WO2000067700A2 - Recombinant vaccine against botulinum neurotoxin - Google Patents

Recombinant vaccine against botulinum neurotoxin Download PDF

Info

Publication number
WO2000067700A2
WO2000067700A2 PCT/US2000/012890 US0012890W WO0067700A2 WO 2000067700 A2 WO2000067700 A2 WO 2000067700A2 US 0012890 W US0012890 W US 0012890W WO 0067700 A2 WO0067700 A2 WO 0067700A2
Authority
WO
WIPO (PCT)
Prior art keywords
serotype
bont
nucleic acid
seq
bont serotype
Prior art date
Application number
PCT/US2000/012890
Other languages
French (fr)
Other versions
WO2000067700A3 (en
Inventor
Leonard A. Smith
Michael P. Byrne
John L. Middlebrook
Hugh Lapenotiere
Original Assignee
United States Army Medical Research & Materiel Cmd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by United States Army Medical Research & Materiel Cmd filed Critical United States Army Medical Research & Materiel Cmd
Priority to AU50035/00A priority Critical patent/AU783450B2/en
Priority to EP00932296A priority patent/EP1180999A4/en
Priority to CA002371279A priority patent/CA2371279A1/en
Priority to JP2000616731A priority patent/JP2004512004A/en
Priority to US09/611,419 priority patent/US7214787B1/en
Publication of WO2000067700A2 publication Critical patent/WO2000067700A2/en
Publication of WO2000067700A3 publication Critical patent/WO2000067700A3/en
Priority to US09/910,186 priority patent/US7081529B2/en
Priority to US11/437,212 priority patent/US7786285B2/en

