1000-fold 10.000-fold, 100.000-fold or even at least 1000.000-fold.
  • the enhancing effect of the second component may be even higher when the two components are expressed as a fusion protein using certain conditions where non-cova- lent complex binding of PhhA and PhhB is un-favoured as compared to the wild-type situation where the two components are expressed as separate gene products in a cell, such as at least 2-fold higher, e.g. at least 5-fold or 10-fold higher. Accordingly, the en- hancing effect of the second component of a fusion protein of the invention may be at least 10% higher than in the wild-type situation, such as at least 20% higher or even at least 30%, 40% or 50% higher.
  • the first component and/or the second component of the fusion protein according to the invention is derived from a Gram negative bacterium including Pseudomonas aeruginosa and Chromobacterium violeans.
  • a fusion protein comprising the PhhA and the PhhB polypeptide from either of these bacterial species is designated PhhAB.
  • the fusion protein of the invention is provided with a tagging sequence permitting that the protein can be readily separated from a medium.
  • tags including a His-tag, e.g. a tag having the sequence Met-Lys-(His-Gln) 6 tag.
  • His-tag e.g. a tag having the sequence Met-Lys-(His-Gln) 6 tag.
  • Such tags are well-known in the art.
  • the fusion protein according to invention may be a protein only consisting of amino acid residues derived from the two components. However, it is also possible to interlink the two active components by one or more amino acid residues linking the amino acid sequence having phenylalanine hydroxylase activity and the polypeptide enhancing the phenylalanine hydroxylase activity or any other enhancing proteins.
  • Such linking sequences or spacer sequences may comprise 1-100 amino acids such as 2-50 amino acids or 5-25 amino acids.
  • the fusion protein may, in addition to the two above active components, comprise further amino acid sequences, e.g. sequences facilitating the expression and/or secretion of the fusion product according to the invention such as leader or signal sequences or fragments of gene products. Additionally, the fusion protein may comprise one or more active gene products, including, but not limited to, enzymatically active gene products such as lipases, proteases and polysaccharide degrading enzymes. It will be appreciated that the fusion protein may comprise additional first and second components as defined above.
  • the fusion protein of the present invention may comprising a sequence selected from the group consisting of:
  • RQPDDNGFIHYPETEHQVWNTLITR SEQ ID NO:6
  • ACQEYLDGIEQLGLPHERIPQLDEINRVLQATTGWR SEQ ID NO: 7
  • ID NO 9 IDILQPLYFVLPDLKRLFQLAQEDIMALVHEAMRLGLHAPLFPPK (SEQ ID NO: 10) TPTTTALTQAHCEACRADAPHVSDEELPVLLRQIPDWNIEVRD (SEQ ID NO:11) HALAFTNAVGEISEAEGHHPGLLTEWGK (SEQ ID NO 12) NDFIMAARTDEVAKTAEGRK (SEQ ID NO 13)
  • MKHQHQHQHQHQHQKTTQYVAR (SEQ ID NO:14), or any combination thereof.
  • the expression "essentially pure” refers to a fusion protein that has been purified to an extent where substantially no other proteins are present.
  • a purified fusion protein can be obtained by protein purification methods that are well-known in the art such as precipitation, chromatography or filtration techniques. The absence of contaminating protein can be confirmed by SDS-PAGE gel electrophoresis methods followed by staining of the gel e.g. silver staining or staining by Coomassie Brilliant Blue.
  • this method comprises the steps of providing a recombinant cell as defined hereinbefore, comprising a nucleic acid coding for a phenylalanine hydroxylase active gene product or a fusion protein as also defined above, cultivating said cell under condi- tions where the gene coding for the gene product having phenylalanine hydroxylase activity or the fusion protein is expressed, and harvesting the phenylalanine hydroxylase active gene product.
  • the invention provides a composition comprising recombinant cells as defined above and a pharmaceutical composition comprising such cells and a pharmaceutically acceptable carrier.
  • Such compositions are useful as dietary adjuncts or pharmaceutical preparations which can be administered to PKU patients to treat phenylketonuria.
  • Particular useful compositions are composition where the cells are cells selected from a generally recognised as safe (GRAS) species as defined hereinbefore such as lac- tic acid bacterial species.
  • GRAS generally recognised as safe
  • the cells of the dietary or pharmaceutical compositions of the invention that are not viable or metabolically active can be used as delivery vehicles for pre-formed gene products, it will be appreciated that it may be preferred that the cells of the dietary or pharmaceutical compositions of the invention are delivered to the Gl tract in a viable and metabolically active condition.
  • viable cells in the Gl tract it is essential that the cells as such are tolerant to the conditions prevailing in the Gl environment or that the selected cells, if they are not sufficiently tolerant, are in a form where they are protected against adverse conditions in the Gl tract. Accordingly, in one suitable embodiment, the cells are protected against such adverse conditions, in particular the acidic conditions in the stomach and the anterior parts of the duodenum.
  • Such a protection can be provided by encapsulating the cells in materials that are resistant to the adverse conditions, thus protecting the cells under such conditions, but which are degrad- able under non-adverse conditions in the intestines.
  • Such encapsulating or protective materials can readily be selected by the person of skill in the art.
  • the cells of the dietary or pharmaceutical composition are not only capable of being delivered in a viable state to the site of phenylalanine hydroxylase activity but are also capable of colonising, metabolising and/or proliferating in the gastrointestinal tract.
  • the cells may preferably be cells in which surface structures are expressed that bind to receptor moieties in the Gl tract.
  • Such structures include as examples fimbrial structures or pili or outer membrane proteins.
  • dietary or pharmaceutical compositions comprising viable cells as described above may be useful in the treatment of PKU patients, it may be convenient to treat such patients with a composition comprising a fusion protein of the invention. Accordingly, the invention provides in a further aspect a pharmaceutical composition comprising such a fusion protein and a pharmaceutically acceptable carrier. Such dietary or pharmaceutical compositions are preferably protected against gastrointestinal conditions such as it is de- scribed above.
  • composition comprising either viable cells or fusion proteins according to the invention may comprise a further active component such as e.g. a peptidase and a protease.
  • a further active component such as e.g. a peptidase and a protease.
  • the advantages of providing peptidases and/or proteases include that the dietary protein is degraded to provide phenylalanine in a configuration that is accessible to the activity of the phenylalanine hydroxylase.
  • This method comprises that a proteinaceous food product starting material containing phenylalanine is contacted with a recombinant cell expressing phenylalanine hydroxylase and/or a phenylalanine hydroxylase enhancing polypeptide or a fusion protein as described above under conditions where the gene product having phenylalanine hydroxylase activity is enzymatically active for a period of time that is sufficient to convert at least part of the phenylalanine content of the starting material into compounds that do not cause phenylketonuria.
  • at least 10%) of the phenylalanine content is converted, such as at least 15%, 20%, 25%, 30%, 50% or 90%.
  • the proteinaceous food product starting material subjected to treatment can be selected from a vegetable proteinaceous material, an animal proteinaceous material including a milk protein such as a casein, a globulin and a whey protein, and a microbially derived proteinaceous material.
  • Fig. 1 shows the conversion of phenylalanine to tyrosine and the regeneration reactions of BH 4 .
  • PAH/PhhA Phenylalanine hydroxylase from man or rat/bacteria
  • PHS/PhhB phen- ylalanine hydroxylase stimulating protein or carbinolamine dehydratase from man or rat/bacteria
  • DHPR dihydropterine reductase
  • Fig. 2 is an alignment of hydroxylase proteins.
  • hPAH Human phenylalanine hydroxylase
  • Trp-H and Tyr-H human tryptophan and tyrosine hydroxylases
  • P. aeruginosa and C. violaceum phenylalanine hydroxylases P. aeruginosa and C. violaceum phenylalanine hydroxylases
  • Fig. 3 is a map of inserts in expression plasmids. Plasmid names are given at the left side. The plasmid map includes promoters, inserted DNA and terminators, if present. A thick line indicates a non-coding DNA insert and an open bar indicates a gene. Gene names are stated and restriction sites are indicated: H: HincW; P: Psfl; Sp: Sph ⁇ ; S: Sa/I; X: Xhol, B: SspHI. Terminators are indicated with an ⁇ . Promoters are shown as a P with an arrow. The map is not drawn to scale; Fig.
  • TUC18 is a reference strain containing vector without an insert.
  • the molecular sizes are given at the left side in kDa.
  • the number at the right side indicates the position of PhhA corresponding to a molecular size of 30 kDa;
  • Fig. 4B is a TLC autoradiogram of cell extracts from JZ9M131, lane 1 (positive control), and TJZ9M ⁇ B, lanes 2, 3 and 4, in which samples were taken 1, 3 and 11 hours after IPTG induction.
  • Lane 5 contained a TUC18 (negative control) sample taken 3 hours after IPTG induction.
  • the dots at the bottom indicate the position of sample loading.
  • the bars at the top indicate the position of the migration front.
  • the migration positions of the [ 14 C]- L-phenylalanine and the [ 14 C]-L-tyrosine are shown at the right side;
  • Fig. 5 is a DNA sequence of the DNA insert in pFUSAB and the deduced amino acids of the translation product (SEQ ID NO:1). Restriction enzyme sites and amino acids origi- nating from linker sequences are shown in bold, the putative ribosome binding site is underlined and the dotted line indicates amino acids originating from the N-terminus of LacZ. A bolded underline shows the amino acids derived from the junction DNA sequence;
  • Fig. 6A shows a SDS-PAGE analysis of protein produced in FUSAB.
  • Lane R shows cell extract from ABUC18, a reference strain containing pUC18.
  • Lanes 1 , 2 and 3 show cell extracts from FUSAB after IPTG induction for 1 , 2 and 3 hours.
  • the numbers to the left indicate molecular sizes in kDa.
  • the number at the right side shows the position of PhhAB corresponding to a molecular size of 49 kDa;
  • Fig. 6B is a TLC autoradiogram of cell extracts from ABUC18 (lane 1) FUSAB (lane 2) and ABJZ9M131 (lane 3).
  • the dots at the bottom indicate the position of sample loading.
  • the bars at the top indicate the position of the migration front.
  • the migration positions of the [ 14 C]-L-phenylalanine and [ 14 C]-L-tyrosine are indicated;
  • Fig. 7 is the DNA sequence of a His15-encoding tag introduced into pMGJ4 (SEQ ID NO:2). Restriction enzyme sites and amino acids originating from linker sequences are shown in bold, the putative ribosome binding site is underlined and the dotted line indicates amino acids originating from the His15-tag; Fig. 8 shows a SDS-PAGE analysis (10% gel) of affinity purified proteins.
  • Lane 1 Rainbow marker (Amersham Pharmacia)
  • lane 2 hisphhA (0,1nmol, 3.1 ⁇ g, 31 kDa)
  • lane 3 hisphhAB (0.1 nmole, 4.8 ⁇ g, 48 kDa)
  • lane 4 MBP-hPAH (0.1 nmole, 9.4 ⁇ g, 94 kDa). Sizes in kDa are indicated to the left;
  • Fig. 9 illustrates a pterin-4 ⁇ -carbinolamine dehydratase assay.
  • the PhhB activity of PhhAB was assayed by adding PhhAB to a phenylalanine hydroxylase reaction using purified human PAH enzyme fused to maltose binding protein (MBP).
  • MBP maltose binding protein
  • the change in UV ab- sorbency was monitored at 244 nm. At this wavelength it was possible to detect a tran- sient accumulation of the highly unstable pterin-4tx-carbinolamine intermediate product during the PAH reaction (curve marked by rhombus).
  • Figs. 10A and B show DNA sequences of the inserts in plasmids pAMJ792 (A)(SEQ ID NO:3) and pAMJ805 (B)(SEQ ID NO:4). Restriction enzyme sites and amino acids originating from linker sequences are shown in bold and the putative ribosome binding site is underlined. The dotted line indicates the encoded Usp45 secretion signal;
  • Fig. 11 is a TLC autoradiogram of lactococcal proteins.
  • Lanes 1 and 2 contain intracellular cell extracts from strains L. lactis AM J817 and AMJ792.
  • Lanes 3 and 4 contain concentrated supematants from strains AMJ817 and AMJ792.
  • L. lactis strain AMJ817 carried pAMJ206 (containing no insert).
  • Lane 5 contained [ 14 C]-L-tyrosine.
  • the dots at the bottom indicate the position of the sample loading site and the bars at the top side indicate the migration front.
  • Phe and Tyr show the position of L-phenylalanine and L-tyrosine, respectively. Traces of [ 14 C]-D-phenylalanine were observed just above Phe in the lanes con- taining [ 14 C]- phenylalanine;
  • Fig. 12 is a TLC autoradiogram of cell extracts showing extracellular and intracellular PhhA activity in L lactis AM J792 (lanes 1 and 3) and L lactis AMJ805 (lanes 2 and 4). Lanes 1 and 2 contained concentrated supematants. Lanes 3 and 4 contained intracellular extracts. Phe and Tyr indicate the position of L-phenylalanine and L-tyrosine. Traces of [ 14 C]-D-phenylalanine were observed just above Phe in the lanes containing [ 14 C]- phenylalanine.
  • Fig. 13 shows the phenylalanine hydroxylase activity measured with TLC assay.
  • phhAB and MBP-hPAH convert 85% and 74% of the phenylalanine to tyrosine in 60 minutes using 200 ⁇ M phenylalanine;
  • Fig. 14 shows phenylalanine hydroxylation at different concentrations of the substrate
  • Fig. 15 illustrates the pH dependence of hisPhhAB activity. More than 75% of the maximal activity was retained between pH 5.5 and 8.5;
  • Fig. 16 illustrates the hydroxylation reaction as a function of temperature, the reaction was carried out for 10 minutes.
  • the optimal assay temperature was 32°C, 50% of the activity was retained between 18°C and 42°C;
  • Fig. 17. shows a mass spectrogram of intact protein molecule.
  • the mass spectrometry showed a mass of 48004 Da +/- 96 Da which correlates with the theoretical mass of 48032 Da;
  • Fig 18. Illustrate the result of mass spectrometric peptide mapping.
  • the underlined parts of the protein were identified as the combined tryptic and chymotryptic peptides. Underlined sequences are enclosed as SEQ ID NO: 6-13.
  • strains and plasmids used herein are listed in the below Table 1.
  • ampicillin 100 ⁇ g/ml
  • kana- mycin 50 ⁇ g/ml
  • streptomycin 25 ⁇ g/ml
  • tetracycline 12.5 ⁇ g/ml
  • M9 medium supplemented with phenylalanine, tryptophan and chorismate precursors was used as recommended by Wallace and Pittard (1969).
  • the lactococcal strains were selected on M17 medium (Oxoid) supplemented with 0.1 % w/v glucose, 0.1 % w/v arginine and 1 ⁇ g/ml erythromycin.
  • a basic medium mix, BMM was developed.
  • BMM is a modification of the SAIV medium (Jensen and Hammer, 1993).
  • the medium components of SAIV were included at three times the original concentration, except that the sodium acetate and the sodium chloride from the sodium saline phosphorus ammonium mixture (NSPA) was added at the original concentration and the medium was supplemented with 5g of yeast extract pr. litre. Also, the morpholinopropane sulfonate buffer (MOPS) from the MOPS-base was excluded.
  • the fermented cultures were kept at pH 6.0 by automatic addition of 2M KOH. The cultures grew to a maximum optical density of 6.5 determined at 600 nm. The cultures used 0.14 mol KOH per litre. The cultivation temperature was 30°C for both selection procedures and fermentations.
  • Induction of £. coli strains was performed by growing cells to an optical density of 0.5 measured at 600 nm. Then 0.5 mM isopropy-thio- ⁇ -D-galactoside (IPTG) was added and growth was continued for a further 3 hours.
  • IPTG isopropy-thio- ⁇ -D-galactoside
  • Plasmid transformations were conducted by electroporation of both £. coli strains and Lactococcus lactic MG1363.
  • Cell treatment procedures for £. coli were as suggested by BioRad, the manufacturer of the electrotransformation apparatus Gene PulserTM connected with a Pulse Controller.
  • the competent cells of lactococcal strain MG1363 was prepared as described by Holo and Nes, 1989.
  • DNA restriction enzymes were purchased from New England BioLabs and used as recommended by the supplier.
  • Plasmid DNA was extracted from £ coli using alkaline lysis and affinity columns manufactured by Genomed GmbH, Germany, according to the protocol recommended in the JETSTARTM Plasmid Kit.
  • Plasmid DNA from lactococcal strains was extracted according to the procedure described by O'Sullivan and Klaenhammer, 1993. All DNA manipulations were performed as described by Sambrook et al. 1989. Sequences of all plasmid constructions were verified by conducting the procedures recommended by Pharmacia Biotech with the ALPex- pressTM automated sequencing facilities
  • Protein expression products were analysed by SDS-PAGE by the use of the NOVEXTM electrophoresis system.
  • protein content samples were submitted to gradient gels of 4-20% polyacryamide and the gels were stained with Coomassie Brilliant Blue. The procedures were conducted according to the recommendations of the supplier.
  • PCR reactions were conducted using the following procedure: 30 seconds of denatu- ration at 95°C, then 30 cycles consisting of denaturation for 30 seconds at 95°C, annealing for 30 seconds at 52°C and extension for 1 minute at 72°C and a final extension for 7 minutes at 72°C.
  • the DNA reaction products were subjected to agarose gel electrophoresis and the appropriate fragments were extracted using the QIAGENTM Gel Extraction Kit.
  • the assay mixture was incubated at 25°C at a final volume of 50 ⁇ l, containing 50 mM N- [2-hydroxyethyl]piperazine-N'-[2-ethanesulfonic acid] (KOH-Hepes), pH 7.0, 200 mM KCI, 0.1 mM ferrous ammonium sulphate, 0.4 mg/ml catalase (65,000 U/mg, Roche Molecular Biochemicals), 5 mM dithiothreitol (DTT), 0.2 mM L-phenylalanine, 0.1 mM (6R)-5,6,7,8- tetrahydro-L-biopterin dihydrochloride (BH 4 ) (Schircks Laboratories, Switzerland), 2 mM phenylmethylsulfonyl fluoride (PMSF). Reactions were started by the addition of BH 4 . In order to keep the stock of BH 4 in a reduced stage, 4 mM of the DTT in the
  • Assay samples including [ 14 C]phenylalanine were analysed by TLC.
  • the assay mixture was centrifuged at 15,000g for 5 minutes and 5 ⁇ l sample was spotted onto a silica gel 60 plate (Merck).
  • the chromatography plate was placed in a solution of 55:35:10 v/v chloro- form:methanol:ammonia and run for 1 hour.
  • the product formation was visualised from the dried TLC plate by autoradiography on Kodak BioMax MR film for 9 hours or more.
  • the formation of tyrosine was evaluated by including reference samples of L-[U- 14 C]tyrosine samples on the plates.
  • HPLC separation was performed on a NovaPak C18 column (3.9X150 mm) connected with the Waters Corporation 626 LC system including a 717 autosampler and a 474 scanning fluorescence detector. Collected data were analysed using Waters Corporation Expert Ease software. Amino acids, peptide, DOPA, dopamine, 5-hydroxytryptophan and serotonin were all resolved by the same buffer gradient. The column was washed and saturated with the buffer A (500 mM NaCI and 20 mM Tris HCI, pH 7.9). The gradient was obtained by controlled dilution of A buffer in water. The gradient program in respect of percentage of A buffer was as follows; 0 min. 100%), 0.5 min. 99%, 18 min.
