WO2000072008A2 - Identification of novel mechanisms of drug resistance - Google Patents
Identification of novel mechanisms of drug resistance Download PDFInfo
- Publication number
- WO2000072008A2 WO2000072008A2 PCT/US2000/014812 US0014812W WO0072008A2 WO 2000072008 A2 WO2000072008 A2 WO 2000072008A2 US 0014812 W US0014812 W US 0014812W WO 0072008 A2 WO0072008 A2 WO 0072008A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cells
- peptide
- protein
- prp
- cell
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
- C12N15/1079—Screening libraries by altering the phenotype or phenotypic trait of the host
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
- C12N15/1082—Preparation or screening gene libraries by chromosomal integration of polynucleotide sequences, HR-, site-specific-recombination, transposons, viral vectors
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/5011—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing antineoplastic activity
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
Definitions
- the invention relates generally to methods of screening for agents which bind to and/or regulate cellular proteins involved in drug resistance, particularly resistance of tumor cells to chemotherapeutic agents
- Biochemical and genetic approaches are commonly used to identify key aspects of signaling pathways involved in a pathological phenotype Biochemical approaches characterize mtracellular protein components, whereas genetic approaches characterize mutations in cellular components
- candidate agents can be any molecule, they are typically small organic compounds Small organic compounds often affect polypeptide structure, stability, or function Additionally, small organic compounds can influence the manner in which proteins interact with each other (Fabb ⁇ zio, E , et al , (1999) Oncogene, 18 4357-63) This in trans effector function of small organic molecules offers subtle means by which signaling pathways can be studied or corrected
- an approach based on screening peptides against entire pathways requires knowledge of the stimulus that activates the disease and a phenotypic outcome.
- the stimulus can be environmentally determined, such as the response to a cytokine, or can be constitutively present, such as a mutated protein that continuously signals a mitogenic response leading to an oncogenic phenotype.
- the phenotypic outcome can be considered movement towards, or away from, the disease state using as a genetic selection tool any of a number of surrogate indicators of phenotype.
- the closest attempts at such are screens of cDNA libraries for complementation in mammalian cells.
- MDR multi-drug resistance
- P-gp P-glycoprotein
- P-gp is a transmembrane protein that functions as an energy-dependent efflux pump whose normal function is to transport metabolites and to provide protection against cytotoxic substances (Bello-Reuss, E. & Ernest, S., (1994) Am. J. Physiol., 267, C1351-1358; Chin, K.V., et al., (1990) Cell Growth Differ., 8, 361-365).
- Over-expression of P-gp results in the expulsion of intracellular anticancer drugs and the consequent establishment of resistance to those compounds.
- cytotoxic drugs such as Taxol (Parekh, H., Wiesen, K. & Simpkins, H. (1997) Biochem.
- the cellular components involved in rendering cells resistant to chemotherapy is of paramount interest, and it is an object of the invention to provide proteins and related molecules involved in MDR It is a further object of the invention to provide recombinant nucleic acids involved in MDR, and expression vectors and host cells containing the nucleic acid encoding proteins involved in MDR A further object of the invention is to provide methods for screening for antagonists and agonists of proteins involved in MD
- the present invention provides methods and compositions for screening for agents that confer or ameliorate MDR Accordingly, the invention provides bioactive agent, such as resistance conferring peptides that confer a MDR phenotype and drug candidates that ameliorate the MDR phenotype
- the invention provides methods for screening for bioactive agents that confer multi-drug resistance on a cell
- the methods comprise the steps of a) introducing a retroviral library of randomized candidate peptide into a plurality of cells, wherein each of said peptides comprises a different peptide sequence, b) screening the plurality of cells for a cell exhibiting a MDR phenotype, wherein the MDR phenotype is due to the presence of a bioactive agent
- the methods may also include the steps of c) isolating the cell(s) exhibiting the MDR phenotype, and, d) isolating a resistance conferring peptide from the cell(s)
- the invention further provides methods for isolating a protein of a resistance pathway
- the invention provides methods for screening for a bioactive agent capable of binding a protein of a multi-drug resistance pathway
- the methods comprise the steps of a) combining a protein of a multi-drug resistance pathway and a candidate bioactive agent, and b) determining the binding of the candidate agent to the protein
- the invention further provides methods of identifying a drug candidate comprising the steps of a) contacting a protein of a multi-drug resistance pathway and a resistance conferring peptide, and b) detecting a decrease in the binding of the peptide to the protein in the presence of the candidate drug, thereby identifying a drug candidate
- the invention provides methods for identifying a bioactive agent capable of modulating the activity of a protein of a multi-drug resistance pathway
- the methods comprise the steps of a) adding a candidate bioactive agent to a plurality of cells, wherein each of said cells expresses a protein of a multi-drug resistance pathway, b) adding a chemotherapeutic agent to said plurality, and c) determining the effect of the candidate bioactive agent on resistance to the chemotherapeutic agent.
- the present invention provides methods of treating a multidrug resistance associated disease comprising administering compositions of modulators of proteins of multi-drug resistance pathway.
- Figure 1 depicts a screen for peptides conferring taxol resistance to HeLa cells.
- Figure 1A illustrates the peptide library screen.
- the vector shown at the top of the diagram encodes a single long terminal repeat (LTR)-driven RNA transcript encoding an operon capable of co-expressing a peptide and the GFP indicator gene.
- LTR long terminal repeat
- the translation of the GFP is initiated from the internal ribosomal entry site
- ⁇ represents the viral packaging sequence.
- a peptide library (complexity 3x10 8 ) encoded within the vector is transfected into the viral packaging cell line Phoenix-ampho. The viral particles are harvested and then used to transduce HeLa cells. The infected HeLa cells are treated with a lethal dose of Taxol. The peptide sequences are rescued from surviving clones by RT- PCR and then recloned into a Tet-regulatable (Tra) retroviral vector.
- the Tra vector contains the tetracycline-responsive element (TRE), minimal immediate early promoter of cytomegalovirus (Pmin) and 3' SIN-LTR which has removed the promoter and enhancer function and allow the transcription is driven by TRE/Pmin.
- TRE tetracycline-responsive element
- Pmin minimal immediate early promoter of cytomegalovirus
- 3' SIN-LTR 3' SIN-LTR which has removed the promoter and enhancer function and allow the transcription is driven by TRE/Pmin.
- the effect of these peptides on Taxol resistance is then re-tested on naive HeLa ceils. After confirming the Taxol resistant phenotype, the cellular target of these peptides are isolated by yeast two-hybrid screening. The functions of these cellular proteins in Taxol resistance are then further validated.
- Figure 1 B depicts enhanced survival of HeLa cells infected with the petptide RGP8.5 in a clonogenic survival assay.
- HeLa cells were infected with a tet-regulatory retroviral vector (Tra) expressing the RGP8.5 peptide or GFP control. After infection, 2x10 5 cells were split into one well of 6-well plate and half of cells were incubated with Dox. The next day the cells were treated with different dosages of Taxol for 48 hours. Two weeks later, the surviving colonies were stained with Giemsa solution and photographed. The cells with Dox were kept in Dox throughout the experiment. This assay has been repeated with the RGP8.5 peptide several times. Similar results were obtained (data not shown).
- Tra tet-regulatory retroviral vector
- Figure 2 demonstrates that the RGP8.5 peptide upregulates MDR1 in HeLa cells.
- Figure 2A shows Taxol resistant HeLa cells expressing the RGP8.5 peptide. HeLa cells infected with different retroviral vectors, stained with monoclonal antibody MDR1 (UIC2) PE conjugate and analyzed on a fluorescence-activated cell sorting (FACS) machine. The upper left panel shows cells expressing the GFP control vector with GFP expression on the X axis and MDR expression on the Y axis. The middle left panel is the 8.2 peptide control showing no effect upon MDR expression. Bottom left is the 8.5 pool that shows significant expression of MDR correlated to GFP expression (surrogate indicator of peptide).
- UIC2 monoclonal antibody MDR1
- FACS fluorescence-activated cell sorting
- the right hand panels verify that the selected clone RGP8.5.1 regulates MDR expression according to induced vector expression.
- Upper right is the HeLa control; middle right is vector expression in absence of presumed peptide expression, lower right is after derepression of peptide expression showing induced MDR expression correlating with GFP (peptide) expression
- Figure 2B depicts Taxol resistance after derepression of vector induction in HeLa cells
- Cells expressing the RGP8 5 peptide (selected clone) were incubated with or without 200 ng/ml Dox for 2 days Subsequently, the cells were incubated with 100 nM Taxol for 48 hours and then visualized for cell survival
- Figure 2C depicts inhibition of MDR-1 pump activity by CsA antagonizes RGP8 5 peptide activity
- the cells with Dox were first incubated with doxycycline for 2 days before seeding in 96-well plates After that point the cells were kept in medium with Dox for the entire experimental period 5x10 3 cells were split in one well of a 96-well plate The next day the cells were treated with different concentrations of Taxol plus or minus 2 ⁇ M CsA in combination with Dox
- Data presented are the mean values of each treatment in triplicate in a standard XTT assay Error bars were smaller than graph data points and are therefore not observable in the Figure Experimental samples are as indicated in the graph inset
- FIG. 2D depicts a Rhodamine 123 efflux assay of a RGP8 5 expressing HeLa clone Cells were incubated with or without 200 ng/ml Dox for 4 days Subsequently the cells were stained with 1 nM Rhodamine 123 and analyzed on FACS In the top panels the GFP positive cells (striped peak, top left) were seen to extrude Rhodamine 123 from cells (striped peak, top right) Cells that did not activate the GFP did not activate pump activity (solid black) The bottom two panels show cells in which the tTA promoter was shut down in the presence of Dox Most cells were below GFP threshold and showed strong retention of Rhodamine 123 (solid black peak)
- FIG. 3 depicts RT-PCR analysis of mdrl mRNA expression of a HeLa clone expressing RGP8 5 peptide
- Total RNA from RGP8 5 1 was isolated and equal amounts of RNA were used to do semi- quantitative RT-PCR (25 cycles)
- the HeLa clone was first incubated with doxycycline 200 ng/ml for 0, 4, 8, 12 hours (lanes 1, 2, 3, and 4) and 3 days (lane 5) before harvesting to purify RNA Equal amount of RT products were used in the mdrl and ⁇ -tubulin PCR amplifications
- Figure 4 depicts immunoprecipitation and western blot anaysis of the association of RGP8 5 peptide with XAPC7 and Zeta proteins
- Figure 4A depicts the association of expressed RGP8 5 in cells with proteasome subunits
- the plasmids encoded GFP-RGP8 5 (lanes 1, 2 and 3) and GFP-RGP56 1 fusions (lanes 4, 5 and 6) were contransfected with vector alone (lanes 1 and 4), flag tagged Zeta (lanes 2 and 5) and XAPC7 (lanes 3 and 6) expression vector into HeLa cells Forty eight hours post- transfection, the cells were harvested, lysed in TNT buffer and subjected to immunoprecipitation with anti-flag antibody bearing beads The co-precipitated proteins were separated in SDS-PAGE and detected with anti-GFP antibody For detection of the expression of GFP-peptide fusions, Zeta and XAPC7, an equal amount of cell extracts was loaded
- Figure 4B shows purification of proteasome subunits using an RGP8 5 affinity column HeLa cell extract were pre-cleared with a streptavidin column The biotinylated RG8 5 peptide was then added to the cell lysate and allowed to mix overnight at 4 °C Next day streptavidin agarose beads were incubated with the cell extract for 3 hours at 4°C After washing the beads five times with lysis buffer, the associated proteins were eluted with 2x protein sample buffer, resolved on SDS-PAGE and detected with monoclonal antibody against Zeta and XAPC7 proteasome subunits
- Figure 5 depicts phenocopying peptide expression by proxy inhibition of the proteasome induces MDR-1 expression
- Figure 5A shows RT-PCR analysis of mdrl mRNA expression of a HeLa clone expressing RGP8 5 peptide
- the total RNA of HeLa cells (lane 1) and the RGP8 5 HeLa clone (lanes 2, 3 and 4) were isolated and equal amount of RNA were used to do RT-PCR (25 cycles)
- the HeLa clone was first incubated with doxycycline 200 ng/ml (lane 3) plus 5 ⁇ M MG132 (Lane 4) for 23 hours before harvesting cells for RNA preparation Equal amounts of RT products were used in mdrl and ⁇ - tubulin PCR amplification
- Figure 5B shows inhibition of the proteasome by MG132 induces MDR-1 protein expression
- the RGP8 5 peptide-expressing clone was incubated with or without 200 ng/ml Dox for 2 days and subsequently cells were treated with or without 5 ⁇ M MG132 for 21 hours The cells were stained with monoclonal antibody MDR1 (UIC2) PE conjugate and analyzed on FACS
- Figure 6 depicts that inhibition of proteasome activity by RGP8 5 arrests cell cycle progression
- Figure 6A shows a Western blot analysis of endogenous levels of GFP, hsp70 and cyclin B proteins in HeLa clones expressing RGP8 5 peptide
- doxycycline 200 ng/ml
- Equal amount of cell lysate were loaded on each lane, separated by SDS-PAGE and immunoblotted with antiserum against GFP (Kodak), hsp70 and cyclin B1 (Santa Cruz)
- Figure 6B shows cell cycle analysis of RG8 5 peptide expressing cells RG8 5 peptide expressing cells were growing to 50% confluence The cells were harvested and processed for flow cytometry of DNA In the DNA content profile, the bold line represents the peptide negative cells and the grayed area curve represents the RG8 5 peptide positive cells Cells were gated for GFP expression, Figure
- Figure 7 depicts the ammo acid sequence of RGP8 5 (SEQUENCE ID NO 1) and the nucleotide sequence of RGP8 5 (SEQUENCE ID NO 2)
- Figure 8A depicts the nucleotide sequence of proteasome subunit XAPC7 (SEQUENCE ID NO 3, Genbank Accession No AF022815)
- Figure 8B depicts the ammo acid sequence of proteasome subunit XPAC7 (SEQUENCE ID NO 4, Genbank Accession No AAB81515) See Huang, J , et al , (1996) J Virol , 70 5582-5591
- Figure 8C depicts the depicts the nucleotide sequence of proteasome subunit Zeta (SEQUENCE ID NO 5, genbank Accession No NMJ302790)
- Figure 8D depicts the ammo acid sequence of proteasome subunit Zeta (SEQUENCE ID NO 6, Genbank Accession No NP_002781 See DeMartmio, G N , et al , (19
- the present invention provides methods of identifying candidate agents that bind to and regulate cellular proteins involved in multi-drug resistance (MDR) As outlined herein, there are two basic types of screens that can be done 1 ) screens for compounds that confer a multidrug resistance phenotype, and, 2) screens for compounds that ameliorate a multidrug resistance phenotype
- libraries of candidate agents are used to screen for compounds that confer a multidrug resistance phenotype
- the target molecules of the compounds are identified, and in the presence of the compounds are used to screen libraries of candidate drugs that bind to the target molecules and/or modulate their activity
- compounds such as the RGP8 5 peptide that confers an MDR phenotype, are used to identify target molecules within an MDR pathway
- the XAPC7 and Zeta molecules can be used in screens for candidate drugs that bind to them and modulate their activity
- the disclosed methods use genetic screens to identify proteins of multi-drug resistance pathways (i e PRP proteins, defined below), which render cells resistant to chemotherapeutics such as Taxol, Etoposide, Cisplatin, and others. Also provided are methods for the identification and isolation of PRP proteins, the tools to characterize pathways of resistance, and methods of screening for candidate bioactive agents capable of binding to and modulating the activity of PRP proteins to identify new drugs that can be used to treat MDR
- the present invention provides methods for the screening of candidate bioactive agents which confer resistance to a chemotherapeutic drug
- These "resistance conferring” agents are capable of binding to a cellular protein that causes or at least contributes to cell death upon exposure to a chemotherapeutic agent
- a resistance conferring agent interacts or modulates a protein of a resistance pathway (PRP protein, see below), thereby inducing resistance to a chemotherapeutic agent(s)
- PRP protein resistance pathway
- the present methods allow for identification of the cellular protein to which the agent binds, and the subsequent use of that cellular protein in screens for bioactive agents, i e , sensitizing agents, which can be used to alleviate the MDR phenotype
- the proteasome is the major system for bulk degradation of proteins in the cell