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/33Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Clostridium (G)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/08Clostridium, e.g. Clostridium tetani
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • This invention is directed to preparation and expression of synthetic genes encoding polypeptides containing protective epitopes of botulinum neurotoxin (BoNT).
  • the invention is also directed to methods of vaccination against botulism using the expressed peptides.
  • Tetanus neurotoxin (TeNT) is produced by Clostridium tetani while Clostridium botulinum produces seven different neurotoxins which are differentiated serologically by specific neutralization.
  • the botulinum neurotoxins (BoNT) have been designated as serotypes A, B, Ci, D, E, F, and G.
  • Botulinum neurotoxins (BoNT) are the most toxic substances known and are the causative agents of the disease botulism.
  • BoNT exert their action by inhibiting the release of the neurotransmitter acetylcholine at the neuromuscular junction
  • BoNT exert their action by inhibiting the release of the neurotransmitter acetylcholine at the neuromuscular junction
  • Hibermann, E., et al., (1986) "Clostridial Neurotoxins: Handling and Action at the Cellular and Molecular Level," C r. Top. Microbiol. Immunol, 129:93-179; Schiavo, G., et al., (1992a), "Tetanus and Botulinum-B Neurotoxins Block Neurotransmitter Release by Proteolytic Cleavage of Synaptobrevin," Nature, 359:832-835; Simpson, L.L., (1986), "Molecular Pharmacology of Botulinum Toxin and Tetanus Toxin," Annu. Rev.
  • Botulinum neurotoxins are translated as a single 150 kDa polypeptide chain and then posttranslationally nicked, forming a dichain consisting of a 100 kDa heavy chain and a 50 kDa light chain which remain linked by a disulfide bond (DasGupta, B.R., et al., (1972), "A Common Subunit Structure in Clostridium botulinum Type A, B, and E Toxins," Biophys. Res.
  • the two chains can be separated; one chain has a Mr of -100 kDa and is referred to as the heavy chain while the other has a Mr -50 kDa and is termed the light chain.
  • toxin is internalized into an endosome through receptor-mediated endocyctosis (Shone, C.C., et al., (1987), "A 50-kDa Fragment from the NH 2 -terminus of the Heavy Subunit of Clostridium botulinum Type A Neurotoxin Forms Channels in Lipid Vesicles, Euro. J. Biochem., 167:175-180).
  • the amino terminal half of the heavy chain is believed to participate in the translocation mechanism of the light chain across the endosomal membrane (Simpson, 1986; Poulain, B., et al., (1991), "Heterologous Combinations of Heavy and Light Chains from Botulinum Neurotoxin A and Tetanus Toxin Inhibit Neurotransmitter Release in Aplysia," J. Biol.
  • BoNT serotypes A, d, and E cleave SNAP-25 (synaptosomal-associated protein of M25,000), serotypes B, D, F, and G cleave VAMP/synaptobrevin (synaptic vesicle- associated membrane protein); and serotype Ci cleaves syntaxin.
  • Inactivation of SNAP-25, VAMP, or syntaxin by BoNT leads to an inability of the nerve cells to release acetylcholine resulting in neuromuscular paralysis and possible death, if the condition remains untreated.
  • Human botulism poisoning is generally caused by type A, B, E or rarely, by type F toxin.
  • Type A and B are highly poisonous proteins which resist digestion by the enzymes of the gastrointestinal tract.
  • Foodborne botulism poisoning is caused by the toxins present in contaminated food, but wound and infant botulism are caused by in vivo growth in closed wounds and the gastrointestinal tract respectively.
  • the toxins primarily act by inhibiting the neurotransmitter acetylcholine at the neuromuscular junction, causing paralysis.
  • Another means for botulism poisoning to occur is the deliberate introduction of the toxin(s) into the environment as might occur in biological warfare.
  • toxin When the cause of botulism is produced by toxin rather than by in vivo infection the onset of neurologic symptoms is usually abrupt and occurs within 18 to 36 hours after ingestion. The most common immediate cause of death in respiratory failure due to diaphragmatic paralysis. Home canned foods are the most common sources of toxins. The most frequently implicated toxin is toxin A, which is responsible for more than 50% of morbidity resulting from botulinum toxin.
  • botulinal toxin Because even small amounts of botulinal toxin can cause serious illness, persons such as laboratory workers who are exposed to toxin must learn to handle all samples that may contain toxin with extreme care. It is also suggested that such workers be protected from illness by vaccination against the toxins. Furthermore, persons exposed to conditions in which botulism toxins might be in the environment which might be inhaled or ingested, such as military personnel, need to be protected from the toxin.
  • Microbiol, 26:2351-2356) available under Investigational New Drug (IND) status, is used to immunize specific populations of at-risk individuals, i.e., scientists and health care providers who handle BoNT and our armed forces who may be subjected to weaponized forms of the toxin
  • serotypes A, B, and E are most associated with botulism outbreaks in humans, type F has also been diagnosed (Midura, T.F., et al., (1972), "Clostridium botulinum Type F: Isolation from Venison Jerky," Appl. Microbiol. ⁇ 24:165-167; Green, J., et al., (1983), "Human Botulism (Type F) - A Rare Type," Am. J.
  • toxoid vaccines are available, there are numerous shortcomings with their current use and ease of production.
  • C. botulinum is a spore- former, a dedicated facility is required to manufacture a toxin-based product.
  • the requirement for a dedicated manufacturing facility is not trivial. It is extremely costly to renovate and upgrade an existing facility or to build a new one and then to maintain the facility in accordance with current Good Manufacturing Practices (cGMP) to manufacture one vaccine.
  • cGMP Good Manufacturing Practices
  • the yields of toxin production from C. botulinum are relatively low.
  • the toxoiding process involves handling large quantities of toxin and thus is dangerous, and the added safety precautions increase the cost of manufacturing.
  • the toxoid product for types A-E consists of a crude extract of clostridial proteins that may influence immunogenicity or reactivity of the vaccine, and the type F toxoid is only partially purified (IND 5077).
  • the toxoiding process involves the use of formaldehyde, which inactivates the toxin, and residual levels of formaldehyde (not to exceed 0.02%) are part of the product formulation to prevent reactivation of the toxin, the vaccine is reactogenic.
  • An additional component of the toxoid vaccines is the preservative thimerosal (0.01%), which also increases the reactogenicity of the product.
  • a recombinant vaccine would eliminate the need for a dedicated manufacturing facility.
  • many cGMP facilities are in existence and available that could manufacture a recombinant product.
  • Production yields from a genetically engineered product is expected to be high.
  • There would be no need to treat the vaccine with formalin because the product would be non-toxic from the outset.
  • Recombinant products would be purer, less reactogenic, and more fully characterized.
  • the cost of a recombinant product would be expected to be much lower than a toxoid because there would be no expenditures required to support a dedicated facility, and the higher production yields would reduce the cost of the vaccine product.
  • this invention provides a nucleic acid encoding the carboxy-terminal portion of the heavy chain (HC) of botulinum neurotoxin (BoNT), the BoNT being selected from the group consisting of BoNT serotype A, BoNT serotype B, BoNT serotype CI, BoNT serotype D, BoNT serotype E, BoNT serotype F, and BoNT serotype G, wherein said nucleic acid is expressable in a recombinant organism selected from Escherichia coli and Pichia pastoris.
  • the nucleic acid comprises a nucleic acid sequence selected from SEQ ID No:l (serotype A), SEQ ID No:7 (serotype B), SEQ ID No:9 (serotype CI), SEQ ID No: 11 (serotype D), SEQ ID No: 13 (serotpye E), SEQ ID No: 15 (serotype F), and SEQ ID No: 17 (serotype G).
  • the nucleic acid encodes an HC amino acid sequence of BoNT selected from SEQ ID No:2 (serotype A), SEQ LD No:8 (serotype B), SEQ ID No: 10 (serotype CI), SEQ JD No: 12 (serotype D), SEQ ID No: 14 (serotpye E), SEQ ID No: 16 (serotype F), and SEQ ID No: 18 (serotype G).
  • this invention provides a nucleic acid encoding the amino-terminal portion of the heavy chain (HN) of botulinum neurotoxin (BoNT), the BoNT being selected from the group consisting of BoNT serotype B, BoNT serotype CI, BoNT serotype D, BoNT serotype E, BoNT serotype F, and BoNT serotype G, wherein said nucleic acid is expressable in a recombinant organism selected from Escherichia coli and Pichia pastoris.
  • BoNT botulinum neurotoxin
  • the nucleic acid comprises a nucleic acid sequence selected from SEQ ID No:21 (serotype B), SEQ ID No:23 (serotype CI), SEQ ID No:25 (serotype D), SEQ ID No:27 (serotpye E), SEQ ID No:29 (serotype F), and SEQ ID No:31 (serotype G).
  • nucleic acid nucleic acid encodes an HN amino acid sequence of BoNT selected from SEQ ID No:22 (serotype B), SEQ ID No:24 (serotype CI), SEQ ID No:26 (serotype D), SEQ ID No:28 (serotpye E), SEQ ID No:30 (serotype F), and SEQ ID No:32 (serotype G).
  • the nucleic acid of this invention is a synthetic nucleic acid.
  • the sequence of the nucleic acid is designed by selecting at least a portion of the codons encoding HC from codons preferred for expression in a host organism, which may be selected from gram negative bacteria, yeast, and mammalian cell lines; preferably, the host organism is Escherichia coli or Pichia pastoris.
  • the nucleic acid sequence encoding HC is designed by selecting codons encoding HC which codons provide HC sequence enriched in guanosine and cytosine residues.
  • nucleic acid encoding HC or HN is expressed in a recombinant host organism with higher yield than a second nucleic acid fragment encoding the same HC sequence, said second nucleic acid fragment having the wild-type Clostridum botulinum sequence of HC.
  • this invention provides anexpression vector comprising the nucleic acid of this invention, whereby HC and/or HN is expressed upon transfection of a host organism with the expression vector.
  • Another embodiment of this invention provides a method of preparing a polypeptide comprising the carboxy-terminal portion of the heavy chain (HC) of botulinum neurotoxin (BoNT) or the amino-terminal portion of the heavy chain (HN) of botulinum neurotoxin (BoNT) selected from the group consisting of BoNT serotype A, BoNT serotype B, BoNT serotype C, BoNT serotype D, BoNT serotype E, BoNT serotype F, and BoNT serotype G, said method comprising culturing a recombinant host organism transfected with the expression vector of of this invention under conditions wherein HC or HN is expressed.
  • the recombinant host organism is a eukaryote.
  • the method of this invention further comprises recovering insoluble protein from the host organism, whereby a fraction enriched in HC or HN is obtained.
  • the host organism is Pichia pastoris.
  • this invention provides an immunogenic composition
  • an immunogenic composition comprising the carboxy-terminal portion of the heavy chain (HC) of botulinum neurotoxin (BoNT) selected from the group consisting of BoNT serotype A, BoNT serotype B, BoNT serotype C, BoNT serotype D, BoNT serotype E, BoNT serotype F, and BoNT serotype G.
  • the immunogenic composition is prepared by culturing a recombinant organism transfected with an expression vector encoding HC. More preferably, the immunogenic composition is prepared by a method wherein an insoluble protein fraction enriched in HC is recovered from said recombinant organism.
  • this invention provides an immunogenic composition comprising the amino-terminal portion of the heavy chain (HN) of botulinum neurotoxin (BoNT) selected from the group consisting of BoNT serotype A, BoNT serotype B, BoNT serotype C, BoNT serotype D, BoNT serotype E, BoNT serotype F, and BoNT serotype G.
  • the immunogenic composition comprising HN is prepared by culturing a recombinant organism transfected with an expression vector encoding HN. More preferably, the immunogenic composition is prepared from an insoluble protein fraction enriched in HN which is recovered from the recombinant organism.
  • this invention provides an immunogenic composition
  • a polypeptide comprising epitopes contained in the carboxy-terminal portion of the heavy chain (HC) of botulinum neurotoxin (BoNT) and/or the amino-terminal portion of the heavy chain (HN) of botulinum neurotoxin (BoNT) selected from the group consisting of BoNT serotype A, BoNT serotype B, BoNT serotype C, BoNT serotype D, BoNT serotype E, BoNT serotype F, and/or BoNT serotype G, said epitopes eliciting protective immunity toward the respective BoNT serotype.
  • the immunogenic composition elicits an ELISA response to the respective BoNT serotype(s) in an animal which is detectable in serum from the animal even when the serum is diluted 100-fold.
  • Figure 1 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype A and the encoded amino acids sequence.
  • Figure 2 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype A and the encoded amino acids sequence.
  • Figure 3 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype A and the encoded amino acids sequence.
  • Figure 4 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype B and the encoded amino acids sequence.
  • Figure 5 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype C and the encoded amino acids sequence.
  • Figure 6 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype D and the encoded amino acids sequence.
  • Figure 7 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype E and the encoded amino acids sequence.
  • Figure 8 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype E and the encoded amino acids sequence.
  • Figure 9 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype F and the encoded amino acids sequence.
  • Figure 10 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype G and the encoded amino acids sequence.
  • Figure 11 shows the sequence for a synthetic gene encoding the H N fragment of BoNT serotype A and the encoded amino acids sequence.
  • Figure 12 shows the sequence for a synthetic gene encoding the H N fragment of BoNT serotype B and the encoded amino acids sequence.
  • Figure 13 shows the sequence for a synthetic gene encoding the H N fragment of BoNT serotype C and the encoded amino acids sequence.
  • Figure 14 shows the sequence for a synthetic gene encoding the H N fragment of BoNT serotype D and the encoded amino acids sequence.
  • Figure 15 shows the sequence for a synthetic gene encoding the H N fragment of BoNT serotype E and the encoded amino acids sequence.
  • Figure 16 shows the sequence for a synthetic gene encoding the H N fragment of BoNT serotype F and the encoded amino acids sequence.
  • Figure 17 shows the sequence for a synthetic gene encoding the H N fragment of BoNT serotype G and the encoded amino acids sequence.
  • Figure 18 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype F and the encoded amino acids sequence.
  • Figure 19 shows (A) AT base content of a putative fragment C region in native C. botulinum DNA. (B) Reduction at AT content after the first design (rBoNTF(Hc)l) of the synthetic gene. (C) AT content of the final gene design (rBoNTF(Hc)2) used to express recombinant rBoNTF(Hc) in P. pastoris.
  • Figure 20 shows (A) SDS-PAGE and (B) Western blot of samples at various steps along the rBoNTF(Hc) purification. Lanes from both figures are identical except lane 1, where SDS-PAGE shows No vex mark 12 wide-range molecular weight markers and Western blot shows Novex See Blue prestained molecular weight markers. Lane 2 is the cell lysate, lane 3 is the cell extract, lane 4 is the cell extract after dialysis, lane 5 is pool of rBoNTF(Hc) positive fractions after Mono S column chromatography, and lane 6 is pool of rBoNTF(Hc)-positive fractions after hydrophobic interaction chromatography. Figure 21 shows purification of rBoNTF(Hc) by sequential chromatography.
  • Figure 22 shows CD spectra of purified soluble ( — ) and resolubilized (-) rBoNTF(Hc) at 30 ⁇ g/ml (0.62 ⁇ M) in 10 M sodium phosphate, pH 7.0 in a 1-cm path length cell. Spectra were the average of four accumulations, scanned from 260 to 200 nm at a scan rate of 10 nm/min with a 2-s response and a 1-nm bandwidth. The temperature was maintained at 20°C using a Peltier thermocontrol device.
  • the present inventors have determined that animals, including primates, may be protected from the effects of botulinum neurotoxin (BoNT) by immunization with fragments of the botulinum neurotoxin protein expressed by recombinant organisms.
  • BoNT botulinum neurotoxin
  • peptides comprising protective epitopes from the receptor binding domain and/or the translocation domain, found in the carboxy terminal and the amino terminal portions of the heavy chain of the BoNT protein, respectively, are expressed by recombinant organisms transfected with expression vectors encoding the peptides for each serotype of BoNT. Immunization with these recombinantly produced peptides will elicit antibodies capable of protecting animals against intoxication with the BoNT of the respective serotype.
  • This invention provides a genetically engineered vaccine for protection against botulism.
  • the vaccine comprises fragments of the A and B toxins known as "C fragments" (He domain). It is now possible to produce the He fragments of the A and B toxins in E. coli using gene segment constructs of the HC fragment or an HC polypeptide fused to E. coli maltose binding protein. It has been found that the fusion product provides excellent protection against the native toxin challenge.
  • the invention provides plasmids and recombinant proteins for use as vaccines to provide protection against toxins of Clostridium botulinum.
  • codons found in clostridial DNA are very unique both in terms of base composition (i.e., very high A+T base composition) and in the use of codons not normally found in E. coli or yeast.
  • Table 1 is a chart depicting codon usage in Pichia pastoris. This table was generated by listing the codons found in a number of highly expressed genes in P. pastoris. The codon data was obtained by sequencing the genes and then listing which codons were found in the genes.
  • the amino acid residues can be encoded for by multiple codons.
  • synthetic genes using P. pastoris codon usage it is preferred to use only those codons that are found in the naturally occurring genes in P. pastoris, and it should be attempted to keep them in the same ratio found in the genes of the natural organism.
  • the clostridial gene has an overall A+T richness of greater than 70% and A+T regions that have spikes of A+T of 95% or higher, they have to be lowered for expression in expression systems like yeast. (Preferably, the overall A+T richness is lowered below 60% and A+T in spikes is also lowered to 60% or below).
  • the amino acid sequence encoded by such synthetic genes will preferably be the sequence of one of the BoNT serotype proteins, or a fragment thereof which contains protective epitopes. Suitable fragments include the He fragments of BoNT serotypes A, B Ci, D, E, F, and G, and the H N fragments of BoNT serotypes A, B, Ci, D, E, F, and G. Such alternative gene sequences are within the contemplation of this invention.
  • proteins containing protective epitopes from both the N-terminal and the C-terminal domains of the respective serotype BoNT proteins may be prepared by fusing a sequence encoding the translocation domain (HN) to the sequence of the HC region. This may be accomplished by removing the restriction enzyme site of the 3' end of the translocation domain gene as well as the termination codon, and also removing the initiation codon, restriction enzyme site and any other nucleotides on the 5' end of the gene that are not part of the botulinum toxin gene. Then a common restriction enzyme site not found in either synthetic gene may be inserted on the 3' end of the H gene and the 5' end of the He gene, and this common restriction site may be used to fuse the two genes together.
  • HN translocation domain
  • the nontoxin fragment is very safe, will not require formalin treatment, and has been shown to produce significant immunity against the fully toxic parent molecule.
  • the recombinantly-produced botulinum neurotoxin (rBoNT) protein fragments are completely nontoxic and, is thus, very safe.
  • the fermentation of the host cell harboring the rBoNT gene e.g., Escherichia coli or Pichia pastoris
  • the synthetic gene can be placed in high expression systems and used to make much larger quantities of the fragment than toxin produced by the parent organism, Clostridium botulinum.
  • Clostridium botulinum the parent organism
  • Synthetic genes as described herein may be transfected into suitable host organisms to create recombinant production organisms, and cultures of these recombinant organisms can then be used to produce immunogenic peptide fragments capable of conferring protective immunity against BoNT of the respective serotypes. Exemplary techniques for transfection and production of BoNT fragments are shown in the Examples. Alternative techniques are well documented in the literature (See, e.g., Maniatis, Fritsch & Sambrook, "Molecular Cloning: A Laboratory Manual” (1982); “DNA Cloning: A Practical Approach,” Volumes I and II (D.N. Glover, ed., 1985); “Oligonucleotide Synthesis” (M.J.
  • the synthetic gene for BoNT serotype B fragment He has been inserted into the yeast expression vector pHIL-D4, and integrated into the chromosome of Pichia pastoris strain GS115.
  • the expressed product (see amino acid sequence in Figure 4B) had the expected molecular weight as shown by denaturing polyacrylamide gel electrophoresis (PAGE) and Western blot analysis using antibodies directed against botulinum neurotoxin serotype B.
  • the synthetic gene for BoNT serotype C fragment H c has been inserted into the yeast expression vector pHIL-D4, and integrated into the chromosome of Pichia pastoris strain GS115.
  • the expressed product (see amino acid sequence in Figure 5B) had the expected molecular weight as shown by denaturing polyacrylamide gel electrophoresis (PAGE) and Western blot analysis using antibodies directed against botulinum neurotoxin serotype C.
  • the expressed recombinant BoNTC (He) elicited high antibody titers as judged by the Enzyme Linked Immunosorbent Assay (ELISA) and, more importantly, these circulating serum titers protected mice from challenges with active toxin.
  • the synthetic gene for BoNT serotype D fragment He has been inserted into the yeast expression vector pHIL-D4, and integrated into the chromosome of Pichia pastoris strain GS115.
  • the expressed product (see amino acid sequence in Figure 6B) had the expected molecular weight as shown by denaturing polyacrylamide gel electrophoresis (PAGE) and Western blot analysis using antibodies directed against botulinum neurotoxin serotype D.
  • PAGE denaturing polyacrylamide gel electrophoresis
  • ELISA Enzyme Linked Immunosorbent Assay
  • the synthetic gene for BoNT serotype E fragment He has been inserted into the yeast expression vectors pHILD2, pHILD3, and pPIC9K (see Figures 7B).
  • a modified form of the synthetic gene in which an internal EcoRI site was removed and the gene was enlarged was inserted into the yeast vector pHJL-D4, and integrated into the chromosome of Pichia pastoris strain GS115.
  • the expressed product (see amino acid sequence in Figure 8) had the expected molecular weight as shown by denaturing polyacrylamide gel electrophoresis (PAGE) and Western blot analysis using antibodies directed against botulinum neurotoxin serotype E.
  • BoNT serotype F fragment H c (see Figure 9A) has been inserted into the yeast expression vector pHIL-D4, and integrated into the chromosome of Pichia pastoris strain GS115.
  • the initial step in the development of the rBoNTF(Hc) vaccine candidate was to design a gene which could satisfactorily be expressed in a pichia host.
  • a synthetic gene encoding rBoNTF(H ) was constructed to lower the inherent AT richness of the native clostridial gene and to remove any potentially rare codons.
  • Clostridial genes having an AT content in excess of 65% or having an average AT content but containing AT-rich tracts usually contain multiple terminators/polyadenylation signals, which can result in premature termination of transcripts when expression is attempted in yeast (Romanos, M.A., et al., (1995), "Expression of Cloned Genes in Yeast," DNA Cloning 2: Expression Systems,” (Glover D., et al., Eds.), Oxford Univ. Press, London).
  • the synthetic gene in this study required two successive rounds of alterations before the yeast could properly produce full-length antigen.
  • the expressed product (see amino acid sequence in Figure 9B) had the expected molecular weight as shown by denaturing polyacrylamide gel electrophoresis (PAGE) and Western blot analysis using antibodies directed against botulinum neurotoxin serotype F.
  • the synthetic gene for BoNT serotype G fragment He has been inserted into the yeast expression vector pHJX,-D4, and integrated into the chromosome of Pichia pastoris strain GS115.
  • the expressed product (see amino acid sequence in Figure 10B) had the expected molecular weight as shown by denaturing polyacrylamide gel electrophoresis (PAGE) and Western blot analysis using antibodies directed against botulinum neurotoxin serotype G.
  • the expressed recombinant BoNTG (He) elicited high antibody titers as judged by the Enzyme Linked Immunosorbent Assay (ELISA) and, more importantly, these circulating serum titers protected mice from challenges with active toxin.
  • ELISA Enzyme Linked Immunosorbent Assay
  • CHAPS zwiterionic detergent