  • £ coli was grown to an optical density of 0.5 determined at 600 nm. Promoter induction was achieved by addition of IPTG to a final concentration of 0.5 mM and growth was continued for three hours before cells were harvested. Cells from 50 ml of culture were centrifuged at 4,000g for 10 minutes at 4°C and then re-suspended in 1,5 ml buffer A includ- ing 0.1 mg/ml lysozyme. Cells were disrupted by sonication and then centrifuged at 10,000g for 30 minutes at 4°C. The resulting extract was collected and used in column affinity purification procedures.
  • a QIAGENTM Ni-NTA resin column was loaded with sample and washed with buffer A supplemented with 20 mM imidazole.
  • the tagged fusion protein was eluted in buffer A containing 200 mM imidazole.
  • the extracellular enzymatic activity was evaluated from the culture supematants.
  • the supematants were re-centrifuged at 20,000g for 15 minutes at 4°C and concentrated on a Millipore Biomax 10NMWL filters. Samples of 4 ml were centrifuged at 5,000g for 30 minutes at 5°C, then washed with 2 ml washing buffer (50 mM Hepes-KOH, pH 7.0 and 200 mM KCl) and finally concentrated 80 times by centrifugation for another 30 minutes under the same conditions. The concentrate was treated on a BioRad P30 micro spin column equilibrated with washing buffer. The untreated supematants could be stored at -20°C without detectable loss of activity.
  • a plasmid, pJZ9M131 (Fig. 3), identical to pJZ9-3a was constructed. The construction was performed as described by Zhao et al., 1994. Plasmid pJZM131 was introduced into £ coli TOP10 and the resulting strain was designated JZ9M131. Also, the plasmid, pJZ9M ⁇ B (Fig.3), which is a derivative of pJZ9M131 having a deletion in phhB gene, was constructed. The pJZ ⁇ M ⁇ B construction was identical to the pJZ9-5 plasmid described by Zhao et al., 1994, and it was obtained using the same strategy.
  • Plasmid pJZ9M ⁇ B was introduced into the two £. coli strains TOP10 and TOPI q and the resulting transformants, JZ9M ⁇ B and TJZ9M ⁇ B, were propagated in LB containing glucose and ampicillin.
  • E.coli TOPI q provides controlled gene expression by tight repression of the lac promotor. Induction of gene expression was performed as described in the Materials and Methods section above. Samples were collected for total protein analysis by SDS-PAGE and determination of PhhA activity (Fig. 4A and 4B). It was demonstrated that PhhA could be produced in strains JZ9M ⁇ B and TJZ9M ⁇ B. However, it was also demon- strated that the highest PhhA level was produced in TJZ9M ⁇ B and that no detectable PhhA activity was found in the cell extracts of TJZ9M ⁇ B (Fig. 4B).
  • the mammalian phenylalanine hydroxylation activity in vivo is dependent on the regeneration of tetrahydrobiopterin co-factor BH 4 .
  • a co-purified protein supports the PAH activity (Lazaurus and Benkovic, 1983 , Lei and Kaufman, 1998)
  • This protein was designated phenylalanine hydroxylase stimulating protein, PHS.
  • PHS acts as a biopterin 4a-carbinolamine dehydratase corresponding to the bacterial PhhB (Lazaurus and Benkovic, 1983, Citron et al., 1992).
  • the detection of a co-purified dehydratase enzyme suggests that PhhB stimulates PhhA activity, not only by improved co-factor re- generation, but also by working as a complex with PhhA having a high stability.
  • the focus is on the production of an enzyme with a high phenylalanine hydroxylase activity and on the development of a fusion enzyme that ensures a stable and active PhhA-PhhB complex.
  • the development of a functional fusion enzyme was expected to facilitate production and secretion in recombinant micro-organisms.
  • Initial protein characterisation of PhhA strongly indicates that the protein acts as a monomer, in contrast to the homologous mammalian phenylalanine hydroxylases (Kaufman, 1993).
  • a prokaryotic-based fusion enzyme was chosen since the enzyme should work as a monomer after secretion from the micro-organism.
  • the first step in constructing the gene fusion, phhAB was performed by PCR amplification of each of the separate phhA and phhB genes. Both amplification reactions were conducted with the pJZ9 plasmid as template.
  • the phhA fragment was amplified with an upstream oligonucleotide (in the following also referred to as oligo), PHHA.for and the downstream oligo, phhAfus.rev.
  • oligo upstream oligonucleotide
  • PHHA PHHA.for
  • phhAfus.rev the downstream oligo
  • the latter oligo contained 14 nucleotides that were com- plementary to the 5' end of the phhB fragment.
  • the upstream phhB oligo, phhBfus.for was used together with the downstream oligo, Phhb-rev, containing a Sail site positioned after the phhB stop codon.
  • the phhBfus.for oligo contained 11 nucleotides that were complementary to the 3' end of the phhA fragment. Oligo DNA sequences are presented in Table 2 below.
  • Oligos for sequence verification were all manufactured with 5'Cy5 for emission detection.
  • the resulting PCR fragments were designed such that a mixture of melted PCR-products could hybridise between the 3' end of the p ⁇ M-containing fragment and the 5' end of the fragment containing phhB.
  • the annealed ends were extended using Taq polymerase and the resulting fragment was PCR amplified using the two outer primers PHHA. for and phhb-rev.
  • the phhAB fragment containing the fusion was inserted into the PCR-cloning vector pCR2.1 , which was a ready-to-clone version prepared with A-protruding ends.
  • the £ coli lac promoter, the corresponding ribosome binding site and a short DNA fragment encod- ing the 26 N-terminal codons of lacZ is located upstream of the inserted phhAB gene.
  • the resulting plasmid, pFUSAB was introduced into the tyr auxotroph £. coli strain AB3257.
  • the transformants were selected on minimal medium without tyrosine, but supplemented with phenylalanine, lactose and ampicillin, which only permits growth of transformants with functional PhhA activity. Surprisingly, only a single transformant was found. This experiment was repeated twice, but no additional transformants were obtained. Using E. coli AB3287, a transformation efficiency of 10 5 -10 6 was routinely reached with 100 ng of vector DNA ligated with 5 times the amount of insert DNA. This transformant, FUSAB, was restreaked on LB plates containing glucose and ampicillin.
  • Plasmid was extracted and DNA sequencing showed that, following the 26 codons of the 5' end of the £ coli lacZ, pFUSAB contained phhA immediately followed by the expected junction sequence encoding 22 amino acids presented in Fig. 5 (SEQ ID NO:1). However, the original start codon, ATG, of the phhB gene downstream of the junction sequence was changed to ACG. This codon change leads to incorporation of threonine instead of the original methionine. The apparent need for a codon substitution could account for the low number of transformants observed in the functional selection. The fusion enzyme might result from an appropriate junction providing a stable and functional conformation. Relevant DNA and amino acid sequences are presented in Fig. 5 and plasmid inserts are shown schematically in Fig. 3.
  • PhhAB can be produced in £. coli and that the PhhA activity is similar to the activity found in a strain that produces PhhA and PhhB as separate polypeptides.
  • the phhAB encoding region of pFUSAB was transferred to an £. coli high-level expression vector, pTrcHis.
  • the original peptide-tag was substituted with a Met-Lys-(His-Gln) 6 tag (the His15-tag, Unizyme Laboratories, Denmark) and a SspHI restriction site suitable for introduction at the ⁇ /col vector site was introduced.
  • a PCR fragment was produced using the oligo DNAs, PHHA-His.for and pseudoPAH.rev using pJZ9M131 as template.
  • the oligo sequences are given in Table 2.
  • the resulting 815 bp PCR fragment carried a SspHI site located at the 5' end, and an internal Pst site.
  • SspHI and Pstl digestion the resulting 0.4 kb fragment was isolated.
  • the 0.4 kb PCR-fragment was inserted into the ⁇ /col and Xhol sites of the pTrcHis vector.
  • Plasmid pMGJ4 was introduced into £. coli TOP10 and the resulting strain was named MGJ4. The correct DNA sequence of the junctions of the inserted fragments in pMGJ4 was confirmed (Fig. 7)(SEQ ID NO:2).
  • Plasmid pMGJ4 has been deposited in accordance with the Budapest Treaty with DSM under the accession number DSM 13242.
  • the tagged protein was purified by applying cell extract to a nickel charged chroma- tographic column which was subsequently washed and eluted using standard protocol conditions described by the manufacturer (QUIAGEN)
  • the purified recombinant protein was shown to harbour PhhA activity (Fig. 9).
  • the protein was purified to more than 90% purity as judged from Coomassie Brilliant Blue stained SDS-PAGE gels (Fig. 8).
  • Lane 1 Rainbow marker (Amersham Pharmacia)
  • lane 2 hisPhhA (0.1 nmol, 3.1 ⁇ g, 31 kDa)
  • lane 3 hisPhhAB (0.1 nmole, 4.8 ⁇ g, 48 kDa)
  • lane 4 MBP-hPAH (0,1 nmole, 9.4 ⁇ g, 94 kDa).
  • Total protein yields were evaluated by the Lowry method (Harlow and Lane, 1988) to be 3.18 mg.
  • HisPhhAB purified His15-tagged PhhAB
  • HisPhhAB showed affinity for nickel charged chromatographic columns, which were used for easy purification of the recombinant enzyme. Furthermore, HisPhhAB was shown to have PhhA activity.
  • the specific PhhA activity of purified HisPhhAB in two different preparations was determined to be in the range of 4 to160 nmol-min "1 -mg "1 which is in accordance with the previously reported specific activity ranging from 4 to 153 nmol-min "1 -mg "1 for co-purified PhhA and PhhB (Zhao et al., 1994).
  • HisPhhAB maintained PhhA activity when stored for more than a month at 4°C in 50 mM KCl, 20 mM KsPO . In contrast to the mammalian PAH (Kowlessur,ef al., 1996), pre-incubation with phenylalanine was not observed to activate the PhhA activity of HisPhhAB.
  • the human PAH was reported to catalyse hydroxylation of phenylalanine in more than one position of the aromatic ring (Kaufman, 1993). Although these reactions occur at a low rate, the biological importance is significant, since the resulting compounds may exert neurotoxic effects (Kaufman, 1993). Therefore, the hydroxylation capability of the HisPhhAB product was examined with special reference to formation of DOPA, dopamine, 5- hydroxytryptophan and serotonin. The ability of HisPhhAB to hydroxylate phenylalanine integrated in proteins would be of practical importance for using PhhAB to convert phen- ylalanine in foods. Therefore, the potential ability to hydroxylate phenylalanine incorporated in the dipeptide Gly-Phe was also examined.
  • Phenylalanine, tyrosine, tryptophan or Gly-Phe was incubated with HisPhhAB and product formation was analysed by HPLC. After incubation, high sensitivity of detection was ob- tained by the derivatisation of all components in the reaction mixture with 6-aminoquin- oline (AQC) followed by detection of the fluorescence emitted upon excitation. Only conversion of phenylalanine to tyrosine could be detected.
  • AQC 6-aminoquin- oline
  • PhhAB specifically hydroxylates phenylalanine at the para-position without any detectable hydroxylation of the other tested aromatic compounds.
  • PhhB activity can be analysed by using radiolabeled 4a-carbinolamine as a reagent. As shown in Figure 9, the addition of 75 ⁇ g HisPhhAB decreased the pool of 4a-carbinolamine strongly indicating that PhhAB has PhhB activity.
  • PhhAB fusion product may readily be produced by micro-organisms including hosts that are generally regarded as safe.
  • a PCR fragment was produced using the upstream oligo PHHA-aug.for and the downstream oligo, pseudoPAH.rev, using pJZ9M131 as template.
  • the resulting 805 bp PCR fragment carried a 5' end positioned SspHI site and an internal Psfl site.
  • the resulting 0.34 kb fragments was isolated.
  • the 0.34 kb PCR-fragment was inserted into the SspHI and Sail sites of pAMJ206.
  • the resulting plasmid, pAMJ792 (Figs. 3 and 10A), contained the phhAB gene placed downstream of the P170 promoter and the ribosome binding site of the lacLM genes.
  • pAMJ792 a derivative of pAMJ792 was constructed that carries a DNA sequence, en- coding a secretion signal at the 5' end of phhAB. This construction was expected to provide PhhAB secretion in L. lactis.
  • the fragment encoding the secretion signal sequence from Usp45 was PCR amplified using the pAMJ219 vector as template and the DNA oligos pAK80.rev and Usp-Ncol.rev.
  • the resulting PCR product contained a Xhol and a Ncol restriction site, respectively.
  • the digested PCR-fragment was inserted into the Xhol and SspHI sites of pAMJ792.
  • the secretion signal sequence of the resulting plasmid pAMJ805 is presented in Figs. 3 and 10B.
  • the L. lactis strains AMJ792 and AMJ805 were grown in fermentors as described in the Materials and Methods. PhhA activity and the presence of recombinant proteins were analysed in cell extracts and in concentrated supematants.
  • the PhhAB protein yields obtained from both L lactis strain AMJ792 and strain AMJ805 were too low to be distinguished from host proteins present in the super- natants and intracellular extracts.
  • the AMJ792 strain showed PhhA activity both in cell extracts and in the supematants (Fig. 11).
  • the growth rates were constantly equivalent to that of strain MG1363 carrying the plasmid pAMJ206 without an insert, indi- eating that no extraordinary cell lysis could account for the PhhA activity in the supernatant.
  • An equal amount of PhhA activity was detected in AMJ792 extracts and in the corresponding supernatant.
  • Strain AMJ805 containing the secretion signal was found to secrete a higher fraction of PhhAB corresponding to 70% of the total PhhA activity produced (Fig. 12).
  • phhAB encodes a protein that confers PhhA activity in L lactis. Furthermore, it was demonstrated that the activity could be detected in the growth supematants showing that PhhAB is secreted from L lactis.
  • hPAH Human phenylalanine hydroxylase
  • MBP maltose-binding protein
  • pMAL bacterial expression system New England Biotech
  • the standard phenylalanine hydroxylase assay was carried out as follows: To 45 ⁇ l purified protein the following reagents were added, 1 ⁇ l Fe((NH 4 ) 2 SO ) 2 and incubated 1 min at 25°C (standard assay temperature), the 2 ⁇ l mix containg 5 mM L-phenylalanine (standard assay, 200 ⁇ M final concentration), 1 ⁇ mol 14 C-labeled L-phenylalanine and 1 ⁇ l catalase (10 mg/ml) was added and after 2 min incubation the reaction was started by adding 2 ⁇ l BH 4 /DTT (2.5 mM/100 mM) to reach final concentrations of 100 ⁇ M and 4 mM, respectively.
  • HPLC separations were performed on a Nova-Pak C18 column using a sysmte consisting of a 626 LC system, a 717 autosampler and a 474 scanning fluorescence detector (Waters Inc.) Chromatographic data were collected and analyzed using Waters Expert Ease software. Chromatographic analysis of the di-peptides: Phe-Gly, Gly-Phe, dopa, dopamine, 5-hydroxytryptophan and serotonin was done using the same gradient, 0 min 100 % A, 18 min 95 % A, 19 min 91 % A, 29.5 min 83 % A, 33 min 0 % A. The flow rate was 1 ml/min at 37°C and the turnaround time was 45 min. Excitation wavelength was 250 nm and emission wavelength was 395 nm.
  • hisPhhAB, hisPhhA and MBP-hPAH were purified to near homogeneity as judged by SDS-PAGE/Coomassie-staining (figure 8).
  • Lane 1 Rainbow marker (Amersham Pharmacia)
  • lane 2 hisPhhA (50 ⁇ g, 31 kDa)
  • lane 3 hisPhhAB (50 ⁇ g, 48 kDa)
  • lane 4 MBP- hPAH (50 ⁇ g, 94 kDa).
  • PhhAB The specific activity of PhhAB was measured using the standard assay with varying phenylalanine concentrations and assay time. In order to test how fast phenylalanine could be converted to tyrosine an assay with varying reaction time was performed.
  • Figure 13 shows that PhhAB and MBP-hPAH convert 85 % and 74 % of the phenylalanine to tyrosine, respectively in 60 min using 200 ⁇ M phenylalanine.
  • initial turnover at non-limiting concentrations of substrate are 0.7 mmol/min/nmol protein for hisPhhAB and 0.65 mmol/min/nmol protein for MBP-hPAH.
  • the standard assay was used to measure the temperature dependence of hisPhhAB activity.
  • a gradient PCR machine Biometra was used to generate a tempera- ture-gradient from 10°C to 50°C and the hydroxylation reaction was carried out for 10 min.
  • Figure 16 shows that the optimal assay temperature is 32°C and that 50 % of the activity was retained between 18°C and 42°C.
  • the purified hisPhhAB was stored in assay buffer at -20°C , 4°C and 20°C. After 30 days we were unable to detect a decrease in activity in samples stored at -20°C. Storage at 4°C and 20°C reduced the measurable activity with 15 % and 40 %, respectively. Storage in the same buffer supplemented with 10 % glycerol decreased the activity at all storage temperatures assayed (data not shown).
  • AQC has been shown to react rapidly and quantitatively with the amine group of amino acids (Cohen, S.A. and Michaud, D.P., 1993). Therefore it was expected to react similarly with amine groups of dipeptides and hormones.
  • the reaction is extremely tolerant of common buffer, salts and detergents, with no discernible decrease in reaction yield with well-buffered samples.
  • Selective fluorescence detection of the derivatives with excitation at 250 nm and emission at 395 nm allows for the direct injection of the reaction mixture with no significant interference from the only major fluorescent reagent by-product, AMQ, retention time 10.95 min.
  • Lys 31 ,50 lie 32,00
  • Serotonin 34,70 Substrate specificity of hisPhhAB were analysed in five assays by HPLC:
  • the enzyme was digested by approx. 470 pmol hisPhhAB dissolved in 30 ⁇ l 50 mM NH 4 HCO 3 and 0.88 ⁇ g trypsin (Promega). The enzyme was digestion for 4 hours at 37°C. Additionally, the enzyme was digested by approx. 470 pmol hisPhhAB dissolved in 30 ⁇ l 50 mM NH 4 HCO 3 and 1.0 ⁇ g chymotrypsin (Worthington, modified). The enzyme was digestion for 16 hours at 37°C.
  • Peptides were separated using HPLC separation of peptides.
  • a Pharmacia Biotech Akta Basic equipped with a column oven (45° C) and a Phenomenex Jupiter RP-
  • the buffer consisted of 0.06% TFA (Rathburn) in water.
  • This sequence is identical to the theoretical initiation (N-terminus) of the protein sequence.
  • the detected peptides that form the basis of the map in figure 2 are listed below as a result of tryptic and chymotryptic degradatiojn.
  • “Num” and “from-to” represents the sequence numbers of amino acids
  • “MH+th” represents the theoretical molecular mass
  • “MH+obs” the observed molecular mass of the peptides.
  • the molecular weigh correlates with the expeceted within one amino acid residue.
  • the N-terminal sequence is identical to the translated nucleotide-sequence deduced sequence
  • the molecular weight of the C-terminal peptid is identical to the theoretical value. 82% of the sequence is covered, either by Edman degradation/sequencing or by mass spektrometric peptide data.
  • PhhB a Pseudomonas aeruginosa homolog of mammalian pterin 4a- carbinolamine dehydratase/DCoH, does not regulate expression of phenylalanine hydroxylase at the transcriptional level J.Bacteriol. 181 :2789-2796.
  • Pseudomonas aeruginosa possesses homologues of mammalian phenylalanine hydroxylase and 4 alpha- carbinolamine dehydratase/DCoH as part of a three-component gene cluster Proc. Natl. Acad. Sci. U. S. A 91 : 1366-1370.