- the proteasome includes cell-cycle regulation, apoptosis, morphogenesis, differentiation, metabolic control and antigen presentation (Groettrup & Schmiddtke, I, Chen, Z et al , (1995) Genes Dev , 9, 1586-1597, Tsurumi, C , et al , (1996) Nippon Rmsho, 54, 861- 869)
- the 20S proteasome is a barrel-shaped core proteolytic complex consisting of four rings with seven subunits each Subunits of the inner two rings are of the beta type and bear the proteolytically active centers pointing towards the lumen of the barrel, the outer two rings are of the alpha type and control access to the inner chambers of the proteasome and association
- RGP8 5 upregulates MDR-1 expression, see Examples below Without being bound by theory, RGP8 5 may bind to XPAC7 and interfere with proteasome activity This theory is supported by the observation that the Hepatitus B virus pX protein (X factor) has been shown to transactivate the MDR1 gene (Doong, S L et al , (1998) J Hepatol , 29, 872-878) XAPC7 associates with X factor in a yeast two-hybrid protein interaction screening and antisense expression of XAPC7 leads to blocked transactivation by X factor (Huang, J , et al , (1996) J Virol 70, 5582-5591, Jorgensen, L & Hendil, K B (1999) Mol Biol Rep 26, 119-123)
- the Zeta subunit has been suggested as a putative ⁇ bonuclease and may regulare mRNA expression by acting on a protein bound to constitutively expressed transcripts of mdr-1 (Fischer, M , Runkel, L & Schaller, H , (1995) Virus Genes, 10, 99-102, Petit, F et al , (1997) Biochem , 326, 93-98)
- the RGP8 5 peptide may confer resistance to the chemotherapeutic drug Taxol by acting as a proteasome inhibitor Therefore, without being bound by theory, one form of drug resistance in cancer cells may arise through mutation or modification of the XPAC7 or Zeta proteasome alpha subunits or their specificity of action Changes in how the proteasome degrades target molecules could directly affect regulators of MDR-1 protein production and lead to up-regulation of MDR-1 and a chemotherapeutic resistance state
- XAPC7 and Zeta proteins have thus been identified as playing a role in MDR, and can been used in a variety of methods, including screening candidate drugs for selective modulation of XAPC7 and/or Zeta activity
- Proteins such as XAPC7 and Zeta, which play a role in MDR are defined herein as "proteins of resistant pathways” or “PRP proteins”
- PRP proteins are cellular components involved in rendering cells resistant to chemotherapy
- the present invention provides methods for screening candidate bioactive agents for a moiety capable of binding to or modulating the activity of a PRP protein such as XAPC7 and Zeta
- candidate bioactive agent or “candidate drug” or “exogeneous compound” as used herein describes any molecule, e g , protein, small organic molecule, carbohydrates (including polysaccha ⁇ des), polynucleotide, lipids, etc.
- assay mixtures are run in parallel with different agent concentrations to obtain a differential response to the various concentrations.
- one of these concentrations serves as a negative control, / e , at zero concentration or below the level of detection
- positive controls can be used
- Candidate agents encompass numerous chemical classes, though typically they are organic molecules, preferably small organic compounds having a molecular weight of more than 100 and less than about 2,500 daltons
- Candidate agents comprise functional groups necessary for structural interaction with proteins, particularly hydrogen bonding, and typically include at least an amine, carbonyl, hydroxyl or carboxyl group, preferably at least two of the functional chemical groups
- the candidate agents often comprise cyclical carbon or heterocyclic structures and/or aromatic or polyaromatic structures substituted with one or more of the above functional groups
- Candidate agents are also found among biomolecules including peptides, saccharides, fatty acids, steroids, purines, pyrimidines, derivatives, structural analogs or combinations thereof Particularly preferred are peptides
- Candidate agents are obtained from a wide variety of sources including libraries of synthetic or natural compounds For example, numerous means are available for random and directed synthesis of a wide variety of organic compounds and biomolecules, including expression of randomized oligonucleotides Alternatively, libraries of natural compounds in the form of bacterial, fungal, plant and animal extracts are available or readily produced Additionally, natural or synthetically produced libraries and compounds are readily modified through conventional chemical, physical and biochemical means Known pharmacological agents may be subjected to directed or random chemical modifications, such as acylation, alkylation, este ⁇ fication, amidification to produce structural analogs
- the candidate bioactive agents are proteins
- protein herein is meant at least two covalently attached ammo acids, which includes proteins, polypeptides, oligopeptides and peptides
- the protein may be made up of naturally occurring ammo acids and peptide bonds, or synthetic peptidomimetic structures
- “ammo acid”, or “peptide residue”, as used herein means both naturally occurring and synthetic ammo acids
- homo-phenylalanine, citrulline and noreleucine are considered ammo acids for the purposes of the invention
- Ammo acid also includes immo acid residues such as proline and hydroxyproline
- the side chains may be in either the (R) or the (S) configuration
- the ammo acids are in the (S) or L-configuration If non-naturally occurring side chains are used, non-ammo acid substituents may be used, for example to prevent or retard in vivo degradations Chemical blocking groups or other chemical substituents may also be added
- the candidate bioactive agents are naturally occurring proteins or fragments of naturally occurring proteins
- cellular extracts containing proteins, or random or directed digests of proteinaceous cellular extracts may be used
- libraries of procaryotic and eukaryotic proteins may be made for screening in the systems described herein
- Particularly preferred in this embodiment are libraries of bacterial, fungal, viral, and mammalian proteins, with the latter being preferred, and human proteins being especially preferred
- the candidate bioactive agents are peptides of from about 5 to about 30 ammo acids, with from about 5 to about 20 ammo acids being preferred, and from about 7 to about 15 being particularly preferred
- the peptides may be digests of naturally occurring proteins as is outlined above, random peptides, or "biased” random peptides
- randomized or grammatical equivalents herein is meant that each nucleic acid and peptide consists of essentially random nucleotides and ammo acids, respectively Since generally these random peptides (or nucleic acids, discussed below) are chemically synthesized, they may incorporate any nucleotide or ammo acid at any position
- the synthetic process can be designed to generate randomized proteins or nucleic acids, to allow the formation of all or most of the possible combinations over the length of the sequence, thus forming a library of randomized candidate bioactive proteinaceous agents
- the library is fully randomized, with no sequence preferences or constants at any position
- the library is biased That is, some positions within the sequence are either held constant, or are selected from a limited number of possibilities
- the nucleotides or ammo acid residues are randomized within a defined class, for example, of hydrophobic ammo acids, hydrophilic residues, stencally biased (either small or large) residues, towards the creation of cystemes, for cross-linking, pralines for SH-3 domains, sennes, threonmes, tyrosines or histidmes for phosphorylation sites, etc , or to purines, etc
- the candidate bioactive agents are nucleic acids By “nucleic acid” or
- nucleic acid of the present invention will generally contain phosphodiester bonds, although in some cases, as outlined below, nucleic acid analogs are included that may have alternate backbones, comprising, for example, phosphoramide (Beaucage, et al , Tetrahedron, 49(10) 1925 (1993) and references therein, Letsmger, J Orq Chem , 35 3800 (1970), Sp ⁇ nzl, et al , Eur J
- nucleic acids may be single stranded or double stranded, as specified, or contain portions of both double stranded or single stranded sequence
- the nucleic acid may be DNA, both genomic and cDNA, RNA or a hybrid, where the nucleic acid contains any combination of deoxynbo- and nbo-nucleotides, and any combination of bases, including uracil, adenine, thymme, cytosine, guanme, mosine, xathanine hypoxathanme,
- nucleic acid candidate bioactive agents may be naturally occurring nucleic acids, random nucleic acids, or "biased" random nucleic acids
- digests of procaryotic or eukaryotic genomes may be used as is outlined above for proteins
- the candidate bioactive agents are organic chemical moieties, a wide variety of which are available in the literature
- a library of different candidate bioactive agents are used
- the library should provide a sufficiently structurally diverse population of randomized agents to effect a probabilistically sufficient range of diversity to allow binding to a particular target
- an interaction library should be large enough so that at least one of its members will have a structure that gives it affinity for the target
- it is difficult to gauge the required absolute size of an interaction library nature provides a hint with the immune response a diversity of 10 7 -10 8 different antibodies provides at least one combination with sufficient affinity to interact with most potential antigens faced by an organism
- Published in vitro selection techniques have also shown that a library size of 10 7 to 10 8 is sufficient to find structures with affinity for the target
- a library of all combinations of a peptide 7 to 20 am o acids in length, such as generally proposed herein, has the potential to code for
- the candidate bioactive agents are combined or added to a cell or population of cells Suitable cell types for different embodiments are outlined above
- the candidate bioactive agent and the cells are combined As will be appreciated by those in the art, this may accomplished in any number of ways, including adding the candidate agents to the surface of the cells, to the media containing the cells, or to a surface on which the cells are growing or in contact with, adding the agents into the cells, for example by using vectors that will introduce the agents into the cells (i e when the agents are nucleic acids or proteins)
- the candidate bioactive agents are either nucleic acids or proteins
- vectors proteins in this context includes proteins, oligopeptides, and peptides
- vectors including viral vectors
- the cells are either replicating or can be induced to replicate, and retroviral vectors are used to introduce candidate bioactive agents to the cells, as is generally outlined in PCT
- a library of retroviral vectors is made using retroviral packaging cell lines that are helper-defective and are capable of producing all the necessary trans proteins, including gag, pol and env, and RNA molecules that have in cis the ⁇ packaging signal
- the library is generated in a retrovirus DNA construct backbone, standard ohgonucleotide synthesis is done to generate either the candidate agent or nucleic acid encoding a protein, for example a random peptide, using techniques well known in the art
- the library is cloned into a first primer
- the first primer serves as a "cassette", which is inserted into the retroviral construct
- the first primer generally contains a number of elements, including for example, the required regulatory sequences (e g translation, transcription, promoters, etc), fusion partners, restriction endonuclease (cloning and subclonmg) sites
- a second primer is then added, which generally consists of some or all of the complementarity region to prime the first primer and optional necessary sequences for a second unique restriction site for subclonmg DNA polymerase is added to make double-stranded oligonucleotides
- the double- stranded oligonucleotides are cleaved with the appropriate subclonmg restriction endonucleases and subcloned into the target retroviral vectors, described below
- retroviral vectors may include selectable marker genes as is more fully described below, promoters driving expression of a second gene, placed in sense or anti-sense relative to the 5' LTR, CRU5 (a synthetic LTR), tetracycline regulation elements in SIN, cell specific promoters, etc
- Preferred retroviral vectors include a vector based on the munne stem cell virus (MSCV) (see Hawley et al , Gene Therapy 1 136 (1994)) and a modified MFG virus (Rivere et al , Genetics 92 6733 (1995)), and pBABE, outlined in PCT US97/01019
- MSCV munne stem cell virus
- the retroviruses may include mducible and constitutive promoters for the expression of the candidate agent
- phase specific promoters such as E2F responsive promoter, p53 responsive promoter, cyclin promoters, etc
- a large number of both mducible and constitutive promoters are known
- it is possible to configure a retroviral vector to allow mducible expression of retroviral inserts after integration of a single vector in target cells importantly, the entire system is contained within the single retrovirus Tet-mducible retroviruses have been designed incorporating the Self- Inactivatmg (SIN) feature of 3' LTR enhancer/promoter retroviral deletion mutant (Hoffman et al , PNAS USA 93 5185 (1996)) Expression of this vector in cells is virtually undetectable in the presence of tetracycline or other active analogs
- SIN Self- Inactivatmg
- the candidate bioactive agents are linked to a fusion partner
- fusion partner or “functional group” herein is meant a sequence that is associated with the candidate bioactive agent, that confers upon all members of the library in that class a common function or ability
- Fusion partners can be heterologous (i e not native to the host cell), or synthetic (not native to any cell) Suitable fusion partners include, but are not limited to a) presentation structures, as defined below, which provide the candidate bioactive agents in a conformationally restricted or stable form; b) targeting sequences, defined below, which allow the localization of the candidate bioactive agent into a subcellular or extracellular compartment, c) rescue sequences as defined below, which allow the purification or isolation of either the candidate bioactive agents or the nucleic acids encoding them; d) stability sequences, which confer stability or protection from degradation to the candidate bioactive agent or the nucleic acid encoding it, for example resistance to proteolytic degradation, e) dimerization sequences, to allow for peptide dimerization, or f) any combination of a), b), c), d), and e), as well as linker sequences as needed
- the fusion partner is a presentation structure
- presentation structure or grammatical equivalents herein is meant a sequence, which, when fused to candidate bioactive agents, causes the candidate agents to assume a conformationally restricted form Proteins interact with each other largely through conformationally constrained domains
- small peptides with freely rotating ammo and carboxyl termini can have potent functions as is known in the art, the conversion of such peptide structures into pharmacologic agents is difficult due to the inability to predict side-chain positions for peptidomimetic synthesis Therefore the presentation of peptides in conformationally constrained structures will benefit both the later generation of pharmaceuticals and will also likely lead to higher affinity interactions of the peptide with the target protein This fact has been recognized in the combinatorial library generation systems using biologically generated short peptides in bacterial phage systems A number of workers have constructed small domain molecules in which one might present randomized peptide structures While the candidate bioactive agents may be either nucleic acid or peptides, presentation structures are
- suitable presentation structures maximize accessibility to the peptide by presenting it on an exterior loop
- suitable presentation structures include, but are not limited to, minibody structures, loops on beta-sheet turns and coiled-coil stem structures in which residues not critical to structure are randomized, zinc-finger domains, cysteine-lmked (disulfide) structures, transglutaminase linked structures, cyclic peptides, B-loop structures, helical barrels or bundles, leucine zipper motifs, etc
- the presentation structure is a coiled-coil structure, allowing the presentation of the randomized peptide on an exterior loop
- coiled-coil structures allow for between 6 to 20 randomized positions
- a preferred coiled-coil presentation structure is as follows MGCAALESEVSALESEVASLESEVAALGRGDMPL AVKSKLSAVKSKLASVKSKLAACGPP
- the underlined regions represent a coiled-coil leucine zipper region defined previously (see Martin et al ,
- the bolded GRGDMP region represents the loop structure and when appropriately replaced with randomized peptides (i e candidate bioactive agents, generally depicted herein as (X) n , where X is an ammo acid residue and n is an integer of at least 5 or 6) can be of variable length
- X is an ammo acid residue
- n is an integer of at least 5 or 6
- the replacement of the bolded region is facilitated by encoding restriction endonuclease sites in the underlined regions, which allows the direct incorporation of randomized oligonucleotides at these positions
- a preferred embodiment generates a Xhol site at the double underlined LE site and a Hindlll site at the double- underlined KL site
- the presentation structure is a minibody structure
- a "minibody” is essentially composed of a minimal antibody complementarity region
- a preferred minibody presentation structure is as follows:
- the presentation structure is a sequence that contains generally two cysteine residues, such that a disulfide bond may be formed, resulting in a conformationally constrained sequence.