  • the subsequent task is to separate that antigen from the myriad of pichia host proteins, lipids, and other impurities that exist in the extracted medium.
  • the chemical separations it is critical that polynucleic acids be efficiently removed. Nucleotides will either bind to the C-fragment (serotypes A, E, and F due to their elevated pis) or will bind to the anion-exchange chromatography resin (as is used in the first purification step of the C ⁇ process). With either case, the chromatography is rendered futile.
  • the C-fragment product will either fail to bind to the chromatography media or it will elute over an unacceptably large sodium chloride concentration range.
  • Pichia cells possess an abundant amount of DNA.
  • Polyethyleneimine (PEI) is a polycationic agent that readily precipitates nucleotides. When pichia cell extracts are treated with PEI, the nucleic acids are efficiently precipitated and removed by centrifugation without significant loss of product. More importantly, the chromatographic separation of C-fragments from pichia proteins are dramatically improved.
  • the soluble portion of the cell lysate may typically be purified in two conventional chromatographic steps.
  • the ultimate objective of this work is to obtain FDA licensure of rBoNT as a safe and effective vaccine.
  • a preferred separation employs a cation-exchange step followed by hydrophobic interaction chromatography (HIC). These two steps complement each other as they provide separations based on electrostatic and hydrophobic interactions.
  • the cation- exchange step was particularly efficient in increasing the purity of rBoNTF(Hc), as the antigen was estimated to be purified greater than 52-fold.
  • Precipitate that results when the cation-exchange pool is treated with ammonium sulfate contains mostly pichia proteins and very little rBoNT product.
  • the HIC step removes most or all of the remaining impurities.
  • the yield of soluble rBoNTF(Hc) from the total recombinant yeast cell lysate was estimated to be greater than 28% with a purity greater than 98%.
  • Use of similar purification steps for rBoNTA(H c ) produced greater than 95% pure material.
  • rBoNTF(Hc) product (30-40%) was identified in the insoluble portion of the cell lysate. Also, the antigen was 35% of the total protein present in the pellet; in effect it was more pure than the soluble rBoNTF(Hc) was after the ion-exchange step. This suggests an alternative process whereby insoluble rBoNT product produced in yeast may be resolubilized and purified to homogeneity. The resolubilization may be performed by resuspending the pellet in urea and subsequently removing the urea by dialyses in nondenaturing buffer.
  • a single chromatographic step using cation-exchange chemistry may be sufficient to purify the resolubilized antigen, in some cases to greater than 98%.
  • the yield of resolubilized rBoNTF(Hc) product from the total cell lysate was estimated to be >19%.
  • the overall bench scale yield of purified soluble and resolubilized rBoNTF(Hc) was estimated to be greater than 47% or 240 mg/Kg of the cell paste.
  • a similar procedure would be suitable for purification of rBoNTA(H ) and other rBoNT fragment peptides from yeast.
  • mice were inoculated with rBoNTF(Hc) and subsequently challenged with a high level of rBoNTF toxin
  • the purified soluble rBoNTF(Hc) completely protected mice receiving three inoculations of 0.2 ⁇ g from challenge with 1000 mouse i.p.
  • the ELISA is performed by coating a microtiter plate with toxin or fragment C itself, then sera from the vaccinated mice is added at various dilutions (i.e., sera diluted 1/100, 1/400, 1/1600, 1/6400, etc.). Since fragment C is sufficient to elicit protection in animals, preferably assays for neutralizing antibody titer in sera from animals vacinated with fragment C are performed using microtiter plates coated with fragment C. Antibody in the sera will bind to the toxin or the fragment C, and the bound antibody may be detected by a secondary antibody (e.g., anti-mouse IgG) that is coupled to horse-radish peroxidase or alkaline phosphatase.
  • a secondary antibody e.g., anti-mouse IgG
  • the secondary IgG will bind to the anti-BoNT antibody that was raised to the fragment C vaccine.
  • a substrate for the peroxidase or phosphatase enzymes is added to the wells.
  • the substrate will give off a color once the enzyme has cleaved the substrate, and the intensity of the color measured (e.g., at 405 nm. Typically, a reading of 0.2 is used as the base.
  • a susceptible host may be immunized using the appropriate peptide vaccine formulated in adjuvant to increase the immune response.
  • adjuvants include but are not limited to Freund's (complete and incomplete), mineral gels, such as aluminum hydroxide, surface active substances such as keyhole limpet hemocyanin, lysolecithin, pluronic polyols, polyanions, peptides, BCG (Bacille Calmette-Guerin), oil emulsions and dinotrophenols. Immunization can be carried out with additional various presentation and cross-linking permutations.
  • such permutations include rBoNT peptides cross-linked to KLH as a carrier, any rBoNT peptide cross-linked to any other rBoNT protein as carrier, rBoNT peptides cross-linked to themselves, and these combinations presented by the various adjuvants listed above. It will become evident that such permutations are available in regard to other peptides and self-assembled peptides disclosed throughout this specification. It will also be known to one of ordinary skill in the art that use of the term
  • susceptible host includes any such mammalian host susceptible to intoxication by BoNT. It will be further evident that any such susceptible host is a candidate for treatment to promote protection from BoNT utilizing the peptide vaccines and associated methods desc ⁇ bed in this specification.
  • a synthetic gene encoding a putative fragment C region of botulinum neurotoxin serotype F was designed and constructed for expression in Escherichia coli (Holley et al, submitted to Vaccine)
  • the recombinant BoNTF(H c ,) ⁇ , gene was expressed in E. coli as a fusion protein with maltose-bmdmg protein (MBP) with yields of 1 mg/L culture (See Figure 18)
  • rBoNTF(Hc) 2 A second synthetic gene, rBoNTF(Hc) 2 , was subsequently designed to facilitate expression in P. pastoris. Redesigning the gene was intended to lower specific regions of the rBoNTF(Hc) ⁇ gene in which spikes of AT-rich tracts still remained. Previous work had shown that rare codons (Makoff, A.J., et al., (1989), "Expression of Tetanus Toxin Fragment C in E.
  • Transformants expressing selectable markers were isolated and tested for their ability to express rBoNTF(H c ). Unlike the rBoNTF(H c ) ⁇ gene, rBoNTF(Hc) 2 was expressed after induction with methanol and yielded the expected molecular weight of approximately 50000 daltons as judged by SDS/PAG ⁇ and Western blot analysis ( Figure 20). The deduced molecular mass of the encoded polypeptide was 50,250 daltons.
  • a stock seed culture of P pastoris was grown in shake-flasks containing 0.5 L of YNB medium (13.4 g/L yeast nitrogen base without amino acids, 20 g/L glycerol, 0.4 mg/L biotin, in 100 mM sodium phosphate, pH 6.0) Cultures were grown at 30°C until an A 600 of 20 absorbance units was achieved, and then used to inoculate a 5-L BioFlo 3000 fermentor (New Brunswick Scientific, Edison, NJ, U.S.A.) containing 2.5 L basal-salt medium plus PTM 4 trace mineral salts and 4% glycerol Dissolved oxygen was maintained at 40% and the pH was maintained at 5.0 with 30% ammonium hydroxide After the initial glycerol was consumed, 50% (w/v) glycerol was added at a rate of 20 g/L/h for 1 h then decreased linearly to 0 g/L/h over 3 h The medium was enriched with 1.5 g methanol/L of medium M
  • YNB medium (13.4 g/L yeast nitrogen base without amino acids, 20 g/L glycerol, 0.4 mg/L biotin, in 100 mM sodium phosphate, pH 6.0) Cultures were grown at 30°C until an A 6 oo of 20 absorbance units was achieved, and then used to inoculate a 5-L BioFlo 3000 fermentor (New Brunswick Scientific, Edison, NJ, U.S.A.) containing 2.5 L basal-salt medium plus PTM t trace mineral salts and 4% glycerol .
  • Dissolved oxygen was maintained at 40% and the pH was maintained at 5.0 with 30% ammonium hydroxide After the initial glycerol was consumed, 50% (w/v) glycerol was added at a rate of 20 g/L/h for 1 h then decreased linearly to 0 g/IJh over 3 h .
  • the medium was enriched with 1.5 g methanol/L of medium Methanol feed was started at 4 g/IJh and linearly increased to 9 g/IJh over 10 h
  • the methanol feed rate was adjusted by using the dissolved oxygen-spike method (Chiruvolu, 1997) After 10 h of methanol induction, the cells were harvested by centrifugation at 6000 x g for 10 min at 4 ° C with a Beckman JA-10 rotor (Beckman Instruments, Palo Alto, CA, U.S.A.) and then stored at -20°C. Cell disruption and sample preparation
  • the resulting extract was noticeably turbid due to the presence of lipids and significant quantities of nucleic acids As rBoNTF(Hc) possessed a calculated isoelectric point of 9.1 and presumably interacted strongly with DNA, DNase was added to the cell extract in order to digest the polynucleotides and facilitate purification.
  • the extract was treated with DNase (100 units/ml, Aldrich) and ZnCl 2 (2 mM, Aldrich) at room temperature for 30 min and then dialyzed extensively with 10 kDa molecular weight cut off (MWCO) Slide-A-Lyzer dialysis cassettes (Pierce) in 50 mM Na 2 HPO 4 /2 mM Na 2 EDTA/l mM PMSF, pH 6.8 at 4°C A precipitate developed during dialysis that was separated by centrifugation at 15000 g for 15 min at 4°C with a Sorval SS-34 rotor The clarified extract contained 7.8 mg/ml of total protein and was used as starting material for the FPLC purification of soluble rBoNTF(Hc) while the pellet was used as starting material for the resolubilized rBoNTF(Hc) purification.
  • Example 4 Conventional Purification of rBoNTF(Hc) from P.
  • the rBoNTF(Hc) protein was pu ⁇ fied to homogeneity using an FPLC system and two chromatographic steps. First, the mate ⁇ al was subjected to cation exchange chromatography ( Figure 21 A) FPLC purification of soluble rBoNTF(H c )
  • Soluble rBoNTF(Hc) was pu ⁇ fied by using a Pharmacia model 500 FPLC system (Pharmacia, Uppsala, Sweden) with programmed elution and A 280 monito ⁇ ng
  • the starting mate ⁇ al was loaded onto a Pharmacia HR 10/10 Mono S cation-exchange column equilibrated with 50 mM Na 2 HP0J2 mM Na EDTA/l mM PMSF, pH 6.8 (buffer A) at a flow rate of 2 ml/min (150 cm h)
  • the column was washed with 16 ml (2 bed volumes) of buffer A Flow through and wash were collected separately and stored for subsequent analysis
  • Protein was eluted from the column with a linear gradient from 0 to 300 mM NaCl over 80 ml (10 bed volumes), then a linear gradient from 300 to 1000 mM NaCl over 20 ml (2.5 bed volumes), and then an isocratic gradient at 1000 mM over 10
  • HIC was used as a second chromatographic step ( Figure 21B) and separated proteins based on their differences in surface hydrophobicity. It was determined that neopentyl chemistry provided the approp ⁇ ate hydrophobic interaction with rBoNTF(Hc). The supernatant was loaded onto a Pharmacia alkyl superose 10/10 hydrophobic interaction chromatography (HIC) column equilibrated with 1.5 M (NH ) 2 SO 4 /50 mM Na 2 HPOJ2 mM Na 2 EDTA/25 mM NaCl, pH 7.5 (buffer B) at a flow rate of 1 ml/min (75 cm/h).
  • HIC Pharmacia alkyl superose 10/10 hydrophobic interaction chromatography
  • Total protein concentration was determined by Pierce BCA , T"M V1 assay rBoNTF(H c ) was identified by Western blot analysis and purity was estimated by analysis of individual lanes of SDS/PAGE by pixel densitometry using NIH imaging software.
  • CD of purified soluble and resolubilized rBoNTF(Hc) Purified soluble and resolubilized rBoNTF(Hc) were subjected to CD spectroscopy in a Jasco 600 spectropolarimeter (Japan Spectroscopy company, Tokyo, Japan) Experiments were performed at a concentration of 30 ⁇ g/ml (0.62 ⁇ M) in a 1 cm path length cell in 10 mM Na 2 HPO , pH 7.0 Spectra were obtained as an average of four accumulations, scanned from 260-200 nm, at a scan rate of 10 nm/min, with a 2 sec response, and a 1 nm band width The temperature was maintained at 20°C with a Peltier thermocontrol device.
  • the cell lysate pellet was resuspended into 20 ml of 3 M urea/50 mM Na 2 HPO 4 , pH 7.0 and extracted 15 h at 4°C on a Labquake rotator .
  • the cellular components not solubilized by the denaturing buffer were removed by centrifugation with a Sorval SS-34 rotor at 15000 g for 10 min at 4°C
  • the supernatant was dialyzed extensively using 10 kDa MWCO Pierce Slide-A-Lyzer dialysis cassettes in buffer A .
  • a slight precipitate formed during the dialysis which was removed by centrifugation as described above Western blot analysis showed that rBoNTF(H c ) was present only in the supernatant, which was estimated to be about 35% pure by
  • the rBoNTF(Hc) was greater than 98% pure as judged by SDS-PAGE.
  • the total yield of purified resolubilized rBoNTF(Hc) was 100 mg/kg of cell paste.
  • the conformation of purified resolubilized antigen showed significant ⁇ -sheet as determined by CD spectral analysis ( Figure 22). However, the overall fold appeared slightly different than that shown by rBoNTF(Hc) purified from the cell lysate supernatant. The primary difference was the lack of a positive peak at 233 nm, indicating differences in ⁇ -sheet. content.
  • mice were inoculated with either one, two, or three doses of purified rBoNTF(H ) from the soluble fraction of lysate at doses ranging from 0.008 to 5 ⁇ g per mouse.
  • mice Crl:CD-l, ICR mice (Charles River, NC, U.S.A.) weighing 16-22 g on receipt, were injected intramuscularly (i.m.) with purified rBoNTF(H c ) Mice were challenged intraperitoneally (i.p.) 21 days after their last rBoNTF(Hc) injection with BoNTF toxin complex (Langeland strain) diluted in .0.2% (w/v) gelatin/0.4% (w/v) Na 2 HPO 4 , pH 6.2, in 100 ⁇ l total volume per mouse. Groups of five naive mice were also used as toxin controls Mice were observed daily and deaths were recorded five days post challenge . All animal manipulations were in accordance with applicable regulations in AAALAC-accredited facilities.
  • the efficacy of the purified soluble rBoNTF(H c ) was determined by inoculating groups of five female mice with one, two, or three doses of 0.008, 0.04, 0.2, 1.0, or 5.0 ⁇ g rBoNTF(H c ) (diluted in 100 ⁇ l of 0.2% (v/v) Alhydrogel (Superfos Biosector, Kvistgaard, Denmark) in 0.9% (w/v) saline) per mouse at 14 day intervals . Two days before challenge, mice were bled retroorbitally and serum was collected for ELISA testing Mice were challenged with 1000 mouse i.p LD 5 o of BoNTF toxin complex.
  • mice All of the mice, including five na ⁇ ve controls, were challenged with 1000 mouse ip LD 50 of BoNTF toxin. The controls all died within 2-4 h. A dose response was observed from groups of mice receiving different numbers of inoculations (Table 3). A single inoculation of 5 ⁇ g protected four of five mice, while a dose of 0.2 ⁇ g or below protected one or no mice. Two and three inoculations protected four of five and five of five mice at doses of 0.2 and 0.04 ⁇ g, respectively. At all dose levels studied, the number of surviving mice increases with the number of inoculations. Serum antibody titers for each individual mouse were determined by ELISA, followed by calculation of the geometric mean titers for each group in the study.
  • Botulinum neurotoxin serotype F (Langeland strain, Food Research Institute, University of Wisconsin, Madison, Wl, U.S.A.) was used as the coating antigen and the positive control for each assay was a mouse IgG monoclonal antibody, 7F8.G2.H3 (Brown, D.R., et al., (1997), "Identification and Characterization of a Neutralizing Monoclonal Antibody against Botulinum Neurotoxin, Serotype F, Following Vaccination with Active Toxin," Hybridoma, 16:447-456).
  • the logistic regression model was used to test associations of geometric mean ELISA titers and individual titers with survival by using SAS, version 6.10. Geometric mean titers correlated well with protection (Table 3). The three groups with no survivors had geometric means titers below the detection limit of the assay (1.4). Similarly, the four groups that showed complete protection had geometric means titers of 2.8 or greater. Individual mouse antibody titers correlated extremely well with protection (Table 4). Only 7 out of 38 mice survived whose titers were below 100. On the other hand, 34 out of 34 survived whose titers were 100 or greater.
  • mice in the study could be classified as a "nonresponder.”
  • the mouse, receiving two injections at the highest dose level had an antibody titer below the detection limit and did not survive the BoNTF challenge.
  • the rest of the mice in that particular group had titers of 1600 or greater.
  • Serum was bled from each mouse individually Titer is reciprocal of the highest dilution having an OD 05 greater than 0.2 AU after correcting for background .
  • Mice were challenged with 1000 i.p LDso BoNTF toxin 21 days after last inoculation.
  • mice were not measured . Two mice did not offer enough serum and one mouse was not challenged.
  • the resolubilized antigen was also evaluated for immunogencity and protective efficacy by its ability to protect mice from a BoNTF toxin challenge.
  • Groups of 10 male mice each received three inoculations of either 1 ⁇ g or 5 ⁇ g of rBoNTF(Hc) (diluted in 100 ⁇ l 0.2% (v/v) Alhydrogel in 0.9% (w/v) saline) per mouse at 14 day intervals . Two days before challenge, mice were bled retroorbitally and serum was collected for ELISA testing.
  • mice inoculated with 1 ⁇ g doses were challenged with 5000 mouse ip LD 50 of BoNTF toxin. Ten of ten mice survived the challenge. Because 100% protection was observed with the group inoculated with 1 ⁇ g doses, the group that received three doses of 5 ⁇ g were subjected to a challenged level two orders of magnitude greater in order to test the limits of the antigen. Therefore, the 5 ⁇ g dose group was challenged with 500,000 mouse ip LD 5 o of BoNTF toxin. None of the mice survived the challenge; however, a significant delay in time to death was observed (24-48 h). All the control mice succumbed within 2-4 h after challenge.
  • GIBCO BRL Restriction endonucleases and DNA modifying enzymes were obtained from GIBCO BRL (Gaithersburg, Maryland).
  • Polymerase chain reaction (PCR) reagents were purchased from Perkin-Elmer Cetus (Norwalk, CT). SDS PAGE precast gels and running buffers were acquired from Amersham (Arlington Heights, Illinois). All oligonucleotides were synthesized by Macromolectular Resources (Ft. Collins, Colorado).
  • ELISA reagents were obtained in house or from Sigma (St. Louis, Missouri) or Kirkegard and Perry Laboratories (Gaithersburg, Maryland). The Escherichia coli host was K12DH5a, purchased as competent cells from GIBCO BRL.
  • Oligonucleotide primers incorporating appropriate terminal restriction enzyme sites were used to PCR amplify the He region of the C. botulinum clone pCBA3.
  • Gel-purified insert DNA and vector DNA were cleaved with the appropriate restriction enzymes, purified on low melting point agarose, and ligated overnight at room temperature.
  • Competent DH5a host cells were transformed according to suppliers recommendations and plated on LB plates with 100 ug/ml ampicillin. Protein electrophoresis was run on precast 11-20% SDS PAGE at the manufacturer's recommended parameters.
  • ELISA plates were incubated with capture antibody (horse an ti -botulinum A polyclonal serum) overnight, then blocked with skim milk prior to application of various dilutions of test material, signal antibody (rabbit antibotulinum A polyclonal serum), signal HRP conjugated anti-(rabbit IgG) and ABTS substrate solution. Plates were read on an automated reader at 405 nm.
  • the C fragment protein sequence was reverse translated using E. coli optimal codon usage. The gene was then altered in many places to insert restriction sites, start codon, stop codon. Other changes were also effected to make the molecule more appropriate for use in the vector. Throughout, the fidelity of the protein sequence generated therefrom was maintained.
  • This gene has been synthesized using a large number of oligomers of approximately 60-65 bases corresponding to the sequences of the + and - strands.
  • the oligomers had overlaps of 7 bases.
  • the oligomers were allowed to anneal and were ligated to form 5 subunits of 250-300 base pairs each. Each subunit had been designed to have restriction sites at their termini which allowed them to be assembled in the right order to form the complete gene. On confirmation there was shown that the correct gene had 7 deletion errors. These errors were repaired using in vitro mutagenesis and the repair sites sequenced to confirm.
  • the C fragment for botulism toxin serotype B of Whelan was studied and the portion of the protein having the sequence
  • the synthetic gene for expression in E. coli was produced in the manner described for synthesis of the gene for the C fragment of the A strand, namely, using a large number of oligomers of approximately 60-65 bases corresponding to the sequences of the _+ and - strands with overlaps of 7 bases.
  • the oligomers were allowed to anneal and were ligated to form subunits of 250-300 base pairs each. Each subunit had been designed to have restriction sites at their termini which allowed them to be assembled in the right order to form the complete gene, the synthetic gene for encoding the c fragment of the B toxin was as follows:
  • BoNTA(Hc) peptide was produced recombinantly in yeast.
  • the first step in the purification process for BoNTA(Hc) was a Streamline expanded bed chromatography column.
  • the product was eluted by a sodium chloride step gradient.
  • Product eluted from the expanded bed chromatography column was estimated to be 10% pure with a total protein concentration of 0.92 mg/ml.
  • After dialyzing the salt away, the material was loaded onto a mono S cation exchange column for further purification.
  • Western blot and ELISA data indicated that BoNTA(H c ) eluted from the column at 110 mM sodium chloride.
  • the Mono S pool was subjected to HIC as a final purification step and thus, the material was adjusted to 1.5 M ammonium sulfate.
  • the Mono S product was loaded onto a HIC column and eluted with a gradient of decreasing ammonium sulfate.
  • Product eluted at 1.04 M ammonium sulfate and BoNTA(Hc) immunologically positive fractions were combined and dialyzed to remove ammonium sulfate. Only a 50 kDa BoNTA(Hc) band was detected by SDS-PAGE and Western blot analysis and was judged to be greater than 95% pure after the final step.
  • Example 11 rBoNTB(Hc) purification and protective effect Recombinant BoNTC(Hc) peptide was produced recombinantly in yeast.
  • the first separation technique employed for the purification process for BoNTB(Hc) was Streamline chromatography (Pharmacia), which is a single pass expanded bed adsorption operation where proteins can be recovered from crude feed stock or cell lysate without prior clarification. Significant clean-up was accomplished in this step as the MES buffer system prohibited binding of a large percentage of unwanted proteins to the SP resin.
  • Protein was loaded onto the column at a concentration of 123 mg/mL-resin, using 20 mM MES buffer, pH 5.7 with 10 mM NaCl. The product pool was eluted in a single step. Under the conditions investigated, on average 3.9% of the total protein loaded was recovered in the elution peak, and the product pool was approximately 70% BoNTB(Hc) fragment based on SDS-PAGE.
  • the second chromatography step in the process utilizes Poros HS, another strong cation exchange resin.
  • the buffer system was similar to that used for Streamline SP, however enhanced selectivity of Poros HS enriched the product peak to about 85% purity.
  • the product peak eluted during the gradient at approximately 130 mM NaCl. Strongly bound proteins were eluted with 1 M NaCl.
  • the final chromatography step utilized a Poros PI column. Analysis of the PI fractions by SDS-PAGE and IEF revealed that the product band, a single band at 50 kD on SDS-PAGE, was present in the pH 8.0 fraction. Analysis of purified BoNTB(H c ) fragment by 2-D electrophoresis resulted in one major spot and two minor, faint spots from the Pi-peak 1 fraction. Peak 2 contained several spots at two different molecular weights corresponding to 50 kD and 47 kD. Presumably these spots represent different isoforms. IEF banding patterns detected in the first dimension are in agreement with those seen in Phast IEF for the two peaks. The protective efficacy of this material was determined by potency assay of 1 dose followed by challenge with 1000 LD50 of BoNTB(Hc). The results are shown in the following Table 7.
  • BoNTC(Hc) peptide was produced recombinantly in yeast.
  • the initial chromatography step used for the purification process for BoNTC ⁇ Hc) was a Mono Q anion-exchange column.
  • the column was equilibrated with 50 mM sodium phosphate, 0.2% (W/V) CHAPS, 2 mM EDTA, pH 7.0.
  • the CHAPS was incorporated into the column buffers to allow product to elute from the column over a narrower sodium chloride concentration.
  • Fractions positive for BoNTC ⁇ Hc) by Western analysis were pooled and adjusted to 1 M ammonium sulfate. A moderate precipitate formed which was removed by passing the material through a 0.2 ⁇ filtration unit.
  • the clarified Mono Q product pool was subjected to hydrophobic interaction chromatography using a Pharmacia alkyl superose column. This final step removed the remainder of the impurities liberating BoNTC ⁇ (Hc) product which was estimated to be greater than 98% pure as judged by SDS/PAGE. Protective effect of this purified material was measured by immunizing mice with 1 dose followed by challenge with 1000 LD50 of BoNTC ⁇ (H c ). The results are shown in Table 8 below.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Biomedical Technology (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