Abstract

Novel cells expressing phenylalanine hydroxylase activity and novel fusion proteins comprising, in addition to the phenylalanine hydroxylase activity, a polypeptide enhancing and/or stabilising the phenylalanine hydroxylase activity are provided. The cells are useful for treatment of phenylketonuria (PKU) that is caused by genetically conditioned metabolic disorders in humans and animals resulting in an accumulation in the body of phenylalanine. The cells and/or proteins may be administered directly to the PKU patients to effect conversion of phenylalanine in the body, or added to proteinaceous food products in order to reduce the content of phenylalanine.

Description

METHOD OF TREATING PHENYLKETONURIA AND MEANS THEREFOR
FIELD OF THE INVENTION
The invention relates to the field of treating the condition generally referred to as phenylketonuria that is an inherited metabolic disorder in humans and animals resulting i.a. in an accumulation in the body of L-phenylalanine and metabolites derived therefrom. In particular, there is provided novel cells expressing phenylalanine hydroxylase activity and novel fusion proteins comprising, in addition to the phenylalanine hydroxylase activity, a polypeptide enhancing and/or stabilising the phenylalanine hydroxylase activity.
TECHNICAL BACKGROUND AND PRIOR ART
Phenylketonuria
Phenylalanine is an essential amino acid for humans and animals. In the organism, this amino acid is used as a component in the synthesis of proteins including structural proteins, enzymes and hormones. Additionally, L-phenylalanine is converted to L-tyrosine in a reaction catalysed by enzymes having phenylalanine hydroxylase activity including the mammalian enzyme generally referred to as PAH (phenylalanine-4-monooxygenase, EC 1.14.16.1) (reviewed by Kaufman, 1993). Consequently, tyrosine is not an essential amino acid as long as the PAH reaction occurs. Tyrosine can be hydroxylated and the resulting substance, DOPA, is a precursor of the neurotransmitters dopamine, nor-adrenaline and adrenaline. The PAH reaction is the first obligatory step in the complete degradation of phenylalanine into CO2 and water and there are no alternative pathways to break down the phenyl ring of phenylalanine.
However, phenylalanine can also be metabolised into other compounds but the metabolic reactions are restricted to occur on the alanine side chain. The resulting compounds include phenylpyruvate, phenyllactate and o-hydroxyphenylacetate.
Patients suffering from an impaired function of PAH accumulate phenylalanine in the body including the blood (hyperphenylalaninemia) and excrete phenylpyruvate in the urine, i.e. phenylketonuria (PKU), the common clinical designation for the metabolic disorder caused by the impaired PAH function. If PKU is left untreated, the condition eventually results in mental retardation. It is not known whether the irreversible brain damage is caused by the accumulation of phenylalanine and/or its metabolites. Currently, blood screening is performed on new-born children throughout most of the Western world.
The immediate treatment of new-born PKU children includes a phenylalanine-restricted diet preventing the mental retardation. PKU patients must follow an accurate phenylalanine-restricted diet for lifetime in order to avoid that the brain function is affected. A PKU diet consists of food that contains low amounts of natural proteins combined with phenylalanine-free formulas covering the demands of the organism for essential amino acids. In addition, fruit, a balanced amount of vegetables and a free intake of fat and starch are allowed. In poor countries, the economy does not allow dietary treatment of PKU children although the screening for PKU may be performed. Consequently, these children inevitably develop mental retardation. When children in the Western world be- come teenagers, they begin to doubt as to the need for keeping their accurate diet. The doubt is primarily driven by a desire to live a normal life like healthy teenagers eating food with a high content of phenylalanine. Accordingly, their phenylalanine-reduced diet may be compromised which is often accompanied by impaired brain function.
The phenylalanine hydroxylase reaction and the ancillary reactions
The PAH catalysed conversion of phenylalanine to tyrosine is accompanied by several ancillary reactions ensuring the regeneration of the essential co-factor tetrahydrobiopterin (BH ) (Kaufman, 1993). The reactions are shown in Fig. 1. Phenylalanine is hydroxylated at carbon position 4 in the aromatic ring with the concomitant conversion of BH4 to 4a- carbinolamine. The 4a-carbinolamine dehydratase subsequently catalyses the formation of quinonoid dihydrobiopterine (qBH2) accompanied by the dissociation of water and, finally, dihydropterine reductase reduces qBH2 to BH4 using NADH as an electron donor. A peroxidase active enzyme is essential when the PAH mediated reaction is carried out in vitro since PAH is inactivated by H2O2 formed by non-enzymatic oxidation of BH4. It should be noted that the BH4 can be replaced by other substances including flavins and pyrimidines (Kaufman, 1993). The molecular properties of phenylalanine hydroxylased from higher organisms and pro- karyotes
The two major forms of phenylalanine hydroxylase from rat and man (PAH) have mo- lecular weights of 110 and 210 kD, respectively (Woo et al. , 1974). The molecular weight of the subunit is 52 kDa and catalytically active PAH has a homo-dimeric and homo- tetrameric structure (Woo et al., 1974). Human PAH is a 452 amino acid protein produced and located intracellularly in liver cells. It is an unstable enzyme which causes difficulties when PAH is used in in vitro experiments or analysis. The enzyme activity is activated by the presence of phenylalanine and it has been shown that the amino terminal region of PAH is involved in the regulation of the catalytic activity (Hufton et al., 1998). The region has been shown to contain a domain necessary for the oligomerisation of the mature PAH. The carboxy-terminal end of PAH contains the catalytic domain of the enzyme (Dickson et a/., 1994).
Human PAH (hPAH) has been expressed recombinantly in E. coli (Martinez et al., 1995, Kowlessur e al., 1996) and in Saccharomyces cerevisiae (Hufton et al., 1998). Rat PAH has been expressed in mouse LTK" cells (Choo et al., 1986) and in E. coli (Dickson et a/., 1994).
Prokaryotic phenylalanine hydroxylases have been identified in Gram-negative bacteria including Pseudomonas aeruginosa and Chromobacterium violeans (Zhao et al., 1994, Onishi et al., 1991). In contrast to the eukaryotic PAH, the bacterial counterpart is catalytically active in a monomeric form. Fig. 2 shows an alignment analysis of the primary structure of human PAH, tryptophan hydroxylase, tyrosine hydroxylase and phenylalanine hydroxylases from P. aeruginosa and C. violeans, respectively. The three human hydroxylases share a high homology throughout the polypeptides while the bacterial phenylalanine hydroxylases are shorter and correspond to the carboxy-terminal end of the human PAH. Thus, the regulatory region is lacking, which explains the monomeric structure of the mature bacterial enzyme.
The phhA is a 789 bp gene encoding the phenylalanine hydroxylase (PhhA) from P. aeruginosa. The gene has been cloned and characterised by R.A. Jensen and co-workers (Zhao et al., 1994). PhhA is a 262 amino acid protein having a molecular weight of 30 kDa. The G+C content of phhA is 64%, which is typical for the P. aeruginosa genome. The gene is part of an operon that also contains the genes phhB and phhC encoding 4a- carbinolamine dehydratase (PhhB) and aromatic am inotransf erase (PhhC). The bacterial PhhB catalyses the conversion of 4a-carbinolamine to quinonoid dihydrobiopterine as shown in Fig. 1 and PhhC catalyses the conversion of tyrosine to 4-hydroxyphenylpyru- vate.
PhhB is playing a key role in controlling the phenylalanine hydroxylase reaction catalysed by PhhA. In P. aeruginosa, PhhB has been shown to regulate the expression of phhA at the posttranscriptional level (Song et al., 1999). Additionally, PhhB stimulates the PhhA catalysed reaction by regenerating the essential pterin co-factor. A non-enzymatic rearrangement of 4a-biopterin to 7-biopterin, a potent inhibitor of phenylalanine hydroxylase, occurs in the absence of carbinolamine dehydratase (Kaufman, 1993). Accordingly, PhhB also stimulates the PhhA reaction by catalysing the removal of 4a-carbinolamine and thereby preventing the formation of 7-biopterin.
Song et al. (1999) have shown that PhhA and PhhB co-precipitates when a crude extract of E. coli (pJZ9-3a), which produces PhhA and PhhB, is treated with antibodies raised against PhhB. The anti-PhhB antibodies do not recognise PhhA alone and, therefore, it was concluded that PhhA and PhhB can exist as a dissociable complex. The conclusion was supported by affinity chromatography where immobilised anti-PhhB antibodies resulted in a separation of both PhhA and PhhB from the crude extract.
PhhA from Chromobacterium violaceum has been expressed recombinantly in E. coli (Onishi et al., 1991) and that from Pseudomonas aeruginosa in £ coli (Zhao et al., 1994, Song et a/., 1999).
The mammalian phenylalanine hydroxylation activity in vivo is dependent on the regeneration of the co-factor tetrahydrobiopterin (BH4). When procedures for the purification of active PAH were developed, it was observed that a co-purified protein supports PAH ac- tivity (Lei and Kaufman, 1998). This protein was designated phenylalanine hydroxylase stimulating protein, PHS. Later it was revealed that PHS acts as a biopterin 4a-carbino- lamine dehydratase (Citron et al., 1992). The detection of a co-purified dehydratase suggested a stimulated phenylalanine hydroxylase activity, not only by co-factor regeneration, but also by working as a complex with high stability. In parallel, it has become evident from the work of R. A. Jensen et al. that the P. aeruginosa PhhA activity is enhanced when PhhB is co-expressed. Jensen et al. reported the construction of a high-level expression plasmid, pJZ9-3a, containing phhA and phhB in the pUC18 vector (Zhao et al., 1994). Deletion of the phhB resulted in a substantial reduction of PhhA activity with only a minor reduction in the protein PhhA yield. This observation showed a dependency be- tween PhhA and PhhB, which was further supported by experiments in which high PhhA activity was recovered by PhhB trans-complementation (Song et. al., 1999).
Current status of PKU therapy and prophylaxis
As outlined above, much effort has been devoted to the study of phenylalanine hydroxylases. The impaired enzymatic activity found in PKU is the result of single base substitutions, small deletions, or insertions and splice defects in the PAH gene and more than 350 different mutations in the gene have been identified. Gene therapy has been suggested as an approach to treat PKU (Eisensmith et al., 1994), but has not yet been successful in vivo.
Enzyme substitution therapy may constitute another potential treatment of PKU. However, up till now no useful means for such a therapy have been provided. The only example is an approach proposed by Chang et al. (1995) who suggested the use of a microbial en- zyme, phenylalanine ammonia lyase (PAL) which is capable of converting phenylalanine into a non-toxic derivative, trans-cinnamic acid. These authors tested the effect of encapsulated PAL in PKU rats fed a normal phenylalanine-containing diet and found that the thus administered enzyme was capable of reducing the PKU symptoms. However, to the best of our knowledge, this approach has not been developed into a useful therapeutic method of treating human PKU patients.
Consequently, at present the only available treatment of PKU patients is the administration of semi-synthetic diets which are low in phenylalanine and at the same time adequate in respect of other nutrients. However, most of such diets are unpalatable and relatively expensive, and it has been found that such a treatment is ineffective in controlling systemic phenylalanine levels during fever and infections and besides, as it is mentioned above, young adult patients have difficulties in observing the strict diet requirements.
Observation of diet requirement could be avoided, if efficient and cost effective means for reducing the phenylalanine content in normal diets could be provided. In this respect one possibility could be to administer effective amounts of phenylalanine hydroxylases or GRAS (generally recognised as safe) organisms expressing or containing such enzymes to PKU patients. Another approach would be to provide palatable phenylalanine reduced diets at a reasonable cost level by treating proteinaceous food products having a high content of phenylalanine with phenylalanine hydroxylase or an organism producing such enzyme.
Evidently, such approaches require that either phenylalanine hydroxylase becomes available in sufficient quantities and/or that GRAS organisms are provided that express the enzymes, which organisms can be used either for treating food products to reduce the content of phenylalanine or can be administered directly to the PKU patients and produce or deliver the enzyme in the gastro-intestinal tract.
Although, as it is mentioned above, phenylalanine hydroxylases have been expressed re- combinantly in £. coli and mammalian cells, no suggestions have, to the best of our knowledge, been made to use such enzymes as such or GRAS organisms expressing the enzymes as active components in pharmaceuticals or for manufacturing of diets having a reduced content of phenylalanine.
SUMMARY OF THE INVENTION
Accordingly, in a first aspect the invention pertains to a recombinant cell comprising a nucleic acid derived from a prokaryotic organism, said nucleic acid coding for a gene product having phenylalanine hydroxylase activity, subject to the limitation that the cell is not an £. coli cell.
In a further aspect there is provided a recombinant lactic acid bacterial cell comprising a nucleic acid sequence coding for a gene product having phenylalanine hydroxylase activ- ity.
In yet a further aspect the invention provides a fusion protein comprising an amino acid sequence having phenylalanine hydroxylase activity and a polypeptide enhancing or stabilising the phenylalanine hydroxylase activity. In a still aspect the invention relates to a method of producing phenylalanine hydroxylase, comprising providing a cell as defined above, cultivating said cell under conditions where the gene coding for the gene product having phenylalanine hydroxylase activity is expressed, and harvesting the phenylalanine hydroxylase active gene product.
There is also provided a composition comprising cells as defined above and a pharmaceutical composition comprising such cells, and a pharmaceutically acceptable carrier. Additionally, the invention relates in other aspects to a composition comprising a fusion protein as also defined above and a pharmaceutical composition comprising such a fusion protein, and a pharmaceutically acceptable carrier.
In yet other aspects the invention relates to a phenylalanine hydroxylase active enzyme for use as a medicament and to the use of a phenylalanine hydroxylase active enzyme for the manufacturing of a medicament for the treatment of phenylketonuria.
As mentioned above, the invention provides means of treating phenylketonuria. Accordingly, the invention provides in another aspect a method of treating phenylketonuria in a mammal, comprising administering to said mammal an effective amount of any of the above compositions.
The cell and the fusion protein of the invention are also useful in the manufacturing of dietetically improved food product, e.g. for patients suffering from the genetic disorder causing phenylketonuria. Accordingly, the present invention provides in yet a further aspect a method of preparing a proteinaceous food product having a reduced content of phenylalanine, the method comprising contacting a proteinaceous food product starting material with a cell or a fusion protein as defined hereinbefore, under conditions where the gene product having phenylalanine hydroxylase activity is enzymatically active for a period of time that is sufficient to convert at least part of the phenylalanine content of the starting material into compounds that do not cause phenylketonuria. DETAILED DISCLOSURE OF THE INVENTION
It is a primary objective of the present invention to provide novel means for treating phenylketonuria. Accordingly, in a first aspect, there is provided a recombinant host cell in which a nucleic acid derived from a prokaryotic organism and coding for a gene product having phenylalanine hydroxylase activity is expressed.
As used herein the expression "nucleic acid coding for phenylalanine hydroxylase activity" refers to any nucleic acid sequences including DNA and RNA that codes for a polypeptide having the ability to catalyse the conversion of L-phenylalanine into L-tyrosine using tetra- hydropterin (BH4) or other factors as reducing agents. It will be appreciated that such a nucleic acid can be a wild-type nucleic acid isolated from a prokaryotic organism naturally containing such a nucleic acid. However, the nucleic acid may also be a coding nucleic acid sequence derived from a wild-type nucleic acid, but still coding for a polypeptide at least partially having the phenylalanine hydroxylase activity of the gene product of the parent nucleic acid sequence. Such a derived sequence can be provided by modifying a nucleic acid sequence coding for the polypeptide, e.g. by modifying the parent sequence by substitution, deletion and/or addition of one or more nucleotides. Alternatively, a nucleic acid coding for phenylalanine hydroxylase can be synthesised using conventional techniques which are well-known in the art. It will be appreciated that a nucleic acid coding for phenyl alanine hydroxylase activity may be provided by substituting one or more wild-type codon(s) with different codon(s). The substitution of codons may be appropriate when the nucleic acid is to be expressed in a heterologous species, such as a lactic acid bacterium.
Additionally, as used herein the "nucleic acid coding for phenylalanine hydroxylase activity" encompasses any derivative, homologue or mutant of any naturally occurring coding sequences for the enzyme including the PhhA encoding sequences of Chromobacterium violaceans and Pseudomanas species including Pseudomonas aeruginosa and Pseu- domonas acidovorans. The nucleic acids also include coding sequences that are capable of hybridising under stringent conditions to any of the above PhhA encoding sequences. In this context, the term "derivative" indicates a sequence that is modified relative to any of these PhhA sequences, e.g. by addition, deletion and/or substitution of one or more nucleotides of such sequences using methods which are well known in the art. The term "homologue" as used herein refers to a nucleic acid sequence that differs from any of the above PhhA sequences in at least one nucleotide. Accordingly, a "homologue" is a coding sequence that is at least 50% homologous to any of the PhhA sequences as determined by a FASTA using the GCG Wisconsin package version 8, Genetic Computer Group including at least 60%, 70%, 80% or 90% similarity.
In this context, the expression "gene product having phenylalanine hydroxylase activity" refers to a polypeptide that is capable of converting the amino acid L-phenylalanine into L- tyrosine optionally using pterins as reducing agents. This phenylalanine hydroxylation reaction is, as it is mentioned above, the first step in the catabolic pathway that leads to complete oxidation of phenylalanine to CO2 and water. Phenylalanine hydroxylase activities are found in mammals including humans and rodents. The mammalian phenylalanine hydroxylase enzyme, L-phenylalanine-4-monooxygenase (EC.1.14.16.1), a mixed function oxidoreductase, is generally referred to as PheOH or PAH. Additionally, oxidoreduc- tases having similar phenylalanine hydroxylase activity and also classified as L-phenyl- alanine-4-monooxygenases (EC.1.14.16.1) have been found in prokaryotic organisms including the Gram negative bacterial species, Chromobacterium violaceans and Pseudo- manas species including Pseudomonas aeruginosa and Pseudomonas acidovorans (Zhao et al., 1994). These prokaryotic L-phenylalanine-4-monooxygenases are generally referred to as PhhAs.
Additionally, in this context, the expression "gene product having phenylalanine hydroxylase activity" encompasses derivatives, mutants or fragments of any naturally occurring phenylalanine hydroxylases including the prokaryotic enzymes having such an activity of Chromobacterium violaceans and Pseudomanas species including Pseudomonas aerugi- nosa and Pseudomonas acidovorans. As used in this context, the term "derivative" refers to modifications of the above polypeptides that has retained at least part of the enzymatic activity of the parent polypeptide. Such modifications can be substitutions, additions and/or deletions of at least one amino acid in such polypeptides. More specifically, "derivative" is a polypeptide having, at the amino acid level, an identity with any of the above naturally occurring enzymes which is at least 30%, including at least 40%, 50%, 60%, 70%, 80%, 90% or 99% identity. "Derivative" also encompasses polypeptides with phenylalanine hydroxylase activity that show at least 30% similarity to a naturally occurring phenylalanine hydroxylase including at least 40%, 50%, 60%, 70%, 80%, 90% or 99% similarity with any of the above naturally occurring polypeptides, the term "similarity" in- eluding not only strict amino acid identity, but also congruence in respect of amino acids having similar physico-chemical characteristics such as electric charge as it is generally appreciated by the person skilled in the art.