- This embodiment is particularly preferred when secretory targeting sequences are used.
- any number of random sequences, with or without spacer or linking sequences, may be flanked with cysteine residues.
- effective presentation structures may be generated by the random regions themselves.
- the random regions may be "doped" with cysteine residues which, under the appropriate redox conditions, may result in highly crosslinked structured conformations, similar to a presentation structure.
- the randomization regions may be controlled to contain a certain number of residues to confer ⁇ -sheet or ⁇ -helical structures.
- the fusion partner is a targeting sequence.
- the localization of proteins within a cell is a simple method for increasing effective concentration and determining function.
- RAF1 when localized to the mitochondrial membrane can inhibit the anti-apoptotic effect of BCL-2.
- membrane bound Sos induces Ras mediated signaling in T-lymphocytes.
- the concentration of a protein can also be simply increased by nature of the localization. Shuttling the proteins into the nucleus confines them to a smaller space thereby increasing concentration.
- the ligand or target may simply be localized to a specific compartment, and inhibitors must be localized appropriately.
- suitable targeting sequences include, but are not limited to, binding sequences capable of causing binding of the expression product to a predetermined molecule or class of molecules while retaining bioactivity of the expression product, (for example by using enzyme inhibitor or substrate sequences to target a class of relevant enzymes); sequences signalling selective degradation, of itself or co-bound proteins; and signal sequences capable of constitutively localizing the candidate expression products to a predetermined cellular locale, including a) subcellular locations such as the Golgi, endoplasmic reticulum, nucleus, nucleo , nuclear membrane, mitochondria, chloroplast, secretory vesicles, lysosome, and cellular membrane, and b) extracellular locations via a secretory signal Particularly preferred is localization to either subcellular locations or to the outside of the cell via secretion
- the targeting sequence is a nuclear localization signal (NLS) NLSs are generally short, positively charged (basic) domains that serve to direct the entire protein in which they occur to the cell's nucleus Numerous NLS am o acid sequences have been reported including single basic NLS's such as that of the SV40 (monkey virus) large T Antigen (Pro Lys Lys Lys Arg Lys
- the targeting sequence is a membrane anchoring signal sequence
- a membrane anchoring region is provided at the carboxyl terminus of the peptide presentation structure
- the randomized epression product region is expressed on the cell surface and presented to the extracellular space, such that it can bind to other surface molecules (affecting their function) or molecules present in the extracellular medium
- the binding of such molecules could confer function on the cells expressing a peptide that binds the molecule
- the cytoplasmic region could be neutral or could contain a domain that, when the extracellular randomized expression product region is bound, confers a function on the cells (activation of a kinase, phosphatas
- membrane-anchoring sequences including both ssTM and TM, are known for a wide variety of proteins and any of these may be used Particularly preferred membrane-anchoring sequences include, but are not limited to, those derived from CD8, ICAM-2, IL-
- Useful sequences include sequences from 1) class I integral membrane proteins such as IL-2 receptor beta-chain (residues 1-26 are the signal sequence, 241-265 are the transmembrane residues, see Hatakeyama et al , Science 244 551 (1989) and von Heijne et al, Eur J Biochem
- insulin receptor beta chain (residues 1-27 are the signal, 957-959 are the transmembrane domain and 960-1382 are the cytoplasmic domain, see Hatakeyama, supra, and Ebina et al , Cell 40 747 (1985)), 2) class II integral membrane proteins such as neutral endopeptidase (residues 29-51 are the transmembrane domain, 2-28 are the cytoplasmic domain, see Malfroy et al , Biochem Biophys Res Commun 144 59 (1987)), 3) type III proteins such as human cytochrome
- CD8 and ICAM-2 are particularly preferred.
- the signal sequences from CD8 and ICAM-2 lie at the extreme 5' end of the transcript These consist of the ammo acids 1-32 in the case of CD8 (MASPLTRFLSLNLLLLGESILGSGEAKPQAP, Nakauchi et al , PNAS USA 82 5126 (1985) and 1-21 in the case of ICAM-2 (MSSFGYRTLTVALFTLICCPG, Staunton et al , Nature (London) 339 61 (1989))
- These leader sequences deliver the construct to the membrane while the hydrophobic transmembrane domains, placed 3' of the random candidate region, serve to anchor the construct in the membrane
- These transmembrane domains are encompassed by ammo acids 145-195 from CD8 (PQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLL
- membrane anchoring sequences include the GPI anchor, which results in a covalent bond between the molecule and the hpid bilayer via a glycosyl-phosphatidylinositol bond for example in DAF (PNKGSGTTSGTTRLLSGHTCFTLTGLLGTLVTMGLLT, with the bolded serine the site of the anchor; see Homans et al., Nature 333(6170):269-72 (1988), and Moran et al., J. Biol. Chem. 266:1250 (1991)).
- the GPI sequence from Thy-1 can be cassetted 3' of the variable region in place of a transmembrane sequence.
- myristylation sequences can serve as membrane anchoring sequences. It is known that the myristylation of c-src recruits it to the plasma membrane. This is a simple and effective method of membrane localization, given that the first 14 amino acids of the protein are solely responsible for this function: MGSSKSKPKDPSQR (see Cross et al., Mol. Cell. Biol. 4(9): 1834 (1984); Spencer et al., Science 262:1019-1024 (1993), both of which are hereby incorporated by reference). This motif has already been shown to be effective in the localization of reporter genes and can be used to anchor the zeta chain of the TCR.
- Palmitoylation can be used to anchor constructs in the plasma membrane; for example, palmitoylation sequences from the G protein-coupled receptor kinase GRK6 sequence (LLQRLFSRQDCCGNCSDSEEELPTRL, with the bold cysteines being palmitolyated; Stoffel et al., J. Biol. Chem 269:27791 (1994)); from rhodopsin (KQFRNCMLTSLCCGKNPLGD; Barnstable et al., J. Mol. Neurosci. 5(3):207 (1994)); and the p21 H- ras 1 protein (LNPPDESGPGCMSCKCVLS; Capon et al., Nature 302:33 (1983)).
- G protein-coupled receptor kinase GRK6 sequence LQRLFSRQDCCGNCSDSEEELPTRL, with the bold cysteines being palmitolyated; Stoffel et al., J. Biol. Chem
- the targeting sequence is a lysozomal targeting sequence, including, for example, a lysosomal degradation sequence such as Lamp-2 (KFERQ; Dice, Ann. N.Y. Acad. Sci. 674:58 (1992); or lysosomal membrane sequences from Lamp-1
- a lysosomal degradation sequence such as Lamp-2 (KFERQ; Dice, Ann. N.Y. Acad. Sci. 674:58 (1992); or lysosomal membrane sequences from Lamp-1
- the targeting sequence may be a mitrochondrial localization sequence, including mitochondrial matrix sequences (e.g. yeast alcohol dehydrogenase III; MLRTSSLFTRRVQPSLFSRNILRLQST; Schatz, Eur. J. Biochem. 165:1-6 (1987)); mitochondrial inner membrane sequences (yeast cytochrome c oxidase subunit IV; MLSLRQSIRFFKPATRTLCSSRYLL;
- mitochondrial matrix sequences e.g. yeast alcohol dehydrogenase III; MLRTSSLFTRRVQPSLFSRNILRLQST; Schatz, Eur. J. Biochem. 165:1-6 (1987)
- mitochondrial inner membrane sequences e.g. yeast cytochrome c oxidase subunit IV; MLSLRQSIRFFKPATRTLCSSRYLL;
- the target sequences may also be endoplasmic reticulum sequences, including the sequences from calreticulin (KDEL; Pelham, Royal Society London Transactions B; 1-10 (1992)) or adenovirus E3/19K protein (LYLSRRSFIDEKKMP; Jackson et al., EMBO J. 9:3153 (1990).