This invention is directed to preparation and expression of synthetic genes encoding polypeptides containing protective epitopes of botulinum neurotoxin (BoNT). The invention is also directed to production of immunogenic peptides encoded by the synthetic genes, as well as recovery and purification of the immunogenic peptides from recombinant organisms. The invention is also directed to methods of vaccination against botulism using the expressed peptides.

Description

Recombinant Vaccine Against Botulinum Neurotoxin
This application is based on U.S. Provisional Application Nos. 60/133,866, 60/133,868, 60/133,869, 60/133,865, 60/133,873, 60/133,867, all filed May 12, 1999, and U.S. Provisional Application No. 60/146,192, filed July 29, 1999, all of which are incorporated herein in their entirety. BACKGROUND OF THE INVENTION
Field of the Invention This invention is directed to preparation and expression of synthetic genes encoding polypeptides containing protective epitopes of botulinum neurotoxin (BoNT). The invention is also directed to methods of vaccination against botulism using the expressed peptides.
Related Art The sporulating, obligate anaerobic, gram-positive bacillus Clostridium produces eight forms of antigenically distinct exotoxins. Tetanus neurotoxin (TeNT) is produced by Clostridium tetani while Clostridium botulinum produces seven different neurotoxins which are differentiated serologically by specific neutralization. The botulinum neurotoxins (BoNT) have been designated as serotypes A, B, Ci, D, E, F, and G. Botulinum neurotoxins (BoNT) are the most toxic substances known and are the causative agents of the disease botulism. BoNT exert their action by inhibiting the release of the neurotransmitter acetylcholine at the neuromuscular junction (Habermann, E., et al., (1986), "Clostridial Neurotoxins: Handling and Action at the Cellular and Molecular Level," C r. Top. Microbiol. Immunol, 129:93-179; Schiavo, G., et al., (1992a), "Tetanus and Botulinum-B Neurotoxins Block Neurotransmitter Release by Proteolytic Cleavage of Synaptobrevin," Nature, 359:832-835; Simpson, L.L., (1986), "Molecular Pharmacology of Botulinum Toxin and Tetanus Toxin," Annu. Rev. Pharmacol. ToxicoL, 26:427-453) which leads to a state of flaccid paralysis. Indeed, only a few molecules of toxin can abolish the action of a nerve cell. Polyclonal antibodies derived for a specific neurotoxin can neutralize the toxic effects of that toxin but will not cross-neutralize another toxin serotype. Thus, to protect against all seven toxins, one needs seven vaccines. Botulinum neurotoxins are translated as a single 150 kDa polypeptide chain and then posttranslationally nicked, forming a dichain consisting of a 100 kDa heavy chain and a 50 kDa light chain which remain linked by a disulfide bond (DasGupta, B.R., et al., (1972), "A Common Subunit Structure in Clostridium botulinum Type A, B, and E Toxins," Biophys. Res. Commun., 48:108-112; DasGupta, B.R., (1989), "The Structure of Botulinum Neurotoxins," Botulinum Neurotoxin and Tetanus Toxin, (Simpson, L.L., Ed.), pp. 53-67, Academic Press, New York). Most of the clostridial strains contain specific endogenous proteases which activate the toxins at a protease-sensitive loop located approximately one third of the way into the molecule from the amino-terminal end. Upon reduction and fractionation (electrophoretically or chromatographically), the two chains can be separated; one chain has a Mr of -100 kDa and is referred to as the heavy chain while the other has a Mr -50 kDa and is termed the light chain.
The mechanism of nerve intoxication is accomplished through the interplay of three key events, each of which is performed by a separate portion of the neurotoxin protein First, the carboxy half of the heavy chain (fragment C or He is required for receptor specific binding to cholinergic nerve cells (Black, J.D., et al., (1986), "Interaction of 125I-botulinum Neurotoxins with Nerve Terminals. I. Ultrastructural Autoradiographic Localization and Quantitation of Distinct Membrane Acceptors for Types A and B on Motor Nerves," J. Cell BioL, 103:521- 534; Nishiki, T.-L, et al., (1994), "Identification of Protein Receptor for Clostridium botulinum Type B Neurotoxin in Rat Brain Synaptosomes," J. Biol. Chem., 269:10498-10503; Shone, C.C., et al., (1985), "Inactivation of Clostridium botulinum Type A Neurotoxin by Trypsin and Purification of Two Tryptic Fragments. Proteolytic Action Near the COOH-terminus of the Heavy Subunit Destroys Toxin-Binding Activity, Eur. J. Biochem., 151:75-82) There is evidence suggesting that polysialogangliosides (van Heyningen, W.E., (1968), "Tetanus," Sci. Am., 218:69-77) could act as receptors for the toxins but the data supporting a specific receptor remains equivocal (Middlebrook, J.L., (1989), "Cell Surface Receptors for Protein Toxins," Botulinum Neurotoxins and Tetanus Toxin, (Simpson, L.L., Ed.) pp. 95-119, Academic Press, New York) After binding, the toxin is internalized into an endosome through receptor-mediated endocyctosis (Shone, C.C., et al., (1987), "A 50-kDa Fragment from the NH2-terminus of the Heavy Subunit of Clostridium botulinum Type A Neurotoxin Forms Channels in Lipid Vesicles, Euro. J. Biochem., 167:175-180). The amino terminal half of the heavy chain is believed to participate in the translocation mechanism of the light chain across the endosomal membrane (Simpson, 1986; Poulain, B., et al., (1991), "Heterologous Combinations of Heavy and Light Chains from Botulinum Neurotoxin A and Tetanus Toxin Inhibit Neurotransmitter Release in Aplysia," J. Biol. Chem., 266:9580-9585; Montal, M.S., et al., (1992), "Identification of an Ion Channel-Forming Motif in the Primary Structure of Tetanus and Botulinum Neurotoxins," FEBS, 313:12-18) The low pH environment of the endosome may trigger a conformational change in the translocation domain, thus forming a channel for the light chain. The final event of intoxication involves enzymatic activity of the light chain, a zinc-dependent endoprotease (Schiavo, 1992a; Schiavo, G., et al., (1992b), "Tetanus Toxin is a Zinc Protein and its Inhibition of Neurotransmitter Release and Protease Activity Depend on Zinc," EMBO J., 11:3577-3583), on key synaptic vesicle proteins (Schiavo, 1992a; Oguma, K., et al., (1995), "Structure and Function of Clostridium botulinum Toxins," Microbiol. Immunol, 39:161-168; Schiavo, G., et al., (1993), "Identification of the Nerve Terminal Targets of Botulinum Neurotoxin Serotypes A, D, and E," J. Biol. Chem., 268:23784-23787; Shone, C.C., et al., (1993), "Proteolytic Cleavage of Synthetic Fragments of Vesicle- Associated Membrane Protein, Isoform-2 by Botulinum Type B Neurotoxin," Eur. J. Biochem., 217:965-971) necessary for neurotransmitter release. The light chains of BoNT serotypes A, d, and E cleave SNAP-25 (synaptosomal-associated protein of M25,000), serotypes B, D, F, and G cleave VAMP/synaptobrevin (synaptic vesicle- associated membrane protein); and serotype Ci cleaves syntaxin. Inactivation of SNAP-25, VAMP, or syntaxin by BoNT leads to an inability of the nerve cells to release acetylcholine resulting in neuromuscular paralysis and possible death, if the condition remains untreated.
Human botulism poisoning is generally caused by type A, B, E or rarely, by type F toxin. Type A and B are highly poisonous proteins which resist digestion by the enzymes of the gastrointestinal tract. Foodborne botulism poisoning is caused by the toxins present in contaminated food, but wound and infant botulism are caused by in vivo growth in closed wounds and the gastrointestinal tract respectively. The toxins primarily act by inhibiting the neurotransmitter acetylcholine at the neuromuscular junction, causing paralysis. Another means for botulism poisoning to occur is the deliberate introduction of the toxin(s) into the environment as might occur in biological warfare. When the cause of botulism is produced by toxin rather than by in vivo infection the onset of neurologic symptoms is usually abrupt and occurs within 18 to 36 hours after ingestion. The most common immediate cause of death in respiratory failure due to diaphragmatic paralysis. Home canned foods are the most common sources of toxins. The most frequently implicated toxin is toxin A, which is responsible for more than 50% of morbidity resulting from botulinum toxin.
Because even small amounts of botulinal toxin can cause serious illness, persons such as laboratory workers who are exposed to toxin must learn to handle all samples that may contain toxin with extreme care. It is also suggested that such workers be protected from illness by vaccination against the toxins. Furthermore, persons exposed to conditions in which botulism toxins might be in the environment which might be inhaled or ingested, such as military personnel, need to be protected from the toxin.
Agents that abolish the action of BoNT have been investigated since the 1940s. Early work at Fort Detrick in the 1940s lead to the development of a toxoid vaccine to protect against serotypes A, B, Ci, D, and E toxins. The toxoid vaccine was manufactured by growing five Clostridium botulinum strains, extracting and precipitating the toxin from the growth media after cell lysis. Formalin was added to the crude preparation to inactivate the neurotoxin. Residual formalin was left in the vaccine product to ensure the toxin remains non-toxic. The product was adsorbed to aluminum hydroxide and blended. Currently, a pentavalent toxoid vaccine against serotypes A through E (Anderson, J.H., et al., (1981), "Clinical Evaluation of Botulinum Toxoids," Biomedical Aspects of Botulism, (Lewis, G.E., Ed.), pp. 233- 246, Academic Press, New York; Ellis, R. J., (1982), "Immunobiologic Agents and Drugs Available from the Centers for Disease Control. Descriptions, Recommendations, Adverse Reactions and Scrologic Response," 3rd ed., Centers for Disease Control. Atlanta, GA; Fiock, M.A., et al., (1963), "Studies of Immunities to Toxins of Clostridium Botulinum. IX. Immunologic Response of Man to Purified Pentavalent ABCDE Botulinum Toxoid," J. Immunol, 90:697-702; Siegel, L.S., (1988), "Human Immune Response to Botulinum Pentavalent (ABCDE) Toxoid Determined by a Neutralization Test and by an Enzyme-Linked Immunosorbent Assay," J. Clin. Microbiol, 26:2351-2356), available under Investigational New Drug (IND) status, is used to immunize specific populations of at-risk individuals, i.e., scientists and health care providers who handle BoNT and our armed forces who may be subjected to weaponized forms of the toxin Though serotypes A, B, and E are most associated with botulism outbreaks in humans, type F has also been diagnosed (Midura, T.F., et al., (1972), "Clostridium botulinum Type F: Isolation from Venison Jerky," Appl. Microbiol. Λ 24:165-167; Green, J., et al., (1983), "Human Botulism (Type F) - A Rare Type," Am. J. Med.t 75:893-895; Sonnabend, W.F., et al., (1987), "Intestinal Toxicoinfection by Clostridium botulinum Type F in an Adult. Case Associated with Guillian-Barre Syndrome," Lancet, 1:357-361; Hatheway, C.L., (1976), "Toxoid of Clostridium botulinum Type F: Purification and Immunogenicity Studies," Appl. Environ. Microbiol, 31:234-242) A separate monovalent toxoid vaccine against BoNTF is available under IND status Hatheway demonstrated that the BoNTF toxoid could protect guinea pigs against a homologous challenge (Wadsworth, J.D.F., et al., (1990), "Botulinum Type F Neurotoxin," Biochem. J., 268:123-128).
Even though toxoid vaccines are available, there are numerous shortcomings with their current use and ease of production. First, because C. botulinum is a spore- former, a dedicated facility is required to manufacture a toxin-based product. The requirement for a dedicated manufacturing facility is not trivial. It is extremely costly to renovate and upgrade an existing facility or to build a new one and then to maintain the facility in accordance with current Good Manufacturing Practices (cGMP) to manufacture one vaccine. Second, the yields of toxin production from C. botulinum are relatively low. Third, the toxoiding process involves handling large quantities of toxin and thus is dangerous, and the added safety precautions increase the cost of manufacturing. Fourth, the toxoid product for types A-E consists of a crude extract of clostridial proteins that may influence immunogenicity or reactivity of the vaccine, and the type F toxoid is only partially purified (IND 5077). Fifth, because the toxoiding process involves the use of formaldehyde, which inactivates the toxin, and residual levels of formaldehyde (not to exceed 0.02%) are part of the product formulation to prevent reactivation of the toxin, the vaccine is reactogenic. An additional component of the toxoid vaccines is the preservative thimerosal (0.01%), which also increases the reactogenicity of the product.
The development of a new-generation, recombinant vaccine could alleviate many of the problems associated with the toxoid. A recombinant vaccine would eliminate the need for a dedicated manufacturing facility. Presently, many cGMP facilities are in existence and available that could manufacture a recombinant product. There would be no need to culture large quantities of a hazardous toxin- producing bacterium. Production yields from a genetically engineered product is expected to be high. There would be no need to treat the vaccine with formalin because the product would be non-toxic from the outset. Recombinant products would be purer, less reactogenic, and more fully characterized. Thus, the cost of a recombinant product would be expected to be much lower than a toxoid because there would be no expenditures required to support a dedicated facility, and the higher production yields would reduce the cost of the vaccine product.
SUMMARY OF THE INVENTION It is an object of this invention to provide immunogenic peptides capable of eliciting protective immunity against botulinum neurotoxin of serotypes A-G.
It is another object of this invention to provide vaccines capable of eliciting protective immunity against botulinum neurotoxin, where the vaccines do not act as neurotoxins themselves. It is yet another object of this invention to provide methods for preparing non-toxic peptides for use in vaccines against botulinum neurotoxin by growing recombinant organisms which express the peptides.
It is still another object of this invention to provide methods for fast and efficient purification of the non-toxic peptides from cultures of recombinant organisms.
These and other objects are met by one or more of the following embodiments of the present invention In one embodiment, this invention provides a nucleic acid encoding the carboxy-terminal portion of the heavy chain (HC) of botulinum neurotoxin (BoNT), the BoNT being selected from the group consisting of BoNT serotype A, BoNT serotype B, BoNT serotype CI, BoNT serotype D, BoNT serotype E, BoNT serotype F, and BoNT serotype G, wherein said nucleic acid is expressable in a recombinant organism selected from Escherichia coli and Pichia pastoris. Preferably, the nucleic acid comprises a nucleic acid sequence selected from SEQ ID No:l (serotype A), SEQ ID No:7 (serotype B), SEQ ID No:9 (serotype CI), SEQ ID No: 11 (serotype D), SEQ ID No: 13 (serotpye E), SEQ ID No: 15 (serotype F), and SEQ ID No: 17 (serotype G). In an alternative preferred embodiment, the nucleic acid encodes an HC amino acid sequence of BoNT selected from SEQ ID No:2 (serotype A), SEQ LD No:8 (serotype B), SEQ ID No: 10 (serotype CI), SEQ JD No: 12 (serotype D), SEQ ID No: 14 (serotpye E), SEQ ID No: 16 (serotype F), and SEQ ID No: 18 (serotype G). In another embodiment, this invention provides a nucleic acid encoding the amino-terminal portion of the heavy chain (HN) of botulinum neurotoxin (BoNT), the BoNT being selected from the group consisting of BoNT serotype B, BoNT serotype CI, BoNT serotype D, BoNT serotype E, BoNT serotype F, and BoNT serotype G, wherein said nucleic acid is expressable in a recombinant organism selected from Escherichia coli and Pichia pastoris. In a prefered embodiment, the nucleic acid comprises a nucleic acid sequence selected from SEQ ID No:21 (serotype B), SEQ ID No:23 (serotype CI), SEQ ID No:25 (serotype D), SEQ ID No:27 (serotpye E), SEQ ID No:29 (serotype F), and SEQ ID No:31 (serotype G). Alternatively, the nucleic acid nucleic acid encodes an HN amino acid sequence of BoNT selected from SEQ ID No:22 (serotype B), SEQ ID No:24 (serotype CI), SEQ ID No:26 (serotype D), SEQ ID No:28 (serotpye E), SEQ ID No:30 (serotype F), and SEQ ID No:32 (serotype G).
Preferably, the nucleic acid of this invention is a synthetic nucleic acid. In a preferred embodiment, the sequence of the nucleic acid is designed by selecting at least a portion of the codons encoding HC from codons preferred for expression in a host organism, which may be selected from gram negative bacteria, yeast, and mammalian cell lines; preferably, the host organism is Escherichia coli or Pichia pastoris. In another preferred embodiment, the nucleic acid sequence encoding HC is designed by selecting codons encoding HC which codons provide HC sequence enriched in guanosine and cytosine residues. More preferably, nucleic acid encoding HC or HN is expressed in a recombinant host organism with higher yield than a second nucleic acid fragment encoding the same HC sequence, said second nucleic acid fragment having the wild-type Clostridum botulinum sequence of HC.
In yet another embodiment, this invention provides anexpression vector comprising the nucleic acid of this invention, whereby HC and/or HN is expressed upon transfection of a host organism with the expression vector. Another embodiment of this invention provides a method of preparing a polypeptide comprising the carboxy-terminal portion of the heavy chain (HC) of botulinum neurotoxin (BoNT) or the amino-terminal portion of the heavy chain (HN) of botulinum neurotoxin (BoNT) selected from the group consisting of BoNT serotype A, BoNT serotype B, BoNT serotype C, BoNT serotype D, BoNT serotype E, BoNT serotype F, and BoNT serotype G, said method comprising culturing a recombinant host organism transfected with the expression vector of of this invention under conditions wherein HC or HN is expressed. Preferably, the recombinant host organism is a eukaryote. In another preferred embodiment, the method of this invention further comprises recovering insoluble protein from the host organism, whereby a fraction enriched in HC or HN is obtained. Preferably, the host organism is Pichia pastoris.
In still another embodiment, this invention provides an immunogenic composition comprising the carboxy-terminal portion of the heavy chain (HC) of botulinum neurotoxin (BoNT) selected from the group consisting of BoNT serotype A, BoNT serotype B, BoNT serotype C, BoNT serotype D, BoNT serotype E, BoNT serotype F, and BoNT serotype G. Preferably, the immunogenic composition is prepared by culturing a recombinant organism transfected with an expression vector encoding HC. More preferably, the immunogenic composition is prepared by a method wherein an insoluble protein fraction enriched in HC is recovered from said recombinant organism.
In yet another embodiment, this invention provides an immunogenic composition comprising the amino-terminal portion of the heavy chain (HN) of botulinum neurotoxin (BoNT) selected from the group consisting of BoNT serotype A, BoNT serotype B, BoNT serotype C, BoNT serotype D, BoNT serotype E, BoNT serotype F, and BoNT serotype G. Preferably, the immunogenic composition comprising HN is prepared by culturing a recombinant organism transfected with an expression vector encoding HN. More preferably, the immunogenic composition is prepared from an insoluble protein fraction enriched in HN which is recovered from the recombinant organism.
In still another embodiment, this invention provides an immunogenic composition comprising a polypeptide comprising epitopes contained in the carboxy-terminal portion of the heavy chain (HC) of botulinum neurotoxin (BoNT) and/or the amino-terminal portion of the heavy chain (HN) of botulinum neurotoxin (BoNT) selected from the group consisting of BoNT serotype A, BoNT serotype B, BoNT serotype C, BoNT serotype D, BoNT serotype E, BoNT serotype F, and/or BoNT serotype G, said epitopes eliciting protective immunity toward the respective BoNT serotype. Preferably, the immunogenic composition elicits an ELISA response to the respective BoNT serotype(s) in an animal which is detectable in serum from the animal even when the serum is diluted 100-fold.
BRIEF DESCRIPTION OF THE DRAWINGS Figure 1 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype A and the encoded amino acids sequence.
Figure 2 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype A and the encoded amino acids sequence.
Figure 3 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype A and the encoded amino acids sequence.
Figure 4 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype B and the encoded amino acids sequence.
Figure 5 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype C and the encoded amino acids sequence. Figure 6 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype D and the encoded amino acids sequence. Figure 7 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype E and the encoded amino acids sequence.
Figure 8 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype E and the encoded amino acids sequence. Figure 9 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype F and the encoded amino acids sequence.
Figure 10 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype G and the encoded amino acids sequence.
Figure 11 shows the sequence for a synthetic gene encoding the HN fragment of BoNT serotype A and the encoded amino acids sequence.
Figure 12 shows the sequence for a synthetic gene encoding the HN fragment of BoNT serotype B and the encoded amino acids sequence.
Figure 13 shows the sequence for a synthetic gene encoding the HN fragment of BoNT serotype C and the encoded amino acids sequence. Figure 14 shows the sequence for a synthetic gene encoding the HN fragment of BoNT serotype D and the encoded amino acids sequence.
Figure 15 shows the sequence for a synthetic gene encoding the HN fragment of BoNT serotype E and the encoded amino acids sequence.
Figure 16 shows the sequence for a synthetic gene encoding the HN fragment of BoNT serotype F and the encoded amino acids sequence.
Figure 17 shows the sequence for a synthetic gene encoding the HN fragment of BoNT serotype G and the encoded amino acids sequence.
Figure 18 shows the sequence for a synthetic gene encoding the He fragment of BoNT serotype F and the encoded amino acids sequence. Figure 19 shows (A) AT base content of a putative fragment C region in native C. botulinum DNA. (B) Reduction at AT content after the first design (rBoNTF(Hc)l) of the synthetic gene. (C) AT content of the final gene design (rBoNTF(Hc)2) used to express recombinant rBoNTF(Hc) in P. pastoris.
Figure 20 shows (A) SDS-PAGE and (B) Western blot of samples at various steps along the rBoNTF(Hc) purification. Lanes from both figures are identical except lane 1, where SDS-PAGE shows No vex mark 12 wide-range molecular weight markers and Western blot shows Novex See Blue prestained molecular weight markers. Lane 2 is the cell lysate, lane 3 is the cell extract, lane 4 is the cell extract after dialysis, lane 5 is pool of rBoNTF(Hc) positive fractions after Mono S column chromatography, and lane 6 is pool of rBoNTF(Hc)-positive fractions after hydrophobic interaction chromatography. Figure 21 shows purification of rBoNTF(Hc) by sequential chromatography.
(A) Mono S cation exchange chromatography of extract from P. pastoris. Proteins were eluted with increasing NaCl gradient. Fractions positive for rBoNTF(Hc) by Western analysis were pooled individually and subjected to hydrophobic interaction chromatography (B) and proteins were eluted with a decreasing ammonium sulfate gradient. In both panels, protein monitored by A280nm is recorded on the left axis and elution conditions are recorded on the right axis, with the gradient trace laid over the chromatogram.