The present invention is i.a. based on the discovery that isolated prokaryotic nucleic acids coding for PhhA can be inserted into host cells and expressed therein. In particular, it has been found that such coding nucleic acids can be expressed effectively in organisms that are generally referred to as GRAS organisms as defined hereinbelow. This opens up for safe and cost effective dietary and pharmaceutical applications of PhhA in PKU patients. However, it is contemplated that a wide range of host cells can be used in the invention for recombinant production of PhhA and similar prokaryotic enzymes having phenylalanine hydroxylase activity, including any eukaryotic cells and prokaryotic cells that are capable of expressing genes coding for such activity.
Useful prokaryotic host cells can be selected from Gram negative and Gram positive bacteria. Examples of useful Gram negative host cells include Enterobacteriaceae species such as e.g. Salmonella spp. and Serratia spp; Pseudomonas spp., and examples of Gram positive bacteria that can be used in the invention include Bacillus spp. Streptomy- ces spp and lactic acid bacterial species. Suitable eukaryotic host cells can be selected from fungal cells including yeast cells, mammalian cells including human cells and insect cells.
Methods for introducing exogenous DNA into such host cells typically include the use of CaCI2 or other agents such as divalent cations and DMSO. DNA can also be introduced into bacterial cells by electroporation (Holo and Ness, 1989), nuclear injection or proto- plast fusion as described generally in Sambrook et al. ( 989). Preferably, the host cell should secrete minimal amounts of proteolytic enzymes. Alternatively, in vitro methods of cloning, e.g. PCR or other nucleic acid polymerase reactions are suitable.
Expression vectors and transformation vectors, either extrachromosomal replicons or in- tegrating vectors, have been developed for transformation into yeast species including Saccharomyces cerevisiae, Candida albicans, Candida maltosa, Hansenula polymorpha, Kluyveromyces lactis, Pichia pastoris and Schizosaccharomyces pombe, and into species of filamentous fungi such as Aspergillus spp., Trichoderma spp., Neurospora spp. or Penicillium spp. Control sequences for yeast vectors include as examples promoter regions from genes such as alcohol dehydrogenase (ADH), endolase, glucokinase, glucose-6-phosphate iso- merase and pyruvate kinase. Inducible yeast promoters having the additional advantage of transcription controlled by growth conditions are available. Yeast enhancers are also advantageously used with yeast promoters. E.g. can upstream activating sequences (UAS) of one yeast promoter be joined with the transcription activation regions of another yeast promoter to create a synthetic hybrid promoter. Furthermore, a yeast promoter may include naturally occurring promoters of non-yeast origin having the ability to bind yeast RNA polymerase and initiate transcription. Other control elements that may be included in yeast expression vectors are terminators and leader sequences which encode signal sequences for secretion such as e.g. the leader sequence derived form the yeast invertase gene and the α-factor gene.
Methods of introducing exogenous DNA into yeast hosts are well known in the art and typically include transformation of spheroplasts or intact yeast cells treated with alkali cations. The introduction can be carried out by transformation, nuclear injection, electroporation or protoplast fusion as described generally in Sambrook et al., supra.
For yeast secretion of the prokaryotic phenylalanine hydroxylase polypeptide of the inven- tion, a native signal sequence can be substituted by another leader such as the yeast invertase, α-factor or acid phosphatase leaders. For intracellular production of the polypeptide in yeast, a sequence encoding a yeast protein can be linked to the coding sequence for the phenylalanine hydroxylase to produce a fusion protein that can be cleaved intra- cellularly upon expression.
Particularly useful insect cell expression systems are based upon baculovirus expression vectors (BEVs), recombinant insect viruses in which the coding sequence for a foreign gene is inserted behind a baculovirus promoter in place of a viral gene, e.g. polyhedrin such as it is described in US Patent No. 4,745,051. A typical useful insect cell expression vector includes a DNA vector useful as an intermediate for the infection or transformation of an insect cell system, the vector generally containing DNA coding for a baculovirus transcriptional promoter, followed downstream by an insect signal DNA sequence capable of directing secretion of a desired polypeptide, and a site for insertion of the foreign gene encoding the foreign polypeptide and the foreign gene placed under transcriptional control of a baculovirus promoter, the foreign gene herein being the nucleotide sequence coding for the phenylalanine hydroxylase polypeptide of the invention.
Useful promoters for an insect cell expression system can be derived from any baculovi- rus infecting cells such as e.g. a baculovirus immediate-early gene IEI or IEN promoter or a strong polyhedrin promoter of baculovirus. The insect expression vector for use herein may also include the polyhedrin polyadenylation signal and a selective marker. DNA encoding suitable signal sequences may also be included such as e.g. the signal sequence of the baculovirus polyhedrin gene or mammalian signal sequences.
The prokaryotic phenylalanine hydroxylases may also be expressed in mammalian cells such as e.g. adipocytes, using promoters and enhancers that are functional in such cells. Typical promoters for mammalian cell expression include as examples, the SV40 early promoter, the CMV promoter, the mouse mammary tumor virus LTR promoter, the adeno- virus late promoter and the herpes simplex virus promoter. Mammalian expression may be either constitutive or regulated (inducible).
Mammalian cell lines available as hosts for expression are also known and include many immortalised cell lines available from the ATCC, including Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney (COS) cells, human hepatocellular carcinoma cells, human embryonic kidney cells, human lung cells and human liver cells.
In the present context, one preferred group of host cells for expression of the phenylala- nine hydroxylase or as delivery vehicles for phenylalanine hydroxylase activtity to the gastrointestinal tract is the group of organisms generally referred to as GRAS organisms, i.e. organisms that are "generally recognised as safe". As used herein, this expression refers to prokaryotic or eukaryotic micro-organisms that, based on experimental data and practical use experience, have been found not to produce any toxic or otherwise hazard- ous substances or to have any adverse effects when ingested by higher organisms including humans and other mammals. The group of GRAS organisms includes micro-organisms that are conventionally used in the manufacturing of food products. Typical examples of such organism are the group of lactic acid bacteria that are used as starter cultures in the dairy industry, the feed industry and other industries concerned with the manufacturing of product where lactic acid bacterial cultures are used. In the present context, the expression "lactic acid bacteria" designates a group of Gram positive, catalase negative, non-motile, microaerophilic or anaerobic bacteria which ferment sugar with the production of acids including lactic acid as the predominantly produced acid, acetic acid, formic acid and propionic acid. The industrially most useful lactic acid bacteria are found among Lactococcus species including Lactococcus lactis, Streptococcus species, Enterococcus species, Lactobacillus species, Leuconostoc species, Oenococcus species and Pediococcus species. In the art, species of the obligate anaerobic bacteria belonging to the Bifidobacterium genus which are taxonomically different from the group of lactic acid bacteria, are frequently included in the group of lactic acid bacteria due to their application as dairy starter cultures.
Other examples of GRAS organisms which can be used in the above method according to the invention are yeast species used in food manufacturing such as baker's yeast, brewer's yeast and yeast organisms used in the fermentation of wine and other bever- ages. Typical examples of yeast species that can be considered as GRAS organisms include Saccharomyces cerevisiae and Schizosaccharomyces pombe. The use of filamentous fungi having GRAS status is also contemplated.
In one useful embodiment the gene coding for phenylalanine hydroxylase activity is a gene coding for PhhA or an enzymatically active fragment thereof. As it is mentioned above, such a gene can be isolated or derived from a prokaryotic organism including Chromobacterium species such as Chromobacterium violaceans and Pseudomanas species including Pseudomonas aeruginosa and Pseudomonas acidovorans.
In useful embodiments, the recombinant cell of the invention that comprises a nucleic acid derived from a prokaryotic organism and coding for phenylalanine hydroxylase activity, including a cell comprising a nucleic acid coding for PhhA or an enzymatically active fragment thereof, is one that further comprises a gene coding for a gene product having an enhancing or stabilising effect on the phenylalanine hydroxylase activity. In this con- text, the expression "enchancing effect" is used to describe both the situation where the expressed phenylalaline hydroxylase is substantially inactive in the absence of the gene product, but becomes active in the presence of the gene product having an enhancing effect, and the situation where the expressed phenylalaline hydroxylase has an activity in the absence of the enhancing gene product, but this activity is increased in the presence of the activity enhancing gene product. Thus, in the latter situation, the phenylalanine hy- droxylase enhancing effect may be at least 10% increase of the enzyme activity, such as at least 20% increase including at least 30%, 40%, 50%, 75% or 100% increase. In other, preferred embodiments the phenylalanine hydroxylase enhancing effect is increased at least 5-fold, such as at least 10-fold, 20-fold, 50-fold, 100-fold or 1000-fold, 10.000-fold, 100.000-fold or even at least 1000.000-fold. As used herein, the term "stabilising effect" implies that the phenylalanine hydroxylase activity enhancing gene product in addition to its enhancing effect on phenylalanine hydroxylase has a stabilising effect on this enzyme in the sense that the presence of this gene product effects that the activity of the phenylalanine hydroxylase is retained under adverse conditions, where the activity of the phen- ylalanine hydroxylase is reduced overtime in the absence of the gene products.
One example of a prokaryotically derived phenylalanine hydroxylase enhancing and/or stabilising gene product is PhhB which has been found to play a key role in controlling the phenylalanine hydroxylase reaction catalysed by PhhA. In P. aeruginosa, PhhB has been shown to regulate the expression of phhA at the posttranscriptional level (Song et al., 1999). Additionally, PhhB stimulates the PhhA catalysed reaction by regenerating the essential pterin co-factor. A non-enzymatic rearrangement of 4a-carbinolamine to 7-biopterin, a potent inhibitor of phenylalanine hydroxylase, occurs in the absence of carbino- lamine dehydratase (Kaufmann, 1993). Accordingly, PhhB also stimulates the PhhA reac- tion by catalysing the removal of 4a-carbinolamine and thereby preventing the formation of 7-biopterin.
Song et al., 1999 have shown that PhhA and PhhB co-precipitates when a crude extract of £. coli (pJZ9-3a), which produces PhhA and PhhB, is treated with antibodies raised against PhhB. The anti-PhhB antibodies do not recognise PhhA alone and, therefore, it was concluded that PhhA and PhhB can exist as a complex. The conclusion was supported by affinity chromatography where immobilised anti-PhhB antibodies resulted in a retention of both PhhA and PhhB from the crude extract.
It will be appreciated that a phenylalanine hydroxylase activity enhancing and/or stabilising fragment of PhhB can be used as well. Additionally, as used herein, "gene product having phenylalanine hydroxylase enhancing or stabilising effect" encompasses derivatives, mutants or fragments of any naturally occurring phenylalanine hydroxylase enhancing or stabilising gene products including the above prokaryotic gene products having such an effect which are naturally produced by Chromobacterium violaceans and Pseu- domanas species including Pseudomonas aeruginosa and Pseudomonas acidovorans. As used in this context, the term "derivative" refers to modifications of the above gene product that has retained at least part of the enhancing or stabilising effect of the parent polypeptide. Such modifications can be substitutions, additions and/or deletions of at least one amino acid in such polypeptides. More specifically, "derivative" is a polypeptide having, at the amino acid level, an identity with any of the above naturally occurring gene products which is at least 30%, including at least 40%, 50%, 60%, 70%, 80%, 90% or 99% identity. "Derivative" also encompasses gene products having a phenylalanine hydroxylase enhancing effect that show at least 30% similarity to a naturally occurring gene products including at least 40%, 50%, 60%, 70%, 80%, 90% or 99% similarity with any of the above naturally occurring gene products, the term "similarity" being defined as above.
In one advantageous embodiment the cell expresses the gene product having phenylalanine hydroxylase activity such as the PhhA as defined hereinbefore, and the gene product having an enhancing effect on the phenylalanine hydroxylase activity such as the above defined PhhB, as a fusion protein, i.e. as a monomeric molecule. It was found that such a fusion protein is capable of withstanding otherwise unfavourable conditions, such as pH, essentially without loss of activity. It is assumed that this highly advantageous stability is due to the fact that the protein domains of the two components of the fusion protein are not dissociated.
The recombinant cell according to the invention may comprise a signal or secretion sequence operably linked to the gene coding for a gene product having phenylalanine hydroxylase activity. Any signal sequence that is capable of effecting secretion of the gene product across the cell membrane in the particular cell that is used, is encompassed. One useful example of a signal sequence is a secretion signal sequence derived from the Lactococcus lactis strain MG1363 (van Asseldonk et al., 1990).
The expression of the gene coding for the gene product having phenylalanine hydroxylase activity can be expressed under the control of its native promotor. However, it may be advantageous to replace the native promoter with a different promoter such a promoter that effects an increased level of expression, relative to the level obtained with a native promoter. The promoter to which the gene coding for phenylalanine hydroxylase activity is operably linked can be a constitutive or a regulatable (inducible) promoter. The factors regulating the latter type of promoters can be selected from physical and chemical factors such as the temperature, composition of the growth medium including the ionic strength, pH and absence/presence of specific regulating substances. Examples of such regulatable promoters are disclosed in WO 94/16086 which is incorporated herein by reference. A particularly useful promoter described in WO 94/16086 is the pH regulatable P170 pro- moter.
In accordance with the invention, the gene coding for the gene product having phenylalanine hydroxylase activity may also code for a tagging sequence associated with the gene product. Useful examples of such tagging sequences include His tags which are well- known in the art, e.g. the His15-tag as used herein.
The gene coding for the gene product having phenylalanine hydroxylase activity can be a wild-type gene or it can be derived from such a wild-type gene by any of the genetic modifications described above. In accordance with the invention, such a gene, whether it is a wild-type gene or a gene derived from a wild-type gene, can be part of a nucleic acid sequence coding for a fusion protein comprising the phenylalanine hydroxylase activity and a gene product having an enhancing and/or stabilising effect on the activity of the phenylalanine hydroxylase, including a DNA sequence coding for a fusion gene product comprising PhhA and PhhB or a modified PhhB where the first methionine residue (Met) is substituted with a different amino acid residue such as e.g threonine (Thr). In further embodiments the nucleic acid sequence coding for a fusion protein comprises at least one further coding sequence.
The gene coding for a gene product having an enhancing effect on the phenylalanine hy- droxylase activity can be selected from a wild-type gene and a gene that is derived from a wild-type gene.
In a further aspect, the invention pertains to a recombinant lactic acid bacterial cell comprising a wild-type nucleic acid coding for a gene product having phenylalanine hydroxy- lase activity or a nucleic acid coding for such a gene product that is derived from a wild- type nucleic acid. The coding gene can be derived from a prokaryotic organism such as it is described above. However, it may be preferred to use a coding nucleic acid that is derived from a eukaryotic organism including a mammalian species such as humans or rodents, examples of which are sequences coding for PAH as described hereinbefore. The recombinant lactic acid bacterial of the invention may further comprise a gene coding for a gene product having an enhancing effect on the phenylalanine hydroxylase activity that is selected from a prokaryotic species such as PhhB or a phenylalanine hydroxylase activity enhancing fragment thereof, including modified PhhB where the first Met residue is substituted with a different amino acid residue, and a mammalian gene coding for such an enhancing gene product including the mammalian phenylalanine hydroxylase stimulating (PHS) protein (Citron et al, 1992) which was found to act as pterin 4α-carbinolamine dehydratase.
In the latter case, the two gene products are advantageously expressed in the lactic acid bacterial cell as a fusion protein such as it is described above. The lactic acid bacterial cell expressing the fusion protein may comprise at least one further coding sequence.
The recombinant lactic acid bacterial cell can be selected from any lactic acid bacterial species as defined above, including a cell of Lactococcus lactis e.g. the strain designated MG1363 or derivatives hereof.
The recombinant lactic acid bacteria may comprise signal sequences operably linked to the gene coding for a gene product having phenylalanine hydroxylase activity, and the gene coding for the gene product having phenylalanine hydroxylase activity may be expressed under the control of a promoter not natively associated with the gene and/or under the control of a regulatable promoter such as described above. Additionally, the gene coding for the gene product having phenylalanine hydroxylase activity may also code for a tagging sequence as defined above.
In a still further aspect, the invention relates to a fusion protein comprising as a first component an amino acid sequence having phenylalanine hydroxylase activity as defined hereinbefore and as a second component, a polypeptide that has an enhancing or stabilising effect on the phenylalanine hydroxylase activity of the fusion protein as it is defined above. Either of the two components may independently be derived from prokaryotic organisms including the PhhA polypeptide and the PhhB polypeptide as described above, or they may be derived from a eukaryotic organism such as a mammal. An example of a polypeptide having phenylalanine hydroxylase activity is the PAH polypeptide that is found i.a. in humans and animal species such as rodent species, and an example of a polypep- tide that has an enhancing effect on the phenylalanine hydroxylase activity of the fusion protein is the PHS polypeptide that can also be derived from humans and animal species. It will be appreciated that either of the components of the fusion protein may comprise full length wild-type polypeptides having the above activities or fragment, mutant or derivatives hereof as defined above, having phenylalanine hydroxylase activity or phenylalanine hydroxylase activity enhancing effect, respectively. However, it has been found that a fusion protein in which at least one amino acid in at least one of a first and second wild-type component is substituted by a different amino acid is highly effective such as a fusion protein where the first Met residue of the second component is substituted by a different amino acid including a Thr residue. Thus, it is contemplated that active fusion proteins can be constructed wherein at least 2, such as at least 3, 4, 5, 10 or 20 amino acids of wild- type components have been substituted or deleted or where at least 1 , such as at least 2, 3, 4, 5, 10 or 20 amino acids in addition to any of the first and second wild-type components have been inserted.
Thus, the two above components of the fusion protein may both be of eukaryotic origin or of prokaryotic origin. Alternatively, one of the components may be of prokaryotic origin and the other one of eukaryotic origin.