- KDEL calreticulin
- LYLSRRSFIDEKKMP adenovirus E3/19K protein
- targeting sequences also include peroxisome sequences (for example, the peroxisome matrix sequence from Luciferase, SKL, Keller et al , PNAS USA 4 3264 (1987)), farnesylation sequences (for example, P21 H-ras 1 , LNPPDESGPGCMSCKCVLS, with the bold cysteine farnesylated, Capon, supra), geranylgeranylation sequences (for example, protein rab-5A, LTEPTQPTRNQCCSN, with the bold cystemes geranylgeranylated, Farnsworth, PNAS USA 91 11963
- peroxisome sequences for example, the peroxisome matrix sequence from Luciferase, SKL, Keller et al , PNAS USA 4 3264 (1987)
- farnesylation sequences for example, P21 H-ras 1 , LNPPDESGPGCMSCKCVLS, with the bold cysteine farnesylated, Capon, supra
- the targeting sequence is a secretory signal sequence capable of effecting the secretion of the candidate translation product
- secretory signal sequences which are placed 5' to the variable peptide region, and are cleaved from the peptide region to effect secretion into the extracellular space
- Secretory signal sequences and their transferability to unrelated proteins are well known, e g , Silhavy, et al (1985) Microbiol Rev 49, 398-418 This is particularly useful to generate a peptide capable of binding to the surface of, or affecting the physiology of, a target cell that is other than the host cell, e g , the cell expressing the peptide
- a fusion product is configured to contain, in series, secretion signal peptide- presentation structure-randomized expression product region-presentation structure In this manner, target cells grown in the vicinity of cells caused to express the library of peptides, are bathed in secreted peptide Target cells exhibiting
- Suitable secretory sequences are known, including signals from IL-2 (MYRMQLLSCIALSLALVTNS, Vil nger et al , J Immunol 155 3946 (1995)), growth hormone
- a particularly preferred secretory signal sequence is the signal leader sequence from the secreted cytokine IL-4, which comprises the first 24 ammo acids of IL-4 as follows MGLTSQLLPPLFFLLACAGNFVHG
- the fusion partner is a rescue sequence
- a rescue sequence is a sequence which may be used to purify or isolate either the candidate agent or the nucleic acid encoding it
- peptide rescue sequences include purification sequences such as the H ⁇ s 6 tag for use with Ni affinity columns and epitope tags for detection, immunoprecipitation or FACS (fluoroscence-activated cell sorting)
- Suitable epitope tags include myc (for use with the commercially available 9E10 antibody), the BSP biotinylation target sequence of the bacterial enzyme BirA, flu tags, lacZ, and GST
- the rescue sequence may be a unique ohgonucleotide sequence which serves as a probe target site to allow the quick and easy isolation of the retroviral construct, via PCR, related techniques, or hybridization
- the fusion partner is a stability sequence to confer stability to the candidate bioactive agent or the nucleic acid encoding it
- peptides may be stabilized by the incorporation of glycines after the initiation methion e (MG or MGG0), for protection of the peptide to ubiquitmation as per Varshavsky's N-End Rule, thus conferring long half-life in the cytoplasm
- two prohnes at the C-terminus impart peptides that are largely resistant to carboxypeptidase action
- the presence of two glycines prior to the pro nes impart both flexibility and prevent structure initiating events in the di-prolme to be propagated into the candidate peptide structure
- preferred stability sequences are as follows MG(X) n GGPP, where X is any ammo acid and n is an integer of at least four
- the fusion partner is a dimerization sequence
- a dimerization sequence allows the non-covalent association of one random peptide to another random peptide, with sufficient affinity to remain associated under normal physiological conditions This effectively allows small libraries of random peptides (for example, 10 4 ) to become large libraries if two peptides per cell are generated which then dime ⁇ ze, to form an effective library of 10 8 (10" X 10 4 ) It also allows the formation of longer random peptides, if needed, or more structurally complex random peptide molecules
- the dimers may be homo- or heterodimers
- Dimerization sequences may be a single sequence that self-aggregates, or two sequences, each of which is generated in a different retroviral construct That is, nucleic acids encoding both a first random peptide with dimerization sequence 1, and a second random peptide with dimerization sequence 2, such that upon introduction into a cell and expression of the nucleic acid, dimerization sequence 1 associates with dimerization sequence 2 to form a new random peptide structure
- dimerization sequences will encompass a wide variety of sequences Any number of protem- protem interaction sites are known. dimerization sequences may also be elucidated using standard methods such as the yeast two hybrid system, traditional biochemical affinity binding studies, or even using the present methods See also U S Patent Application No 09/285,912, hereby expressly incorporated by reference in its entirety. the peptides may be made as a part of a fusion protein, see PCT US99/23715, hereby expressly incorporated by reference
- the fusion partners may be placed anywhere (i e N-terminal, C-terminal, internal) in the structure as the biology and activity permits
- the fusion partner includes a linker or tethering sequence, as generally described in PCT US 97/01019, that can allow the candidate agents to interact with potential targets unhindered
- useful linkers include glycine-se ⁇ ne polymers (including, for example, (GS) n , (GSGGS) n and (GGGS) n , where n is an integer of at least one), glycine-alanme polymers, alanine-se ⁇ ne polymers, and other flexible linkers such as the tether for the shaker potassium channel, and a large variety of other flexible linkers, as will be appreciated by those in the art Glycine-se ⁇ ne polymers are preferred since both of these ammo acids are relatively unstructured, and therefore may be able to serve as a neutral tether between components Secondly, serine is hydrophilic and therefore able to solubi ze what could be a globular
- the fusion partners may be modified, randomized, and/or matured to alter the presentation orientation of the randomized expression product
- determinants at the base of the loop may be modified to slightly modify the internal loop peptide tertiary structure, which maintaining the randomized ammo acid sequence
- combinations of fusion partners are used
- any number of combinations of presentation structures, targeting sequences, rescue sequences, and stability sequences may be used, with or without linker sequences
- candidate agents can include these components, and may then be used to generate a library of fragments, each containing a different random nucleotide sequence that may encode a different peptide
- the ligation products are then transformed into bacteria, such as E coli, and DNA is prepared from the resulting library, as is generally outlined in Kitamura, PNAS USA 92 9146-9150 (1995), hereby expressly incorporated by reference
- Suitable retroviral packaging system cell lines include, but are not limited to, the Bing and BOSC23 cell lines described in WO 94/19478, Soneoka et al , Nucleic Acid Res 23(4) 628 (1995), Finer et al , Blood 83 43 (1994), Pheonix packaging lines such as PhiNX-eco and PhiNX-ampho, described below, 292T + gag-pol and retrovirus envelope, PA317, and cell lines outlined in Markowitz et al , Virology 167 400 (1988), Markowitz et al , J Virol 62 1120 (1988), Li et al , PNAS USA 93 11658 (1996), Kmsella et al , Human Gene Therapy 7 1405 (1996), all of which are incorporated by reference Preferred systems include PhiNX-eco and PhiNX-ampho or similar cell lines, disclosed in PCT US97/010
- viral vectors When the cells are not replicating, other viral vectors may be used, including adenoviral vectors, feline immunoviral (FIV) vectors, etc
- the candidate agent when the candidate agent is introduced to the cells using a viral vector, the candidate peptide agent is linked to a detectable molecule, and the methods of the invention include at least one expression assay
- An expression assay is an assay that allows the determination of whether a candidate bioactive agent has been expressed, i e whether a candidate peptide agent is present in the cell
- the candidate agent is operably linked to a detectable molecule
- this is done by creating a fusion nucleic acid
- the fusion nucleic acid comprises a first nucleic acid encoding the candidate bioactive agent (which can include fusion partners, as outlined above), and a second nucleic acid encoding a detectable molecule
- first and second are not meant to confer an orientation of the sequences with respect to 5'-3' orientation of the fusion nucle
- the candidate nucleic acids are introduced into the cells to screen for bioactive agents capable of eliminating multi-drug resistance
- introduction into or grammatical equivalents herein is meant that the nucleic acids enter the cells in a manner suitable for subsequent expression of the nucleic acid
- Exemplary methods include CaP0 4 precipitation, liposome fusion, hpofectin®, electroporation, viral infection, etc
- the candidate nucleic acids may stably integrate into the genome of the host cell (for example, with retroviral introduction, outlined below), or may exist either transiently or stably in the cytoplasm (i e through the use of traditional plasmids, utilizing standard regulatory sequences, selection markers, etc ) As many pharmaceutically important screens require human or model mammalian cell targets, retroviral vectors capable of transfecting such targets are preferred
- the candidate nucleic acids are part of a retroviral particle which infects the cells.
- infection of the cells is straightforward with the application of the infection- enhancing reagent polybrene, which is a polycation that facilitates viral binding to the target cell Infection can be optimized such that each cell generally expresses a single construct, using the ratio of virus particles to number of cells Infection follows a Poisson distribution
- candidate agents other than nucleic acids or the peptides encoded by them are used, the candidate agents are added to the cells in any number of ways, as will be appreciated by those in the art
- the candidate agents are added to cells
- the type of cells used in the present invention can vary widely Basically, any mammalian cells may be used, with mouse, rat, primate and human cells being particularly preferred, although as will be appreciated by those in the art, modifications of the system by pseudotyp g allows all eukaryotic cells to be used, preferably higher eukaryotes
- suitable cell types include, but are not limited to, tumor cells of all types (particularly melanoma, myeloid leukemia, carcinomas of the lung, breast, ovaries, colon, kidney, prostate, pancreas and testes), cardiomyocytes, endothelial cells, epithelial cells, lymphocytes (T-cell and B cell), mast cells, eosmophils, vascular intimal cells, hepatocytes, leukocytes including mononuclear leukocytes, stem cells such as haemopoetic, neural, skin, lung, kidney, liver and myocyte stem cells
- Suitable cells also include known research cells, including, but not limited to, Jurkat T cells, NIH3T3 cells, CHO, Cos, H1299, MDMB435S, A549, HeLa, etc See the ATCC cell line catalog, hereby expressly incorporated by reference
- the cells may be genetically engineered, that is, contain exogeneous nucleic acid, for example, to contain target molecules
- a plurality of cells is screened That is, the cells into which the candidate nucleic acids are introduced are screened as outlined herein
- a “plurality of cells” herein is meant roughly from about 10 3 cells to 10 8 or 10 9 , with from 10 6 to 10 8 being preferred
- This plurality of cells comprises a cellular library, wherein generally each cell within the library contains a member of the retroviral molecular library, i e a different candidate nucleic acid, although as will be appreciated by those in the art, some cells within the library may not contain a retrovirus, and some may contain more than one Alternatively, when non-retroviral candidate agents are used, each cell is the same, and different cells get exposed to different candidate agents When methods other than retroviral infection are used to introduce the candidate nucleic acids into a plurality of cells, the distribution of candidate nucleic acids within the individual cell members of the cellular library may vary widely, as it is generally difficult to control the number of nucleic acids which enter a cell during electroporation
- the candidate nucleic acids are introduced into a plurality of cells, and the protective effect of the candidate bioactive agents is reexammed in naive HeLa cells as described below If necessary, the cells are treated to conditions suitable for the expression of the candidate nucleic acids (for example, when mducible promoters are used), to produce the candidate expression products, either translation or transcription products
- libraries of candidate agents are used to screen for compounds that result in a multidrug phenotype, that is, for example, peptides that confer the MDR phenotype are used to identify target molecules within the MDR pathway.
- the candidate agents are added to the cells (either extracellularly or mtracellularly, as outlined above) under reaction conditions that favor agent-target interactions Generally, this will be physiological conditions Incubations may be performed at any temperature which facilitates optimal activity, typically between 4 and 40°C Incubation periods are selected for optimum activity, but may also be optimized to facilitate rapid high through put screening Typically between 0 1 and 1 hour will be sufficient Excess reagent is generally removed or washed away
- reagents may be included in the assays These include reagents like salts, neutral proteins, e g albumin, detergents, etc which may be used to facilitate optimal protem-protem binding and/or reduce non-specific or background interactions Also reagents that otherwise improve the efficiency of the assay, such as protease inhibitors, nuclease inhibitors, anti-microbial agents, etc , may be used.
- the mixture of components may be added in any order that provides for detection Washing or rinsing the cells will be done as will be appreciated by those in the art at different times, and may include the use of filtration and centrifugation
- second labeling moieties also referred to herein as "secondary labels”
- second labeling moieties are preferably added after excess non-bound target molecules are removed, in order to reduce non-specific binding, however, under some circumstances, all the components may be added simultaneously
- the present invention provides for screens of candidate agents that can confer or ameliorate multidrug resistance
- multi-drug resistance or other grammatical equivalents herein is meant the simultaneous loss of sensitivity to multiple chemotherapeutic drugs
- Cells which acquire MDR may be detected by phenotypic changes
- Suitable phenotypic changes include, but are not limited to gross physical changes such as changes in cell morphology, cell growth, cell viability, adhesion to substrates or other cells, and cellular density, changes in the expression of one or more RNAs, proteins, pids, hormones, cytokines, or other molecules, changes in the equilibrium state (i e half-life) or one or more RNAs, proteins, hpids, hormones, cytokines, or other molecules, changes in the localization of one or more RNAs, proteins, hpids, hormones, cytokines, or other molecules, changes in the bioactivity or specific activity of one or more RNAs, proteins, hpids, hormones,
- the bioactive agent changes the sensitivity of the cell, such that the cell survives treatment with a chemotherapeutic agent
- the MDR phenotype may be detected in a wide variety of ways, as is described more fully below
- the MDR phenotype is detected using, for example microscopic analysis of cell morphology, standard cell viability assays, standard labeling assays such as fluoromet ⁇ c indicator assays for the presence or level of a particular cell or molecule, including FACS or other dye staining techniques, biochemical detection of the expression of target compounds after killing the cells, etc
- the MDR phenotype is detected in the cell in which the randomized nucleic acid was introduced
- the MDR phenotype is detected by treating cells with a lethal dose of a chemotherapeutic drug and isolating the surviving clones
- lethal dose herein is meant a concentration of a chemotherapeutic drug sufficient to kill 99 99% of the cells
- chemotherapeutic drug useful in the methods of the present invention include taxol, etoposide, cisplatm, ad ⁇ amycin, mitoxantrone, camptothecm, vinc ⁇ stine, etc See also any of the anti-neoplastic agents outlined in the
- Taxol is used in general, the concentration of Taxol used ranges from 1 nm to 100 ⁇ M In a preferred embodiment, cells are treated with 100-200 nM, Taxol for 48 to 72 hours In a particularly preferred embodiment, cells are treated with 200 nM Taxol for forty eight hours
- MDR phenotype of a cell indicates the presence of a bioactive agent
- the cell is isolated from the plurality which do not have MDR phenotypes
- isolation techniques include, but are not limited to, FACS, lysis selection using complement, cell cloning, scanning by Fluo ⁇ mager, expression of a "survival" protein, induced expression of a cell surface protein or other molecule that can be rendered fluorescent or taggable for physical isolation, expression of an enzyme that changes a non-fluorescent molecule to a flourescent one, overgrowth against a background of no or slow growth, death of cells and isolation of DNA or other cell vitality indicator dyes, etc
- surviving clones are isolated and retreated with the same concentration of the chemotherapeutic drug to eliminate clones whose outgrowth is due to non-heritable, stochastic, or transitory resistance
- the candidate nucleic acid and/or the bioactive agent is isolated from the positive cell This may be done in a number of ways
- primers complementary to DNA regions common to the retroviral constructs, or to specific components of the library such as a rescue sequence, defined above are used to "rescue" the unique random sequence
- the bioactive agent is isolated using a rescue sequence
- rescue sequences comprising epitope tags or purification sequences may be used to pull out the bioactive agent, using immunoprecipitation or affinity columns In some instances, as is outlined below, this may also pull out the primary target molecule, if there is a sufficiently strong binding interaction between the bioactive agent and the target molecule
- the peptide may be detected using mass spectroscopy
- bioactive agent and/or bioactive nucleic acid is determined This information can then be used in a number of ways.
- the bioactive agent is resynthesized and reintroduced into the target cells, to verify the effect
- This may be done using retroviruses, or alternatively using fusions to the HIV-1 Tat protein, and analogs and related proteins, which allows very high uptake into target cells See for example, Fawell et al , PNAS USA 91 664 (1994), Frankel et al , Cell 55 1189 (1988), Savion et al , J Biol Chem 256 1149 (1981), Derossi et al , J Biol Chem 269 10444 (1994), and Baldm et al , EMBO J 9 1511 (1990), all of which are incorporated by reference
- a clonogenic survival assay in naive HeLa cells is used Resynthesizing and reintroducmg bioactive agents which confer multi-drug resistance allows screening for constructs which enable growth at higher concentrations of the chemotherapeutic drug used in the initial selection process These agents can be selected for further study as outlined below
- the methods of the present invention comprise identifying and isolating bioactive agents capable of conferring or ameliorating MDR
- bioactive agents capable of conferring MDR are defined herein as “resistance conferring” (RC) agents, defined above
- RC resistance conferring
- bioactive agents capable of ameliorating MDR are defined herein as “sensitizing” agents, defined below
- a RC agent is a peptide that interacts with or modulates a PRP protein to confer a MDR phenotype in the presence of a chemotherapeutic agent(s)
- the RC peptide comprises the ammo acid sequence set forth in SEQ ID No 1
- the bioactive agent is a RC peptide having at least 90% sequence identity to the sequence set forth in SEQ ID No 1
- the RC peptide is encoded and preferably expressed by an RC nucleic acid (see for example, Figure 7B)
- the sequence of a bioactive agent is used to generate more candidate bioactive agents
- the sequence of the bioactive agent may be the basis of a second round of (biased) randomization, to develop bioactive agents with increased or altered activities
- the second round of randomization may change the affinity of the bioactive agent
- it may be desirable to put the identified random region of the bioactive agent into other presentation structures, or to alter the sequence of the constant region of the presentation structure, to alter the conformation/shape of the bioactive agent It may also be desirable to "walk" around a potential binding site, in a manner similar to the mutagenesis of a binding pocket, by keeping one end of the hgand region constant and randomizing the other end to shift the binding of the peptide around
- either the bioactive agent or the bioactive nucleic acid encoding it is used to identify target molecules, i e the molecules with which the bioactive agent interacts.