Figure 22 shows CD spectra of purified soluble ( — ) and resolubilized (-) rBoNTF(Hc) at 30 μg/ml (0.62 μM) in 10 M sodium phosphate, pH 7.0 in a 1-cm path length cell. Spectra were the average of four accumulations, scanned from 260 to 200 nm at a scan rate of 10 nm/min with a 2-s response and a 1-nm bandwidth. The temperature was maintained at 20°C using a Peltier thermocontrol device.
DETAILED DESCRIPTION OF THE EMBODIMENTS OF THIS INVENTION
The present inventors have determined that animals, including primates, may be protected from the effects of botulinum neurotoxin (BoNT) by immunization with fragments of the botulinum neurotoxin protein expressed by recombinant organisms. Specifically, peptides comprising protective epitopes from the receptor binding domain and/or the translocation domain, found in the carboxy terminal and the amino terminal portions of the heavy chain of the BoNT protein, respectively, are expressed by recombinant organisms transfected with expression vectors encoding the peptides for each serotype of BoNT. Immunization with these recombinantly produced peptides will elicit antibodies capable of protecting animals against intoxication with the BoNT of the respective serotype.
This invention provides a genetically engineered vaccine for protection against botulism. The vaccine comprises fragments of the A and B toxins known as "C fragments" (He domain). It is now possible to produce the He fragments of the A and B toxins in E. coli using gene segment constructs of the HC fragment or an HC polypeptide fused to E. coli maltose binding protein. It has been found that the fusion product provides excellent protection against the native toxin challenge. The invention provides plasmids and recombinant proteins for use as vaccines to provide protection against toxins of Clostridium botulinum.
Kozaki et al. in "Antibodies against Botulism Neurotoxin", L.L. Simpson, ed., 1989, Academic Press, New York, suggested that a protective epitope might be present in the 50 kDa carboxyl terminus (HC) region of the protein. Thompson et al. (1990, Eur. J. Biochem. 189:73-81) deduced the amino acid sequence for the serotype A botulinum toxin. DasGupta, et al. (1990, Biochemie, 72:661-664), identified the "nick" site for post-translational cleavage of the expressed toxin polypeptide, from which the sequence of the heavy chain can be deduced as follows (see also Krieglstein, et al., 1994, J. Protein Chem., 13:49-57): ALNDLCIKVNNWDLFFSPSEDNFTNDLNKGEEITSDTNIEA AEENISL
DLIQQYYLTFNFDNEPENISffiNLSSDIIGQLELMPNffiRFPNGKKYELDKYTM
FHYLRAQEFEHGKSRIALTNSVNEALLNPSRVYTFFSSDYVKKVNKATEAA MFLGWVEQLVYDFTDETSEVSTTDKIADITIΠPYIGPALNIGMLYKDDFVGA LIFSGAVILLEFIPEIAIPVLGTFALVSYIANKVLTVQTIDNALSKRNEKWDEV YKYIVTNWLAKVNTQROLIRKKMKEALENQAEATKAIINYQYNQYTEEEKN NE^NRODLSSIO.NESINKAMINI KT^NQCSVSYLMNSMIPYGVKTLLEDFDA SLKDALLKYIRDNYGTLIGQVDRLKDKVNNTLSTDIPFQLSKYVDNQRLLST FTEYIK^IINTSILNLRYESNHLROLSRYASMNIGSKVNFDPIDKNQIQLFNLES SKIEVILKNAIVYNSMYENFSTSFWIRIPKYFNSISLNNEYTIINCMENNSGWK VSLNYGEHWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKI YTINGRLROQKPISNLGNIHASNNIMFIΠJDGCRDTHRYIWIKYFNLFDKELNE KEIKDLYDNQSNSGILKDFWGDYLQYDKPYYMILLYDPNKYVDVNNVGIR GYMYLKGPRGSVMTTNIYLNSSLYRGTKFIIKKASGNKDNIVRNNDRVYIN VVVKNKEYRLATNASQAGVEKTLSALEIPDVGNLSQVVVMKSKNDQGITNK CKMNLQDNNGNDIGFIGFHQFNNIAKLVASNWYNROTERSSRTLGCSWEFI PVDDGWGERPL Whelan et al. (Appl. Environ. Microbiol. 58:2345-2354, 1992) have deduced the amino acid sequence for the serotype B botulinum toxin. Schmidt, et al. (1985, Arch. Biochem. Biophys., 238:544-548), provided N-terminal sequence information for the heavy chain resulting form post-translational cleavage of the expressed toxin polypeptide, and the sequence of the heavy chain can be deduced from this information as follows:
APGICIDVDNEDLFFIADKNSFSDDLSKNERIEYNTQSNYIENDFPINEL ILDTDLISKffiLPSENTESLTDF^VDVPVYEKQPAIKKIFTDENTIFQYLYSQTF PLDIRDISLTSSFDDALLFSNKVYSFFSMDYIKTANKVVEAGLFAGWVKQIV NDFVffiANKSNTMDKIADISLIVPYIGLALNVGNETAKGNFENAFEIAGASIL LEFIPELLIPVVGAFLLESYIDNKNKIIKTIDNALTKRNEKWSDMYGLIVAQW LSTVNTQFYTIKEGMYKALNYQAQALEEIIKYRYNIYSEKEKSNINIDFNDIN SK1.NEGINQAIDNINNFINGCSVSYLMKKMIPLAVEKLLDFDNTLKKNLLNYI DENKLYLIGS AEYEKSKVNKYLKTIMPFDLSIYTNDTILIEMFNKYNSEILNNI ILNLRYKDNNLIDLSGYGAKVEVYDGVELNDKNQFKLTSSANSKIRTTQNQ NIIFNSVFLDFSVSFW iPKYI^DGIQNYfflNEYTIINCMKJSfNSGWKISIRGRI IWTLroiNGKTKSVIΨEYNIREDISEYINRWFFVTITNNLNNAKIYINGKLESN TDIH)IREVIANGEIIFKI.DGDIDRTQFIWMKYFSIFNTELSQSNIEERYKIQSY SEYLKJ FWGNPLMYNKEYYMFNAGNKNSYTIKLKKDSPVGEILTRSKYNQ NSKYINYRDLYIGEKΗIRRKSNSQSINDDIVRKEDYIYLDFFNLNQEWRVYT YKYFKKEEELFLAPISDSDEFYNTIQIKEYDEQPTYSCQLLFKKDEESTDEIGL IGIHRFYESGIVFEEVKDλΦCISDWYLEVKJlKPYNLKLGCNWQFIPKDEGWT E Analogous post-translational cleavage for all BoNT serotypes produces analogous heavy chain and light chain structures (see Krieglstein, et al., 1994, J. Protein Chem., 13:49-57, and references cited therein). Synthetic Gene Construction
Preliminary experiments indicated that the DNA sequence found in C. botulinum encoding the relevant BoNT fragments are not well expressed in typical recombinant hosts. Therefore, synthetic gene construction was undertaken, based on the amino acid sequence of the respective fragments. Synthetic gene construction is a technique used to optimize for expression in heterologous host systems. The base composition (i.e., percent A+T or percent G+C) as well as the specific codons in a gene sequence play a role in determining whether a gene from one organism will be optimally expressed in a different organism. There is a reason why certain codons are used and why some are not. Organisms will use the codons in which corresponding tRNAs are present. If the organisms do not use certain codons, they most likely lack those specific tRNAs. As it turns out, codons found in clostridial DNA (i.e., genes found in the genus of bacterial called Clostridium) are very unique both in terms of base composition (i.e., very high A+T base composition) and in the use of codons not normally found in E. coli or yeast.
Table 1 is a chart depicting codon usage in Pichia pastoris. This table was generated by listing the codons found in a number of highly expressed genes in P. pastoris. The codon data was obtained by sequencing the genes and then listing which codons were found in the genes.
From Table 1, it is clear that the amino acid residues can be encoded for by multiple codons. When constructing synthetic genes using P. pastoris codon usage, it is preferred to use only those codons that are found in the naturally occurring genes in P. pastoris, and it should be attempted to keep them in the same ratio found in the genes of the natural organism. When the clostridial gene has an overall A+T richness of greater than 70% and A+T regions that have spikes of A+T of 95% or higher, they have to be lowered for expression in expression systems like yeast. (Preferably, the overall A+T richness is lowered below 60% and A+T in spikes is also lowered to 60% or below). It is of course necessary to balance keeping the same codon ratio (e.g., for glycine GGG was not found, GGA was found 22% of the time, GGT was found 74% of the time, GGC was found 3% of the time) with reducing the high A+T content. In the construction of the genes, it is preferred to keep the A+T spikes about 55%.
Considering codon usage for a number of organisms including E. coli, it turns out that a synthetic gene using E. coli codon usage also expresses fairly well in P. pastoris. Similarly, a synthetic gene using P. pastoris codon usage also appears to express very well in E. coli. Synthetic genes for the H fragments of botulinum neurotoxin serotypes A-G are shown in Figures 1-10, along with the amino acid sequences encoded by the synthetic genes. Synthetic genes for the HN fragments of botulinum neurotoxin serotypes A-G are shown in Figures 11-17, along with the amino acid sequences encoded by the synthetic genes. Synthetic genes having alternative gene sequences may be prepared by following the guidance provided herein concerning codon selection. The amino acid sequence encoded by such synthetic genes will preferably be the sequence of one of the BoNT serotype proteins, or a fragment thereof which contains protective epitopes. Suitable fragments include the He fragments of BoNT serotypes A, B Ci, D, E, F, and G, and the HN fragments of BoNT serotypes A, B, Ci, D, E, F, and G. Such alternative gene sequences are within the contemplation of this invention.
Also within the contemplation of this invention are proteins containing protective epitopes from both the N-terminal and the C-terminal domains of the respective serotype BoNT proteins. Such proteins may be prepared by fusing a sequence encoding the translocation domain (HN) to the sequence of the HC region. This may be accomplished by removing the restriction enzyme site of the 3' end of the translocation domain gene as well as the termination codon, and also removing the initiation codon, restriction enzyme site and any other nucleotides on the 5' end of the gene that are not part of the botulinum toxin gene. Then a common restriction enzyme site not found in either synthetic gene may be inserted on the 3' end of the H gene and the 5' end of the He gene, and this common restriction site may be used to fuse the two genes together.
Recombinant Peptide Production The nontoxin fragment is very safe, will not require formalin treatment, and has been shown to produce significant immunity against the fully toxic parent molecule. There are two major advantages of the invention over the presently employed vaccine. First, the recombinantly-produced botulinum neurotoxin (rBoNT) protein fragments are completely nontoxic and, is thus, very safe. The fermentation of the host cell harboring the rBoNT gene (e.g., Escherichia coli or Pichia pastoris) will not require the high biological containment facilities presently needed to ferment the spore-forming Clostridium botulinum required for the production of the toxoid vaccine. Second, the synthetic gene can be placed in high expression systems and used to make much larger quantities of the fragment than toxin produced by the parent organism, Clostridium botulinum. Thus, there will be immense cost savings because it will be easier and safer to produce much larger quantities of the vaccine than is now possible.
Synthetic genes as described herein may be transfected into suitable host organisms to create recombinant production organisms, and cultures of these recombinant organisms can then be used to produce immunogenic peptide fragments capable of conferring protective immunity against BoNT of the respective serotypes. Exemplary techniques for transfection and production of BoNT fragments are shown in the Examples. Alternative techniques are well documented in the literature (See, e.g., Maniatis, Fritsch & Sambrook, "Molecular Cloning: A Laboratory Manual" (1982); "DNA Cloning: A Practical Approach," Volumes I and II (D.N. Glover, ed., 1985); "Oligonucleotide Synthesis" (M.J. Gait, ed., 1984); "Nucleic Acid Hybridization" (B.D. Hames & S.J. Higgins, eds., 1985); "Transcription and Translation" (B.D. Hames & S.J. Higgins, eds., 1984); "Animal Cell Culture" (R.I. Freshney, ed., 1986); "Immobilized Cells and Enzymes" (IRL Press, 1986); B. Perbal, "A Practical Guide to Molecular Cloning" (1984), and Sambrook, et al., "Molecular Cloning: a Laboratory Manual" (1989)). Such techniques are explained fully in the literature, and modification of these techniques within the scope of this invention is within the skill in the art.
The synthetic gene for BoNT serotype B fragment He (see Figure 4A) has been inserted into the yeast expression vector pHIL-D4, and integrated into the chromosome of Pichia pastoris strain GS115. The expressed product (see amino acid sequence in Figure 4B) had the expected molecular weight as shown by denaturing polyacrylamide gel electrophoresis (PAGE) and Western blot analysis using antibodies directed against botulinum neurotoxin serotype B. The expressed recombinant BoNTB (He) elicited high antibody titers as judged by the Enzyme Linked Immunosorbent Assay (ELISA) and, more importantly, these circulating serum titers protected mice, guinea pigs, and non-human primates from challenges with active toxin. Industrial scale manufacturing processes (fermentation and purification) have been completed and a pilot lot has been produced in compliance with cGMP.
The synthetic gene for BoNT serotype C fragment Hc (see Figure 5A) has been inserted into the yeast expression vector pHIL-D4, and integrated into the chromosome of Pichia pastoris strain GS115. The expressed product (see amino acid sequence in Figure 5B) had the expected molecular weight as shown by denaturing polyacrylamide gel electrophoresis (PAGE) and Western blot analysis using antibodies directed against botulinum neurotoxin serotype C. The expressed recombinant BoNTC (He) elicited high antibody titers as judged by the Enzyme Linked Immunosorbent Assay (ELISA) and, more importantly, these circulating serum titers protected mice from challenges with active toxin.
The synthetic gene for BoNT serotype D fragment He (see Figure 6A) has been inserted into the yeast expression vector pHIL-D4, and integrated into the chromosome of Pichia pastoris strain GS115. The expressed product (see amino acid sequence in Figure 6B) had the expected molecular weight as shown by denaturing polyacrylamide gel electrophoresis (PAGE) and Western blot analysis using antibodies directed against botulinum neurotoxin serotype D. The expressed recombinant BoNTD (He) elicited high antibody titers as judged by the Enzyme Linked Immunosorbent Assay (ELISA) and, more importantly, these circulating serum titers protected mice from challenges with active toxin.
The synthetic gene for BoNT serotype E fragment He (see Figure 7A) has been inserted into the yeast expression vectors pHILD2, pHILD3, and pPIC9K (see Figures 7B). A modified form of the synthetic gene in which an internal EcoRI site was removed and the gene was enlarged (see Figure 8) was inserted into the yeast vector pHJL-D4, and integrated into the chromosome of Pichia pastoris strain GS115. The expressed product (see amino acid sequence in Figure 8) had the expected molecular weight as shown by denaturing polyacrylamide gel electrophoresis (PAGE) and Western blot analysis using antibodies directed against botulinum neurotoxin serotype E. The expressed recombinant BoNTE (He) elicited high antibody titers as judged by the Enzyme Linked Immunosorbent Assay (ELISA) and, more importantly, these circulating serum titers protected mice from challenges with active toxin. The synthetic gene for BoNT serotype F fragment Hc (see Figure 9A) has been inserted into the yeast expression vector pHIL-D4, and integrated into the chromosome of Pichia pastoris strain GS115. The initial step in the development of the rBoNTF(Hc) vaccine candidate was to design a gene which could satisfactorily be expressed in a pichia host. A synthetic gene encoding rBoNTF(H ) was constructed to lower the inherent AT richness of the native clostridial gene and to remove any potentially rare codons. Clostridial genes having an AT content in excess of 65% or having an average AT content but containing AT-rich tracts usually contain multiple terminators/polyadenylation signals, which can result in premature termination of transcripts when expression is attempted in yeast (Romanos, M.A., et al., (1995), "Expression of Cloned Genes in Yeast," DNA Cloning 2: Expression Systems," (Glover D., et al., Eds.), Oxford Univ. Press, London). The synthetic gene in this study required two successive rounds of alterations before the yeast could properly produce full-length antigen. The expressed product (see amino acid sequence in Figure 9B) had the expected molecular weight as shown by denaturing polyacrylamide gel electrophoresis (PAGE) and Western blot analysis using antibodies directed against botulinum neurotoxin serotype F.
A previous study (Hatheway, 1976) demonstrated that the serotype F toxoid antigen needed to be at least partially purified to be efficacious. The same observation was noted with the rBoNTF(Hc) antigen produced in pichia cells as the crude cell lysate did not protect mice against a BoNTF challenge. The putative receptor-binding domain of BoNTF was purified from yeast and shown to be efficacious in a mouse model. The expressed recombinant BoNTF (He) elicited high antibody titers as judged by the Enzyme Linked Immunosorbent Assay (ELISA) and, more importantly, these circulating serum titers protected mice from challenges with active toxin.
The synthetic gene for BoNT serotype G fragment He (see Figure 10A) has been inserted into the yeast expression vector pHJX,-D4, and integrated into the chromosome of Pichia pastoris strain GS115. The expressed product (see amino acid sequence in Figure 10B) had the expected molecular weight as shown by denaturing polyacrylamide gel electrophoresis (PAGE) and Western blot analysis using antibodies directed against botulinum neurotoxin serotype G. The expressed recombinant BoNTG (He) elicited high antibody titers as judged by the Enzyme Linked Immunosorbent Assay (ELISA) and, more importantly, these circulating serum titers protected mice from challenges with active toxin. When purifying a protein for the first time, it is important to generate a viable means for identifying which fractions contain product. If the protein of interest is not an enzyme or does not absorb at a unique wavelength, there are still suitable assays (for example mass spectrometry) for identifying the product. The inventors chose to monitor the purification of rBoNT(Hc) through immunological detection by Western blot analysis. However, with various polyclonal antibodies against whole toxin available but without an appropriate positive control, the Western blot results can only be interpreted as ambiguous until a purified sample is sequenced or shown to be protective.
There are two major issues of concern when extracting C-fragment, HN, and/or heavy chain (He) antigens from pichia cells. The first concern is the solubility of these proteins (i.e., can enough product be extracted into the soluble fraction for further processing?). The second concern deals with the effective removal of polynucleic acids and/or other contaminating materials, which strongly interfere with the necessary chromatography. The zwiterionic detergent, CHAPS, is most notably an effective agent for solubilizing membrane proteins. Membrane proteins exist in a hydrophobic environment, and if removed from that environment, possess strong tendencies to aggregate and ultimately precipitate. CHAPS prevents that aggregation from occurring with membrane bound proteins. The inventors extrapolated this premise to the clostridial proteins noted above. C-fragments, translocation domains (HN), and entire heavy chains are missing their natural partner (the remaining segments of the neurotoxin) and thus, presumably bare exposed hydrophobic regions on their protein surface where the He, HN, or heavy chain normally associates with rest of the neurotoxin. These exposed hydrophobic regions are potential nucleation sources for protein aggregation, because the natural tendency of a protein in an aqueous environment is to bury their hydrophobic surface. When pichia cells are disrupted with CHAPS (on the order of 0.3% W/V) present in the cracking buffer, the amount of fragment C protein isolated in the soluble fraction has been observed to increase from less than 5% to nearly 80% with serotype
Figure imgf000022_0001
Dramatic increases in solubility have been noted with C-fragment serotypes A and F as well.
Once a soluble antigen has been produced, the subsequent task is to separate that antigen from the myriad of pichia host proteins, lipids, and other impurities that exist in the extracted medium. In order for the chemical separations to be feasible by liquid chromatography, it is critical that polynucleic acids be efficiently removed. Nucleotides will either bind to the C-fragment (serotypes A, E, and F due to their elevated pis) or will bind to the anion-exchange chromatography resin (as is used in the first purification step of the C\ process). With either case, the chromatography is rendered futile. The C-fragment product will either fail to bind to the chromatography media or it will elute over an unacceptably large sodium chloride concentration range. Pichia cells possess an abundant amount of DNA. Polyethyleneimine (PEI) is a polycationic agent that readily precipitates nucleotides. When pichia cell extracts are treated with PEI, the nucleic acids are efficiently precipitated and removed by centrifugation without significant loss of product. More importantly, the chromatographic separation of C-fragments from pichia proteins are dramatically improved.
The soluble portion of the cell lysate may typically be purified in two conventional chromatographic steps. The ultimate objective of this work is to obtain FDA licensure of rBoNT as a safe and effective vaccine. Even though separations can be accomplished at extremely high resolution with affinity chemistry, there remains an undesirable effect of hapten leaching from the resin. Thus, a preferred separation employs a cation-exchange step followed by hydrophobic interaction chromatography (HIC). These two steps complement each other as they provide separations based on electrostatic and hydrophobic interactions. The cation- exchange step was particularly efficient in increasing the purity of rBoNTF(Hc), as the antigen was estimated to be purified greater than 52-fold. The efficiency of purification is primarily attributed to the significant difference in isoelectric points between most pichia proteins (pls<7 ) and rBoNT(Hc) (experimental pl=9.4 for rBoNTF(Hc) , data not shown) and thus, the pichia proteins were removed in the column flow through. Precipitate that results when the cation-exchange pool is treated with ammonium sulfate contains mostly pichia proteins and very little rBoNT product. The HIC step removes most or all of the remaining impurities. The yield of soluble rBoNTF(Hc) from the total recombinant yeast cell lysate was estimated to be greater than 28% with a purity greater than 98%. Use of similar purification steps for rBoNTA(Hc) produced greater than 95% pure material.
A significant amount of rBoNTF(Hc) product (30-40%) was identified in the insoluble portion of the cell lysate. Also, the antigen was 35% of the total protein present in the pellet; in effect it was more pure than the soluble rBoNTF(Hc) was after the ion-exchange step. This suggests an alternative process whereby insoluble rBoNT product produced in yeast may be resolubilized and purified to homogeneity. The resolubilization may be performed by resuspending the pellet in urea and subsequently removing the urea by dialyses in nondenaturing buffer. A single chromatographic step using cation-exchange chemistry may be sufficient to purify the resolubilized antigen, in some cases to greater than 98%. The yield of resolubilized rBoNTF(Hc) product from the total cell lysate was estimated to be >19%. The overall bench scale yield of purified soluble and resolubilized rBoNTF(Hc) was estimated to be greater than 47% or 240 mg/Kg of the cell paste. A similar procedure would be suitable for purification of rBoNTA(H ) and other rBoNT fragment peptides from yeast. Analysis of CD spectra of both soluble and resolubilized product revealed the presence of significant β-sheet which is in agreement with that predicted for rBoNTF(Hc) using an artificial neural network (Lebeda, F.J., et al., (1997), "Predicting Differential Antigen-Antibody Contact Regions Based on Solvent Accessibility," J. Protein Chem., 16:607-618), and that determined by crystal structure of BoNT serotype A (Lacy, D.B., et al., (1998), "Crystal Structure of Botulinum Neurotoxin Type A and Implications for Toxicity," Nat. Struct. Biol, 5:898-902). However, even though CD revealed that the two antigens possessed similar folds, there were subtle differences between the two spectra suggesting that the secondary structures, and hence, tertiary structures were not identical. Immunization