As it is also described above, the phenylalanine hydroxylase enhancing effect of the sec- ond component of the fusion protein may be an at least 10% increase of the phenylalanine hydroxylase, such as at least 20% increase including at least 30%, 40%, 50%, 75% or 100% increase or, in other, preferred embodiments the phenylalanine hydroxylase enhancing effect is increased at least 5-fold, such as at least 10-fold, 20-fold, 50-fold, 100- fold or 1000-fold 10.000-fold, 100.000-fold or even at least 1000.000-fold. It is a possibility that the enhancing effect of the second component may be even higher when the two components are expressed as a fusion protein using certain conditions where non-cova- lent complex binding of PhhA and PhhB is un-favoured as compared to the wild-type situation where the two components are expressed as separate gene products in a cell, such as at least 2-fold higher, e.g. at least 5-fold or 10-fold higher. Accordingly, the en- hancing effect of the second component of a fusion protein of the invention may be at least 10% higher than in the wild-type situation, such as at least 20% higher or even at least 30%, 40% or 50% higher.
In a presently preferred embodiment, the first component and/or the second component of the fusion protein according to the invention is derived from a Gram negative bacterium including Pseudomonas aeruginosa and Chromobacterium violeans. In this connection, a fusion protein comprising the PhhA and the PhhB polypeptide from either of these bacterial species is designated PhhAB.
In convenient embodiments, the fusion protein of the invention is provided with a tagging sequence permitting that the protein can be readily separated from a medium. Such tags, including a His-tag, e.g. a tag having the sequence Met-Lys-(His-Gln)6 tag. Such tags are well-known in the art.
The fusion protein according to invention may be a protein only consisting of amino acid residues derived from the two components. However, it is also possible to interlink the two active components by one or more amino acid residues linking the amino acid sequence having phenylalanine hydroxylase activity and the polypeptide enhancing the phenylalanine hydroxylase activity or any other enhancing proteins. Such linking sequences or spacer sequences may comprise 1-100 amino acids such as 2-50 amino acids or 5-25 amino acids.
The fusion protein may, in addition to the two above active components, comprise further amino acid sequences, e.g. sequences facilitating the expression and/or secretion of the fusion product according to the invention such as leader or signal sequences or fragments of gene products. Additionally, the fusion protein may comprise one or more active gene products, including, but not limited to, enzymatically active gene products such as lipases, proteases and polysaccharide degrading enzymes. It will be appreciated that the fusion protein may comprise additional first and second components as defined above.
The fusion protein of the present invention may comprising a sequence selected from the group consisting of:
RQPDDNGFIHYPETEHQVWNTLITR (SEQ ID NO:6) ACQEYLDGIEQLGLPHERIPQLDEINRVLQATTGWR (SEQ ID NO: 7)
VPALIPFQTFFELLASQQFPVATFIRTPEELDYLQEPDIFHEIFGHCPLLTNPW-
FAEFTHTYGK (SEQ ID NO:8)
VFLARLYWMTIEFGLVETDQGKRIYGGGILSSPKETVYSLSDEPLHQAFNPLEAMR (SEQ
ID NO 9) IDILQPLYFVLPDLKRLFQLAQEDIMALVHEAMRLGLHAPLFPPK (SEQ ID NO: 10) TPTTTALTQAHCEACRADAPHVSDEELPVLLRQIPDWNIEVRD (SEQ ID NO:11) HALAFTNAVGEISEAEGHHPGLLTEWGK (SEQ ID NO 12) NDFIMAARTDEVAKTAEGRK (SEQ ID NO 13)
MKHQHQHQHQHQHQKTTQYVAR (SEQ ID NO:14), or any combination thereof.
For certain applications, it may be advantageous to provide the fusion protein according to the invention in an essentially pure form. As used herein, the expression "essentially pure" refers to a fusion protein that has been purified to an extent where substantially no other proteins are present. Such a purified fusion protein can be obtained by protein purification methods that are well-known in the art such as precipitation, chromatography or filtration techniques. The absence of contaminating protein can be confirmed by SDS-PAGE gel electrophoresis methods followed by staining of the gel e.g. silver staining or staining by Coomassie Brilliant Blue.
It is an important objective of the present invention to provide a method of producing phenylalanine hydroxylase or a fusion protein comprising phenylalanine hydroxylase. Generally, this method comprises the steps of providing a recombinant cell as defined hereinbefore, comprising a nucleic acid coding for a phenylalanine hydroxylase active gene product or a fusion protein as also defined above, cultivating said cell under condi- tions where the gene coding for the gene product having phenylalanine hydroxylase activity or the fusion protein is expressed, and harvesting the phenylalanine hydroxylase active gene product.
In another aspect, the invention provides a composition comprising recombinant cells as defined above and a pharmaceutical composition comprising such cells and a pharmaceutically acceptable carrier. Such compositions are useful as dietary adjuncts or pharmaceutical preparations which can be administered to PKU patients to treat phenylketonuria. Particular useful compositions are composition where the cells are cells selected from a generally recognised as safe (GRAS) species as defined hereinbefore such as lac- tic acid bacterial species.
Although it is contemplated that the cells of the dietary or pharmaceutical compositions of the invention that are not viable or metabolically active can be used as delivery vehicles for pre-formed gene products, it will be appreciated that it may be preferred that the cells of the dietary or pharmaceutical compositions of the invention are delivered to the Gl tract in a viable and metabolically active condition. For the application of viable cells in the Gl tract, it is essential that the cells as such are tolerant to the conditions prevailing in the Gl environment or that the selected cells, if they are not sufficiently tolerant, are in a form where they are protected against adverse conditions in the Gl tract. Accordingly, in one suitable embodiment, the cells are protected against such adverse conditions, in particular the acidic conditions in the stomach and the anterior parts of the duodenum. Such a protection can be provided by encapsulating the cells in materials that are resistant to the adverse conditions, thus protecting the cells under such conditions, but which are degrad- able under non-adverse conditions in the intestines. Such encapsulating or protective materials can readily be selected by the person of skill in the art.
In particular useful embodiments of the inventions the cells of the dietary or pharmaceutical composition are not only capable of being delivered in a viable state to the site of phenylalanine hydroxylase activity but are also capable of colonising, metabolising and/or proliferating in the gastrointestinal tract. Thus, the cells may preferably be cells in which surface structures are expressed that bind to receptor moieties in the Gl tract. Such structures include as examples fimbrial structures or pili or outer membrane proteins.
Whereas, dietary or pharmaceutical compositions comprising viable cells as described above may be useful in the treatment of PKU patients, it may be convenient to treat such patients with a composition comprising a fusion protein of the invention. Accordingly, the invention provides in a further aspect a pharmaceutical composition comprising such a fusion protein and a pharmaceutically acceptable carrier. Such dietary or pharmaceutical compositions are preferably protected against gastrointestinal conditions such as it is de- scribed above.
The above composition comprising either viable cells or fusion proteins according to the invention may comprise a further active component such as e.g. a peptidase and a protease. The advantages of providing peptidases and/or proteases include that the dietary protein is degraded to provide phenylalanine in a configuration that is accessible to the activity of the phenylalanine hydroxylase.
It is a further aspect of the invention to provide a method of preparing a proteinaceous food product having a reduced content of phenylalanine. This method comprises that a proteinaceous food product starting material containing phenylalanine is contacted with a recombinant cell expressing phenylalanine hydroxylase and/or a phenylalanine hydroxylase enhancing polypeptide or a fusion protein as described above under conditions where the gene product having phenylalanine hydroxylase activity is enzymatically active for a period of time that is sufficient to convert at least part of the phenylalanine content of the starting material into compounds that do not cause phenylketonuria. Preferably, at least 10%) of the phenylalanine content is converted, such as at least 15%, 20%, 25%, 30%, 50% or 90%.
Any proteinaceous material for, which there is a need to reduce the phenylalanine con- tent, can be treated by the above method. Thus, the proteinaceous food product starting material subjected to treatment can be selected from a vegetable proteinaceous material, an animal proteinaceous material including a milk protein such as a casein, a globulin and a whey protein, and a microbially derived proteinaceous material.
The invention will now be further illustrated in the following non-limiting examples and in the figures, where
Fig. 1 shows the conversion of phenylalanine to tyrosine and the regeneration reactions of BH4. PAH/PhhA: Phenylalanine hydroxylase from man or rat/bacteria; PHS/PhhB: phen- ylalanine hydroxylase stimulating protein or carbinolamine dehydratase from man or rat/bacteria; DHPR: dihydropterine reductase;
Fig. 2 is an alignment of hydroxylase proteins. Human phenylalanine hydroxylase (hPAH), human tryptophan and tyrosine hydroxylases (Trp-H and Tyr-H), and P. aeruginosa and C. violaceum phenylalanine hydroxylases (PhhA and CvPAH). In the consensus sequence conserved amino acids are shown in capital letters. If the amino acid is only the most likely to occupy the position, it is represented by a small letter.
Fig. 3 is a map of inserts in expression plasmids. Plasmid names are given at the left side. The plasmid map includes promoters, inserted DNA and terminators, if present. A thick line indicates a non-coding DNA insert and an open bar indicates a gene. Gene names are stated and restriction sites are indicated: H: HincW; P: Psfl; Sp: Sph\; S: Sa/I; X: Xhol, B: SspHI. Terminators are indicated with an Ω. Promoters are shown as a P with an arrow. The map is not drawn to scale; Fig. 4A shows a SDS-PAGE analysis of protein extracts from JZ9MΔB, lane 1; TUC18, lane 2 and TJZ9MΔB, lane 3. TUC18 is a reference strain containing vector without an insert. The molecular sizes are given at the left side in kDa. The number at the right side indicates the position of PhhA corresponding to a molecular size of 30 kDa;
Fig. 4B is a TLC autoradiogram of cell extracts from JZ9M131, lane 1 (positive control), and TJZ9MΔB, lanes 2, 3 and 4, in which samples were taken 1, 3 and 11 hours after IPTG induction. Lane 5 contained a TUC18 (negative control) sample taken 3 hours after IPTG induction. The dots at the bottom indicate the position of sample loading. The bars at the top indicate the position of the migration front. The migration positions of the [14C]- L-phenylalanine and the [14C]-L-tyrosine are shown at the right side;
Fig. 5 is a DNA sequence of the DNA insert in pFUSAB and the deduced amino acids of the translation product (SEQ ID NO:1). Restriction enzyme sites and amino acids origi- nating from linker sequences are shown in bold, the putative ribosome binding site is underlined and the dotted line indicates amino acids originating from the N-terminus of LacZ. A bolded underline shows the amino acids derived from the junction DNA sequence;
Fig. 6A shows a SDS-PAGE analysis of protein produced in FUSAB. Lane R shows cell extract from ABUC18, a reference strain containing pUC18. Lanes 1 , 2 and 3 show cell extracts from FUSAB after IPTG induction for 1 , 2 and 3 hours. The numbers to the left indicate molecular sizes in kDa. The number at the right side shows the position of PhhAB corresponding to a molecular size of 49 kDa;
Fig. 6B is a TLC autoradiogram of cell extracts from ABUC18 (lane 1) FUSAB (lane 2) and ABJZ9M131 (lane 3). The dots at the bottom indicate the position of sample loading. The bars at the top indicate the position of the migration front. At the right side the migration positions of the [14C]-L-phenylalanine and [14C]-L-tyrosine are indicated;
Fig. 7 is the DNA sequence of a His15-encoding tag introduced into pMGJ4 (SEQ ID NO:2). Restriction enzyme sites and amino acids originating from linker sequences are shown in bold, the putative ribosome binding site is underlined and the dotted line indicates amino acids originating from the His15-tag; Fig. 8 shows a SDS-PAGE analysis (10% gel) of affinity purified proteins. Lane 1 : Rainbow marker (Amersham Pharmacia), lane 2: hisphhA (0,1nmol, 3.1 μg, 31 kDa), lane 3: hisphhAB (0.1 nmole, 4.8 μg, 48 kDa), lane 4: MBP-hPAH (0.1 nmole, 9.4 μg, 94 kDa). Sizes in kDa are indicated to the left;
Fig. 9 illustrates a pterin-4α-carbinolamine dehydratase assay. The PhhB activity of PhhAB was assayed by adding PhhAB to a phenylalanine hydroxylase reaction using purified human PAH enzyme fused to maltose binding protein (MBP). The change in UV ab- sorbency was monitored at 244 nm. At this wavelength it was possible to detect a tran- sient accumulation of the highly unstable pterin-4tx-carbinolamine intermediate product during the PAH reaction (curve marked by rhombus). This transient accumulation of pterin-4α-carbinolamine was not observed when the phenylalanine hydroxylation was performed with hisPhhAB (curve marked with crosses). Addition of 25 μg hisPhhAB (curve marked with squares) or 75 μg hisPhhAB (curve marked with triangles) to the PAH reac- tion gradually decreased the transient accumulation of pterin-4α-carbinolamine;
Figs. 10A and B show DNA sequences of the inserts in plasmids pAMJ792 (A)(SEQ ID NO:3) and pAMJ805 (B)(SEQ ID NO:4). Restriction enzyme sites and amino acids originating from linker sequences are shown in bold and the putative ribosome binding site is underlined. The dotted line indicates the encoded Usp45 secretion signal;
Fig. 11 is a TLC autoradiogram of lactococcal proteins. Lanes 1 and 2 contain intracellular cell extracts from strains L. lactis AM J817 and AMJ792. Lanes 3 and 4 contain concentrated supematants from strains AMJ817 and AMJ792. L. lactis strain AMJ817 carried pAMJ206 (containing no insert). Lane 5 contained [14C]-L-tyrosine. The dots at the bottom indicate the position of the sample loading site and the bars at the top side indicate the migration front. Phe and Tyr show the position of L-phenylalanine and L-tyrosine, respectively. Traces of [14C]-D-phenylalanine were observed just above Phe in the lanes con- taining [14C]- phenylalanine;
Fig. 12 is a TLC autoradiogram of cell extracts showing extracellular and intracellular PhhA activity in L lactis AM J792 (lanes 1 and 3) and L lactis AMJ805 (lanes 2 and 4). Lanes 1 and 2 contained concentrated supematants. Lanes 3 and 4 contained intracellular extracts. Phe and Tyr indicate the position of L-phenylalanine and L-tyrosine. Traces of [14C]-D-phenylalanine were observed just above Phe in the lanes containing [14C]- phenylalanine.
Fig. 13 shows the phenylalanine hydroxylase activity measured with TLC assay. phhAB and MBP-hPAH convert 85% and 74% of the phenylalanine to tyrosine in 60 minutes using 200 μM phenylalanine;
Fig. 14 shows phenylalanine hydroxylation at different concentrations of the substrate;
Fig. 15 illustrates the pH dependence of hisPhhAB activity. More than 75% of the maximal activity was retained between pH 5.5 and 8.5;
Fig. 16 illustrates the hydroxylation reaction as a function of temperature, the reaction was carried out for 10 minutes. The optimal assay temperature was 32°C, 50% of the activity was retained between 18°C and 42°C;
Fig. 17. shows a mass spectrogram of intact protein molecule. The mass spectrometry showed a mass of 48004 Da +/- 96 Da which correlates with the theoretical mass of 48032 Da; and
Fig 18. Illustrate the result of mass spectrometric peptide mapping. The underlined parts of the protein were identified as the combined tryptic and chymotryptic peptides. Underlined sequences are enclosed as SEQ ID NO: 6-13.
EXAMPLES
MATERALS AND METHODS
Strains, plasmids, media and growth conditions
The strains and plasmids used herein are listed in the below Table 1.
Table 1. Bacterial strains and plasmids used Strain or plasmid Characteristics Reference or origin
Escherichia coli
TOP10 P rpsL(StrR) Invitrogen
SP536 F7aclq1 /acZ::Tn5(KanR) Sørensen and Pedersen., 1991
TOPIq TOP10 F7aclq1 /acZ::Tn5(KanR) This study
TUC18 TOP10 with pUC18 This study
JZ9M131 TOP10 with pJZ9M 131 This study
TJZ9MΔB TOP10 with pJZ9MΔB This study
AB3257 aroF aroG aroH s.r712(StrR) Wallace and Pittard, 1969
ABJZ9M131 AB3257 with pJZ9M 131 This study
ABUC18 AB3257 with pUC18 This study
FUSAB AB3257 with pFUSAB This study
MGJ4 (DSM 13242) TOP10 with pMGJ4 This study
TB1 MAL-Xa-hPAH Expression of hPAH AmpR Martinez et al. 1995
Lactococcus lactis subsp. cremoris
MG1363 PrtP Lac Gasson, 1983
AMJ817 MG1363 with pAMJ206 WO 98/10079
AMJ792 MG1363 with pAMJ792 This study
AMJ805 MG 1363 with pAMJ805 This study
Plasmids pUC18 Plac lacZ lacl AmpR MB1 rop Yanisch-Perron et al., 1985 pJZ9 pUC18::5.7kb phhA, B and C Zhao er a/., 1994 pJZ9M131 pUC18::2.5kb Hindi phhA and B This study pJZ9MΔB pJZ9M131 Sph\ 0.5 kb deletion in This study phhB pCR2.1 Plac lacZα AmpR KanR ColE1 Invitrogen pFUSAB pCR2.1 ::1.2kb phhAB This study (SEQ ID NO:1) pTrcHisA Ptrc /aclq ampR ColE1 Invitrogen pMGJ4 pTrcHisA::/7/"s75::1.2kb phhAB This study (SEQ ID NO:2) pAMJ206 P170 from pAMJ586 ErmR WO 98/10079 pAMJ219 AMJ206::usp45 s.s. * ErmR WO 98/10079 pAMJ792 pAMJ206::1.2kb Λ β This study (SEQ ID NO:3) pAMJ805 pAMJ792::ι/sp45 s.s.*::1.2kb This study (SEQ ID NO:4) phhAB * usp45 s.s. indicates a fragment encoding the export signal sequence of the secreted Usp45 protein (van Asseldonk et al., 1990).
The vector system for controlled expression in Lactococcus lactic is described in WO 98/10079. Professor R.A. Jensen kindly provided the plasmid pJZ9 including phhA, B and C (Zhao et al., 1994). Sequencing of the pJZ9 plasmid revealed a substitution of a de- oxyadenylate (A) with a deoxyguanylate nucleotide (G) at position 589 in the database sequence (Sequence database reference number M88627). However, this had no influence on the deduced amino acid sequence. All £. coli strains were grown at 37°C on LB medium supplemented with the appropriate antibiotics, i.e. ampicillin (100 μg/ml), kana- mycin (50 μg/ml), streptomycin (25 μg/ml) and tetracycline (12.5 μg/ml). For selection of auxotrophs, M9 medium supplemented with phenylalanine, tryptophan and chorismate precursors was used as recommended by Wallace and Pittard (1969). The lactococcal strains were selected on M17 medium (Oxoid) supplemented with 0.1 % w/v glucose, 0.1 % w/v arginine and 1 μg/ml erythromycin. For the fermentation of lactococcal strains, a basic medium mix, BMM, was developed. BMM is a modification of the SAIV medium (Jensen and Hammer, 1993). The medium components of SAIV were included at three times the original concentration, except that the sodium acetate and the sodium chloride from the sodium saline phosphorus ammonium mixture (NSPA) was added at the original concentration and the medium was supplemented with 5g of yeast extract pr. litre. Also, the morpholinopropane sulfonate buffer (MOPS) from the MOPS-base was excluded. The fermented cultures were kept at pH 6.0 by automatic addition of 2M KOH. The cultures grew to a maximum optical density of 6.5 determined at 600 nm. The cultures used 0.14 mol KOH per litre. The cultivation temperature was 30°C for both selection procedures and fermentations.
Induction of £. coli strains was performed by growing cells to an optical density of 0.5 measured at 600 nm. Then 0.5 mM isopropy-thio-β-D-galactoside (IPTG) was added and growth was continued for a further 3 hours.
DNA isolation and manipulations
Plasmid transformations were conducted by electroporation of both £. coli strains and Lactococcus lactic MG1363. Cell treatment procedures for £. coli were as suggested by BioRad, the manufacturer of the electrotransformation apparatus Gene Pulser™ connected with a Pulse Controller. The competent cells of lactococcal strain MG1363 was prepared as described by Holo and Nes, 1989. DNA restriction enzymes were purchased from New England BioLabs and used as recommended by the supplier. Plasmid DNA was extracted from £ coli using alkaline lysis and affinity columns manufactured by Genomed GmbH, Germany, according to the protocol recommended in the JETSTAR™ Plasmid Kit. Plasmid DNA from lactococcal strains was extracted according to the procedure described by O'Sullivan and Klaenhammer, 1993. All DNA manipulations were performed as described by Sambrook et al. 1989. Sequences of all plasmid constructions were verified by conducting the procedures recommended by Pharmacia Biotech with the ALPex- press™ automated sequencing facilities.
Protein expression products were analysed by SDS-PAGE by the use of the NOVEX™ electrophoresis system. For the evaluation of protein content samples were submitted to gradient gels of 4-20% polyacryamide and the gels were stained with Coomassie Brilliant Blue. The procedures were conducted according to the recommendations of the supplier.
PCR cloning procedures
All PCR reactions were conducted using the following procedure: 30 seconds of denatu- ration at 95°C, then 30 cycles consisting of denaturation for 30 seconds at 95°C, annealing for 30 seconds at 52°C and extension for 1 minute at 72°C and a final extension for 7 minutes at 72°C. The DNA reaction products were subjected to agarose gel electrophoresis and the appropriate fragments were extracted using the QIAGEN™ Gel Extraction Kit.