- target molecules i e the molecules with which the bioactive agent interacts
- the bioactive agent is used to pull out target molecules, such as the
- the use of epitope tags or purification sequences can allow the purification of primary target molecules via biochemical means (co-immunoprecipitation, affinity columns, etc )
- the peptide when expressed in bacteria and purified, can be used as a probe against a bacterial cDNA expression library made from mRNA of the target cell type
- peptides can be used as "bait" in either yeast or mammalian two or three hybrid systems
- Such interaction cloning approaches have been very useful to isolate DNA-bmdmg proteins and other interacting protein components
- the pept ⁇ de(s) can be combined with other pharmacologic activators to study the epistatic relationships of signal transduction pathways in question It is also possible to synthetically prepare labeled peptide bioactive agent and use it to screen a cDNA library expressed in bacte ⁇ ophage for those cDNAs which bind the peptide
- secondary target molecules may be identified in the same manner, using the primary target as the "bait" In this manner, signaling pathways may be elucidated Similarly, bioactive agents specific for secondary target molecules may also be discovered, to allow a number of bioactive agents to act on a single pathway, for example for combination therapies
- PRP proteins identified in the first screen such as XPCA7
- secondary screens of candidate agents to identify drug compounds that will modulate the activity of the PRP proteins, for use in methods of treating MDR
- the PRP target molecules are used in binding and bioactivity screens
- target molecules PRP proteins and nucleic acids which render cells resistant to chemotherapeutic drugs
- PRP proteins are proteasome alpha type subunit XAPC7 and proteasome alpha type subunit Zeta
- PRP protein of the present invention may be identified in several ways "Protein” in this sense includes proteins, polypeptides, and peptides
- An PRP nucleic acid or protein is initially identified by substantial nucleic acid and/or ammo acid sequence homology to the sequences shown in Figure 8
- Such homology can be based upon the overall nucleic acid or ammo acid sequence
- a protein is a "PRP protein" if the overall homology of the protein sequence to the ammo acid sequences shown in Figure 8B and 8D is preferably greater than about 50%, more preferably greater than about 60%, even more preferably greater than about 75% and most preferably greater than 80 In some embodiments the homology will be as high as about 90 to 95 or 98%
- Homology in this context means sequence similarity or identity, with identity being preferred This homology will be determined using standard techniques known in the art, such as the Best Fit sequence program described by Devereux ef al , Nucl Acid Res 12 387-395 (1984), preferably using the default settings, or the BLASTX program (Altschul et al , J Mol Biol 275, 403-410) The alignment may include the introduction of gaps in the sequences to be aligned.
- sequences which contain either more or fewer ammo acids than the proteins shown in Figure 8B and 8D it is understood that the percentage of homology will be determined based on the number of homologous am o acids in relation to the total number of ammo acids Thus, for example, homology of sequences shorter than that shown in Figure 8B and 8D, as discussed below, will be determined using the number of ammo acids in the shorter sequence
- percent identity or similarity is calculated by FastDB based upon the following parameters mismatch penalty of 1 0, gap penalty of 1 0, gap size penalty of 0 33, joining penalty of 30 0 ("Current Methods in Comparison and Analysis", Macromolecule Sequencing and
- PILEUP PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments It can also plot a tree showing the clustering relationships used to create the alignment PILEUP uses a simplification of the progressive alignment method of Feng and Doolittle J Mol Evol 1987 35 351-360, the method is similar to that described by Higgins and Sharp 1989 CABIOS 5 151-153 Useful PILEUP parameters including a default gap weight of 3 00, a default gap length weight of 0 10, and weighted end gaps
- WU-BLAST-2 uses several search parameters, most of which are set to the default values
- the HSP S and HSP S2 parameters are dynamic values and are established by the program itself depending upon the composition of the particular sequence and composition of the particular database against which the sequence of interest is being searched, however, the values may be adjusted to increase sensitivity
- percent ammo acid sequence identity is determined In percent identity calculations relative weight is not assigned to various manifestations of sequence variation, such as, insertions, deletions, substitutions, efc Only identities are scored positively (+1 ) and all forms of sequence variation given a value of "0", which obviates the need for a weighted scale or parameters as described above for sequence similarity calculations Therefore, percent identity represents a highly rigorous method of comparing sequences
- Percent sequence identity can be calculated, for example, by dividing the number of matching identical residues by the total number of residues of the "shorter" sequence in the aligned region and multiplying by 100 The "longer" sequence is the one having the most actual residues in the aligned region
- PRP proteins of the present invention may be shorter or longer than the ammo acid sequences shown in Figure 8B and 8D
- included within the definition of MDR proteins are portions or fragments of the sequences depicted in Figure 8B and 8D
- MDR deletion mutants can be made
- the PRP proteins are derivative or variant PRP proteins That is, as outlined more fully below, the derivative PRP peptides will contain at least one ammo acid substitution, deletion or insertion, with ammo acid substitutions being particularly preferred The am o acid substitution, insertion or deletion may occur at any residue within the PRP peptide
- PRP proteins can be made that are longer than those depicted in Figure 8B and 8D, for example, by the addition of epitope or purification tags, the addition of other fusion sequences, etc
- PRP proteins may also be identified as being encoded by PRP nucleic acids Thus, PRP proteins are encoded by nucleic acids that will hybridize to the sequences depicted in Figure 8A and 8C or its complement, as outlined herein
- the PRP proteins when the PRP proteins are to be used to generate antibodies, the PRP proteins must share at least one epitope or determinant with their respective full length proteins shown in Figure 8B and 8D
- epitope or “determinant” herein is meant a portion of a protein which will generate and/or bind an antibody
- the epitope is unique, that is, antibodies generated to a unique epitope show little or no cross-reactivity
- the antibodies to PRP proteins are capable of reducing or eliminating the biological function of PRP proteins, as is described below
- the addition of anti-PRP antibodies (either polyclonal or preferably monoclonal) to PRP (or cells containing PRP) also may reduce or eliminate the PRP activity
- at least a 25% decrease in activity is preferred, with at least about 50% being particularly preferred and about a 95-100% decrease being especially preferred
- Antibodies of the invention specifically bind to PRP proteins
- specifically bind to PRP proteins By “specifically bind” herein is meant that the antibodies bind to the protein with a binding constant in the range of at least 10" - 10 -6 M ⁇ with a preferred range being 10 7 - 10 "9 M 1
- the nucleic acid sequence homology may be either lower or higher than that of the protein sequence
- the homology of the nucleic acid sequence as compared to the nucleic acid sequence of either Figure 8A or Figure 8C is preferably greater than 75%, more preferably greater than about 80%, particularly greater than about 85% and most preferably greater than 90% In some embodiments the homology will be as high as about 93 to 95 or 98%
- Nucleic acid similarity can be determined using, for example, BLASTN (Altschul ef al 1990 J Mol Biol 147 195-197) BLASTN uses a simple scoring system in which matches count +5 and mismatches -4 To achieve computational efficiency, the default parameters have been incorporated directly into the source code
- PRP nucleic acids encode, an PRP protein, such as proteasome alpha type subunits XAPC7 or Zeta
- an PRP protein such as proteasome alpha type subunits XAPC7 or Zeta
- an extremely large number of nucleic acids may be made, all of which encode the PRP proteins of the present invention
- those skilled in the art could make any number of different nucleic acids, by simply modifying the sequence of one or more codons in a way which does not change the ammo acid sequence of the encoded PRP protein
- nucleic acid homology is determined through hybridization studies
- nucleic acids which hybridize under high stringency to the nucleic acid sequences shown in Figure 8A and/or 8C or their complements are considered an PRP gene
- hybridization conditions will be evident to one skilled in the art and will generally be guided by the purpose of the hybridization, the type of hybridization (DNA-DNA, DNA-RNA, RNA-RNA, ohgonucleotide-DNA efc ), and the level of desired relatedness between the sequences
- Methods for hybridization are well established in the literature
- the stringency of hybridization may be used to maximize or minimize the stability of such duplexes
- Hyb ⁇ diziation stringency can be altered by, for example, adjusting the temperature of hybridization solution, adjusting the percentage of hehx-destabihzing agents, such as, formamide, in the hybridization solution, and adjusting the temperature and salt concentration of the wash solutions
- the stringency of hybridization is adjusted during the post-hyb ⁇ dization washes by varying the salt concentration and/or the temperature Stringency of hybridization may be increased
- nucleic acid may refer to either DNA or RNA, or molecules which contain both deoxy- and ⁇ bonucleotides
- the nucleic acids include genomic DNA, cDNA and oligonucleotides including sense and anti-sense nucleic acids
- Such nucleic acids may also contain modifications in the ⁇ bose- phosphate backbone to increase stability and half life of such molecules in physiological environments
- the nucleic acid may be double stranded, single stranded, or contain portions of both double stranded or single stranded sequence
- the depiction of a single strand also defines the sequence of the other strand (“Crick")
- the sequence depicted in Figures 7B and 8A and 8C also includes the complement of the sequences
- recombinant nucleic acid herein is meant nucleic acid, originally formed in vitro, in general, by the manipulation of nucleic acid by endonucleases, in a form not normally found in nature
- an isolated PRP nucleic acid, in a linear form, or an expression vector formed in vitro by ligating DNA molecules that are not normally joined are both considered recombinant for the purposes of this invention It is understood that once a recombinant nucleic acid is made and reintroduced into a host cell or organism, it will replicate non-recombmantly, i e using
- a "recombinant protein” is a protein made using recombinant techniques, i e through the expression of a recombinant nucleic acid as depicted above
- a recombinant protein is distinguished from naturally occurring protein by at least one or more characteristics
- the protein may be isolated or purified away from some or all of the proteins and compounds with which it is normally associated in its wild type host, and thus may be substantially pure
- an isolated protein is unaccompanied by at least some of the material with which it is normally associated in its natural state, preferably constituting at least about 0 5%, more preferably at least about 5% by weight of the total protein in a given sample
- a substantially pure protein comprises at least about 75% by weight of the total protein, with at least about 80% being preferred, and at least about 90% being particularly preferred
- the definition includes the production of an MDR protein from one organism in a different organism or host cell Alternatively, the protein may be made at a significantly higher concentration than is normally seen, through the use of a mducible promoter or
- ammo acid sequence variants are also included within the definition of PRP proteins of the present invention.
- ammo acid sequence variants fall into one or more of three classes substitutional, msertional or deletional variants
- These variants ordinarily are prepared by site specific mutagenesis of nucleotides in the DNA encoding PRP proteins XAPC7 and Zeta, using cassette or PCR mutagenesis or other techniques well known in the art, to produce DNA encoding the variant, and thereafter expressing the DNA in recombinant cell culture as outlined above
- variant PRP protein fragments having up to about 100-150 residues may be prepared by in vitro synthesis using established techniques
- Ammo acid sequence variants are characterized by the predetermined nature of the variation, a feature that sets them apart from naturally occurring allehc or mterspecies variation of the PRP protein ammo acid sequences
- the variants typically exhibit the same qualitative biological activity as the naturally occurring analogue, although variants can also be selected which have modified characteristics as will be more fully outlined below
- the mutation per se need not be predetermined
- random mutagenesis may be conducted at the target codon or region and the expressed PRP variants screened for the optimal combination of desired activity
- Techniques for making substitution mutations at predetermined sites in DNA having a known sequence are well known, for example, M13 primer mutagenesis and PCR mutagenesis Screening of the mutants is done using survival assays of PRP protein activities, for example, resistance to Taxol
- Am o acid substitutions are typically of single residues, insertions usually will be on the order of from about 1 to 20 ammo acids, although considerably larger insertions may be tolerated
- Deletions range from about 1 to about 20 residues, although in some cases deletions may be much larger
- substitutions deletions, insertions or any combination thereof may be used to arrive at a final derivative Generally these changes are done on a few ammo acids to minimize the alteration of the molecule However, larger changes may be tolerated in certain circumstances When small alterations in the characteristics of PRP protein are desired, substitutions are generally made in accordance with the following chart
- substitutions are less conservative than those shown in Chart I
- substitutions may be made which more significantly affect the structure of the polypeptide backbone in the area of the alteration, for example the alpha-helical or beta-sheet structure, the charge or hydrophobicity of the molecule at the target site, or the bulk of the side chain
- substitutions which in general are expected to produce the greatest changes in the polypeptide's properties are those in which (a) a hydrophilic residue, e g seryl or threonyl, is substituted for (or by) a hydrophobic residue, e g leucyl, isoleucyl, phenylalanyl, valyl or alanyl, (b) a cysteine or proline is substituted for (or by) any other residue, (c) a residue having an electropositive side chain, e g lysyl, arginyl, or histidyl, is substituted for (a) a hydrophilic residue, e g se
- a library of variants are generated by an entirely, non-specific, random mutagenesis method
- DNA shuffling as described by Stemmer Nature 370 389-391 (1994) and Stemmer PNAS USA 91 10747-10751 (1994)) can be used to produce variants which are cloned, expressed, and screened for a desired property
- the intracellular activity of an PRP protein can be increased or decreased
- variants typically exhibit the same qualitative biological activity and will elicit the same immune response as the naturally-occurring analogue, although variants also are selected to modify the characteristics of the PRP protein as needed Alternatively, the variant may be designed such that the biological activity of the PRP protein is altered For example, glycosylation sites may be altered or removed
- Covalent modifications of PRP polypeptides are included within the scope of this invention
- One type of covalent modification includes reacting targeted ammo acid residues of an PRP polypeptide with an organic de ⁇ vatizing agent that is capable of reacting with selected side chains or the N-or C-terminal residues of an PRP polypeptide
- De ⁇ vatization with bifunctional agents is useful, for instance, for crosslinkmg an PRP protein to a water-insoluble support matrix or surface for use in the method for purifying anti-PRP antibodies, respectively, or screening assays, as is more fully described below
- Commonly used crosslinkmg agents include, e g , 1 ,1-b ⁇ s(d ⁇ azoacetyl)-2-phenylethane, glutaraldehyde, N-hydroxysuccmimide esters, for example, esters with 4-az ⁇ dosahcyl ⁇ c acid, homobifunctional imidoesters, including disuccinimidyl esters such as 3,3'-
- Another type of covalent modification of the PRP proteins included within the scope of this invention comprises altering the native glycosylation pattern of the polypeptide "Altering the native glycosylation pattern" is intended for purposes herein to mean deleting one or more carbohydrate moieties found in a native sequence of a PRP polypeptide, and/or adding one or more glycosylation sites that are not present in the native sequences of an PRP polypeptide
- Addition of glycosylation sites to PRP polypeptides may be accomplished by altering the ammo acid sequence thereof
- the alteration may be made, for example, by the addition of, or substitution by, one or more serine or threonine residues to the native sequences of PRP polypeptides (for 0-hnked glycosylation sites)
- the PRP am o acid sequence may optionally be altered through changes at the DNA level, particularly by mutating the DNA encoding an PRP polypeptide at preselected bases such that codons are generated that will translate into the desired ammo acids
- Removal of carbohydrate moieties present on PRP polypeptides may be accomplished chemically or enzymatically or by mutational substitution of codons encoding for ammo acid residues that serve as targets for glycosylation
- Chemical deglycosylation techniques are known in the art and described, for instance, by Hakimuddin, et al , Arch Biochem Biophvs . 259 52 (1987) and by Edge et al , Anal Biochem . 118 131 (1981)
- Enzymatic cleavage of carbohydrate moieties on polypeptides can be achieved by the use of a variety of endo-and exo-glycosidases as described by Thotakura et al , Meth Enzvmol . 138 350 (1987)
- Another type of covalent modification of PRP proteins comprise linking the polypeptides to one of a variety of nonproteinaceous polymers, e g , polyethylene glycol, polypropylene glycol, or polyoxyalkylenes, in the manner set forth in U S Patent Nos 4,640,835, 4,496,689, 4,301,144, 4,670,417, 4,791 ,192 or 4,179,337
- the PRP proteins of the present invention may also be modified in a way to form chime ⁇ c molecules comprising an PRP polypeptide fused to another, heterologous polypeptide or ammo acid sequence
- such a chime ⁇ c molecule comprises a fusion of an PRP polypeptide with a tag polypeptide which provides an epitope to which an anti-tag antibody can selectively bind
- the epitope tag is generally placed at the amino-or carboxyl-terminus of an PRP polypeptide
- the presence of such epitope-tagged forms of an PRP polypeptide can be detected using an antibody against the tag polypeptide
- provision of the epitope tag enables the PRP polypeptide to be readily purified by affinity purification using an anti-tag antibody or another type of affinity matrix that binds to the epitope tag
- the chime ⁇ c molecule may comprise a fusion of an PRP polypeptide with an immunoglobulm or a particular region of an immunoglobulm
- such a fusion could be to the Fc region of an IgG molecule
- Various tag polypeptides and their respective antibodies are well known in the art Examples include poly-hist
- Tag polypeptides include the Flag-peptide [Hopp et al , BioTechnology. 6 1204-1210 (1988)], the KT3 epitope peptide [Martin et al , Science.