The purified soluble and resolubilized antigens appear to be in a folded conformation. However, the bottom line with any potential vaccine is the demonstration of protection Are the antigens in a conformation that will elicit the production of neutralizing antibody? To answer this question, mice were inoculated with rBoNTF(Hc) and subsequently challenged with a high level of rBoNTF toxin The purified soluble rBoNTF(Hc) completely protected mice receiving three inoculations of 0.2 μg from challenge with 1000 mouse i.p. LD50 of BoNT/F toxin Analysis of the association of dose with survival indicated that dose was associated with the odds of surviving (odds ratio=2.0, meaning that the odds of survival increase twofold per unit increase in dose with a 95% confidence level from 1.3 to 3 1) The number of inoculations was also associated with survival Both two inoculations and three inoculations were associated with increased odds of survival relative to a single inoculation (5.3-fold with a 95% confidence level of 1.2-23 for two inoculations and 22-fold with a 95% confidence level of 4.3 -110 for three inoculations) It is apparent that a single shot at higher doses achieved protection comparable to multiple inoculations at lower doses Also, three doses of 1 μg of purified resolubilized rBoNTF(Hc) completely protected mice from a challenge of 5000 mouse i.p. LD50 of BoNTF toxin, thus demonstrating that refolded rBoNTF(Hc) from the insoluble fraction of lysate could also be a prosperous source of antigen.
Individual antibody ELISA titer appears to be an excellent predictor of mouse survival If the antibody titer of a mouse was 100 or greater, that mouse was predicted to and did survive a challenge of 1000 mouse i.p. LD50 of BoNTF toxin. Upon vaccination of mice with 2 or 3 doses of rBoNTA(Hc) or rBoNTB(Hc) vaccine delivered on a specific schedule (i.e., parental intramuscular injection at 0,4, and 8 weeks), survival of animals challenged with 100,000 or 1,000,000 million LD50 of toxin is very high. Measurement of the antibody levels in these animals via an ELISA shows that the survival rate can be correlated with the measured antibody level. The ELISA is performed by coating a microtiter plate with toxin or fragment C itself, then sera from the vaccinated mice is added at various dilutions (i.e., sera diluted 1/100, 1/400, 1/1600, 1/6400, etc.). Since fragment C is sufficient to elicit protection in animals, preferably assays for neutralizing antibody titer in sera from animals vacinated with fragment C are performed using microtiter plates coated with fragment C. Antibody in the sera will bind to the toxin or the fragment C, and the bound antibody may be detected by a secondary antibody (e.g., anti-mouse IgG) that is coupled to horse-radish peroxidase or alkaline phosphatase. The secondary IgG will bind to the anti-BoNT antibody that was raised to the fragment C vaccine. After washing the microtiter wells, a substrate for the peroxidase or phosphatase enzymes is added to the wells. The substrate will give off a color once the enzyme has cleaved the substrate, and the intensity of the color measured (e.g., at 405 nm. Typically, a reading of 0.2 is used as the base. Thus, if dilution of the sera by 1/1600 gives a reading of 0.15 at 405 nm and a dilution of 1/400 gives a reading of 0.45 at 405 nm, the antibody titer in the sera in characterized as 1/400 dilution (i.e., titer of 400 fold). Obviously, if readings of 0.2 are obtained at higher dilutions, better protection is observed. With rBoNTA(Hc) vaccination, for mice which had ELISA titers of less than 100, only 14.3% survival rate was observed under the conditions of vaccination and challenge. With rBoNTF(Hc), for mice which had ELISA titers of 100 fold, under the condition of vaccination and challenge, 100% of the mice were protected.
It also will be well known to one of ordinary skill in the art that a susceptible host may be immunized using the appropriate peptide vaccine formulated in adjuvant to increase the immune response. Such adjuvants include but are not limited to Freund's (complete and incomplete), mineral gels, such as aluminum hydroxide, surface active substances such as keyhole limpet hemocyanin, lysolecithin, pluronic polyols, polyanions, peptides, BCG (Bacille Calmette-Guerin), oil emulsions and dinotrophenols. Immunization can be carried out with additional various presentation and cross-linking permutations. By way of example and not of limitation, such permutations include rBoNT peptides cross-linked to KLH as a carrier, any rBoNT peptide cross-linked to any other rBoNT protein as carrier, rBoNT peptides cross-linked to themselves, and these combinations presented by the various adjuvants listed above. It will become evident that such permutations are available in regard to other peptides and self-assembled peptides disclosed throughout this specification. It will also be known to one of ordinary skill in the art that use of the term
"susceptible host" includes any such mammalian host susceptible to intoxication by BoNT. It will be further evident that any such susceptible host is a candidate for treatment to promote protection from BoNT utilizing the peptide vaccines and associated methods descπbed in this specification.
EXAMPLES In order to facilitate a more complete understanding of the invention, a number of Examples are provided below However, the scope of the invention is not limited to specific embodiments disclosed in these Examples, which are for purposes of illustration only.
Example 1. Synthesis and cloning of a synthetic gene encoding rBoNTF(Hc)
A synthetic gene encoding a putative fragment C region of botulinum neurotoxin serotype F was designed and constructed for expression in Escherichia coli (Holley et al, submitted to Vaccine) The recombinant BoNTF(Hc,)ι, gene was expressed in E. coli as a fusion protein with maltose-bmdmg protein (MBP) with yields of 1 mg/L culture (See Figure 18)
The same gene was used for expression studies the yeast, P pastoris This particular host was chosen because it could produce high levels of recombinant proteins (Cregg, J.M., et al., (1993), "Recent Advances in the Expression of Foreign Genes in Pichia pastoris," Bio/Technology, 11:905-909, Romanos, M.A., et al., (1992), "Foreign Gene Expression in Yeast: A Review," Yeast, 8:423-488; Sreekπshna, K., et al., (1988), "High Level Expression of Heterologous Proteins Methylotrophic Yeast Pichia pastoris," J. Bas. Microbiol, 28:265-278) and because it lacked endotoxms which would facilitate product development Intracellular expression of the antigen was used to avoid potential glycosylation of the recombinant protein The rBoNTF(Hc)ι, gene was modified at its 3' end for insertion into the unique EcoR I site of the yeast vector, pHILD4 The recombinant construct containing the rBoNTF(Hc)ι gene was subsequently linearized with Sac I and the cassette integrated into the chromosomal alcohol oxidase (AOX 1) of Pichia pastons strain GS115 (Clare, J.J., et al., (1991), "High-Level Expression of Tetanus Toxin Fragment C in Pichia pastoris Strains Containing Multiple Tandem Integrations of the Gene," Bio/Technology, 9:455-460) Yeast transformants expressing the selectable markers histidine dehydrogenase (Cregg, J.M., et al , (1985), "Pichia pastoris as a Host System for Transformations," Mol. Cell. Biol, 5:3376-3385) and aminoglycoside phosphotransferase 3' (I) (Scorer, C.A., et al., (1994), "Rapid Selection Using G418 of High Copy Number Transformants of Pichia pastoris for High-Level Foreign Gene Expression," Bio/Technology, 12:181- 184) were isolated These isolates were further characterized for their ability to express rBoNTF(Hc) after induction with methanol. Although the various transformants generated were able to express the selectable markers, no expression of rBoNTF(Hc) as judged by SDS/PAGE and blot analysis was observed in these isolates (data not shown). SDS/PAGE, Western blot, and protein assays
Total protein concentrations were determined by using the Pierce BCA™ (bicinchoninic acid) protein assay kit with BSA as a standard The purity of the rBoNTF(Hc) product was assessed by SDS/PAGE with Novex (San Diego, CA, U.S.A.) gel electrophoresis supplies, reagents, protocols, and National Institutes of Health (NIH) imaging software as previously described (Byrne, M.P., et al., (1998), "Purification, Potency, and Efficacy of the Botulinum Neurotoxin Type A Binding Domain from Pichia pastoris as a Recombinant Vaccine Candidate," Infect. Immun., 66:4817-4822) Western blot assays were used to identify FPLC fractions containing rBoNTF(Hc) as previously described (Byrne, 1998) with the following changes The primary antibody used was a polyclonal protein G sepharose-purified horse anti- BoNTF antibody incubated at 1 μg/ml for 3 h The secondary antibody used was a horseradish peroxidase-labeled affinity-purified goat anti-horse IgG (Kirkegaard & Perry Laboratories, Gaithersburg, MD, U.S.A.) assayed at 1 μg ml for 2 h.
Example 2. Synthesis and cloning of a synthetic gene encoding rBoNTF(Hc)
A second synthetic gene, rBoNTF(Hc)2, was subsequently designed to facilitate expression in P. pastoris. Redesigning the gene was intended to lower specific regions of the rBoNTF(Hc)ι gene in which spikes of AT-rich tracts still remained. Previous work had shown that rare codons (Makoff, A.J., et al., (1989), "Expression of Tetanus Toxin Fragment C in E. coli: High Level Expression by Removing Rare Condons," Nucleic Acids Res., 17:10191-10201) and/or highly enriched AT base compositions (Romanos, M.A., et al., (1991), "Expression of Tetanus Toxin Fragment C in Yeast: Gene Synthesis is Required to Eliminate Fortuitous Polyadenylation Sites in AT-rich DNA," Nucleic Acids Res., 19:1461- 1467) in clostridial DNA were incompatible with optimum expression of clostridial genes in E coli and yeast A second synthetic gene encoding the rBoNTF(Hc) fragment was designed and constructed using P pastoris codon usage (Sreekrishna, K., (1993), "Strategies for Optimizing Protein Expression and Secretion in the Methyl otrophic Yeast Pichia pastoris," Industrial Micororganisms: Basic and Applied Molecular Genetics, (Baltz, R. H., et al, Eds.), pp. 119-126, Am. Soc. Microbiol., Washington, DC) Briefly, complimentary oligonucleotides encoding the amino terminal region of the F(Hc)(423 nucleotides flanked with EcoRl and Pstl sites), the central region of the F(Hc) (606 nucleotides flanked by Pstl and Sail sites) and the carboxy-terminal region of F(Hc) (336 nucleotides flanked by Sail and EcoRl sites) were annealed and cloned into pUC or PCR zero-blunt plasmid vectors. The AT base composition in the native clostridial F(HC) DNA averaged 76% while rBoNTF(Hc)ι averaged 58% and rBoNTF(Hc)2, 53% (Figure 19) The synthetic gene sequence of rBoNTF(Hc)2 and the 432 amino acids it encoded for is shown in Figure 9 After nucleotide sequencing, the cloned fragments were excised by the appropriate restriction endonucleases, separated by agarose gel electrophoresis, and purified The isolated DNA fragments were ligated simultaneously into EcoR I digested and dephosphorylated plasmid pHILD4 The vector harboring the rBoNTF(Hc)2 gene was integrated into the chromosomal AOX1 locus of P pastoris as described above. Transformants expressing selectable markers (histidine dehydrogenase and aminoglycoside phosphotransferase 3' (I)) were isolated and tested for their ability to express rBoNTF(Hc). Unlike the rBoNTF(Hc)ι gene, rBoNTF(Hc)2 was expressed after induction with methanol and yielded the expected molecular weight of approximately 50000 daltons as judged by SDS/PAGΕ and Western blot analysis (Figure 20). The deduced molecular mass of the encoded polypeptide was 50,250 daltons.
Example 3. Expression and Cell Disruption of rBoNTF(Hc) in P. pastoris
Large-scale fermentation conditions and optimal intracellular expression of rBoNTF(Hc) were determined for the yeast strain P. pastoris. Protein expression
A stock seed culture of P pastoris was grown in shake-flasks containing 0.5 L of YNB medium (13.4 g/L yeast nitrogen base without amino acids, 20 g/L glycerol, 0.4 mg/L biotin, in 100 mM sodium phosphate, pH 6.0) Cultures were grown at 30°C until an A600 of 20 absorbance units was achieved, and then used to inoculate a 5-L BioFlo 3000 fermentor (New Brunswick Scientific, Edison, NJ, U.S.A.) containing 2.5 L basal-salt medium plus PTM4 trace mineral salts and 4% glycerol Dissolved oxygen was maintained at 40% and the pH was maintained at 5.0 with 30% ammonium hydroxide After the initial glycerol was consumed, 50% (w/v) glycerol was added at a rate of 20 g/L/h for 1 h then decreased linearly to 0 g/L/h over 3 h The medium was enriched with 1.5 g methanol/L of medium Methanol feed was started at 4 g/IJh and linearly increased to 9 g/IJh over 10 h The methanol feed rate was adjusted by using the dissolved oxygen-spike method (Chiruvolu, V., et al., (1997), "Recombinant Protein Expression in an Alcohol Oxidase-Defective Strain of Pichia pastoris in Feed-Batch Fermentations, Enzyme Microbiol. Technol, 21:277-283) After 10 h of methanol induction, the cells were harvested by centrifugation at 6000 g for 10 min at 4°C with a Beckman JA-10 rotor (Beckman Instruments, Palo Alto, CA, U.S.A.) and then stored at -20°C. Protein expression A stock seed culture of P pastoris was grown in shake-flasks containing 0.5
L of YNB medium (13.4 g/L yeast nitrogen base without amino acids, 20 g/L glycerol, 0.4 mg/L biotin, in 100 mM sodium phosphate, pH 6.0) Cultures were grown at 30°C until an A6oo of 20 absorbance units was achieved, and then used to inoculate a 5-L BioFlo 3000 fermentor (New Brunswick Scientific, Edison, NJ, U.S.A.) containing 2.5 L basal-salt medium plus PTMt trace mineral salts and 4% glycerol. Dissolved oxygen was maintained at 40% and the pH was maintained at 5.0 with 30% ammonium hydroxide After the initial glycerol was consumed, 50% (w/v) glycerol was added at a rate of 20 g/L/h for 1 h then decreased linearly to 0 g/IJh over 3 h. The medium was enriched with 1.5 g methanol/L of medium Methanol feed was started at 4 g/IJh and linearly increased to 9 g/IJh over 10 h The methanol feed rate was adjusted by using the dissolved oxygen-spike method (Chiruvolu, 1997) After 10 h of methanol induction, the cells were harvested by centrifugation at 6000 x g for 10 min at 4°C with a Beckman JA-10 rotor (Beckman Instruments, Palo Alto, CA, U.S.A.) and then stored at -20°C. Cell disruption and sample preparation
Eleven g of frozen cell paste was resuspended in 100 ml of 50 mM Na2HPO4/2 mM Na2EDTA l mM PMSF, pH 6.8 at 4°C The suspended cells were disrupted by three successive passes through a microfluidizer device (model HOY, Microfluidics Corp., Newton, MA, U.S.A.) at 21000 psi The temperature of the disruptate was kept below 10°C throughout the process by cooling the exit line and collection flask with ice The cells were judged to be greater than 95% disrupted as determined by microscopy In comparison, 8-10 passes through a Gaulin homogenizer were required to efficiently disrupt the cells in past protocols. SDS- PAGE and Western blot analysis of cell lysate showed that expressed rBoNTF(Hc) represented <0.5% of the total protein. The resulting cell lysate volume was 105 ml with a protein concentration of 11 mg/ml Cellular debris and insoluble proteins were removed by centrifugation at 15000 g for 15 min at 4°C with a Sorval SS-34 rotor (Sorval Instruments, Newtown, CT, U.S.A.). The resulting extract was noticeably turbid due to the presence of lipids and significant quantities of nucleic acids As rBoNTF(Hc) possessed a calculated isoelectric point of 9.1 and presumably interacted strongly with DNA, DNase was added to the cell extract in order to digest the polynucleotides and facilitate purification. To remove the polynucleotides, the extract was treated with DNase (100 units/ml, Aldrich) and ZnCl2 (2 mM, Aldrich) at room temperature for 30 min and then dialyzed extensively with 10 kDa molecular weight cut off (MWCO) Slide-A-Lyzer dialysis cassettes (Pierce) in 50 mM Na2HPO4/2 mM Na2EDTA/l mM PMSF, pH 6.8 at 4°C A precipitate developed during dialysis that was separated by centrifugation at 15000 g for 15 min at 4°C with a Sorval SS-34 rotor The clarified extract contained 7.8 mg/ml of total protein and was used as starting material for the FPLC purification of soluble rBoNTF(Hc) while the pellet was used as starting material for the resolubilized rBoNTF(Hc) purification. Example 4. Conventional Purification of rBoNTF(Hc) from P. pastoris
The rBoNTF(Hc) protein was puπfied to homogeneity using an FPLC system and two chromatographic steps. First, the mateπal was subjected to cation exchange chromatography (Figure 21 A) FPLC purification of soluble rBoNTF(Hc)
Soluble rBoNTF(Hc) was puπfied by using a Pharmacia model 500 FPLC system (Pharmacia, Uppsala, Sweden) with programmed elution and A280 monitoπng The starting mateπal was loaded onto a Pharmacia HR 10/10 Mono S cation-exchange column equilibrated with 50 mM Na2HP0J2 mM Na EDTA/l mM PMSF, pH 6.8 (buffer A) at a flow rate of 2 ml/min (150 cm h) The column was washed with 16 ml (2 bed volumes) of buffer A Flow through and wash were collected separately and stored for subsequent analysis Protein was eluted from the column with a linear gradient from 0 to 300 mM NaCl over 80 ml (10 bed volumes), then a linear gradient from 300 to 1000 mM NaCl over 20 ml (2.5 bed volumes), and then an isocratic gradient at 1000 mM over 10 ml (1.25 bed volumes) Four-ml fractions were collected throughout the linear and isocratic gradients. This step was highly efficient as most pichia proteins possess isoelectπc points between pH 5 and 7 and, therefore, pass through the column without binding. Fractions eluting between 230 and 260 mM NaCl were positive for rBoNTF(Hc) by Western blot analysis and were pooled The pooled fractions were adjusted to 1.5 M ammonium sulfate by the slow addition of 2 M (NH4)2SO4 50 mM Na2HPOJ2 mM Na2EDTA/25 mM NaCl, pH 7.5 with stir bar agitation A protein precipitate formed which consisted pπmaπly of yeast proteins with a small amount of rBoNTF(Hc) product (approximately 10%) The precipitate was removed by centπfugation at 6000 g for 10 min at 4°C with a Sorval SS-34 rotor Fortunately, when the pool of Mono S column fractions was diluted with ammonium sulfate, most of the rBoNTF(Hc) product remained in solution (approximately 90%) while significant quantities of pichia proteins salted out The first step enπched the desired product from <0.5 to 26% of the total protein (Table 2). HIC was used as a second chromatographic step (Figure 21B) and separated proteins based on their differences in surface hydrophobicity. It was determined that neopentyl chemistry provided the appropπate hydrophobic interaction with rBoNTF(Hc). The supernatant was loaded onto a Pharmacia alkyl superose 10/10 hydrophobic interaction chromatography (HIC) column equilibrated with 1.5 M (NH )2SO4/50 mM Na2HPOJ2 mM Na2EDTA/25 mM NaCl, pH 7.5 (buffer B) at a flow rate of 1 ml/min (75 cm/h). The column was washed with 8 ml (1 bed volume) of buffer B Protein was eluted from the column with a linear gradient of decreasing (NH4)2SO4 from 1.5 to 0 M over 60 ml (7.5 bed volumes). The rBoNTF(Hc) eluted from the HIC column at 0.92 M ammonium sulfate in a volume of 3 ml with a protein concentration of 0.52 mg/ml. Fractions positive by Western blot analysis and which only showed a single band by SDS/PAGE were pooled and dialyzed extensively in 50 mM Na2HPO4 2 mM Na2EDTA, pH 6.8
The recovery of purified product from cell extract was estimated to be greater than 42%, with a yield of 140 mg/kg of cell paste (Table 2). The resulting rBoNTF(Hc) was judged to be greater than 98% pure as only a single band was detected by SDS-PAGE (Figure 20) even when moderately (4 μg) overloaded. Capillary isoelectric focusing showed the antigen possessed an isoelectric point of 9.4 (data not shown), which is in reasonable agreement with the calculated pi of 9.1.
TABLE 2 Purification of soluble rBoNTF(Hc)
Total protein concentration was determined by Pierce BCA , T"MV1 assay rBoNTF(Hc) was identified by Western blot analysis and purity was estimated by analysis of individual lanes of SDS/PAGE by pixel densitometry using NIH imaging software.
Concentration Protein rBoNTF(Hc) Purity Fold Reco
Step (mg/ml) (mg) (mg) (%) Purification (
Lysate 11 1100 5.6 <0.5 — 3.
Dialzed extract 7.8 740 3.7 <0.5 — 6
Mono S 1.2 9.6 2.5 26 >52 4
Alyl superose 0.52 1.6 1.6 100 3.8 2
CD of purified soluble and resolubilized rBoNTF(Hc) Purified soluble and resolubilized rBoNTF(Hc) were subjected to CD spectroscopy in a Jasco 600 spectropolarimeter (Japan Spectroscopy company, Tokyo, Japan) Experiments were performed at a concentration of 30 μg/ml (0.62 μM) in a 1 cm path length cell in 10 mM Na2HPO , pH 7.0 Spectra were obtained as an average of four accumulations, scanned from 260-200 nm, at a scan rate of 10 nm/min, with a 2 sec response, and a 1 nm band width The temperature was maintained at 20°C with a Peltier thermocontrol device.
Analysis of the far-UV circular dichroism spectrum (Figure 22) of the purified antigen showed a positive peak at 233 nm and a minimum at 214 nm. This suggests the molecule is in a folded conformation and possesses considerable β- sheet.
Example 5. Purification of Resolubilized rBoNTF(Hc)
Western blot analysis revealed that approximately 30-40% of the total expressed rBoNTF(Hc) was present in the insoluble pellet after cell lysis. To investigate whether this insoluble protein could be recovered, the pellet was extracted in the denaturant urea and then dialyzed in nondenaturing buffer.
FPLC purification of resolubilized rBoNTF(Hc)
The cell lysate pellet was resuspended into 20 ml of 3 M urea/50 mM Na2HPO4, pH 7.0 and extracted 15 h at 4°C on a Labquake rotator. The cellular components not solubilized by the denaturing buffer were removed by centrifugation with a Sorval SS-34 rotor at 15000 g for 10 min at 4°C The supernatant was dialyzed extensively using 10 kDa MWCO Pierce Slide-A-Lyzer dialysis cassettes in buffer A. A slight precipitate formed during the dialysis which was removed by centrifugation as described above Western blot analysis showed that rBoNTF(Hc) was present only in the supernatant, which was estimated to be about 35% pure by
SDS/PAGE. The supernatant was loaded onto a Pharmacia HR 10/10 Mono S cation-exchange column and separated by the same conditions as above. Fractions containing only a single positive rBoNTF(Hc) band SDS/PAGE and Western blot analysis were pooled and dialyzed in 50 mM Na2HPO4/2 mM Na2EDTA, pH 6.8 in
10 kDa MWCO dialysis cassettes The final resolubilized rBoNTF(Hc) product was judged to be greater than 98% pure as determined by SDS/PAGE.
After a single cation exchange chromatography separation step, the rBoNTF(Hc) was greater than 98% pure as judged by SDS-PAGE. The total yield of purified resolubilized rBoNTF(Hc) was 100 mg/kg of cell paste. The conformation of purified resolubilized antigen showed significant β-sheet as determined by CD spectral analysis (Figure 22). However, the overall fold appeared slightly different than that shown by rBoNTF(Hc) purified from the cell lysate supernatant. The primary difference was the lack of a positive peak at 233 nm, indicating differences in β-sheet. content.
Example 6. Mouse Immunogenicity and Efficacy Studies To assess the immunogenicity of the recombinant rBoNTF(Hc), mice were inoculated with either one, two, or three doses of purified rBoNTF(H ) from the soluble fraction of lysate at doses ranging from 0.008 to 5 μg per mouse.
Mouse inoculations and BoNTF toxin challenge
Mice, Crl:CD-l, ICR mice (Charles River, NC, U.S.A.) weighing 16-22 g on receipt, were injected intramuscularly (i.m.) with purified rBoNTF(Hc) Mice were challenged intraperitoneally (i.p.) 21 days after their last rBoNTF(Hc) injection with BoNTF toxin complex (Langeland strain) diluted in .0.2% (w/v) gelatin/0.4% (w/v) Na2HPO4, pH 6.2, in 100 μl total volume per mouse. Groups of five naive mice were also used as toxin controls Mice were observed daily and deaths were recorded five days post challenge. All animal manipulations were in accordance with applicable regulations in AAALAC-accredited facilities.