In vitro assay for phenylalanine hydroxylase activity using 14C phenylalanine
In the phenylalanine hydroxylase assay used, the conversion of L-phenylalanine to L-tyrosine in the presence of 0.2 mM L-phenylalanine is measured. For radioactive isotope de- tection, L-[U-14C]phenylalanine (Amersham Life Science Products) was added to a concentration of 1 μCi/ml. The incubation conditions were adapted from Martinez et al., 1995. The assay mixture was incubated at 25°C at a final volume of 50 μl, containing 50 mM N- [2-hydroxyethyl]piperazine-N'-[2-ethanesulfonic acid] (KOH-Hepes), pH 7.0, 200 mM KCI, 0.1 mM ferrous ammonium sulphate, 0.4 mg/ml catalase (65,000 U/mg, Roche Molecular Biochemicals), 5 mM dithiothreitol (DTT), 0.2 mM L-phenylalanine, 0.1 mM (6R)-5,6,7,8- tetrahydro-L-biopterin dihydrochloride (BH4) (Schircks Laboratories, Switzerland), 2 mM phenylmethylsulfonyl fluoride (PMSF). Reactions were started by the addition of BH4. In order to keep the stock of BH4 in a reduced stage, 4 mM of the DTT in the final assay mixture was added when BH4 was introduced. Boiling for 2 minutes stopped the reaction.
For detection of products formed from non-radioactive molecules, 1 μmol of L-phenylalanine, L-tyrosine, L-tryptophan or the Gly-Phe dipeptide was added to the assay. The assay reaction products containing amine groups were derivatised with 6-aminoquinoline (AMQ, AccQ Fluor reagent, Waters Corporation). Assay samples of 10 μl were adjusted with 70 μl sodium borate solution (200 mM boric acid and 5 mM Ethylenedi- aminetetraacetic Acid (EDTA), pH 8.8) and 20 μl of AQC reagent was added (3 mg/ml acetonitrile, Fisher Scientific Company). Amino acid standard no. H (Pierce Chemical Company), 3.4-dihydroxyphenylalanine (DOPA), dopamin, 5-hydroxytryptophan, 5-hy- droxytryptamine (serotonin) and Gly-Phe dipeptide were all purchased from Sigma Chemical Company.
Detection of phenylalanine hydroxylase activity by Thin Layer Chromatography (TLC)
Assay samples including [14C]phenylalanine were analysed by TLC. The assay mixture was centrifuged at 15,000g for 5 minutes and 5 μl sample was spotted onto a silica gel 60 plate (Merck). The chromatography plate was placed in a solution of 55:35:10 v/v chloro- form:methanol:ammonia and run for 1 hour. The product formation was visualised from the dried TLC plate by autoradiography on Kodak BioMax MR film for 9 hours or more. The formation of tyrosine was evaluated by including reference samples of L-[U- 14C]tyrosine samples on the plates.
Detection of phenylalanine hydroxylase activity by High Performance Liquid Chromatography (HPLC)
HPLC separation was performed on a NovaPak C18 column (3.9X150 mm) connected with the Waters Corporation 626 LC system including a 717 autosampler and a 474 scanning fluorescence detector. Collected data were analysed using Waters Corporation Expert Ease software. Amino acids, peptide, DOPA, dopamine, 5-hydroxytryptophan and serotonin were all resolved by the same buffer gradient. The column was washed and saturated with the buffer A (500 mM NaCI and 20 mM Tris HCI, pH 7.9). The gradient was obtained by controlled dilution of A buffer in water. The gradient program in respect of percentage of A buffer was as follows; 0 min. 100%), 0.5 min. 99%, 18 min. 95%, 19 min 91%), 29.5 min 83%, and 33 min. with water. A flow rate of 1 ml/min at 37°C and a turn- around time of 45 minutes were used in these procedures. For product detection an excitation wavelength of 250 nm was used and the emission wavelength at 395 nm was monitored.
HisPhhAB protein purification
£ coli was grown to an optical density of 0.5 determined at 600 nm. Promoter induction was achieved by addition of IPTG to a final concentration of 0.5 mM and growth was continued for three hours before cells were harvested. Cells from 50 ml of culture were centrifuged at 4,000g for 10 minutes at 4°C and then re-suspended in 1,5 ml buffer A includ- ing 0.1 mg/ml lysozyme. Cells were disrupted by sonication and then centrifuged at 10,000g for 30 minutes at 4°C. The resulting extract was collected and used in column affinity purification procedures.
A QIAGEN™ Ni-NTA resin column was loaded with sample and washed with buffer A supplemented with 20 mM imidazole. The tagged fusion protein was eluted in buffer A containing 200 mM imidazole.
Production of PhhAB in L. lactis
For extraction of intracellular protein, cells from 50 ml fermented culture were resus- pended in 0.5 ml extraction buffer (50 mM Hepes-KOH, pH 7.0, 200 mM KCI and 0.04 ml Complete™ (EDTA free protease inhibitor mixture from Roche Molecular Biochemicals) per ml extraction buffer. The extraction was conducted by addition of 0.5 ml glass beads (106 μm, Sigma Chemical Company) and disruption of cells in the FastPrep machine (BIO101) at speed 6.5 for 25 seconds. The disruption was repeated three times and the sample was cooled on ice before each re-treatment. Extract was centrifuged at 20,000g for 15 minutes. The intracellular extracts were stored at -70°C without detectable loss of activity. The extracellular enzymatic activity was evaluated from the culture supematants. The supematants were re-centrifuged at 20,000g for 15 minutes at 4°C and concentrated on a Millipore Biomax 10NMWL filters. Samples of 4 ml were centrifuged at 5,000g for 30 minutes at 5°C, then washed with 2 ml washing buffer (50 mM Hepes-KOH, pH 7.0 and 200 mM KCl) and finally concentrated 80 times by centrifugation for another 30 minutes under the same conditions. The concentrate was treated on a BioRad P30 micro spin column equilibrated with washing buffer. The untreated supematants could be stored at -20°C without detectable loss of activity.
EXAMPLE 1
Confirming that activity of PhhA is enhanced by co-production of PhhB
R.A. Jensen and co-workers (Zhao et al., 1994) have reported the construction of a high- level expression plasmid, pJZ9-3a, which carries phhA and phhB in the pUC18 vector. Deletion of the phhB resulted in a substantial reduction of PhhA activity with only a small reduction in the PhhA yield. This result suggested dependency between PhhA and PhhB and was further supported by experiments in which high PhhA activity was restored by trans-complementation with PhhB (Song et al., 1999). These data are confirmed in the following experiments.
A plasmid, pJZ9M131 (Fig. 3), identical to pJZ9-3a was constructed. The construction was performed as described by Zhao et al., 1994. Plasmid pJZM131 was introduced into £ coli TOP10 and the resulting strain was designated JZ9M131. Also, the plasmid, pJZ9MΔB (Fig.3), which is a derivative of pJZ9M131 having a deletion in phhB gene, was constructed. The pJZΘMΔB construction was identical to the pJZ9-5 plasmid described by Zhao et al., 1994, and it was obtained using the same strategy.
Plasmid pJZ9MΔB was introduced into the two £. coli strains TOP10 and TOPIq and the resulting transformants, JZ9MΔB and TJZ9MΔB, were propagated in LB containing glucose and ampicillin. E.coli TOPIq provides controlled gene expression by tight repression of the lac promotor. Induction of gene expression was performed as described in the Materials and Methods section above. Samples were collected for total protein analysis by SDS-PAGE and determination of PhhA activity (Fig. 4A and 4B). It was demonstrated that PhhA could be produced in strains JZ9MΔB and TJZ9MΔB. However, it was also demon- strated that the highest PhhA level was produced in TJZ9MΔB and that no detectable PhhA activity was found in the cell extracts of TJZ9MΔB (Fig. 4B).
From the work of R. A. Jensen et al. and the results generated in our laboratory, it has become clear that PhhA activity is strongly enhanced when PhhB is co-produced.
The mammalian phenylalanine hydroxylation activity in vivo is dependent on the regeneration of tetrahydrobiopterin co-factor BH4. When procedures for the purification of active PAH were developed, it was observed that a co-purified protein supports the PAH activity (Lazaurus and Benkovic, 1983 , Lei and Kaufman, 1998) This protein was designated phenylalanine hydroxylase stimulating protein, PHS. Later it was revealed that PHS acts as a biopterin 4a-carbinolamine dehydratase corresponding to the bacterial PhhB (Lazaurus and Benkovic, 1983, Citron et al., 1992). The detection of a co-purified dehydratase enzyme suggests that PhhB stimulates PhhA activity, not only by improved co-factor re- generation, but also by working as a complex with PhhA having a high stability.
In the following example, the focus is on the production of an enzyme with a high phenylalanine hydroxylase activity and on the development of a fusion enzyme that ensures a stable and active PhhA-PhhB complex. The development of a functional fusion enzyme was expected to facilitate production and secretion in recombinant micro-organisms. Initial protein characterisation of PhhA strongly indicates that the protein acts as a monomer, in contrast to the homologous mammalian phenylalanine hydroxylases (Kaufman, 1993). In addition, a prokaryotic-based fusion enzyme was chosen since the enzyme should work as a monomer after secretion from the micro-organism.
EXAMPLE 2
Construction of the phhAB transscriptional fusion in E. coli
The first step in constructing the gene fusion, phhAB, was performed by PCR amplification of each of the separate phhA and phhB genes. Both amplification reactions were conducted with the pJZ9 plasmid as template. The phhA fragment was amplified with an upstream oligonucleotide (in the following also referred to as oligo), PHHA.for and the downstream oligo, phhAfus.rev. The latter oligo contained 14 nucleotides that were com- plementary to the 5' end of the phhB fragment. The upstream phhB oligo, phhBfus.for was used together with the downstream oligo, Phhb-rev, containing a Sail site positioned after the phhB stop codon. The phhBfus.for oligo contained 11 nucleotides that were complementary to the 3' end of the phhA fragment. Oligo DNA sequences are presented in Table 2 below.
Table 2. List of oligonucleotide names, sequences and relations Name Sequence 5' - 3'*' Relation
POLYMERASE CHAIN REACTIONS
PHHA.for TAAATTGAAAACGACGCAGTACGTGGCC FUSAB
Phhb-rev GGAAGTGACTGACTCATTTGCGCCCCTCG FUSAB phhAfus.rev CCGACCATAGTACAAGGCCGCCTGCTTGGGCGGGAACAGCGGCG FUSAB phhBfus.for GCAGGCGGCCTTGTACTATGGTCGGCAGGCACGG FUSAB
PHHA-his.for TAAATCATGAAACACCAACACCAACATCAACATCAACATCAACATC MGJ4
AAAAAACGACGCAGTACGTGGCC pseudoPAH. GGAAGTCGACTCAGGCCGCCTGCTTGGG MGJ4, AMJ792 rev
PHHA- TAAATCATGAAAACGACGCAGTACGTGGCC AMJ792 aug.for pAK80.rev2 CCCATTTAGCCGTCATTTCAGC AMJ805
Usp-Ncol.rev CCATGCCATGGCTGTGTCAGCGTAAACACCTGA AMJ805
SEQUENCE VERIFICATION*2
ppahseq.for CAGCAATTCCCCGTCGCCAC phhAB insert pphh2.for CCGACGAGCCGCTGCACC phhAB insert phh2.rev GGCAGGCTTCGCAATGGGC phhAB insert
M13for CGCCAGGGTTTTCCCAGTCACGAC pFUSAB
M 13rev TCACACAGGAAACAGCTATGAC pFUSAB
Trc seq TATCAGACAATCTGTGTGGGGC pMGJ4 exp.vec.up1 GGATCCCGGGTCTAGATTAGGG pAMJ792, 805
PrrnCtt CTCGAACTCCCAACACCC PAMJ792, 805
*1 The sequences given in bold indicate restriction sites that were introduced. All custom designed oligos were delivered from DNA Technology ApS, Denmark.
*2 Oligos for sequence verification were all manufactured with 5'Cy5 for emission detection. The resulting PCR fragments were designed such that a mixture of melted PCR-products could hybridise between the 3' end of the pΛM-containing fragment and the 5' end of the fragment containing phhB. Subsequently, the annealed ends were extended using Taq polymerase and the resulting fragment was PCR amplified using the two outer primers PHHA. for and phhb-rev.
The phhAB fragment containing the fusion was inserted into the PCR-cloning vector pCR2.1 , which was a ready-to-clone version prepared with A-protruding ends. The £ coli lac promoter, the corresponding ribosome binding site and a short DNA fragment encod- ing the 26 N-terminal codons of lacZ is located upstream of the inserted phhAB gene. Subsequently, the resulting plasmid, pFUSAB, was introduced into the tyr auxotroph £. coli strain AB3257. The transformants were selected on minimal medium without tyrosine, but supplemented with phenylalanine, lactose and ampicillin, which only permits growth of transformants with functional PhhA activity. Surprisingly, only a single transformant was found. This experiment was repeated twice, but no additional transformants were obtained. Using E. coli AB3287, a transformation efficiency of 105-106 was routinely reached with 100 ng of vector DNA ligated with 5 times the amount of insert DNA. This transformant, FUSAB, was restreaked on LB plates containing glucose and ampicillin. Plasmid was extracted and DNA sequencing showed that, following the 26 codons of the 5' end of the £ coli lacZ, pFUSAB contained phhA immediately followed by the expected junction sequence encoding 22 amino acids presented in Fig. 5 (SEQ ID NO:1). However, the original start codon, ATG, of the phhB gene downstream of the junction sequence was changed to ACG. This codon change leads to incorporation of threonine instead of the original methionine. The apparent need for a codon substitution could account for the low number of transformants observed in the functional selection. The fusion enzyme might result from an appropriate junction providing a stable and functional conformation. Relevant DNA and amino acid sequences are presented in Fig. 5 and plasmid inserts are shown schematically in Fig. 3.
To confirm expression of PhhA activity, a FUSAB extract was analysed by an in vitro assay. As shown in Fig. 6B, FUSAB produced PhhA activity similar to the activity obtained from ABJZ9M131 , which contains phhA and phhB. Additionally, protein extracts were applied to SDS-PAGE. In accordance with the deduced size of 49.1 kDa, a band of 49 kDa was detected on a Coomassie Brilliant Blue stained gel (Fig. 6A). In conclusion, it was demonstrated that PhhAB can be produced in £. coli and that the PhhA activity is similar to the activity found in a strain that produces PhhA and PhhB as separate polypeptides.
EXAMPLE 3
Construction, expression and purification of a His15-tagged PhhAB protein
To facilitate purification of the fusion protein, the phhAB encoding region of pFUSAB was transferred to an £. coli high-level expression vector, pTrcHis. In this transfer process, the original peptide-tag was substituted with a Met-Lys-(His-Gln)6tag (the His15-tag, Unizyme Laboratories, Denmark) and a SspHI restriction site suitable for introduction at the Λ/col vector site was introduced.
A PCR fragment was produced using the oligo DNAs, PHHA-His.for and pseudoPAH.rev using pJZ9M131 as template. The oligo sequences are given in Table 2. The resulting 815 bp PCR fragment carried a SspHI site located at the 5' end, and an internal Pst site. Upon SspHI and Pstl digestion the resulting 0.4 kb fragment was isolated. In combination with the 0.9 kb Ps/I-Sa/I fragment obtained from pFUSAB, the 0.4 kb PCR-fragment was inserted into the Λ/col and Xhol sites of the pTrcHis vector. The resulting plasmid, pMGJ4, contained a His15-tagged phhAB gene as shown in Fig 3. Plasmid pMGJ4 was introduced into £. coli TOP10 and the resulting strain was named MGJ4. The correct DNA sequence of the junctions of the inserted fragments in pMGJ4 was confirmed (Fig. 7)(SEQ ID NO:2).
Plasmid pMGJ4 has been deposited in accordance with the Budapest Treaty with DSM under the accession number DSM 13242.
The tagged protein was purified by applying cell extract to a nickel charged chroma- tographic column which was subsequently washed and eluted using standard protocol conditions described by the manufacturer (QUIAGEN) The purified recombinant protein was shown to harbour PhhA activity (Fig. 9). The protein was purified to more than 90% purity as judged from Coomassie Brilliant Blue stained SDS-PAGE gels (Fig. 8). Lane 1 : Rainbow marker (Amersham Pharmacia), lane 2: hisPhhA (0.1 nmol, 3.1 μg, 31 kDa), lane 3: hisPhhAB (0.1 nmole, 4.8 μg, 48 kDa), lane 4: MBP-hPAH (0,1 nmole, 9.4 μg, 94 kDa). Total protein yields were evaluated by the Lowry method (Harlow and Lane, 1988) to be 3.18 mg.
Preparations of purified His15-tagged PhhAB, designated HisPhhAB, were used in the subsequent protein characterisations as described below.
In conclusion, it was demonstrated that HisPhhAB showed affinity for nickel charged chromatographic columns, which were used for easy purification of the recombinant enzyme. Furthermore, HisPhhAB was shown to have PhhA activity.
EXAMPLE 4
Determination of specific PhhA activity of PhhAB
Using standard assay conditions, described in the Materials and Methods section, the specific PhhA activity of purified HisPhhAB in two different preparations was determined to be in the range of 4 to160 nmol-min"1-mg"1 which is in accordance with the previously reported specific activity ranging from 4 to 153 nmol-min"1-mg"1 for co-purified PhhA and PhhB (Zhao et al., 1994).
The standard assay conditions were modified to determine the requirements for activity. Both the presence of Fe2+and the tetrahydrobiopterin co-factor was found to be essential for activity. The optimal activity performance was found at pH 7.4, 50 mM KCl, 20 mM K3PO4. Purified HisPhhAB showed PhhA activity in MCAC-0 buffer (0.5 M NaCI, 20 mM Tris-HCI [pH 7.9]) and in MCAC-2020 mM imidazole, 0.5 M NaCI, 20 mM Tris-HCI [pH 7.9]). Immobilised HisPhhAB was tested in MCAC-0 buffer. Only a weak activity was obtained. HisPhhAB maintained PhhA activity when stored for more than a month at 4°C in 50 mM KCl, 20 mM KsPO . In contrast to the mammalian PAH (Kowlessur,ef al., 1996), pre-incubation with phenylalanine was not observed to activate the PhhA activity of HisPhhAB.
The human PAH was reported to catalyse hydroxylation of phenylalanine in more than one position of the aromatic ring (Kaufman, 1993). Although these reactions occur at a low rate, the biological importance is significant, since the resulting compounds may exert neurotoxic effects (Kaufman, 1993). Therefore, the hydroxylation capability of the HisPhhAB product was examined with special reference to formation of DOPA, dopamine, 5- hydroxytryptophan and serotonin. The ability of HisPhhAB to hydroxylate phenylalanine integrated in proteins would be of practical importance for using PhhAB to convert phen- ylalanine in foods. Therefore, the potential ability to hydroxylate phenylalanine incorporated in the dipeptide Gly-Phe was also examined.
Phenylalanine, tyrosine, tryptophan or Gly-Phe was incubated with HisPhhAB and product formation was analysed by HPLC. After incubation, high sensitivity of detection was ob- tained by the derivatisation of all components in the reaction mixture with 6-aminoquin- oline (AQC) followed by detection of the fluorescence emitted upon excitation. Only conversion of phenylalanine to tyrosine could be detected. The results are summarised in the below Table 3. As it appears from this table, no product with neuroactive effects or hydroxylation of phenylalanine in the dipeptide was found.
Table 3. Detection of hydroxylation products
Hydroxylation product*1
Substrate Tyr Phe Tip Gly-Phe Gly-Tyr DOPA Dopamin 5-OH-Trp* Serotonin
Phe 1 nmol <50 fmol - - - <1 fmoi <1 fmol <1 fmol <1 fmol
Tyr 1 nmol - - - <1 fmol <1 fmol <1 fmol <1 fmol
Trp 1 nmol - - <1 fmol <1 fmol <1 fmol <1 fmol
Gly-Phe - 1 nmol <50 fmol - - - -
1 50 μg HisPhhAB was incubated for 10 minutes with 1 nmol of substrate. '-' Indicates that detection of the specific hydroxylation product is of no relevance. * 5-OH-Trp is an abbreviation of 5-hydroxytryptophan.
In conclusion, it was demonstrated that PhhAB specifically hydroxylates phenylalanine at the para-position without any detectable hydroxylation of the other tested aromatic compounds.
5
EXAMPLE 5
Dehydratase activity of PhhAB
10 In vivo dehydration of the oxidised co-factor, 4(x-carbinolamine, is essential for the recycling of co-factor as described above (Fig.l). Clones expressing both the phhA and phhB were capable of complementing a tyr auxothroph £ coli strain. Also, clones expressing phhAB were capable of complementing the ryr auxothroph £. coli strain suggesting that PhhAB has the PhhB activity or is activating the PhhA activity. The following experiment
15 was carried out to determine the PhhB activity of PhhAB.
The addition of an excess of PAH to a preparation containing phenylalanine and the co- factor BH4 will lead to the accumulation of 4α -carbinolamine. Recombinant human PAH was produced in £. coli as a fusion with maltose binding protein (MBP) (Martinez et al.,
20 1995) and purified by utilising the MBP substrate affinity (Fig. 8). The assay conditions described by Lazarus et al. (1983) were modified as described in the Materials and Methods section. The 4α-carbinolamine accumulation was monitored as the change in absorb- ency at 244 nm. The accumulation of 4<x-carbinolamine should be reduced by the presence of PhhB activity since 4<x-carbinolamine is converted to quinonoid dihydropterin. It is
25 contemplated that PhhB activity can be analysed by using radiolabeled 4a-carbinolamine as a reagent. As shown in Figure 9, the addition of 75 μg HisPhhAB decreased the pool of 4a-carbinolamine strongly indicating that PhhAB has PhhB activity.
In conclusion, we have produced a PhhA-PhhB fusion in such a way that both catalytic 30 activities have been preserved. The stability of a functional fusion enzyme facilitates production and purification of PhhAB. The PhhAB fusion product may readily be produced by micro-organisms including hosts that are generally regarded as safe. EXAMPLE 6
Expression of the phhAB fusion in . lactis