- tubulm epitope peptide [Skinner et al , J Biol Chem , 266 15163-15166 (1991)], and the T7 gene 10 protein peptide tag [Lutz-Freyermuth et al , Proc Natl Acad Sci USA. 87 6393-6397 (1990)]
- an PRP nucleic acid Once an PRP nucleic acid is identified, it can be cloned and, if necessary, its constituent parts recombmed to form the entire PRP nucleic acid
- the recombinant PRP nucleic acid Once isolated from its natural source, e g , contained within a plasmid or other vector or excised therefrom as a linear nucleic acid segment, the recombinant PRP nucleic acid can be further-used as a probe to identify and isolate other PRP nucleic acids It can also be used as a "precursor" nucleic acid to make modified or variant PRP nucleic acids and proteins
- the expression vectors may be either self-replicatmg extrachromosomal vectors or vectors which integrate into a host genome Generally, these expression vectors include transcriptional and translational regulatory nucleic acid operably linked to the nucleic acid encoding the PRP protein
- control sequences refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism
- the control sequences that are suitable for prokaryotes include a promoter, optionally an operator sequence, and a ⁇ bosome binding site Eukaryotic cells are known to utilize promoters, polyadenylation signals, and enhancers
- Nucleic acid is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence
- DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide
- a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence
- a ⁇ bosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation
- "operably linked” means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase
- enhancers do not have to be contiguous Linking is accomplished by gation at convenient rest ⁇ ction sites If such sites do not exist, the synthetic ohgonucleotide adaptors or linkers are used in accordance with conventional practice
- the transcriptional and translational regulatory nucleic acid will generally be appropriate
- the transcriptional and translational regulatory sequences may include, but are not limited to, promoter sequences, nbosomal binding sites, transcriptional start and stop sequences, translational start and stop sequences, and enhancer or activator sequences
- the regulatory sequences include a promoter and transcriptional start and stop sequences
- Promoter sequences encode either constitutive or mducible promoters
- the promoters may be either naturally occurring promoters or hybrid promoters Hybrid promoters, which combine elements of more than one promoter, are also known in the art, and are useful in the present invention
- the expression vector may comprise additional elements
- the expression vector may have two replication systems, thus allowing it to be maintained in two organisms, for example in mammalian or insect cells for expression and in a procaryotic host for cloning and amplification
- the expression vector contains at least one sequence homologous to the host cell genome, and preferably two homologous sequences which flank the expression construct
- the integrating vector may be directed to a specific locus in the host cell by selecting the appropriate homologous sequence for inclusion in the vector Constructs for integrating vectors are well known in the art
- the expression vector contains a selectable marker gene to allow the selection of transformed host cells Selection genes are well known in the art and will vary
- a preferred expression vector system is a retroviral vector system such as is generally described in PCT/US97/01019 and PCT/US97/01048, both of which are hereby expressly incorporated by reference
- the PRP proteins of the present invention are produced by culturing a host cell transformed with an expression vector containing nucleic acid encoding an PRP protein, under the appropriate conditions to induce or cause expression of the encoded protein
- the conditions appropriate for PRP protein expression will vary with the choice of the expression vector and the host cell, and will be easily ascertained by one skilled in the art through routine experimentation
- the use of constitutive promoters in the expression vector will require optimizing the growth and proliferation of the host cell, while the use of an mducible promoter requires the appropriate growth conditions for induction
- the timing of the harvest is important
- the baculoviral systems used in insect cell expression are lytic viruses, and thus harvest time selection can be crucial for product yield.
- Appropriate host cells include yeast, bacteria, archebacte ⁇ a, fungi, and insect and animal cells, including mammalian cells.
- yeast Drosophila melangaster cells, Saccharomyces cerevisiae and other yeasts, E. coli, Bacillus subtilis, SF9 cells, C129 cells, 293 cells, Neurospora, BHK, CHO, COS, and HeLa cells, fibroblasts, Schwanoma cell lines, immortalized mammalian myeloid and lymphoid cell lines, Jurkat cells, mast cells and other endocrine and exoc ⁇ ne cells, and neuronal cells
- the PRP proteins are expressed in mammalian cells
- Mammalian expression systems are also known in the art, and include retroviral systems
- a mammalian promoter is any DNA sequence capable of binding mammalian RNA polymerase and initiating the downstream (3') transcription of a coding sequence for the PRP protein into mRNA
- a promoter will have a transcription initiating region, which is usually placed proximal to the 5' end of the coding sequence, and a TATA box, using a located 25-30 base pairs upstream of the transcription initiation site The TATA box is thought to direct RNA polymerase II to begin RNA synthesis at the correct site.
- a mammalian promoter will also contain an upstream promoter element (enhancer element), typically located within 100 to 200 base pairs upstream of the TATA box
- An upstream promoter element determines the rate at which transcription is initiated and can act in either orientation
- mammalian promoters include the SV40 early promoter, mouse mammary tumor virus LTR promoter, adenovirus major late promoter, herpes simplex virus promoter, and the CMV promoter
- transcription termination and polyadenylation sequences recognized by mammaiian cells are regulatory regions located 3' to the translation stop codon and thus, together with the promoter elements, flank the coding sequence The 3' terminus of the mature mRNA is formed by site-specific post-translational cleavage and polyadenylation Examples of transcription terminator and polyadenlytion signals include those derived form SV40
- PRP proteins are expressed in bacterial systems Bacterial expression systems are well known in the art
- a suitable bacterial promoter is any nucleic acid sequence capable of binding bacte ⁇ al RNA polymerase and initiating the downstream (3') transcription of the coding sequence of PRP protein into mRNA
- a bacterial promoter has a transcription initiation region which is usually placed proximal to the 5' end of the coding sequence This transcription initiation region typically includes an RNA polymerase binding site and a transcription initiation site
- Sequences encoding metabolic pathway enzymes provide particularly useful promoter sequences Examples include promoter sequences derived from sugar metabolizing enzymes, such as galactose, lactose and maltose, and sequences derived from biosynthetic enzymes such as tryptophan Promoters from bactenophage may also be used and are known in the art
- synthetic promoters and hybrid promoters are also useful, for example, the tac promoter is a hybrid of the trp and lac promoter sequences
- the ⁇ bosome binding site is called the Shme-Delgarno (SD) sequence and includes an initiation codon and a sequence 3-9 nucleotides in length located 3 - 11 nucleotides upstream of the initiation codon
- the expression vector may also include a signal peptide sequence that provides for secretion of the PRP protein in bacteria
- the signal sequence typically encodes a signal peptide comprised of hydrophobic ammo acids which direct the secretion of the protein from the cell, as is well known in the art
- the protein is either secreted into the growth media (gram-positive bacteria) or into the periplasmic space, located between the inner and outer membrane of the cell (gram-negative bacteria)
- the bacterial expression vector may also include a selectable marker gene to allow for the selection of bacterial strains that have been transformed Suitable selection genes include genes which render the bacteria resistant to drugs such as ampicilhn, chloramphenicol, erythromycm, kanamycin, neomycin and tetracycline Selectable markers also include biosynthetic genes, such as those in the histidine, tryptophan and leucine biosynthetic pathways
- Expression vectors for bacteria are well known in the art, and include vectors for Bacillus subtilis, E coli, Streptococcus cremons, and Streptococcus lividans, among others
- the bacterial expression vectors are transformed into bacterial host cells using techniques well known in the art, such as calcium chloride treatment, electroporation, and others.
- PRP protein is produced in insect cells
- Expression vectors for the transformation of insect cells, and in particular, baculovirus-based expression vectors, are well known in the art.
- PRP protein is produced in yeast cells Yeast expression systems are well known in the art, and include expression vectors for Saccharomyces cerevisiae, Candida albicans and
- promoter sequences for expression in yeast include the mducible GAL1.10 promoter, the promoters from alcohol dehydrogenase, enolase, glucokmase, glucose-6-phosphate isomerase, glyceraldehyde-3-phosphate- dehydrogenase, hexokmase, phosphofructokinase, 3-phosphoglycerate mutase, pyruvate kinase, and the acid phosphatase gene
- yeast selectable markers include ADE2, HIS4, LEU2, TRP1, and ALG7, which confers resistance to tunicamycm, the neomycin phosphotransferase gene, which confers resistance to G418, and the CUP1
- the PRP protein may also be made as a fusion protein, using techniques well known in the art Thus, for example, for the creation of monoclonal antibodies, if the desired epitope is small, the PRP protein may be fused to a carrier protein to form an immunogen Alternatively, the PRP protein may be made as a fusion protein to increase expression, or for other reasons For example, when the PRP protein is a peptide, the nucleic acid encoding the peptide may be linked to other nucleic acid for expression purposes
- the PRP nucleic acids, proteins and antibodies of the invention are labeled.
- labeled herein is meant that a compound has at least one element, isotope or chemical compound attached to enable the detection of the compound.
- labels fall into three classes a) isotopic labels, which may be radioactive or heavy isotopes, b) immune labels, which may be antibodies or antigens, and c) colored or fluorescent dyes The labels may be incorporated into the compound at any position
- the PRP protein is purified or isolated after expression
- PRP proteins may be isolated or purified in a variety of ways known to those skilled in the art depending on what other components are present in the sample Standard purification methods include electrophoretic, molecular, immunological and chromatographic techniques, including ion exchange, hydrophobic, affinity, and reverse-phase HPLC chromatography, and chromatofocusing
- the PRP protein may be purified using a standard affinity column using antibody specific for the PRP protein Ultrafiltration and diafiltration techniques, in conjunction with protein concentration, are also useful
- the PRP proteins, nucleic acids, modified proteins and cells containing the native or modified PRP proteins are used in screening assays Identification of important PRP proteins permits the design of drug screening assays for compounds that modulate PRP activity
- the methods comprise combining an PRP protein sample and a candidate bioactive agent, and evaluating the effect on multi-drug resistance
- PRP activity or grammatical equivalents herein is meant either the decrease or loss of MDR
- PRP activity is the loss of MDR
- the activity of the PRP protein is increased, in another preferred embodiment, the activity of the PRP protein is decreased
- bioactive agents that are antagonists are preferred in some embodiments, and bioactive agents that are agonists may be preferred in other embodiments
- Screens may be designed to first find candidate agents that can bind to PRP proteins, and then these agents may be used in assays that evaluate the ability of the candidate agent to modulate PRP activity
- assays there are a number of different assays which may be run, i e , binding assays and activity assays
- the methods comprise combining an PRP protein and a candidate bioactive agent, and determining the binding of the candidate agent to the PRP protein
- Preferred embodiments utilize the human PRP protein, although other eucaryotic proteins may also be used, including rodents (mice, rats, hamsters, guinea pigs, etc ), farm animals (cows, sheep, pigs, horses, etc ) primates and yeast These latter embodiments may be preferred in the development of animal models of human disease
- va ⁇ ant or derivative PRP proteins may be used, including deletion PRP proteins as outlined above
- PRP proteins included within the definition of PRP proteins are portions of PRP proteins, that is, either the full-length protein may be used, or functional portions thereof.