The efficacy of the purified soluble rBoNTF(Hc) was determined by inoculating groups of five female mice with one, two, or three doses of 0.008, 0.04, 0.2, 1.0, or 5.0 μg rBoNTF(Hc) (diluted in 100 μl of 0.2% (v/v) Alhydrogel (Superfos Biosector, Kvistgaard, Denmark) in 0.9% (w/v) saline) per mouse at 14 day intervals. Two days before challenge, mice were bled retroorbitally and serum was collected for ELISA testing Mice were challenged with 1000 mouse i.p LD5o of BoNTF toxin complex.
All of the mice, including five naϊve controls, were challenged with 1000 mouse ip LD50 of BoNTF toxin. The controls all died within 2-4 h. A dose response was observed from groups of mice receiving different numbers of inoculations (Table 3). A single inoculation of 5 μg protected four of five mice, while a dose of 0.2 μg or below protected one or no mice. Two and three inoculations protected four of five and five of five mice at doses of 0.2 and 0.04 μg, respectively. At all dose levels studied, the number of surviving mice increases with the number of inoculations. Serum antibody titers for each individual mouse were determined by ELISA, followed by calculation of the geometric mean titers for each group in the study.
Mouse serum ELISA
Individual mouse serum ELISAs were performed as previously described (Byrne, 1998) except for the following differences. Botulinum neurotoxin serotype F (Langeland strain, Food Research Institute, University of Wisconsin, Madison, Wl, U.S.A.) was used as the coating antigen and the positive control for each assay was a mouse IgG monoclonal antibody, 7F8.G2.H3 (Brown, D.R., et al., (1997), "Identification and Characterization of a Neutralizing Monoclonal Antibody Against Botulinum Neurotoxin, Serotype F, Following Vaccination with Active Toxin," Hybridoma, 16:447-456).
TABLE 3. Survival, antibody group ELISA titers, and serum neutralization titers of mice after inoculation with purified soluble rBoNTF(Hc) Mice were challenged with 1000 i.p. LD50 BoNTF toxin 21 days after last inoculation. Antibody ELISA titers were measured as the reciprocal of the highest dilution having an OD405 greater than 0.2 AU after correcting for background. Geometric mean ELISA titers were determined by taking the geometric mean of the logarithm of the individual titers. Standard deviations of the geometric means are also reported. If the ELISA titer was determined to be below the detection limit of the assay (<100), the ELISA titer was arbitrarily assigned a value of 25. A geometric mean titer value of 1.4 means that all ELISA titers within that group were below the detection limit. Vaccination Survival (alive/5 tested) Geometric mean ELISA titers dose (μg) IX 2X 3X IX 2X 3X
0.008 0* 0 2 1.4 1.4 1.6±0.3
0.04 0 1 4 1.4 1.5±0.3 2.4±0.8
0.2 1 4 5 1.4 2.1±0.9 2.9±1.3
1.0 2 5 5 1.4 2.8±0.3 4.3±0.3
5.0 4 4 5 1.6±0.3 2.8±0.9 4.1±0.5
* Only four mice were tested within this group Statistical analysis
The logistic regression model was used to test associations of geometric mean ELISA titers and individual titers with survival by using SAS, version 6.10. Geometric mean titers correlated well with protection (Table 3). The three groups with no survivors had geometric means titers below the detection limit of the assay (1.4). Similarly, the four groups that showed complete protection had geometric means titers of 2.8 or greater. Individual mouse antibody titers correlated extremely well with protection (Table 4). Only 7 out of 38 mice survived whose titers were below 100. On the other hand, 34 out of 34 survived whose titers were 100 or greater. One mouse in the study could be classified as a "nonresponder." The mouse, receiving two injections at the highest dose level, had an antibody titer below the detection limit and did not survive the BoNTF challenge. The rest of the mice in that particular group had titers of 1600 or greater.
TABLE 4. Correlation of individual antibody ELISA titer with protection after inoculation with purified soluble rBoNTF(Hc)
Serum was bled from each mouse individually Titer is reciprocal of the highest dilution having an OD 05 greater than 0.2 AU after correcting for background. Mice were challenged with 1000 i.p LDso BoNTF toxin 21 days after last inoculation.
Individual Survival ELISA titer (alive/total)* % survival
<100 7/38 18.4
100 7/7 100
400 4/4 100
1600 11/11 100
6400 3/3 100
25600 9/9 100
* The individual antibody titers from three mice were not measured. Two mice did not offer enough serum and one mouse was not challenged. The resolubilized antigen was also evaluated for immunogencity and protective efficacy by its ability to protect mice from a BoNTF toxin challenge. Groups of 10 male mice each received three inoculations of either 1 μg or 5 μg of rBoNTF(Hc) (diluted in 100 μl 0.2% (v/v) Alhydrogel in 0.9% (w/v) saline) per mouse at 14 day intervals. Two days before challenge, mice were bled retroorbitally and serum was collected for ELISA testing. Mice inoculated with 1 μg doses were challenged with 5000 mouse ip LD50 of BoNTF toxin. Ten of ten mice survived the challenge. Because 100% protection was observed with the group inoculated with 1 μg doses, the group that received three doses of 5 μg were subjected to a challenged level two orders of magnitude greater in order to test the limits of the antigen. Therefore, the 5 μg dose group was challenged with 500,000 mouse ip LD5o of BoNTF toxin. None of the mice survived the challenge; however, a significant delay in time to death was observed (24-48 h). All the control mice succumbed within 2-4 h after challenge.
Example 7. Synthesis and clonining of a synthetic gene encoding rBoNTA (Hc)
The preparation of genetically engineered proteins to provide protection from the toxins produced by Clostridium botulinum was accomplished in E. coli.
Restriction endonucleases and DNA modifying enzymes were obtained from GIBCO BRL (Gaithersburg, Maryland). Polymerase chain reaction (PCR) reagents were purchased from Perkin-Elmer Cetus (Norwalk, CT). SDS PAGE precast gels and running buffers were acquired from Amersham (Arlington Heights, Illinois). All oligonucleotides were synthesized by Macromolectular Resources (Ft. Collins, Colorado). ELISA reagents were obtained in house or from Sigma (St. Louis, Missouri) or Kirkegard and Perry Laboratories (Gaithersburg, Maryland). The Escherichia coli host was K12DH5a, purchased as competent cells from GIBCO BRL. Expression vectors pMAL from New England Biolabs (Beverly, Massachusetts) and pKK233-2 from Pharmacia LKB (Piscataway, New Jersey) were used according to the manufacturers' standard protocols. The DNA clone coding of the Hc domain of c. botulinum toxin serotype A was pCBA3, kindly provided by Nigel Minton.
Oligonucleotide primers incorporating appropriate terminal restriction enzyme sites were used to PCR amplify the He region of the C. botulinum clone pCBA3. Gel-purified insert DNA and vector DNA were cleaved with the appropriate restriction enzymes, purified on low melting point agarose, and ligated overnight at room temperature. Competent DH5a host cells were transformed according to suppliers recommendations and plated on LB plates with 100 ug/ml ampicillin. Protein electrophoresis was run on precast 11-20% SDS PAGE at the manufacturer's recommended parameters. ELISA plates were incubated with capture antibody (horse an ti -botulinum A polyclonal serum) overnight, then blocked with skim milk prior to application of various dilutions of test material, signal antibody (rabbit antibotulinum A polyclonal serum), signal HRP conjugated anti-(rabbit IgG) and ABTS substrate solution. Plates were read on an automated reader at 405 nm.
The sequence of the C fragment of the A chain was deduced as:
RYESNHLIDLSRYASKINIGSKVNFDPIDKNQIQLFNLESSKIEVILKNA IVYNSMYENFSTSFWIRIPKYFNSISLNNEYTΠNCMENNSGWKVSLNYGEII WTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYINGRLID QKPISNLGNFFLASNNIMFKLDGCRDTHRYIWIFYFNLFDKELNEKEIKDLYDN QSNSGILKDFWGDYLQYDKPYYMLNLYDPNKYVDVNNVGIRGYMYLKGP RGSVMTTNIYLNSSLYRGTKFΠKKYASGNKDNIVRNNDRVYINVVVKNKE YRLATNASQAGVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQ DNNGNDIGFIGFHQFNNIAKLVASNWYNRQIERSSRTLGCSWEFIPVDDGWG
ERPL
The C fragment protein sequence was reverse translated using E. coli optimal codon usage. The gene was then altered in many places to insert restriction sites, start codon, stop codon. Other changes were also effected to make the molecule more appropriate for use in the vector. Throughout, the fidelity of the protein sequence generated therefrom was maintained.
The sequence for the synthetic gene is found below: CTCGAGCCATGGCTCGTCTGCTGTCTACCTTCACTGAATACATCAA GAACATCATCAATACCTCCATCCTGAACCTGCGCTACGAATCCAATCACC TGATCGACCTGTCTCGCTACGCTTCCAAAATCAACATCGGTTCTAAACTT AACTTCGATCCGATCGACAAGAATCAGATCCAGCTGTTCAATCTGGAAT CTTCCAAAATCGAAGTTATCCTGAAGAATGCTATCGTATACAACTCTATG TACGAAAACTTCTCCACCTCCTTCTGGATCCGTATCCCAAATACTTCAAC TCCATCTCTCTGAACAATGAATACACCATCATCAACTGCATGGAAAACA ATTCTGGTTGGAAAGTATCTCTGAACTACGGTGAAATCATCTGGACTCTG CAGGACACTCAGGAAATCAAACAGCGTGTTGTATTCAAATACTCTCAGA TGATCAACATCTCTGACTACATCAATCGCTGGATCTTCGTTACCATCACC AACAATCGTCTGAATAACTCCAAAATCTACATCAACGCCGTCTGATCGA CCAGAAACCGATCTCCAATCTGGGTAACATCCACGTTCTAATAACATCAT GTTCAAACTGGACGGTTGTCGTGACACTCACCGCTACATCTGGATCAAAT ACTTCAATCTGTTCGACAAAGAACTGAACGAAAAAGAAATCAAAGACCT GTACGAC A ACC AGTCC A ATTCTGGT ATCCTG A A AGACTTCTGGGGTG ACT ACCTGCAGTACGACAAACCGTACTACATGCTGAATCTGTACGATCCGAA CAAATACGTTGACGTCAACAATGTAGGTATCCGCGGTTACATGTACCTG AAAGGTCCGCGTGGTTCTGTTATGACTACCAACATCTACCTGAACTCTTC CCTGTACCGTGGTACCAAATTCATCATCAAGAAATACGCGTCTGGTAAC AAGGACAATATDCGCAACAATGATCGTGTATACATCAATGTTGTAGTTA AGAACAAAGAATACCGTCTGGCTACCAATGCTTCTCAGGCTGGTGTAGA AAAGATCTTGTCTGCTCTGGAAATCCCGGACGTTGGTAATCTGTCTCAGG TAGTTGTAATGAAATCCAAGAACGACCAGGGTATCACTAACAAATGCAA AATGAATCTGCAGGACAACAATGGTAACGATATCGGTTTCATCGGTTTCC ACCAGTTCAACAATATCGCTAAACTGGTTGCTTCCAACTGGTACAATCGT CAGATCGAACGTTCCTCTCGCACTCTGGGTTGCTCTTGGGAGTTCATCCC GGTTGATGACGGTTGGGGTGAACGTCCGCTGTAACCCGGGAAAGCTT
This gene has been synthesized using a large number of oligomers of approximately 60-65 bases corresponding to the sequences of the + and - strands. The oligomers had overlaps of 7 bases. The oligomers were allowed to anneal and were ligated to form 5 subunits of 250-300 base pairs each. Each subunit had been designed to have restriction sites at their termini which allowed them to be assembled in the right order to form the complete gene. On confirmation there was shown that the correct gene had 7 deletion errors. These errors were repaired using in vitro mutagenesis and the repair sites sequenced to confirm.
Example 8. Synthesis and cloning of a synthetic gene encoding rBoNTB (Hc)
The C fragment for botulism toxin serotype B of Whelan was studied and the portion of the protein having the sequence
FNKYNSEILNNIILNLRYKDNNLIDLSGYGAKVEVYDGVELNDKNQF I^TSSANSKIRVTQNQNIΠ^SVFLDFSVSFWIRIPKYKNDGIQNYIHNEYTΠN CMKNNSGWKISIRGNRITWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTIT NNLNNAKIYINGKUESNTDIKDIREVIANGEIIFKLDGDIDRTQFIWMKYFSIF NTELSQSNIEERYKIQSYSEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKLK KDSPVGEILTRSKYNQNSKYINYRDLYIGEKΠIRRKSNSQSINDDIVRKEDYI YLDFF-NLNQEQRVYTYK.KFKKEEEKLFLAPISDSDEFYNTIQIKEYDEQPTY SCQLLFKKDEESTDEIGLIGIHRFYESGIVFEEYKDYFCISKWYLKEVKRKPY NLKLGCNWQFIPKDEGWTE was defined as the C fragment.
The synthetic gene for expression in E. coli was produced in the manner described for synthesis of the gene for the C fragment of the A strand, namely, using a large number of oligomers of approximately 60-65 bases corresponding to the sequences of the _+ and - strands with overlaps of 7 bases. The oligomers were allowed to anneal and were ligated to form subunits of 250-300 base pairs each. Each subunit had been designed to have restriction sites at their termini which allowed them to be assembled in the right order to form the complete gene, the synthetic gene for encoding the c fragment of the B toxin was as follows:
ATGGCTTTCAACAAATACAATTCCGAAATCCTGAACAATATCATC CTGAACCTGCGTTACAAAGACAACAATCTGATCGATCTGTCTGGTTACGG TGCTAAAGTTGAAGTATACGACGGTGTTGAACTGAATGACAAGAACCAG TTCAAACTGACCTCTTCCGCTAACTCTAAGATCCGTGTTACTCAGAATCA GAACATCATCTTCAACTCCGTATTCCTGGACTTCTCTGTTTCCTTCTGGAT CCGTATCCCGAAATACAAGAACGACGGTATCCAGAATTACATCCACAAT GAATACACCATCATCAACTGCATGAAGAATAACTCTGGTTGGAAGATCT CCATCCGCGGTAACCGTATCATCTGGACTCTGATCGATATCAACGGTAAG ACCAAATCTGTATTCTTCGAATACAACATCCGTGAAGACATCTCTGAATA CATCAATCGCTGGTTCTTCGTTACCATCACCAATAACCTGAACAATGCTA AAATCTACATCAACGGTAAACTGGAATCTAATACCGACATCAAAGACAT CCGTGAAGTTATCGCTAACGGTGAAATCATCTTCAAACTGGACGGTGAC ATCGATCGTACCCAGTTCATCTGGATGAAATACTTCTCCATCTTCAACAC CGAACTGTCTCAGTCCAATATCGAAGAACGGTACAAGATCCAGTCTTAC TCCGAATACCTGAAAGACTTCTGGGGTAATCCGCTGATGTACAACAAAG AATACTATATGTTCAATGCTGGTAACAAGAACTCTTACATCAAACTGAA GAAAGACTCTCCGGTTGGTGAATCCTGACTCGTTCCAAATACAACCAGA ACTCTAAATACATCAACTACCGCGACCTGTACATCGGTGAAAAGTTCATC ATCCGTCGCAAATCTAACTCTCAGTCCATCAATGAGACATCGTACGTAAA GAAGACTACATCTACCTGGACTTCTTCAACCTGAATCAGAATGGCGTGTA TACACCTACAAGTACTTCAAGAAAGAAGAAGAAAAGCTTTTCCTGGCTC CGATCTCTGATTCCGACGA ACTCTAC AAC ACC ATCC AG ATC AA AGAATA CGACGAACAGCCGACCTACTCTTGCCAGCTGCTGTTCAAGAAAGATGAA GAATCTACTGACGAAATCGGTCTGATCGGTATCCACCGTTTCTACGAATC TGGTATCGTATTCGAAGAATACAAAGACTCTTCTGCATCTCCAAATGGTA CCTGAAGGAAGTTAAACGCAAACCGTACAACCTGAAACTGGGTTGCAAT TGGCAGTTCATCCCGAAAGACGAAGGTTGGACCGAATAGTAACCTCTAG AGTCGAGGCCTGCAG Cloning:
Supernatants of sonicated, IPTG-induced recombinant pMAL fusion E. coli cultures were tested for the presence of the botulinum He expression product by ΕLISA and SDS-PAGΕ gels stained with coomassie brilliant blue were unsuccessful. Attempts to express He fragment as a non-fusion product were unsuccessful. Initial characterization of plasmid DNA from putative clones in pKK233-2 demonstrated an insert of the expected size was present. In addition, SDS-PAGΕ indicated the presence of a protein of approximately 50 kDa after induction. However, the recombinants appeared unstable and further preparations of this and other cultures failed to reproduce these results. This approach was subsequently abandoned in favor of the fusion product expression. Example 9 Immunization Trials:
Although attempts to quantitate expressed He fusion products were unsuccessful, limited immunization trials were performed on mice to evaluate the vaccine potential of the product. Initial vaccination employed concentrated, crude E. coli lysate with complete Freund's adjuvant. Two weeks later, animals were boosted with amylose column-purified expression product with Freund's incomplete adjuvant. At this time, a second group of five animals received amylose purified product in Freund's incomplete adjuvant as a single vaccination. After two additional weeks, both groups were challenged intraperitoneally with a dose of 3 LD50 of toxin. All eleven animals receiving two immunizations with Hc survived while six of the twelve control animals receiving pMAL vector alone died. Likewise, all five animals receiving one H vaccination survived while animals receiving the pMAL vector alone died.
Four weeks after the initial challenge with 3 LD50 of toxin, nine of the eleven animals who had received two immunizations were exposed to 30, 300, or 1200 LD50 doses of toxin. The animals succumbing to the toxin challenge of 30 and 300 LD50 did not exhibit fatality typical of botulinum toxin poisoning in that they appeared healthy after 18 hours, but were dead a few hours thereafter. In contrast, the animal which died from the 1200 LD50 dose appeared moribund when examined at 18 hours and remained so until death. This reaction is consistent with symptoms usually observed with botulinum toxin-induced paralysis. Additional data on second challenge is shown on Table 5. Hence, it was shown that immunization with the genetically engineered toxin protected against large doses of the toxin.
It is also possible to produce antibodies using the genetically engineered toxin. Because the toxin is not disease-producing in the animal, it is possible to produce large amounts of antitoxin more cheaply. It is also possible to produce antitoxin using hybridoma technology. TABLE 5
PROTECTION OF MICE IMMUNIZED WITH Hc OF A TOXI DERIVED FROM SYNTHETIC GENE (# of deaths/total animals)
Figure imgf000043_0001
3000 0/1
The animals received vaccinations of crude lysated cell material at 0, 2 and 4 weeks. Challenges were administered intraperitoneally with serotype A toxin at 5 weeks.
Example 10 rBoNTA(Hc) purification and protective effect
Recombinant BoNTA(Hc) peptide was produced recombinantly in yeast. The first step in the purification process for BoNTA(Hc) was a Streamline expanded bed chromatography column. The product was eluted by a sodium chloride step gradient. Product eluted from the expanded bed chromatography column was estimated to be 10% pure with a total protein concentration of 0.92 mg/ml. After dialyzing the salt away, the material was loaded onto a mono S cation exchange column for further purification. Western blot and ELISA data indicated that BoNTA(Hc) eluted from the column at 110 mM sodium chloride. The Mono S pool was subjected to HIC as a final purification step and thus, the material was adjusted to 1.5 M ammonium sulfate. The Mono S product was loaded onto a HIC column and eluted with a gradient of decreasing ammonium sulfate. Product eluted at 1.04 M ammonium sulfate and BoNTA(Hc) immunologically positive fractions were combined and dialyzed to remove ammonium sulfate. Only a 50 kDa BoNTA(Hc) band was detected by SDS-PAGE and Western blot analysis and was judged to be greater than 95% pure after the final step. Protective effect of this purified material was measured by immunizing mice with 1 dose followed by challenge with 1000 LD50 of BoNTA(Hc). The results are shown in Table 6 below. Table 6 Potency assay: 1 dose followed by challenge with 1000 LD50 of BoNTA(Hc)
Figure imgf000044_0001
Example 11 rBoNTB(Hc) purification and protective effect Recombinant BoNTC(Hc) peptide was produced recombinantly in yeast. The first separation technique employed for the purification process for BoNTB(Hc) was Streamline chromatography (Pharmacia), which is a single pass expanded bed adsorption operation where proteins can be recovered from crude feed stock or cell lysate without prior clarification. Significant clean-up was accomplished in this step as the MES buffer system prohibited binding of a large percentage of unwanted proteins to the SP resin. Protein was loaded onto the column at a concentration of 123 mg/mL-resin, using 20 mM MES buffer, pH 5.7 with 10 mM NaCl. The product pool was eluted in a single step. Under the conditions investigated, on average 3.9% of the total protein loaded was recovered in the elution peak, and the product pool was approximately 70% BoNTB(Hc) fragment based on SDS-PAGE.
The second chromatography step in the process utilizes Poros HS, another strong cation exchange resin. The buffer system was similar to that used for Streamline SP, however enhanced selectivity of Poros HS enriched the product peak to about 85% purity.
The product peak eluted during the gradient at approximately 130 mM NaCl. Strongly bound proteins were eluted with 1 M NaCl.
The final chromatography step utilized a Poros PI column. Analysis of the PI fractions by SDS-PAGE and IEF revealed that the product band, a single band at 50 kD on SDS-PAGE, was present in the pH 8.0 fraction. Analysis of purified BoNTB(Hc) fragment by 2-D electrophoresis resulted in one major spot and two minor, faint spots from the Pi-peak 1 fraction. Peak 2 contained several spots at two different molecular weights corresponding to 50 kD and 47 kD. Presumably these spots represent different isoforms. IEF banding patterns detected in the first dimension are in agreement with those seen in Phast IEF for the two peaks. The protective efficacy of this material was determined by potency assay of 1 dose followed by challenge with 1000 LD50 of BoNTB(Hc). The results are shown in the following Table 7.
Table 7 BoNTB(Hc
Figure imgf000045_0001
Example 12 rBoNTC(Hc) purification and protective effect
Recombinant BoNTC(Hc) peptide was produced recombinantly in yeast. The initial chromatography step used for the purification process for BoNTC^Hc) was a Mono Q anion-exchange column. The column was equilibrated with 50 mM sodium phosphate, 0.2% (W/V) CHAPS, 2 mM EDTA, pH 7.0. The CHAPS was incorporated into the column buffers to allow product to elute from the column over a narrower sodium chloride concentration. Fractions positive for BoNTC^Hc) by Western analysis were pooled and adjusted to 1 M ammonium sulfate. A moderate precipitate formed which was removed by passing the material through a 0.2 μ filtration unit. The clarified Mono Q product pool was subjected to hydrophobic interaction chromatography using a Pharmacia alkyl superose column. This final step removed the remainder of the impurities liberating BoNTCι(Hc) product which was estimated to be greater than 98% pure as judged by SDS/PAGE. Protective effect of this purified material was measured by immunizing mice with 1 dose followed by challenge with 1000 LD50 of BoNTCι(Hc). The results are shown in Table 8 below.
Table 8. Potency Assay: One dose followed by challenge with 1000 LD50 of BoNTCι(Hc)
Figure imgf000046_0001
For purposes of clarity of understanding, the foregoing invention has been described in some detail by way of illustration and example in conjunction with specific embodiments, although other aspects, advantages and modifications will be apparent to those skilled in the art to which the invention pertains. The foregoing description and examples are intended to illustrate, but not limit the scope of the invention. Modifications of the above-described modes for carrying out the invention that are apparent to persons of skill in medicine, immunology, hybridoma technology, pharmacology, and/or related fields are intended to be within the scope of the invention, which is limited only by the appended claims.
All publications and patent applications mentioned in this specification are indicative of the level of skill of those skilled in the art to which this invention pertains. All publications and patent applications are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference. . 7021 AβAeld Coβon Frictu
Figure imgf000047_0001
1M7 11:40
Mat ATG 90.00 1.00
From : Menu A0X2 β«n« It* ATA 0.00 o.oo
HEFORUAT of: aoa2atrpic.dat Cft cJt: 9β4i IIP ATT-\ 93.00 0.30 from: 1 to: 1992 27-UAY-1987 11:41 no ATC-' 72.00 0.44
From : Ft en 1 0A31 gana Thr ACQ 3.00 0.03
REFORMAT of-: daaUtruc.dat Check: 3191 Thr ACA 8.00 0.03 from: 1 to: 2124 22-APR-I94T7 13:08 Thr ACT 88.00 0.50
Thr ce 74.00 0.43
From : F I en 140AS2 flpn*
REFORMAT of: das2atrue.dat eftβelC: 5479 Trp TCC 39.00 1.00 from: 1 to: 2124 1S-JUM-1987 14:33 End TCA 0.00 O.OO
« cy« TGT 33.00 0.83
From : Plcnta"GAP gent cya TCC 7.00 0.17
RE OR AT of: egacstrue.dat cftaeK: 9039 from: 1 10: 1002 1S-JUN-1987 1*:3β Cnd TAG 1.00 0.2O
End TAA 4.00 0.8O
Tyr TAT 18.00 0.12
AfflACId Coβon NuflitMr Fraction Tyr TAC 128.00 0.88
αiy GGG 0.00 o.oα leu TTβ 120.00 0.32 βly GCA 39.00 0.22 leu TTA 21.00 0.09 βiy GCΓ 197.00 0.74 •iw TTT 24.00 0.19 βly CCC 9.00 0.03 Phβ TTC 104.00 0.81
GIu GAG 112.00 0.38 S«r TCC 8.00 0.03
Cm GAA 80.00 0.42 e TCA 14.00 0.07
ASO GAT Sβ.00 0.32 ST TCT^ 89.00 0.47
Aao ■ GAC 11β.00 0.88 r TCC-' 71.00 0.37
V«| 6TC 10.00 0.05 f CCG 2.00 0.01
V I GTA 1.00 0.04 ς CCA 0.00 0.00
Vai GTT--. 107.00 0.50 A e CCT 28.00 0.18
V«| cτcJ 07.00 0.41; Arg CC 0.00 0.00 00 0.34
Ata GC6 1.00 0.00 cm CAG-N 31.
Ala GCA 25.00 0.10 cm CAA-' 59.00 0.66
Ait GCT 147.00 0.80 HI* CAT 11.00 0.13
Ai« CCC 71.00 0.29 HI* CAC 77.00 .ββ
re AGG( 2.00 0.01 l«u re 33.00 0.13
Arg AGA' 111.00 0.79 l«u CTA 7.00 0.03
J«r AGT 8.00 0.04 LIU CTT 43.00 0.18
ST AGC 3.00 0.02 C«u CTC 7.00 0.03
Lya AAG US.00 0.79 Fro CCC 0.00 0.00
«-yj AAA 3a. oo 0.21 Fro CCA 97.00 0.57
Aan AAT 19.00 0.13 Fro CCT •a. oo 0.39
Asn •'AAC 119.00 0.87 Fro ccc 7.00 0.04
Figure imgf000047_0002