A PCR fragment was produced using the upstream oligo PHHA-aug.for and the downstream oligo, pseudoPAH.rev, using pJZ9M131 as template. The resulting 805 bp PCR fragment carried a 5' end positioned SspHI site and an internal Psfl site. Upon SspHI and Pstl digestion, the resulting 0.34 kb fragments was isolated. In combination with the 0.9 kb Pstl-Sall fragment obtained from pFUSAB, the 0.34 kb PCR-fragment was inserted into the SspHI and Sail sites of pAMJ206. The resulting plasmid, pAMJ792 (Figs. 3 and 10A), contained the phhAB gene placed downstream of the P170 promoter and the ribosome binding site of the lacLM genes.
In addition, a derivative of pAMJ792 was constructed that carries a DNA sequence, en- coding a secretion signal at the 5' end of phhAB. This construction was expected to provide PhhAB secretion in L. lactis. The fragment encoding the secretion signal sequence from Usp45 (van Asseldonk et al., 1990) was PCR amplified using the pAMJ219 vector as template and the DNA oligos pAK80.rev and Usp-Ncol.rev. At each terminal, the resulting PCR product contained a Xhol and a Ncol restriction site, respectively. The digested PCR-fragment was inserted into the Xhol and SspHI sites of pAMJ792. The secretion signal sequence of the resulting plasmid pAMJ805 is presented in Figs. 3 and 10B.
The DNA sequence at the junction sites of pAMJ792 (SEQ ID NO:3) and pAMJ805 (SEQ ID NO:4) was confirmed and the plasmids were introduced into L. lactis MG1363, result- ing in strains AMJ792 and AMJ805, respectively.
The L. lactis strains AMJ792 and AMJ805 were grown in fermentors as described in the Materials and Methods. PhhA activity and the presence of recombinant proteins were analysed in cell extracts and in concentrated supematants.
In SDS-PAGE, the PhhAB protein yields obtained from both L lactis strain AMJ792 and strain AMJ805 were too low to be distinguished from host proteins present in the super- natants and intracellular extracts. Surprisingly, the AMJ792 strain showed PhhA activity both in cell extracts and in the supematants (Fig. 11). The growth rates were constantly equivalent to that of strain MG1363 carrying the plasmid pAMJ206 without an insert, indi- eating that no extraordinary cell lysis could account for the PhhA activity in the supernatant. An equal amount of PhhA activity was detected in AMJ792 extracts and in the corresponding supernatant. Strain AMJ805 containing the secretion signal was found to secrete a higher fraction of PhhAB corresponding to 70% of the total PhhA activity produced (Fig. 12).
In conclusion, it was demonstrated that phhAB encodes a protein that confers PhhA activity in L lactis. Furthermore, it was demonstrated that the activity could be detected in the growth supematants showing that PhhAB is secreted from L lactis.
EXAMPLE 7
Activity characteristics of the purified PhhAB
Purification of hisPhhAB and hisPhhA was performed as previously described. Human phenylalanine hydroxylase (hPAH) was purified as a maltose-binding fusion protein with maltose-binding protein (MBP) using the pMAL bacterial expression system (New England Biotech). The eluted proteins were concentrated and buffer was changed to assay buffer (50 mM KCl, 20 mM K2HPO4 pH 7.4) at 2-5 mg/ml by ultrafiltration (Millipore ultra- filter, cut-off 10,000 kDa). Concentration was determined by measuring the absorbance at 280 nm using theoretical extinction coefficients for the recombinant proteins. Calculated extinction coefficients are: hisPhhAB, ε=62780/M/cm; hisPhhA, ε=35620/M/cm; MBP- hPAH, ε= 110220/M/cm.
The standard phenylalanine hydroxylase assay was carried out as follows: To 45 μl purified protein the following reagents were added, 1 μl Fe((NH4)2SO )2 and incubated 1 min at 25°C (standard assay temperature), the 2 μl mix containg 5 mM L-phenylalanine (standard assay, 200 μM final concentration), 1 μmol 14C-labeled L-phenylalanine and 1 μl catalase (10 mg/ml) was added and after 2 min incubation the reaction was started by adding 2 μl BH4/DTT (2.5 mM/100 mM) to reach final concentrations of 100 μM and 4 mM, respectively. After incubation for 10 min, the reaction was stopped by adding 50 μl 8 % TCA. Protein-free extracts were obtained by 5 min centrifugation (13000 rpm). Phenylalanine hydroxylase activity was measured by separating phenylalanine and tyrosine by thin- layer-chromatography (TLC). Two microliters of each sample was spotted on a TLC-plate (10x20 cm, Merck 1.05730). When dry, plates were run in a humidified chamber prepared with 12 ml solution A (33 % (v/v) HAc) and 28 ml solution B (50 % (v/v) n-butanol, 50 % (v/v) acetone, 1.2 % (w/v) ninhydrin. TLC-plates were placed in the chamber for 60-75 min and dried completely (ninhydrin-stained amino acid become visible). The plates were wrapped in one layer of SaranWrap and exposed to a phosphorimager screen for at least 16 hours before development. Quantification of the phenylalanine and tyrosine bands was done by using the software ImageQuant (Molecular Dynamics Inc.). The background value of the plate was subtracted for each sample and the percent conversion was calculated.
Amino acids were detected using HPLC. Alternatively, assay reactions were analysed by HPLC using the AQC-derivatization method (Waters Inc.). After deproteination the samples were derivatized as follows: An aliquot containing 10 μl sample was buffered at pH 8.8 with 70 μl sodium borate (200 mM). Derivatization was accomplished by the addition of 20 μl of AQC reagent (3 mg/ml in acetonitrile). HPLC separations were performed on a Nova-Pak C18 column using a sysmte consisting of a 626 LC system, a 717 autosampler and a 474 scanning fluorescence detector (Waters Inc.) Chromatographic data were collected and analyzed using Waters Expert Ease software. Chromatographic analysis of the di-peptides: Phe-Gly, Gly-Phe, dopa, dopamine, 5-hydroxytryptophan and serotonin was done using the same gradient, 0 min 100 % A, 18 min 95 % A, 19 min 91 % A, 29.5 min 83 % A, 33 min 0 % A. The flow rate was 1 ml/min at 37°C and the turnaround time was 45 min. Excitation wavelength was 250 nm and emission wavelength was 395 nm.
hisPhhAB, hisPhhA and MBP-hPAH were purified to near homogeneity as judged by SDS-PAGE/Coomassie-staining (figure 8). Lane 1: Rainbow marker (Amersham Pharmacia), lane 2: hisPhhA (50 μg, 31 kDa), lane 3: hisPhhAB (50 μg, 48 kDa), lane 4: MBP- hPAH (50 μg, 94 kDa).
The specific activity of PhhAB was measured using the standard assay with varying phenylalanine concentrations and assay time. In order to test how fast phenylalanine could be converted to tyrosine an assay with varying reaction time was performed. Figure 13 shows that PhhAB and MBP-hPAH convert 85 % and 74 % of the phenylalanine to tyrosine, respectively in 60 min using 200 μM phenylalanine. However initial turnover at non-limiting concentrations of substrate are 0.7 mmol/min/nmol protein for hisPhhAB and 0.65 mmol/min/nmol protein for MBP-hPAH. While MBP-hPAH is subjected to reversible activation by the substrate (Zhao et al., 1994), hisPhhAB is hydroxylating phenylalanine at low concentrations (> 50 μM). Figure 14 shows the phenylalanine hydroxylation at different concentrations of the substrate (standard assay time: 10 min). It can be seen that while MBP-hPAH is unable to catalyze efficiently below 200 μM phenylalanine, hisPhhAB is active and is apparently not subjected to substrate activation.
The standard assay was used to measure pH-dependence of hisPhhAB. Five microlitres of the enzyme (236 μM) was diluted in 50 mM KCl, 20 mM K2HPQ, adjusted to varying pH -ranging from 3,5 - 8,5. Figure 15 shows that the optimal pH is pH 7.5, and that more than 75 % of the maximal activity was retained between pH 5.5 and 8.5.
Additionally, the standard assay was used to measure the temperature dependence of hisPhhAB activity. A gradient PCR machine (Biometra) was used to generate a tempera- ture-gradient from 10°C to 50°C and the hydroxylation reaction was carried out for 10 min. Figure 16 shows that the optimal assay temperature is 32°C and that 50 % of the activity was retained between 18°C and 42°C.
The purified hisPhhAB was stored in assay buffer at -20°C , 4°C and 20°C. After 30 days we were unable to detect a decrease in activity in samples stored at -20°C. Storage at 4°C and 20°C reduced the measurable activity with 15 % and 40 %, respectively. Storage in the same buffer supplemented with 10 % glycerol decreased the activity at all storage temperatures assayed (data not shown).
AQC has been shown to react rapidly and quantitatively with the amine group of amino acids (Cohen, S.A. and Michaud, D.P., 1993). Therefore it was expected to react similarly with amine groups of dipeptides and hormones. Studies on derivatisation conditions demonstrated excellent derivative yield over the pH range 8.2-10.0. The reaction is extremely tolerant of common buffer, salts and detergents, with no discernible decrease in reaction yield with well-buffered samples. Selective fluorescence detection of the derivatives with excitation at 250 nm and emission at 395 nm allows for the direct injection of the reaction mixture with no significant interference from the only major fluorescent reagent by-product, AMQ, retention time 10.95 min. Separation of the derivatized amino acids, dipeptides and hormones have been optimized on a C18 column with complete resolution in less than 45 min. In addition, excellent response linearity was demonstrated over the concen- tration range 2.5-200 μM. Table 4 contains a list of retention times of derivatised dipeptides, homones and amino acids. Each of the derivatized peptides and hormones is well resolved from derivatized amino acids.
Table 4. Retention times of derivatised dipeptides, homones and amino acids.
Amino acid Retention time
(min)
Asp 12,50
Ser 13,93
Glu 14,60
Gly 15,65
His 16,35
Arg 20,25
Thr 20,95
Ala 20,08
Pro 23,75
5-hydroxy-tryptophan 24,75
Dopa 25,10
Tyr 26,75
Gly-Tyr 27,50
Val 28,03
Met 28,27
Tyr-Gly/Phe-Gly 30,50
Lys 31 ,50 lie 32,00
Leu 32,61
Dopamine 33,45
Phe 33,80
Gly-Phe 34,45
Serotonin 34,70 Substrate specificity of hisPhhAB were analysed in five assays by HPLC:
1. Conversion of phenylalanine to tyrosine
2. Conversion of tyrosine to dopa and dopamine
3. Conversion of tryptophan to 5-hydroxytryptophan and serotonin 4. Conversion of phenylalanine to tyrosine bound in dipeptide (Gly-Phe to Gly-Tyr) 5. Conversion of phenylalanine to tyrosine bound in dipeptide (Phe-Gly to Tyr-Gly) It was found that hisPhhAB posseses only the catalytic hydroxylation activity of conversion of free phenylalanine to tyrosine (detection limit femtomole scale).
EXAMPLE 8
Protein characterisation of PhhAB
In order to establish the sequence of the purified protein, and compare the obtained sequence with the theoretical sequence, a protein characterisation was performed. The N- terminal was evaluated using automatic Edman degradation. The remainder of the sequence and the C-terminus were evaluated using mass spectrometric peptide mapping using two different enzymes (trypsin and chymotrypsin).
The Edman degradation was performed using a HP G1000A protein sequencer equipped with a HP 1090 HPLC with UV detektor (269nm). All chemicals and chromatographic columns were HP sequencer standard except: HPLC solvent B: Isopropanol, Rathbum HPLC solvent C: Acetonitril HPLC grade, Fischer Scientific
In order to carry out the mass spectrometric peptide mapping the enzyme was digested by approx. 470 pmol hisPhhAB dissolved in 30 μl 50 mM NH4HCO3 and 0.88 μg trypsin (Promega). The enzyme was digestion for 4 hours at 37°C. Additionally, the enzyme was digested by approx. 470 pmol hisPhhAB dissolved in 30 μl 50 mM NH4HCO3 and 1.0 μg chymotrypsin (Worthington, modified). The enzyme was digestion for 16 hours at 37°C.
Peptides were separated using HPLC separation of peptides. A Pharmacia Biotech Akta Basic equipped with a column oven (45° C) and a Phenomenex Jupiter RP-|8 4.6 x 250 mm column, 5μm, 300A were used. Peptides were detection at 214 nm. The buffer consisted of 0.06% TFA (Rathburn) in water. B buffer: 0.05% TFA (Ratburn) in acetonitril (Fisher Scientific): water (80 : 20)
All mass spectrometry sample were analysed using a Voyager-Elite MALDI instrument with delayed extraction (PerSeptive Biosystems). All spectra were recorded in "linear positive mode". Matrix: alpha-cyano-4-hydroxycinnamic acid (Aldrich) and the sample application method was dried droplet.
All water was Milli-Q purified (Millipore).
The mass spectrometry of the intact protein molecule showed a mass of 48004 Da +/- 96 Da which correlates with the theoretical mass of 48032 Da. Figure 17 shows the mass spectrogram of the protein.
The result of the automatic Edman degradation showed the following sequence:
MKHQHQHQHQHQHQKTTQYVAR (SEQ ID NO:14)
This sequence is identical to the theoretical initiation (N-terminus) of the protein sequence.
By mass spectrometric peptide mapping the following parts of the protein were identified (underlined stretches) (figure 18).
The detected peptides that form the basis of the map in figure 2 are listed below as a result of tryptic and chymotryptic degradatiojn. "Num" and "from-to" represents the sequence numbers of amino acids, "MH+th" represents the theoretical molecular mass and "MH+obs" the observed molecular mass of the peptides.
Tryptic peptides:
Num From-To MH+ th MH+ obs Sequence
1 1- 2 278.15 MK 2 3- 15 1737.82 HQHQHQHQHQHQK
3 16- 22 838.44 TTQYVAR
Figure imgf000048_0001
o CD o CM sr o CΛ * oo co o * CM sj- 00 co h~ co d CD σ CM ~' CD 00 CM h>: co
CD LO 1^- o σ> CM --. cq h~ h>: co co co LO CM LO CM' 00 co σi CM o d 1^ t--' r- o σ> o C3. LO O O oo σ> LO 1^ T x— 00 O O t^ σ> co
0) CM o -— CM r CD CM CM o CM σj CM >- t^ CM CM σ>
CM
CO CD CO O CD co co co o co O 00 O. CM CM oo "3- CM 1^ oo ' CM LO co . CM CD ~ O CM 1^ oo D r 1^ O CM o σ> CO LO CM CD *- O ι— CM CO OJ CD CM CM o O i^ ^ 'd- CM CM S; σi CD 'ϋ- sr CM ^ ^ CM 'tf co CM d 00 co σi -: --• LO d r d LO CO LO σi LO --- ~: CD i^: LO LO σ> CD LO d d d σ> co σ> CO co CM i^: CM co
00 r- D σ> co OO co CO o CO O CM t^ σ> 'ϊ CO oo 1^ x— 00 CM !>- CO o o O CD CO CD O 1^ OO co CD co σ) CO ιo o o o CO σ> LO 'd- CO ^ co O o LO LO 1^ σ> ~ -— LO sr r- >- 1^ CM ro CD »d- CJ) O ST C33 CD LO
CM CM τ- CM "sT CM CM - CM x— CM
I^ τ- -sJ- I^ CM Cτ> O t- CO I^ CM CO τ- CM O CD ~ τ- -sr θ CD CD '!l- σ) CM O - LO C σ) rn n -* r ι -- - ro LO O CΩ O I^ ∞ Cn θ CM C 'r -r Ω I^ ∞ OO CO Cn σ. τ- CM CO 'r ^ S S ^ m m S ^ ^ '^ -^ -^ ^ -^ -^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ CM CM C CO CO CO CO O CO O -sf -sr i i i i i i ι T θ OO CM LO OO CO O τ- CM 'sr θO CO '^|- CM CO v- t^ OO CM LO τ- ~ r^ LO O CO - CM CD ^r
90 CO I^ O LO CM -^ -r CM LO CO CΩ Ω - OT OT O C CM -r -r D r^ ∞ CO ∞ ro OT ^ CM C -r W 90 CM -sr -O LO I^ OO CTJ C-J τ- -^ ^ -r- τ- τ- - τ- CM CM CM CM CM CM CM CM CM CM CM CM CO CO CO CO CO C CO CO C^
O - CM CO -r LO CD t^ CO C3 0 -7- CM C '* LO CD t^ Oθ σ. O - CM C0 ^1- LO CD t^- CO O. O -- CM ^ LO CD I^ CXJ OT -Γ- - - T- T- T- - T- T- - CM CM CM CM CM CM CM CM C CM CO CO CO CO C CO CO CO CO CO ^
LO O LO O LO O LO
T- t- CM C CO CO
43 415-415 147.11 K
Chymotryptic peptides
Num From-To MH+ th MH+ obs Sequence 1 1- 19 2490.17 MKHQHQHQHQHQHQKTTQY
2 20- 29 1118.52 2538.18* VARQPDDNGF 3 30- 40 1438.68 IHYPETEHQVW 4 41- 59 2234.18 NTLITRQLKVIEGRACQEY
10 5 60- 89 3411.80 LDGIEQLGLPHERIPQLDEINRVLQATTGW 6 90-100 1238.77 1 1223388..7777 RVARVPALIPF 7 101-103 395.19 QTF 8 104-104 166.09 F 9 105-117 1450.76 1 1445500..6622 ELLASQQFPVATF
15 10 118-126 1135.56 2 2550044..2233** IRTPEELDY 11 127-133 861.44 LQEPDIF 12 134-137 545.27 HEIF 13 138-147 1136.54 GHCPLLTNPW 14 148-148 166.09 F
20 15 149-151 366.17 AEF 16 152-155 521.24 THTY 17 156-169 1561.91 GKLGLKASKEERVF 18 170-174 635.39 LARLY 19 175-175 205.10 W
25 20 176-180 640.30 1997.60* MTIEF 21 181-192 1378.73 1378.73 GLVETDQGKRIY 22 193-205 1307.68 1307.68 GGGILSSPKETVY 23 206-216 1243.60 1243.52 SLSDEPLHQAF 24 217-226 1191.58 1191.58 NPLEAMRTPY
30 25 227-235 1130.66 1130.66 RIDILQPLY 26 236-236 166.09 1277.73* F 27 237-245 1100.68 1100.69 VLPDLKRLF 28 246-277 3571.89 QLAQEDIMALVHEAMRLGLHAPLFPPKQAALY 29 278-278 182.08 Y
35 30 279-331 6052.06 GRQARPVRRSHMRQPRTPTTTALTQAHCEACR
ADAPHVSDEELPVLLRQIPDW
31 332-346 1806.94 NIEVRDGIMQLEKVY
32 347-348 279.17 LF
33 349-351 408.22 KNF 34 352-357 686.40 KHALAF
35 358-378 2247.07 2245.59 TNAVGEISEAEGHHPGLLTEW
36 379-385 790.45 GKVTVTW
37 386-386 205.10 W
) 38 387-398 1410.72 SHS1KGLHRNDF
39 399-415 1846.98 1846.20 IMAARTDEVAKTAEGRK
Notes:
* inkludes the previous or following peptide
MH+ positive molekylar ion
The protein structure of hisPhhAB was found to be in compliance with the theoretical sequence.
The molecular weigh correlates with the expeceted within one amino acid residue. The N-terminal sequence is identical to the translated nucleotide-sequence deduced sequence
The molecular weight of the C-terminal peptid is identical to the theoretical value. 82% of the sequence is covered, either by Edman degradation/sequencing or by mass spektrometric peptide data.
REFERENCES
1. Chang.T.M.S., Bourget,L., and Lister.C. (1995) A new theory of enterorecirculation of amino acids and its use for depleting unwanted amino acids using oral enzyme- artificial cells, as in removing phenylalanine in phenylketonuria Art. cells, blood subs, and immob. biotech. 23:1-21
2. Choo,K.H., Filby.R.G., Jennings,l. G., Peterson,G., and Fowler.K. (1986) Vectors for expression and amplification of cDNA in mammalian cells: expression of rat phenylalanine hydroxylase DNA 5:529-537.
3. Citron, B.A., Davis, M.D., Milstein.S., Gutierrez,J., Mendel, D.B., Crabtree.G.R., and Kaufman, S. (1992) Identity of 4a~carbinolamine dehydratase, a component of the phenylalanine hydroxylation system, and DCoH, a transregulator of homeodomain proteins Proc.Natl.Acad.Sci.U.S.A 89:11891-11894.
4. Cohen, S.A., and Michaud.D.P. (1993) Anal.Blochem. 211:279.
5. Dickson.P.W., Jennings, I. G., and Cotton, R.G. (1994) Delineation of the catalytic core of phenylalanine hydroxylase and identification of glutamate 286 as a critical residue for pterin function J.Biol.Chem. 269:20369-20375.
6. Eisensmith.R.O, and Woo.S.L.C. (1994) Population genetics of phenylketonuria. Ada. Paadiatr. Suppl. 407: 19-26.
7. Gasson,M.J. (1983) Plasmid complements of Streptococcus lactis NCDO 712 and other Lactic Streptococci after protoplast-induced curing J.Bacteriol. 154:1-9.
8. Holo.H., and Ness.l.F. (1989) High-Frequency Transformation, by Electroporation, of Lactococcus lactis subsp. cremoris Grown with Glycine in Osmotically Stabilized Media Appl. Environ. Microbiol. 55:3119-3123.
9. Hufton, S.E., Jennings.l.G., and Cotton, R.G. (1998) Structure/function analysis of the domains required for the multimerisation of phenylalanine hydroxylase Bio- chim.Biophys.Acta 1382:295-304.
10. Jensen, P.R., and Hammer.K. (1993) Minimal requirements for exponential growth of Lactococcus lactis Appl. Environ. Microbiol. 59:4363-4366. 11. Kaufman, S. (1993) The phenylalanine hydroxylating system Adv.Enzymol.Relat Areas Mol.Biol. 67:77-264.
12. Kowlessur.D., Citron, B.A., and Kaufman, S. (1996) Recombinant human phenylalanine hydroxylase: novel regulatory and structural properties Arch.Biochem.Biophys. 333:85-95.
13. Lazarus,RA, Benkovic,S.J. (1983) Phenylalanine Hydroxylase Stimulator Protein Is a 4a-Carbinolamine Dehydratase J.Biol.Chem. 258:10960-10962.
14. Lei,X.D., Kaufman, S. (1998) Identification of hepatic nuclear factor 1 binding sites in the 5' flanking region of the human phenylalanine hydroxylase gene: implication of a dual function of phenylalanine hydroxylase stimulator in the phenylalanine hydroxylation system Proc.Natl.Acad.Sci.U.S.A 95:1500-1504.
15. Martinez.A., Knappskog.P.M., Olafsdottir.S., Doskeland,A.P., Eiken,H.G., Svebak.R.M., Bozzini.M., Apold.J., and Flatmark,T. (1995) Expression of recombinant human phenylalanine hydroxylase as fusion protein in Escherichia coli circum- vents proteolytic degradation by host cell proteases. Isolation and characterization of the wild-type enzyme Biochem.J. 306:589-597.
16. Onishi.A., Liotta,L.J., and Benkovic,S.J. (1991) Cloning and expression of Chromobacterium violaceum phenylalanine hydroxylase in Escherichia coli and comparison of amino acid sequence with mammalian aromatic amino acid hydroxylases J.Biol. Chem. 266: 18454-18459.
17. O'Sullivan.D.J., and Klaenhammer,T.R. (1993) Rapid mini-prep isolation of high- quality plasmid DNA from Lactococcus and Lactobacillus spp.
Appl. Environ. Microbiol. 59:2730-2733.
18. Sambrook.J., Fritsch.E.F., and Maniatis.T. (2000) Molecular cloning, a laboratory manual Sambrook,J., Fritsch,E.F., and Maniatis,T. (eds). New York: Cold Spring
Harbor Laboratory Press.
19. Song,J., Xia,T., and Jensen, R.A. (1999) PhhB, a Pseudomonas aeruginosa homolog of mammalian pterin 4a- carbinolamine dehydratase/DCoH, does not regulate expression of phenylalanine hydroxylase at the transcriptional level J.Bacteriol. 181 :2789-2796. 20. Sørensen,M.A., and Pedersen.S. (1991) Absolute in vivo translation rates of individual codons in Escherichia coli. The two glutamic acid codons GAA and GAG are translated with a threefold difference in rate J.Mol.Biol. 222:265-280.
21. van Asseldonk,M., Rutten,G., Oteman,M., Siezen,R.J., de Vos,W.M., and Simons,G. (1990) Cloning of usp45, a gene encoding a secreted protein from Lactococcus lactis subsp. lactis MG1363 Gene 95:155-160.
22. Wallace.B.J., and Pittard.J. (1969) Regulation of 3-deoxy-D-arabino-heptulosonic 7- phosphate acid synthetase activity in relation to synthesis of the aromatic vitamins in Echerichia coli K-12 J.Bacteriol. 99:707-712
23. Woo.S.L, Gillam.S.S., and Woolf,L.I. (1974) The isolation and properties of phenylalanine hydroxylase from human liver Biochem.J. 139:741-749.
24. Yanisch-Perron.O, Vieira.J., and Messing,J. (1985) Improved M13 phage cloning vectors and host strains: nucleotide sequences of the M13mp18 and pUC19 vectors Gene 33:103-119.
25. Zhao.G., Xia.T., Song,J., and Jensen.R.A. (1994) Pseudomonas aeruginosa possesses homologues of mammalian phenylalanine hydroxylase and 4 alpha- carbinolamine dehydratase/DCoH as part of a three-component gene cluster Proc. Natl. Acad. Sci. U. S. A 91 : 1366-1370.