- the assays described herein may utilize either isolated PRP proteins or cells comprising the PRP proteins
- the PRP protein or the candidate agent is non-diffusably bound to an insoluble support having isolated sample receiving areas (e g a microtiter plate, an array, etc )
- the insoluble supports may be made of any composition to which the compositions can be bound, is readily separated from soluble material, and is otherwise compatible with the overall method of screening
- the surface of such supports may be solid or porous and of any convenient shape
- suitable insoluble supports include microtiter plates, arrays, membranes and beads These are typically made of glass, plastic (e g , polystyrene), polysaccha ⁇ des, nylon or nitrocellulose, teflonTM, etc Microtiter plates and arrays are especially convenient because a large number of assays can be carried out simultaneously, using small amounts of reagents and samples
- the particular manner of binding of the composition is not crucial so long as it is compatible with the reagents and overall methods of the invention, maintains the activity of the composition and is nondiffusable P
- the PRP protein is bound to the support, and a candidate bioactive agent is added to the assay
- the candidate agent is bound to the support and the PRP protein is added
- Novel binding agents include specific antibodies, non-natural binding agents identified in screens of chemical libraries, peptide analogs, etc Of particular interest are screening assays for agents that have a low toxicity for human cells
- assays may be used for this purpose, including labeled in vitro protein-protein binding assays, electrophoretic mobility shift assays, immunoassays for protein binding, functional assays (phosphorylation assays, etc ) and the like.
- the determination of the binding of the candidate bioactive agent to the PRP protein may be done in a number of ways
- the candidate bioactive agent is labeled, and binding determined directly
- this may be done by attaching all or a portion of the PRP protein to a solid support, adding a labeled candidate agent (for example a fluorescent label), washing off excess reagent, and determining whether the label is present on the solid support
- a labeled candidate agent for example a fluorescent label
- label herein is meant that the compound is either directly or indirectly labeled with a label which provides a detectable signal, e g radioisotope, fluorescers, enzyme, antibodies, particles such as magnetic particles, chemiluminescers, or specific binding molecules, etc
- Specific binding molecules include pairs, such as biotm and streptavidin, digoxin and antidigoxm, etc
- the complementary member would normally be labeled with a molecule which provides for detection, in accordance with known procedures, as outlined above
- the label can directly or indirectly provide a detectable signal
- the proteins may be labeled at tyrosine positions using 125 l, or with fluorophores Alternatively, more than one component may be labeled with different labels, using 125 l for the proteins, for example, and a fluorophor for the candidate agents
- the binding of the candidate bioactive agent is determined through the use of competitive binding assays.
- the competitor is a binding moiety known to bind to the target molecule (i.e. an PRP protein), such as an antibody, peptide, binding partner, ligand, etc.
- the competitor is the peptide of SEQ ID NO. 1. Under certain circumstances, there may be competitive binding as between the bioactive agent and the binding moiety, with the binding moiety displacing the bioactive agent.
- the candidate bioactive agent is labeled.
- Either the candidate bioactive agent, or the competitor, or both, is added first to the protein for a time sufficient to allow binding, if present.
- Incubations may be performed at any temperature which facilitates optimal activity, typically between 4 and 40°C. Incubation periods are selected for optimum activity, but may also be optimized to facilitate rapid high through put screening. Typically between 0.1 and 1 hour will be sufficient. Excess reagent is generally removed or washed away. The second component is then added, and the presence or absence of the labeled component is followed, to indicate binding.
- methods for screening for a bioactive agent capable of modulating the activity of a PRP protein comprise the steps of adding a candidate bioactive agent to a sample of a PRP proteins, as described above, and determining an alteration in the biological activity of the PRP protein.
- “Modulating the activity of a PRP protein” includes an increase in activity, a decrease in activity, or a change in the type or kind of activity present.
- the candidate agent should bind to the PRP protein (although this may not be necessary), and alter its biological or biochemical activity as defined herein.
- the methods include both in vivo screening methods, as are generally outlined above, and in vivo screening of cells for alterations in the phenotype of a PRP protein, including but not limited to, changes in the presence, distribution, activity or amount of the PRP protein.
- the competitor is added first, followed by the candidate bioactive agent.
- Displacement of the competitor is an indication that the candidate bioactive agent is binding to the PRP protein and thus is capable of binding to, and potentially modulating, the activity of the PRP protein.
- either component can be labeled.
- the presence of label in the wash solution indicates displacement by the agent.
- the candidate bioactive agent is labeled, the presence of the label on the support indicates displacement.
- modulation by the candidate bioactive agent is determined through the use of competitive assays.
- the candidate bioactive agent is added first, with incubation and washing, followed by the competitor.
- the absence of modulation of the PRP protein by the competitor may indicate that the bioactive agent is bound to the PRP protein with a higher affinity.
- the presence of the label on the support, coupled with a lack of competitor binding may indicate that the candidate agent is capable of binding to the PRP protein
- the methods comprise differential screening to identity bioactive agents that are capable of modulating the activity of the PRP proteins
- the methods comprise combining an PRP protein and a competitor in a first sample
- a second sample comprises a candidate bioactive agent, an PRP protein and a competitor
- the binding of the competitor is determined for both samples, and a change, or difference in binding between the two samples indicates the presence of an agent capable of binding to the PRP protein and potentially modulating its activity That is, if the binding of the competitor is different in the second sample relative to the first sample, the agent is capable of binding to the PRP protein
- another embodiment utilizes differential screening to identify drug candidates that bind to the native PRP protein, but cannot bind to modified PRP proteins
- the structure of the PRP protein may be modeled, and used in rational drug design to synthesize agents that interact with that site
- Drug candidates that affect PRP bioactivity are also identified by screening drugs for the ability to either enhance or reduce the activity of the protein
- Positive controls and negative controls may be used in the assays, as described herein Preferably all control and test samples are performed in at least triplicate to obtain statistically significant results.
- reagents may be included in the screening assays These include reagents like salts, neutral proteins, e g albumin, detergents, etc which may be used to facilitate optimal prote -protem binding and/or reduce non-specific or background interactions Also reagents that otherwise improve the efficiency of the assay, such as protease inhibitors, nuclease inhibitors, anti-microbial agents, etc , may be used The mixture of components may be added in any order that provides for the requisite binding
- the invention provides methods for screening for bioactive agents capable of modulating the phenotype of a PRP protein in a cell
- modulating the phenotype of a PRP protein herein is meant changes in, for example, the presence, distribution, activity or amount of the PRP protein
- changes in the activity of the PRP protein is determined
- the methods comprise adding a candidate bioactive agent, as defined above, to a cell comprising PRP proteins
- Preferred cell types include almost any cell, as described herein
- the cells either express PRP proteins from a endogenous gene or from a recombinant nucleic acid
- a library of candidate agents are tested on a plurality of cells Alternatively, a screen is preformed in the presence or absence of a competitive inhibitor and the PRP phenotype is determined
- the PRP proteins and bioactive agents may find use as therapeutic agents in compositions used in the treatment of a multi-drug resistance associated disease
- Bioactive agents which find use as therapeutic agents are referred to herein as “sensitzmg agents”
- Sensitizing agents are any molcule that when added to a cell inhibits resistance to an chemotherapeutic agent(s) Sensitizing agents may be added separately or in combination with chemotherapeutic agents
- MDR multi-drug resistance
- the PRP proteins are useful in the study or treatment of conditions which are mediated by MDR , i e to diagnose, treat, or prevent MDR associated diseases
- compositions and methods provided herein are particularly deemed useful for the treatment of multi-drug resistance associated with cancer, including solid tumors such as skin, breast, brain, cervical carcinomas, testicular carcinomas, etc More particularly, cancers that may be treated by the compositions and methods of the invention include, but are not limited to Cardiac sarcoma (angiosarcoma, fibrosarcoma, rhabdomyosarcoma, hposarcoma), myxoma, rhabdomyoma, fibroma, hpoma and teratoma, Lung bronchogenic carcinoma (squamous cell, undifferentiated small cell, undifferentiated large cell, adenocarcinoma), alveolar (bronchiolar) carcinoma, bronchial adenoma, sarcoma, lymphoma, chondromatous hamartoma, mesothehoma, Gastrointestinal esophagus
- Cardiac sarcoma angio
- squamous cell carcinoma adenocarcinoma, leiomyosarcoma, lymphoma
- stomach carcinoma, lymphoma, leiomyosarcoma
- pancreas ductal adenocarcinoma, insuhnoma, glucagonoma, gast ⁇ noma, carcinoid tumors, vipoma
- small bowel adenocarcinoma, lymphoma, carcinoid tumors, Karposi's sarcoma, leiomyoma, hemangioma, hpoma, neurofibroma, fibroma), large bowel (adenocarcinoma, tubular adenoma, villous adenoma, hamartoma, leiomyoma), Genitourinary tract kidney (adenocarcinoma, Wilm's tumor [nephroblastoma], lymphoma, leukemia), bladder and urethra (s
- HematoloQic blood myeloid leukemia [acute and chronic], acute lymphoblastic leukemia, chronic lymphocytic leukemia, myelopro ferative diseases, multiple myeloma, myelodysplastic syndrome), Hodgkm's disease, non-Hodgkin's lymphoma [malignant lymphoma], Skin malignant melanoma, basal cell carcinoma, squamous cell carcinoma, Karposi's sarcoma, moles dysplastic nevi, hpoma, angioma, dermatofibroma, keloids, psoriasis, and Adrenal glands neuroblastoma
- acute and chronic acute lymphoblastic leukemia
- chronic lymphocytic leukemia chronic lymphocytic leukemia
- myelopro ferative diseases multiple myeloma, myelodysplastic syndrome
- Hodgkm's disease non-Hodgkin's lymphom
- cancerous cell includes a cell afflicted by any one of the above identified conditions
- methods of modulating MDR in cells or organisms comprise administering to a cell an anti-PRP antibody that reduces or eliminates the biological activity of the corresponding endogeneous PRP proteins
- the methods comprise administering to a cell or organism a recombinant nucleic acid encoding an PRP protein
- the gene therapy techniques include the incorporation of the exogeneous gene using enhanced homologous recombination (EHR), for example as described in
- the invention provides methods for diagnosing an MDR related condition in an individual
- the methods comprise measuring the activity of an PRP protein in a tissue from the individual or patient, which may include a measurement of the amount or specific activity of PRP proteins XAPC7 and Zeta This activity is compared to the activity of XAPC7 and Zeta from either a unaffected second individual or from an unaffected tissue from the first individual When these activities are different, the first individual may be at risk for an MDR mediated disorder
- the PRP proteins of the present invention may be used to generate polyclonal and monoclonal antibodies to PRP proteins, which are useful as described herein Similarly, the PRP proteins can be coupled, using standard technology, to affinity chromatography columns These columns may then be used to purify PRP antibodies In a preferred embodiment, the antibodies are generated to epitopes unique to an PRP protein, that is, the antibodies show little or no cross-reactivity to other proteins These antibodies find use in a number of applications For example, the PRP antibodies may be coupled to standard affinity chromatography columns and used to purify PRP proteins The antibodies may also be used as blocking polypeptides, as outlined above, since they will specifically bind to PRP proteins
- a therapeutically effective dose of a sensitizing agent is administered to a patient
- therapeutically effective dose herein is meant a dose that produces the effects for which it is administered
- the exact dose will depend on the purpose of the treatment, and will be ascertainable by one skilled in the art using known techniques As is known in the art, adjustments for degradation of the sensitizing agent, systemic versus localized delivery, and rate of new protease synthesis, as well as the age, body weight, general health, sex, diet, time of administration, drug interaction and the severity of the condition may be necessary, and will be ascertainable with routine experimentation by those skilled in the art
- a "patient” for the purposes of the present invention includes both humans and other animals and organisms, such as experimental animals Thus the methods are applicable to both human therapy and veterinary applications
- the patient is a human
- compositions of the present invention can be done in a variety of ways, including, but not limited to, orally, subcutaneously, intravenously, mtranasally, transdermally, intraperitoneally, intramuscularly, intrapulmonary, vaginally, rectally, or mtraocularly
- the composition may be directly applied as a solution or spray
- the compounds may be formulated in a variety of ways
- the concentration of therapeutically active compound in the formulation may vary from about 0 1 -100 wt %
- compositions of the present invention comprise a compound in a form suitable for administration to a patient
- the pharmaceutical compositions are in a water soluble form, such as being present as pharmaceutically acceptable salts, which is meant to include both acid and base addition salts
- “Pharmaceutically acceptable acid addition salt” refers to those salts that retain the biological effectiveness of the free bases and that are not biologically or otherwise undesirable, formed with inorganic acids such as hydrochloric acid, hydrobromic acid, sulfu ⁇ c acid, nitric acid, phosphoric acid and the like, and organic acids such as acetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, maleic acid, malonic acid, succinic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandehc acid, methanesulfonic acid, ethanesulfonic acid, p-toluenesulfonic acid, salicy
- compositions may also include one or more of the following: carrier proteins such as serum albumin; buffers; fillers such as microcrystalline cellulose, lactose, corn and other starches; binding agents; sweeteners and other flavoring agents; coloring agents; and polyethylene glycol.
- carrier proteins such as serum albumin
- buffers such as buffers
- fillers such as microcrystalline cellulose, lactose, corn and other starches
- binding agents such as microcrystalline cellulose, lactose, corn
- Phoenix-ampho cells (293T with integrated viral packaging genes) (Pear, W. S., et al., (1993) Proc. Natl. Acad. Sci. U S A, 90, 8392-8396) and Hela tTA cells (Hela expressing the tet activator) (Clontech) were used for retroviral transduction and Taxol sensitivity experiments, respectively.
- Information on Phoenix-ampho can be obtained at ⁇ http://www.stanford.edu/group/nolan>.
- the retroviral vector was used for peptide library construction as indicated in Fig.1 A.
- GFP-peptide fusions were cloned into the Tra vector as shown in Fig 1A, replacing GFP with the fusion protein and with no peptide in the primary expression position.
- Random peptide library construction A peptide library was constructed containing random 18mers flanked with MGEFLIVIKS(X 1 ⁇ )EFLIVIKSGPP.