Claims

CLAIMS:
1. A nucleic acid encoding the carboxy-terminal portion of the heavy chain (He) of botulinum neurotoxin (BoNT) selected from the group consisting of BoNT serotype A, BoNT serotype B, BoNT serotype Ci, BoNT serotype D, BoNT serotype E, BoNT serotype F, and BoNT serotype G, wherein said nucleic acid is expressable in a recombinant organism selected from Escherichia coli and Pichia pastoris.
2. The nucleic acid of claim 1, wherein said nucleic acid comprises a nucleic acid sequence selected from SEQ ID No:l (serotype A), SEQ ID No:7 (serotype B),
SEQ ID No:9 (serotype C,), SEQ ID No: 11 (serotype D), SEQ ID No: 13 (serotpye E), SEQ ID No: 15 (serotype F), and SEQ ID No: 17 (serotype G).
3. The nucleic acid of claim 1, wherein the nucleic acid encodes an He amino acid sequence of BoNT selected from SEQ ID No:2 (serotype A), SEQ ID No:8 (serotype B), SEQ ID No: 10 (serotype C,), SEQ ID No: 12 (serotype D), SEQ ID No: 14 (serotpye E), SEQ ID No: 16 (serotype F), and SEQ ID No: 18 (serotype G).
4. A nucleic acid encoding the amino-terminal portion of the heavy chain (HN) of botulinum neurotoxin (BoNT) selected from the group consisting of BoNT serotype B, BoNT serotype Ci, BoNT serotype D, BoNT serotype E, BoNT serotype F, and BoNT serotype G, wherein said nucleic acid is expressable in a recombinant organism selected from Escherichia coli and Pichia pastoris.
5. The nucleic acid of claim 4, wherein said nucleic acid comprises a nucleic acid sequence selected from SEQ ID No:21 (serotype B), SEQ ID No:23 (serotype Ci), SEQ ID No:25 (serotype D), SEQ ID No:27 (serotpye E), SEQ ID No:29 (serotype F), and SEQ ID No:31 (serotype G).
6. The nucleic acid of claim 4. wherein the nucleic acid encodes an HN amino acid sequence of BoNT selected from SEQ ID No:22 (serotype B), SEQ ID No:24 (serotype C,), SEQ ID No:26 (serotype D), SEQ ID No:28 (serotpye E), SEQ ID No:30 (serotype F), and SEQ ID No:32 (serotype G).
7. The nucleic acid of any one of claims 1, 3, 4, or 6, wherein the sequence of the nucleic acid is designed by selecting at least a portion of the codons encoding He from codons preferred for expression in a host organism.
8. The nucleic acid of claim 7, wherein the host organism is selected from gram negative bacteria, yeast, and mammalian cell lines.
9. The nucleic acid of claim 8, wherein the host organism is Escherichia coli or Pichia pastoris .
10. The nucleic acid of any one of claims 1, 3, 4, or 6, wherein the nucleic acid sequence encoding He is designed by selecting codons encoding H which codons provide He sequence enriched in guanosine and cytosine residues.
11. The nucleic acid of any one of claims 1, 3, 4, or 6, wherein said nucleic acid is a synthetic nucleic acid.
12. The nucleic acid of any one of claims 1, 3, 4, or 6, wherein said nucleic acid encoding H or HN is expressed in a recombinant host organism with higher yield than a second nucleic acid fragment encoding the same He sequence, said second nucleic acid fragment having the wild-type Clostridum botulinum sequence of He.
13. An expression vector comprising the nucleic acid of any one of claims 1, 3, 4, or 6, whereby He or HN is expressed upon transfection of a host organism with said expression vector.
14. A method of preparing a polypeptide comprising the carboxy-terminal portion of the heavy chain (He) of botulinum neurotoxin (BoNT) or the amino- terminal portion of the heavy chain (HN) of botulinum neurotoxin (BoNT) selected from the group consisting of BoNT serotype A, BoNT serotype B, BoNT serotype C, BoNT serotype D, BoNT serotype E. BoNT serotype F, and BoNT serotype G, said method comprising culturing a recombinant host organism transfected with the expression vector of claim 13 under conditions wherein He or HN is expressed.
15. The method of claim 14, wherein the recombinant host organism is a eukaryote.
16. The method of claim 14. further comprising recovering insoluble protein from said host organism, whereby a fraction enriched in He or H is obtained.
17. The method of claim 16, wherein said host organism is Pichia pastoris.
18. An immunogenic composition comprising the carboxy-terminal portion of the heavy chain (He) of botulinum neurotoxin (BoNT) selected from the group consisting of BoNT serotype A, BoNT serotype B, BoNT serotype C, BoNT serotype D, BoNT serotype E, BoNT serotype F, and BoNT serotype G.
19. The immunogenic composition of claim 18, wherein He is prepared by culturing a recombinant organism transfected with an expression vector encoding Hc.
20. The immunogenic composition of claim 19, wherein an insoluble protein fraction enriched in He is recovered from said recombinant organism.
21. An immunogenic composition comprising the amino-terminal portion of the heavy chain (HN) of botulinum neurotoxin (BoNT) selected from the group consisting of BoNT serotype A, BoNT serotype B, BoNT serotype C, BoNT serotype D, BoNT serotype E, BoNT serotype F, and BoNT serotype G.
22. The immunogenic composition of claim 15, wherein HN is prepared by culturing a recombinant organism transfected with an expression vector encoding
23. The immunogenic composition of claim 16, wherein an insoluble protein fraction enπched in HN IS recovered from said recombinant organism.
24. An immunogenic composition compπsing a polypeptide composing epitopes contained in the carboxy-terminal portion of the heavy chain (He) of botulinum neurotoxin (BoNT) or the ammo-terminal portion of the heavy chain (HN) of botulinum neurotoxin (BoNT) selected from the group consisting of BoNT serotype A, BoNT serotype B, BoNT serotype C, BoNT serotype D, BoNT serotype E, BoNT serotype F, and BoNT serotype G, said epitopes eliciting protective immunity toward the respective BoNT serotype.
25. The immunogenic composition of claim 25, wherein said immunogenic composition elicits an ELISA response to the respective BoNT serotype in an animal, said ELISA response being detectable upon 100-fold dilution of serum from said animal.
PCT/US2000/012890 1993-09-21 2000-05-12 Recombinant vaccine against botulinum neurotoxin WO2000067700A2 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
AU50035/00A AU783450B2 (en) 1999-05-12 2000-05-12 Recombinant vaccine against botulinum neurotoxin
EP00932296A EP1180999A4 (en) 1999-05-12 2000-05-12 Recombinant vaccine against botulinum neurotoxin
CA002371279A CA2371279A1 (en) 1999-05-12 2000-05-12 Recombinant vaccine against botulinum neurotoxin
JP2000616731A JP2004512004A (en) 1999-05-12 2000-05-12 Recombinant vaccine against botulinum neurotoxin
US09/611,419 US7214787B1 (en) 1993-09-21 2000-07-06 Recombinant vaccine against botulinum neurotoxin
US09/910,186 US7081529B2 (en) 1993-09-21 2001-07-20 Recombinant vaccine against botulinum neurotoxin
US11/437,212 US7786285B2 (en) 1993-09-21 2006-05-19 Recombinant vaccine against botulinum neurotoxin

Applications Claiming Priority (14)

Application Number Priority Date Filing Date Title
US13386999P 1999-05-12 1999-05-12
US13387399P 1999-05-12 1999-05-12
US13386699P 1999-05-12 1999-05-12
US13386899P 1999-05-12 1999-05-12
US13386799P 1999-05-12 1999-05-12
US13386599P 1999-05-12 1999-05-12
US60/133,873 1999-05-12
US60/133,867 1999-05-12
US60/133,865 1999-05-12
US60/133,869 1999-05-12
US60/133,868 1999-05-12
US60/133,866 1999-05-12
US14619299P 1999-07-29 1999-07-29
US60/146,192 1999-07-29

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
US12397593A Continuation-In-Part 1993-09-21 1993-09-21

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US12397593A Continuation 1993-09-21 1993-09-21
US09/611,419 Continuation US7214787B1 (en) 1993-09-21 2000-07-06 Recombinant vaccine against botulinum neurotoxin

Publications (2)

Publication Number Publication Date
WO2000067700A2 true WO2000067700A2 (en) 2000-11-16
WO2000067700A3 WO2000067700A3 (en) 2001-02-08

Family

ID=27568892

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2000/012890 WO2000067700A2 (en) 1993-09-21 2000-05-12 Recombinant vaccine against botulinum neurotoxin

Country Status (5)

Country Link
EP (1) EP1180999A4 (en)
JP (1) JP2004512004A (en)
AU (1) AU783450B2 (en)
CA (1) CA2371279A1 (en)
WO (1) WO2000067700A2 (en)

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2003012117A1 (en) * 2001-07-28 2003-02-13 The Secretary Of State For Defence Dna vaccine
US7037680B2 (en) * 1993-09-21 2006-05-02 The United States Of America As Represented By The Secretary Of The Army Recombinant light chains of botulinum neurotoxins and light chain fusion proteins for use in research and clinical therapy
FR2889066A1 (en) * 2005-07-28 2007-02-02 Centre Nat Rech Scient METHOD OF GENETIC IMMUNIZATION BY ELECTROTRANSFER AGAINST TOXIN AND ANTISERUM THAT CAN BE OBTAINED BY THIS PROCESS
US7227010B2 (en) * 1993-09-21 2007-06-05 United States Of America As Represented By The Secretary Of The Army Recombinant light chains of botulinum neurotoxins and light chain fusion proteins for use in research and clinical therapy
JP2008508886A (en) * 2004-08-04 2008-03-27 アラーガン、インコーポレイテッド Optimization of expression of active botulinum toxin type A
US7825233B2 (en) 2004-06-30 2010-11-02 Allergan, Inc. Optimizing expression of active Botulinum Toxin type E
WO2015004461A1 (en) * 2013-07-09 2015-01-15 Syntaxin Limited Cationic neurotoxins
WO2016110662A1 (en) * 2015-01-09 2016-07-14 Ipsen Bioinnovation Limited Cationic neurotoxins
JP2018515542A (en) * 2015-05-15 2018-06-14 ボード オブ リージェンツ オブ ザ ユニバーシティ オブ ネブラスカ Genetically engineered Clostridium botulinum toxin for molecular delivery to selected cells
CN110075288A (en) * 2019-05-06 2019-08-02 中国兽医药品监察所 A kind of nontoxic c-type clostridium botulinum genetic engineering subunit vaccine and its production method
CN112351992A (en) * 2017-12-20 2021-02-09 阿勒根公司 Botulinum toxin cell binding domain polypeptides and methods for their use in skin regeneration

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2009106163A (en) * 2007-10-26 2009-05-21 Kyushu Univ Nucleic acid sequence, vector, transformant, production method, and nucleic acid sequence primer
PT2491384E (en) 2009-10-21 2014-02-21 Merz Pharma Gmbh & Co Kgaa System for determining unprocessed and partially processed neurotoxin type a
GB201407525D0 (en) * 2014-04-29 2014-06-11 Syntaxin Ltd Manufacture of recombinant clostridium botulinum neurotoxins

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB9511909D0 (en) * 1995-06-12 1995-08-09 Microbiological Res Authority Vaccine

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
CAMPBELL K. ET AL.: 'Gene probes for identification of the botulinal neurotoxin gene and specific identification of neurotoxin types B, E and F, J' J. CLIN. MICROBIOLOGY vol. 31, no. 9, September 1993, pages 2255 - 2262, XP002934084 *
LI L.: 'In vitro translation of type A clostridium botulinum neurotoxin heavy chain and analysis of its binding to rat synaptosomes' J. PROTEIN CHEMISTRY vol. 18, no. 1, January 1999, pages 89 - 95, XP002934086 *
POTTER K. ET AL.: 'Production and purification of the heavy-chain fragment C of botulinum neurotoxin, serotype B, expressed in the methylotrophic yeast pichia pastoris' PROTEIN EXPRESSION AND PURIFICATION vol. 13, no. 3, 1998, pages 357 - 365, XP002934085 *
See also references of EP1180999A2 *

Cited By (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7037680B2 (en) * 1993-09-21 2006-05-02 The United States Of America As Represented By The Secretary Of The Army Recombinant light chains of botulinum neurotoxins and light chain fusion proteins for use in research and clinical therapy
US7227010B2 (en) * 1993-09-21 2007-06-05 United States Of America As Represented By The Secretary Of The Army Recombinant light chains of botulinum neurotoxins and light chain fusion proteins for use in research and clinical therapy
WO2003012117A1 (en) * 2001-07-28 2003-02-13 The Secretary Of State For Defence Dna vaccine
US7825233B2 (en) 2004-06-30 2010-11-02 Allergan, Inc. Optimizing expression of active Botulinum Toxin type E
JP2008508886A (en) * 2004-08-04 2008-03-27 アラーガン、インコーポレイテッド Optimization of expression of active botulinum toxin type A
FR2889066A1 (en) * 2005-07-28 2007-02-02 Centre Nat Rech Scient METHOD OF GENETIC IMMUNIZATION BY ELECTROTRANSFER AGAINST TOXIN AND ANTISERUM THAT CAN BE OBTAINED BY THIS PROCESS
WO2007012671A3 (en) * 2005-07-28 2007-04-26 Centre Nat Rech Scient Method for genetic immunization by electrotransfer against a toxin and antiserum obtainable by said method
US11034947B2 (en) 2013-07-09 2021-06-15 Ipsen Bioinnovation Limited Cationic neurotoxins
EA039105B1 (en) * 2013-07-09 2021-12-03 Ипсен Байоинновейшн Лимитед Cationic neurotoxins
CN105492020A (en) * 2013-07-09 2016-04-13 益普生生物创新有限公司 Cationic neurotoxins
KR102617830B1 (en) 2013-07-09 2023-12-27 입센 바이오이노베이션 리미티드 Cationic neurotoxins
KR102340476B1 (en) 2013-07-09 2021-12-21 입센 바이오이노베이션 리미티드 Cationic neurotoxins
KR20210154889A (en) * 2013-07-09 2021-12-21 입센 바이오이노베이션 리미티드 Cationic neurotoxins
TWI694081B (en) 2013-07-09 2020-05-21 英商益普生生物創新公司 Cationic neurotoxins
KR20160029110A (en) * 2013-07-09 2016-03-14 입센 바이오이노베이션 리미티드 Cationic neurotoxins
WO2015004461A1 (en) * 2013-07-09 2015-01-15 Syntaxin Limited Cationic neurotoxins
CN112961227A (en) * 2013-07-09 2021-06-15 益普生生物创新有限公司 Cationic neurotoxins
CN105492020B (en) * 2013-07-09 2021-03-12 益普生生物创新有限公司 Cationic neurotoxins
EP3822286A1 (en) * 2015-01-09 2021-05-19 Ipsen Bioinnovation Limited Cationic neurotoxins
US11014968B2 (en) 2015-01-09 2021-05-25 Ipsen Bioinnovation Limited Cationic neurotoxins
RU2733493C2 (en) * 2015-01-09 2020-10-02 Ипсен Байоинновейшн Лимитед Cationic neurotoxins
WO2016110662A1 (en) * 2015-01-09 2016-07-14 Ipsen Bioinnovation Limited Cationic neurotoxins
US11118170B2 (en) 2015-05-15 2021-09-14 The Board Of Regents Of The University Of Nebraska Engineered clostridium botulinum toxin adapted to deliver molecules into selected cells
JP2018515542A (en) * 2015-05-15 2018-06-14 ボード オブ リージェンツ オブ ザ ユニバーシティ オブ ネブラスカ Genetically engineered Clostridium botulinum toxin for molecular delivery to selected cells
CN112351991A (en) * 2017-12-20 2021-02-09 阿勒根公司 Botulinum toxin cell binding domain polypeptides and methods for their use in treating fibrosis related disorders
CN112351992A (en) * 2017-12-20 2021-02-09 阿勒根公司 Botulinum toxin cell binding domain polypeptides and methods for their use in skin regeneration
CN110075288A (en) * 2019-05-06 2019-08-02 中国兽医药品监察所 A kind of nontoxic c-type clostridium botulinum genetic engineering subunit vaccine and its production method
CN110075288B (en) * 2019-05-06 2022-04-26 中国兽医药品监察所 Nontoxic C-type clostridium botulinum genetic engineering subunit vaccine and production method thereof

Also Published As

Publication number Publication date
AU783450B2 (en) 2005-10-27
EP1180999A2 (en) 2002-02-27
AU5003500A (en) 2000-11-21
EP1180999A4 (en) 2005-03-30
JP2004512004A (en) 2004-04-22
WO2000067700A3 (en) 2001-02-08
CA2371279A1 (en) 2000-11-16

Similar Documents

Publication Publication Date Title
US7786285B2 (en) Recombinant vaccine against botulinum neurotoxin
Byrne et al. Development of vaccines for prevention of botulism
Byrne et al. Fermentation, purification, and efficacy of a recombinant vaccine candidate against botulinum neurotoxin type F from Pichia pastoris
FI107334B (en) Method for the preparation of a vaccine for the prevention of Lyme disease
DK2248822T3 (en) MENINGOCOKKER ADHESIONS
US20090274708A1 (en) Recombinant Toxin Fragments
Webb et al. Protection with recombinant Clostridium botulinum C1 and D binding domain subunit (Hc) vaccines against C and D neurotoxins
AU783450B2 (en) Recombinant vaccine against botulinum neurotoxin
US20130345398A1 (en) Recombinant light chains of botulinum neurotoxins and light chain fusion proteins for use in research and clinical therapy
US7227010B2 (en) Recombinant light chains of botulinum neurotoxins and light chain fusion proteins for use in research and clinical therapy
US7037680B2 (en) Recombinant light chains of botulinum neurotoxins and light chain fusion proteins for use in research and clinical therapy
EP0500736B1 (en) Recombinant vaccine for porcine pleuropneumonia
US6287566B1 (en) Protective peptides neurotoxin of C. botulinum
US8153397B2 (en) Recombinant light chains of botulinum neurotoxins and light chain fusion proteins for use in research and clinical therapy
AU2002228887A1 (en) Recombinant light chains of botulinum neurotoxins and light chain fusion proteins for use in research and clinical therapy
WO2011103465A2 (en) Botulinum neurotoxin antigenic compositions and methods
US20030185850A1 (en) Protective peptides neurotoxin of C. botulinum
US20060141572A1 (en) Recombinant light chains of botulinum neurotoxins and light chain fusion proteins for use in research and clinical therapy
Loveless Clostridium botulinum neurotoxin type E binding domain from Pichia pastoris as a recombinant vaccine candidate
AU654392B2 (en) Enzymatically-inactive phospholipase D of corynebacterium pseudotuberculosis
NZ244437A (en) Enzymatically inactive phospholipase d analogues from corynebacterium pseudotuberculosis, their use and production

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): GH GM KE LS MW SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
AK Designated states

Kind code of ref document: A3

Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW

AL Designated countries for regional patents

Kind code of ref document: A3

Designated state(s): GH GM KE LS MW SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG

DFPE Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
WWE Wipo information: entry into national phase

Ref document number: 50035/00

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 2371279

Country of ref document: CA

Ref country code: CA

Ref document number: 2371279

Kind code of ref document: A

Format of ref document f/p: F

ENP Entry into the national phase

Ref country code: JP

Ref document number: 2000 616731

Kind code of ref document: A

Format of ref document f/p: F

WWE Wipo information: entry into national phase

Ref document number: 2000932296

Country of ref document: EP

WWP Wipo information: published in national office

Ref document number: 2000932296

Country of ref document: EP

REG Reference to national code

Ref country code: DE

Ref legal event code: 8642

WWG Wipo information: grant in national office

Ref document number: 50035/00

Country of ref document: AU