Claims

1. A recombinant cell comprising a nucleic acid derived from a prokaryotic organism, said nucleic acid coding for a gene product having phenylalanine hydroxylase activity, subject to the limitation that the cell is not an E. coli cell.
2. A cell according to claim 1 where the cell is selected from the group consisting of a eukaryotic cell and a prokaryotic cell.
3. A cell according to claim 2 where the eukaryotic cell is selected from the group con- sisting of a mammalian cell, a plant cell, a fungal cell and an insect cell.
4. A cell according to claim 2 which is of a generally recognised as safe (GRAS) species.
5. A cell according to claim 2 where the prokaryotic cell is selected from the group con- sisting of a Gram negative bacterium and a Gram positive bacterium.
6. A cell according to claim 5 where the Gram positive bacterium is a lactic acid bacterium.
7. A cell according to claim 1 where the coding nucleic acid is derived from a Gram negative bacterium.
8. A cell according to claim 7 where the Gram negative bacterium is selected from the group consisting of Pseudomonas aeruginosa and Chromobacterium violeans.
9. A cell according to claim 3 where the fungal cell is a Saccharomyces cerevisiae cell.
10. A cell according to claim 1 where the nucleic acid coding for phenylalanine hydroxylase activity is a nucleic acid coding for PhhA or an enzymatically active fragment thereof.
11. A cell according to claim 1 further comprising a nucleic acid coding for a gene product having an enhancing effect on the phenylalanine hydroxylase activity.
12. A cell according to claim 11 where the gene product having phenylalanine hydroxy- lase activity is PhhA or an enzymatically active fragment thereof.
13. A cell according to claim 11 where the gene product having an enhancing effect on the phenylalanine hydroxylase activity is PhhB or a phenylalanine hydroxylase activity enhancing fragment thereof.
5
14. A cell according to claim 11 where the gene product having phenylalanine hydroxylase activity and the gene product having an enhancing effect on the phenylalanine hydroxylase activity is expressed as a fusion protein.
10 15. A cell according to claim 14 where the gene product having phenylalanine hydroxylase activity is PhhA.
16. A cell according to claim 14 where the gene product having an enhancing effect on the phenylalanine hydroxylase activity is PhhB.
15
17. A cell according to claim 1 comprising a signal sequence operably linked to the nucleic acid coding for a gene product having phenylalanine hydroxylase activity.
18. A cell according to claim 1 where the nucleic acid coding for the gene product having 20 phenylalanine hydroxylase activity is expressed under the control of a promoter not natively associated with the nucleic acid.
19. A cell according to claim 1 or 18 where the nucleic acid coding for the gene product having phenylalanine hydroxylase activity is expressed under the control of a regulatable
25 promoter.
20. A cell according to claim 1 where the nucleic acid coding for the gene product having phenylalanine hydroxylase activity codes for a tagging sequence.
30 21. A cell according to claim 1 where the nucleic acid coding for the gene product having phenylalanine hydroxylase activity is a wild-type nucleic acid.
22. A cell according to claim 1 where the nucleic acid coding for the gene product having phenylalanine hydroxylase activity is a nucleic acid derived from a wild-type gene coding 35 for a gene product having phenylalanine hydroxylase activity.
23. A cell according to claim 1 where the nucleic acid coding for the gene product having phenylalanine hydroxylase activity is part of a nucleic acid sequence coding for a fusion protein comprising the phenyl hydroxylase activity and a gene product having an
5 enhancing effect on the activity of the phenylalanine hydroxylase.
24. A cell according to claim 23 where the gene product having phenylalanine hydroxylase activity being encoded is PhhA and the gene product having an enhancing effect on the phenylalanine hydroxylase activity is PhhB or modified PhhB where the first Met resi-
10 due is substituted with a different amino acid residue.
25. A cell according to claim 23 where the nucleic acid sequence coding for a fusion protein comprises at least one further coding sequence.
15 26. A cell according to claim 11 where the nucleic acid coding for a gene product having an enhancing effect on the phenylalanine hydroxylase activity is a wild-type nucleic acid.
27. A cell according to claim 11 where the nucleic acid coding for a gene product having an enhancing effect on the phenylalanine hydroxylase activity is derived from a wild-type
20 nucleic acid coding for a gene product having an enhancing effect on the phenylalanine hydroxylase activity.
28. A recombinant lactic acid bacterial cell comprising a nucleic acid coding for a gene product having phenylalanine hydroxylase activity.
25
29. A cell according to claim 28 where the coding nucleic acid is derived from a prokaryotic organism.
30. A cell according to claim 29 where the prokaryotic organism is a Gram negative bacte- 30 rium.
31. A cell according to claim 30 where the Gram negative bacterium is selected from the group consisting of Pseudomonas aeruginosa and Chromobacterium violeans.
32. A cell according to claim 28 where the coding nucleic acid is derived from a eukaryotic organism.
33. A cell according to claim 32 where the eukaryotic organism from which the coding nu- 5 cleic acid is derived is a mammalian species.
34. A cell according to claim 28 which is a Lactococcus lactis cell.
35. A cell according to claim 28 where the nucleic acid coding for phenylalanine hydroxy- 10 lase activity is a nucleic acid coding for PhhA or an enzymatically active fragment thereof.
36. A cell according to claim 28 further comprising a nucleic acid coding for a gene product having an enhancing effect on the phenylalanine hydroxylase activity.
15 37. A cell according to claim 36 where the gene product having an enhancing effect on the phenylalanine hydroxylase activity is PhhB or a phenylalanine hydroxylase activity enhancing fragment thereof.
38. A cell according to claim 36 where the gene product having phenylalanine hydroxy- 20 lase activity and the gene product having an enhancing effect on the phenylalanine hydroxylase activity is expressed as a fusion protein.
39. A cell according to claim 28 comprising a signal sequence operably linked to the nucleic acid coding for a gene product having phenylalanine hydroxylase activity.
25
40. A cell according to claim 28 where the nucleic acid coding for the gene product having phenylalanine hydroxylase activity is expressed under the control of a promoter not natively associated with the gene.
30 41. A cell according to claim 28 or 40 where the nucleic acid coding for the gene product having phenylalanine hydroxylase activity is expressed under the control of a regulatable promoter.
42. A cell according to claim 28 where the nucleic acid coding for the gene product having 35 phenylalanine hydroxylase activity codes for a tagging sequence.
43. A cell according to claim 28 where the nucleic acid coding for the gene product having phenylalanine hydroxylase activity is a wild-type nucleic acid.
5 44. A cell according to claim 28 where the nucleic acid coding for the gene product having phenylalanine hydroxylase activity is a nucleic acid derived from a wild-type nucleic acid coding for a gene product having phenylalanine hydroxylase activity.
45. A cell according to claim 28 where the gene product having phenylalanine hydroxy- 10 lase activity being encoded is PhhA and the gene product having an enhancing effect on the phenylalanine hydroxylase activity is PhhB or modified PhhB where the first Met residue is substituted with a different amino acid residue.
46. A cell according to claim 38 where the nucleic acid coding for a fusion protein com- 15 prises at least one further coding sequence.
47. A cell according to claim 36 where the nucleic acid coding for a gene product having an enhancing effect on the phenylalanine hydroxylase activity is a wild-type nucleic acid.
20 48. A cell according to claim 36 where the nucleic acid coding for a gene product having an enhancing effect on the phenylalanine hydroxylase activity is derived from a wild-type nucleic acid coding for a gene product having an enhancing effect on the phenylalanine hydroxylase activity.
25 49. A fusion protein comprising an amino acid sequence having phenylalanine hydroxylase activity and a polypeptide enhancing and/or stabilising the phenylalanine hydroxylase activity.
50. A protein according to claim 50 where the amino acid sequence having phenylalanine 30 hydroxylase activity is derived from a cell selected from the group consisting of a eukaryotic cell and a prokaryotic cell.
51. A protein according to claim 50 where the amino acid sequence having phenylalanine hydroxylase activity is derived from a Gram negative bacterium.
35
52. A protein according to claim 52 where the amino acid sequence having phenylalanine hydroxylase activity is derived from a Gram negative bacterium selected from the group consisting of Pseudomonas aeruginosa and Chromobacterium violeans.
5 53. A protein according to claim 50 where the amino acid sequence having phenylalanine hydroxylase activity is a full length protein.
54. A protein according to claim 50 where the amino acid sequence having phenylalanine hydroxylase activity is a wild-type protein.
10
55. A protein according to claim 50 where the amino acid sequence having phenylalanine hydroxylase activity is PhhA or an enzymatically active part thereof.
56. A protein according to claim 50 where the amino acid sequence having phenylalanine 15 hydroxylase activity is derived from PhhA or an enzymatically active part thereof.
57. A protein according to claim 50 where the polypeptide enhancing the phenylalanine hydroxylase activity is PhhB or a phenylalanine hydroxylase activity enhancing part thereof.
20
58. A protein according to claim 50 where the polypeptide enhancing the phenylalanine hydroxylase activity is derived from PhhB or a phenylalanine hydroxylase activity enhancing part thereof.
25 59. A protein according to claim 50 further comprising a tagging sequence.
60. A protein according to claim 50 comprising at least one amino acid linking the amino acid sequence having phenylalanine hydroxylase activity and the polypeptide enhancing the phenylalanine hydroxylase activity.
30
61. A protein according to claim 50 which comprises at least one further amino acid sequence.
62. A protein according to claim 50 which is in an essentially pure form. 35
63. A protein according to claim 50 where the amino acid sequence having phenylalanine hydroxylase activity is PhhA, and the gene product enhancing the activity of the phenylalanine hydroxylase activity is PhhB or modified PhhB where the first Met residue is substituted with a different amino acid residue.
5
64. A method of producing phenylalanine hydroxylase, comprising providing a cell according to any of claims 1-49, cultivating said cell under conditions where the nucleic acid coding for the gene product having phenylalanine hydroxylase activity is expressed, and harvesting the phenylalanine hydroxylase active gene product.
10
65. A composition comprising cells according to any of claims 1-49.
66. A pharmaceutical composition comprising cells according to any of claims 1-49, and a pharmaceutically acceptable carrier.
15
67. A composition according to claim 66 or 67 where the cells are cells selected from a generally recognised as safe (GRAS) species.
68. A composition according to claim 68 where the cells are cells of lactic acid bacterial 20 species.
69. A composition according to claim 66 or 67 where the cells are protected against gastrointestinal conditions.
25 70. A composition according to claim 66 or 67 where the cells are capable of surviving, colonising, metabolising and/or proliferating in the gastrointestinal tract.
71. A composition comprising a fusion protein according to any of claims 50-64.
72. A pharmaceutical composition comprising a fusion protein according to any of claims 30 50-64, and a pharmaceutically acceptable carrier.
73. A composition according to claim 72 or 73 where the fusion protein is protected against gastrointestinal conditions.
74. A composition according to any of claims 66, 67, 72 or 73 comprising a further active component.
75. A composition according to claim 75 wherein the further active component is selected 5 from the group consisting of a peptidase and a protease.
76. A phenylalanine hydroxylase active enzyme for use as a medicament.
77. An enzyme according to claim 77 which is derived from a mammalian species. 10
78. An enzyme according to claim 77 which is derived from a prokaryotic species.
79. An enzyme according to claim 79 which is PhhA.
15 80. Use of a phenylalanine hydroxylase active enzyme for the manufacturing of a medicament for the treatment of phenylketonuria.
81. Use according to claim 81 wherein the enzyme is derived from a mammalian species.
20 82. Use according to claim 81 wherein the enzyme is derived from a prokaryotic species.
83. Use according to claim 83 wherein the enzyme is PhhA.
84. A method of treating phenylketonuria in a mammal, comprising administering to said 25 mammal an effective amount of the composition according to any of claims 66, 67, 72 or
73.
85. A method of preparing a proteinaceous food product having a reduced content of phenylalanine, the method comprising contacting a proteinaceous food product starting
30 material with a cell according to any of claims 1-49 or a fusion protein according to any of claims 50-64 under conditions where the gene product having phenylalanine hydroxylase activity is enzymatically active for a period of time that is sufficient to convert at least part of the phenylalanine content of the starting material into compounds that do not cause phenylketonuria.
35
86. A method according to claim 86 wherein the proteinaceous food product starting material is an animal protein.
87. A method according to claim 87 wherein the animal protein is a milk protein derived from a casein, a globulin and a whey protein.
PCT/DK2001/000172 2000-03-14 2001-03-14 Method of treating phenylketonuria and means therefor WO2001068822A2 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
AU2001242302A AU2001242302A1 (en) 2000-03-14 2001-03-14 Method of treating phenylketonuria and means therefor

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US52511600A 2000-03-14 2000-03-14
US09/525,116 2000-03-14

Publications (2)

Publication Number Publication Date
WO2001068822A2 true WO2001068822A2 (en) 2001-09-20
WO2001068822A3 WO2001068822A3 (en) 2002-04-11

Family

ID=24091987

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/DK2001/000172 WO2001068822A2 (en) 2000-03-14 2001-03-14 Method of treating phenylketonuria and means therefor

Country Status (2)

Country Link
AU (1) AU2001242302A1 (en)
WO (1) WO2001068822A2 (en)

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1383865A2 (en) * 2001-05-04 2004-01-28 E.I. Du Pont De Nemours And Company Methods for the production of tyrosine, cinnamic acid and para-hydroxycinnamic acid
WO2018167621A1 (en) * 2017-03-16 2018-09-20 Pfizer Inc. Tyrosine prototrophy
US10894812B1 (en) 2020-09-30 2021-01-19 Alpine Roads, Inc. Recombinant milk proteins
US10947552B1 (en) 2020-09-30 2021-03-16 Alpine Roads, Inc. Recombinant fusion proteins for producing milk proteins in plants
CN113493796A (en) * 2020-03-18 2021-10-12 北京优酶科技发展有限公司 Construction method and application of probiotic engineering strain for phenylketonuria treatment
US11718864B2 (en) 2015-09-23 2023-08-08 Pfizer Inc. Cells and method of cell culture
US11840717B2 (en) 2020-09-30 2023-12-12 Nobell Foods, Inc. Host cells comprising a recombinant casein protein and a recombinant kinase protein
RU2814137C2 (en) * 2019-03-13 2024-02-22 Дженерейшен Био Ко. Non-viral dna vectors and options for their use for expression of therapeutic agent based on phenylalanine hydroxylase (pah)

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6110707A (en) * 1996-01-19 2000-08-29 Board Of Regents, The University Of Texas System Recombinant expression of proteins from secretory cell lines

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPS4824748B1 (en) * 1970-04-08 1973-07-24

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6110707A (en) * 1996-01-19 2000-08-29 Board Of Regents, The University Of Texas System Recombinant expression of proteins from secretory cell lines

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
BENJAMIN WEISS ET AL: "Entrapment of phenylalanine hydroxylase in a polyacrylamide matrix" BIOCHEMICAL MEDICINE, vol. 18, 1977, pages 330-343, XP002902006 *
DATABASE WPI Section Ch, Derwent Publications Ltd., London, GB; Class B04, AN 1973-42737U XP002902007 & JP 48 024748 B (OGATA K) *
JIAN SONG ET AL: "PhhB, a Pseudomonas aeruginosa homolog of mammalian pterin 4a-carbinolamine dehydratase/DCoH, does not regulate expression of phenylalanine hydroxylase at the trascriptional level" JOURNAL OF BACTERIOLOGY, vol. 181, no. 9, May 1999 (1999-05), pages 2789-2796, XP002902005 *
VAN DE GUCHTE M ET AL: "Gene expression in lactococcus-lactis" BIOSIS, 1992, XP002902008 *

Cited By (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1383865A4 (en) * 2001-05-04 2004-11-10 Du Pont Methods for the production of tyrosine, cinnamic acid and para-hydroxycinnamic acid
EP1383865A2 (en) * 2001-05-04 2004-01-28 E.I. Du Pont De Nemours And Company Methods for the production of tyrosine, cinnamic acid and para-hydroxycinnamic acid
US11718864B2 (en) 2015-09-23 2023-08-08 Pfizer Inc. Cells and method of cell culture
WO2018167621A1 (en) * 2017-03-16 2018-09-20 Pfizer Inc. Tyrosine prototrophy
JP2020509763A (en) * 2017-03-16 2020-04-02 ファイザー・インク Tyrosine prototrophy
JP7177076B2 (en) 2017-03-16 2022-11-22 ファイザー・インク tyrosine prototrophy
RU2814137C2 (en) * 2019-03-13 2024-02-22 Дженерейшен Био Ко. Non-viral dna vectors and options for their use for expression of therapeutic agent based on phenylalanine hydroxylase (pah)
CN113493796A (en) * 2020-03-18 2021-10-12 北京优酶科技发展有限公司 Construction method and application of probiotic engineering strain for phenylketonuria treatment
CN113493796B (en) * 2020-03-18 2023-05-30 苏州优信合生技术有限公司 Construction method and application of probiotic engineering strain for treating phenylketonuria
US10894812B1 (en) 2020-09-30 2021-01-19 Alpine Roads, Inc. Recombinant milk proteins
US11142555B1 (en) 2020-09-30 2021-10-12 Nobell Foods, Inc. Recombinant milk proteins
US11401526B2 (en) 2020-09-30 2022-08-02 Nobell Foods, Inc. Recombinant fusion proteins for producing milk proteins in plants
US11072797B1 (en) 2020-09-30 2021-07-27 Alpine Roads, Inc. Recombinant fusion proteins for producing milk proteins in plants
US11034743B1 (en) 2020-09-30 2021-06-15 Alpine Roads, Inc. Recombinant milk proteins
US11685928B2 (en) 2020-09-30 2023-06-27 Nobell Foods, Inc. Recombinant fusion proteins for producing milk proteins in plants
US10988521B1 (en) 2020-09-30 2021-04-27 Alpine Roads, Inc. Recombinant milk proteins
US11840717B2 (en) 2020-09-30 2023-12-12 Nobell Foods, Inc. Host cells comprising a recombinant casein protein and a recombinant kinase protein
US10947552B1 (en) 2020-09-30 2021-03-16 Alpine Roads, Inc. Recombinant fusion proteins for producing milk proteins in plants
US11952606B2 (en) 2020-09-30 2024-04-09 Nobell Foods, Inc. Food compositions comprising recombinant milk proteins

Also Published As

Publication number Publication date
WO2001068822A3 (en) 2002-04-11
AU2001242302A1 (en) 2001-09-24

Similar Documents

Publication Publication Date Title
EP3250692B1 (en) Promoter and uses thereof
Corbin et al. Cloning of an insecticidal cholesterol oxidase gene and its expression in bacteria and in plant protoplasts
US7670822B2 (en) Aldolase and production process of 4-hydroxy-L-isoleucine
WO2001023591A1 (en) Process for producing transglutaminase
US11965167B2 (en) Materials and methods for protein production
JPWO2002081694A1 (en) Secretory production of protein
US10113161B2 (en) Mutant glutamate-cysteine ligase and method for manufacturing gamma glutamyl-valyl-glycine
TW201000634A (en) Proline-specific protease
Longstaff et al. In vivo contextual requirements for UAG translation as pyrrolysine
KR20210153106A (en) Materials and methods for protein production
KR20230107315A (en) Genetically modified yeast cells for hemoglobin production
Matsui et al. A periplasmic, pyridoxal-5′-phosphate-dependent amino acid racemase in Pseudomonas taetrolens
US20220348615A1 (en) Production of bacteriocins
US10508295B2 (en) Gamma glutamyl-valine synthase, and method for producing gamma glutamyl-valyl-glycine
JP2013510587A (en) Whole cell biocatalyst
WO2001068822A2 (en) Method of treating phenylketonuria and means therefor
WO1999061591A1 (en) ENDO-β-N-ACETYLGLUCOSAMINIDASE GENE
KR20050027009A (en) Gene encoding glutathione synthetase from candida utilis
AU3798900A (en) Novel proteins related to gaba metabolism
JP2003180352A (en) Variants of erwinia-type creatinase
Dahinden et al. Oxaloacetate decarboxylase of Vibrio cholerae: purification, characterization, and expression of the genes in Escherichia coli
KR20050108387A (en) Nucleotide sequences of coryneform bacteria coding for proteins involved in l-serine metabolism and method for producing l-serine
Tsang et al. Expression of a Brassic napus glutamate 1-semialdehyde aminotransferase in Escherichia coli and characterization of the recombinant protein
Nagayoshi et al. Purification and characterization of human brain serine racemase expressed in moderately halophilic bacteria
Lisse et al. Functional specificity of the mitochondrial DnaJ protein, Mdj1p, in Saccharomyces cerevisiae

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AT AU AZ BA BB BG BR BY BZ CA CH CN CR CU CZ CZ DE DE DK DK DM DZ EE EE ES FI FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
DFPE Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
AK Designated states

Kind code of ref document: A3

Designated state(s): AE AG AL AM AT AT AU AZ BA BB BG BR BY BZ CA CH CN CR CU CZ CZ DE DE DK DK DM DZ EE EE ES FI FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW

AL Designated countries for regional patents

Kind code of ref document: A3

Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG

122 Ep: pct application non-entry in european phase
NENP Non-entry into the national phase

Ref country code: JP