- the FLIVIKS sequence is derived from a study where the SKVILFE sequence was shown to form dinners in solution (Bodenmuller, H., et al., (1986) EMBO J., 5, 1825-29).
- Our studies demonstrate the FLIVIKS sequence demonstrates a strong capacity to self-anneal and create protease-resistant scaffolded structures.
- Two oligos, RG221 (5'-
- Fmoc-Pro-Novasyn-TGT resin Standard Fmoc-compatible side-chain-protection groups were used and the coupling reactions were carried out twice with a five-fold excess of Fmoc-protected alpha- ammo acids adopting BOP/DIPEA mediated coupling method (Castro, B , et al friction (1975) Tetrahedron Lett , 14, 1219-1222) After assembling all the ammo acids followed by the spacer (Acap, aminocaproic acid) and the biotm at the N-terminus, peptide was cleaved from the resin, purified by
- the peptide library was transfected into Phoenix-ampho cells by calcium phosphate precipitation (Ausubel, F M , et al , (1994) "Transfection of DNA into eukaryotic cells", in
- RT-PCR for peptide rescue and MDR1 mRNA level assay Peptide sequences were rescued by RT-PCR from Taxol-resistant cells and later cloned into a Tra vector (in which the peptide expression was under tetracycline control) Each peptide was re-tested in naive Hela cells by a clonogenic survival assay
- RiboGreen RNA quantification kit Molecular Probes
- Oligonucleotides for amplification of MDR-1 mRNA were described previously (Chen, G et al , (1997) J Biol Chem , 272, 5974-5982)
- Clonogenic survival assay Viruses carrying the rescued peptides were used to infect Hela cells as described above After infection, 2x10 5 cells were seeded into single well of 6-well plate w/o Doxycycline (200 ng/ml) in the medium 24 hours later, the cells were treated with Taxol for 48 hours Two weeks after Taxol treatment, the Taxol-resistant clones were stained with Giemsa solution, photographed and enumerated
- the DNA library was transfected into the retroviral producer cell line Phoemx-Ampho
- the infectious viral supernatant was harvested 48 hours later Fresh supernatant was immediately used to infect 4x10 ⁇ Hela cells After a period of two days, during which retroviral integration finalizes and peptide expression reaches maximal levels, the cells were subjected to "Taxol selection pressure" More than 99 99% of the infected cells died after treatment with 200 nM Taxol for 48 hours After two weeks of growth in fresh media, 150 surviving clones were picked and retreated with the same dosage of Taxol to test for and eliminate clones whose original outgrowth had been due to false-positive breakthrough (i e , rare cells that are resistant to Taxol by non-heritable mechanisms not related to peptide expression) The peptide sequences from the clones that remained Taxol resistant were rescued by RT-PCR and re-cloned into a Tetracychne-regulated
- Rhodam ⁇ ne123 efflux assay 2 5x10 5 Hela cells were incubated in 1ml color-free MEM with 1 mM Rhodam ⁇ ne123 for 15 minutes at 37°C The cells were spun down and resuspended in 1 ml MEM without Rhodam ⁇ ne123 and incubated for an additional 15 minutes The Rhodam ⁇ ne123 retention was analyzed on FACS (Lee, J S et al , (1994) Mol Pharmacol , 46, 627-638)
- Cell proliferation assay Cells expressing the RGP8 5 peptide under the control of a tet activator were grown with or without 200 ng/ml Dox for 2 days 5x10 3 cells were then seeded in single wells of a 96- well plate The next day, the cells were treated with Taxol in the presence or absence of 2 mM CsA for 48 hr The viability of Taxol-treated cells was analyzed by the Cell Proliferation Kit II (XTT,
- the RG8 5 expressing cells were grown in the logarithmic phase The cells were harvested, washed once with PBS and fixed in 2% paraformaldehyde pH7 4 at 4°C for 30 minute s After washing with 1 %BSA-PBS, the cells were resuspended in PI staining buffer containing 250 mg/ml RNase, 50 ug/ml PI, 0 1% Triton X100 in 0 1% Na Citrate pH7 4 buffer, RT for 30m ⁇ n, and analyzed on FACS
- Yeast two-hybrid screening The bait used for two-hybrid screening was RGP8 5 fused to the Gal4 DNA binding domain containing a three glycine linker/spacer
- a cDNA library made from a combination of multiple human tissues was used for the screening 20 million transformants were screened 27 H ⁇ s7LacZ + colonies were retrieved for further analysis
- the proteins were then transferred to a PVDF membrane
- the blot was blocked in PBS-Tween (Calbiochem) containing 5% non-fat milk, and then incubated with rabbit anti-GFP (Molecular Probe), monoclonal anti-flag antibody (Kodak ) or monoclonal anti-Zeta and ant ⁇ -XAPC7 of the human 20S proteasome subunits (Affiniti, United Kingdom) at 4°C overnight After washing, the blots were incubated with a protein A conjugated HRP (Bio-Rad) for the rabbit primary antibody or a goat anti- mouse conjugate HRP (Santa Cruz) for the mouse primary antibody for 1 hour at room temperature The proteins were visualized by enhanced chemiluminescent substrate (Pierce)
- RGP8 5 peptide up-regulates mdr-1 gene expression in HeLa cells
- the expressed peptide might promote survival of Hela cells in a variety of manners, including action upon known regulators of apoptosis
- Both Bcl-2 and Bcl-xL remain at the same expression level in either case (data not shown), suggesting that RGP8 5 peptidejriediated Taxol resistance is not involved at this level of an anti-apoptotic pathway
- the peptide acts at a different level than through direct action on Bel family protein expression levels
- Rhodamine 123 a fluorescent indicator dye, is actively pumped from cells expressing functional MDR-1 protein and therefore reflects MDR-1 mediated drug efflux activity (Krishan, A.., et al., (1997) Cytometry, 29, 279-285). Uninfected
- Rhodamine123 staining retention shows very little efflux pump activity as measured by Rhodamine123 staining retention.
- the clone containing the RGP8.5 peptide clearly was able to extrude the Rhodamine 123 and this effect was significantly diminished when peptide expression was turned off by the addition of Dox ( Figure 2D).
- R6G an analogue of Rhodamine123, to do the efflux assay, we found the GFP positive population was associated with the pump positive peak (data not shown).
- MRP multidrug resistance associated protein
- LRP lung resistance-related protein
- MRP protein is expressed in the Hela tTA cell line. However, in contrast to P-gp, the RGP8.5 peptide has no effect on the levels of MRP expression in these cells (data not shown). Previous studies have also suggested that MRP overexpression does not confer resistance against Taxol (Huang, Y., et al., (1997) Leukemia, 11, 253-257).
- RGP8 5 modulates the mdr-1 gene expression at the RNA level
- RGP8 5 peptide associates with proteasome subunits in vivo
- Zeta subunits were shown to bind to RGP8.5 peptides in equimolar amounts. Thus ⁇ genetically in yeast and biochemically in mammalian cells ⁇ we observe association of the RGP8.5 peptide with these proteasome subunits.
- Proteasome-mediated protein degradation modulates MDR-1 gene expression.
- MDR-1 mRNA levels were reduced after turning off the RGP8.5 peptide expression by the addition of Dox ( Figure 5A, lane 3).
- the level of MDR-1 mRNA was significantly enhanced under the same conditions when MG132 was added to the media ( Figure 5A, lane 4). mRNA levels for the tubulin control were unaffected by Dox or MG132.
- RGP8.5 peptide exhibits proteasome inhibitor activity.
Abstract
Description
Claims
Priority Applications (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU53032/00A AU5303200A (en) | 1999-05-25 | 2000-05-25 | Identification of novel mechanisms of drug resistance |
EP00937920A EP1183534A2 (en) | 1999-05-25 | 2000-05-25 | Identification of novel mechanisms of drug resistance |
JP2000620346A JP2003500649A (en) | 1999-05-25 | 2000-05-25 | Identification of novel mechanisms of drug resistance |
CA002374918A CA2374918A1 (en) | 1999-05-25 | 2000-05-25 | Identification of novel mechanisms of drug resistance |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US13601899P | 1999-05-25 | 1999-05-25 | |
US60/136,018 | 1999-05-25 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2000072008A2 true WO2000072008A2 (en) | 2000-11-30 |
WO2000072008A3 WO2000072008A3 (en) | 2001-02-22 |
Family
ID=22470869
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2000/014812 WO2000072008A2 (en) | 1999-05-25 | 2000-05-25 | Identification of novel mechanisms of drug resistance |
Country Status (5)
Country | Link |
---|---|
EP (1) | EP1183534A2 (en) |
JP (1) | JP2003500649A (en) |
AU (1) | AU5303200A (en) |
CA (1) | CA2374918A1 (en) |
WO (1) | WO2000072008A2 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005026328A2 (en) * | 2003-09-12 | 2005-03-24 | Uab Research Foundation | Cpt resistant cell line |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1996011207A1 (en) * | 1994-10-06 | 1996-04-18 | The General Hospital Corporation | Compositions and methods for interfering with hepatitis b virus infection |
WO1997027212A1 (en) * | 1996-01-23 | 1997-07-31 | Rigel Pharmaceuticals, Inc. | Methods for screening for transdominant intracellular effector peptides and rna molecules |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JPH05317059A (en) * | 1992-05-22 | 1993-12-03 | Bio Material Kenkyusho:Kk | Component of rat proteasome and its dna |
-
2000
- 2000-05-25 JP JP2000620346A patent/JP2003500649A/en active Pending
- 2000-05-25 EP EP00937920A patent/EP1183534A2/en not_active Withdrawn
- 2000-05-25 AU AU53032/00A patent/AU5303200A/en not_active Abandoned
- 2000-05-25 WO PCT/US2000/014812 patent/WO2000072008A2/en not_active Application Discontinuation
- 2000-05-25 CA CA002374918A patent/CA2374918A1/en not_active Abandoned
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1996011207A1 (en) * | 1994-10-06 | 1996-04-18 | The General Hospital Corporation | Compositions and methods for interfering with hepatitis b virus infection |
WO1997027212A1 (en) * | 1996-01-23 | 1997-07-31 | Rigel Pharmaceuticals, Inc. | Methods for screening for transdominant intracellular effector peptides and rna molecules |
Non-Patent Citations (1)
Title |
---|
DATABASE WPI Section Ch, Week 199402 Derwent Publications Ltd., London, GB; Class B04, AN 1994-011024 XP002152781 & JP 05 317059 A (BIO MATERIAL KENKYUSHO KK), 3 December 1993 (1993-12-03) * |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005026328A2 (en) * | 2003-09-12 | 2005-03-24 | Uab Research Foundation | Cpt resistant cell line |
WO2005026328A3 (en) * | 2003-09-12 | 2005-08-04 | Uab Research Foundation | Cpt resistant cell line |
Also Published As
Publication number | Publication date |
---|---|
WO2000072008A3 (en) | 2001-02-22 |
CA2374918A1 (en) | 2000-11-30 |
AU5303200A (en) | 2000-12-12 |
EP1183534A2 (en) | 2002-03-06 |
JP2003500649A (en) | 2003-01-07 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Ucker | Cytotoxic T lymphocytes and glucocorticoids activate an endogenous suicide process in target cells | |
Puthalakath et al. | The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex | |
JP2010063461A (en) | COMPOSITION AND METHOD FOR MODULATING CELLULAR NF-kappaB ACTIVATION | |
EP1856145B1 (en) | Voltage dependent anion channel (vdac1) compositions and methods of use thereof for regulating apoptosis | |
US7494976B2 (en) | Caveolin peptides and their use as therapeutics | |
CN111225976A (en) | Modular binding proteins | |
WO2001034824A2 (en) | Methods and compositions comprising renilla gfp | |
WO1998040397A1 (en) | Bax inhibitor proteins | |
JP2002544522A (en) | Methods for identifying protein-protein interactions and interacting proteins and amino acid sequences of interaction sites | |
JP2002544522A5 (en) | ||
US6737240B1 (en) | Methods of screening for a multi-drug resistance conferring peptide | |
EP1515985B1 (en) | Methods of screening molecular libraries for active molecules that restore the function of mutant p53 | |
WO1998056806A1 (en) | A TRANSCRIPTION FACTOR COACTIVATOR PROTEIN, p/CIP | |
EP1183534A2 (en) | Identification of novel mechanisms of drug resistance | |
US20060111289A1 (en) | Compositions and methods of using Alpha-fetoprotein growth inhibitory peptides | |
US6887675B1 (en) | Tankyrase H, compositions involved in the cell cycle and methods of use | |
US20080021202A1 (en) | Novel apoptosis proteins | |
EP1237916B1 (en) | Ing2, an iaps associated cell cycle protein, compositions and methods of use | |
Dowell et al. | Expression of a mutant p193/CUL7 molecule confers resistance to MG132-and etoposide-induced apoptosis independent of p53 or Parc binding | |
Ernst et al. | Ectopic expression of human topoisomerase IIα fragments and etoposide resistance in mammalian cells | |
US6812336B1 (en) | Transcription factor coactivator protein, p/CIP | |
EP1239038A1 (en) | High-throughput identification of modulators of e2f activity | |
EP1343816A2 (en) | PROTEINS THAT INTERACT WITH $g(b)TRCP | |
WO2001012213A2 (en) | Ttp-related zinc finger domains and methods of use | |
EP1218506A1 (en) | Traf4 associated cell cycle proteins, compositions and methods of use |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY CA CH CN CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG UZ VN YU ZA ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
AK | Designated states |
Kind code of ref document: A3 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY CA CH CN CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG UZ VN YU ZA ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A3 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
ENP | Entry into the national phase in: |
Ref document number: 2374918 Country of ref document: CA Ref country code: CA Ref document number: 2374918 Kind code of ref document: A Format of ref document f/p: F |
|
ENP | Entry into the national phase in: |
Ref country code: JP Ref document number: 2000 620346 Kind code of ref document: A Format of ref document f/p: F |
|
WWE | Wipo information: entry into national phase |
Ref document number: 53032/00 Country of ref document: AU |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2000937920 Country of ref document: EP |
|
WWP | Wipo information: published in national office |
Ref document number: 2000937920 Country of ref document: EP |
|
REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
WWW | Wipo information: withdrawn in national office |
Ref document number: 2000937920 Country of ref document: EP |