WO2000043494A9 - Control of virus infection using replication associated proteins, compositions and methods of use - Google Patents
Control of virus infection using replication associated proteins, compositions and methods of useInfo
- Publication number
- WO2000043494A9 WO2000043494A9 PCT/US2000/001849 US0001849W WO0043494A9 WO 2000043494 A9 WO2000043494 A9 WO 2000043494A9 US 0001849 W US0001849 W US 0001849W WO 0043494 A9 WO0043494 A9 WO 0043494A9
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- virus
- rep
- leaf curl
- iteron
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/12011—Geminiviridae
- C12N2750/12022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
Definitions
- the invention relates to methods and compositions for controlling virus infection using replication associated proteins.
- Viruses can infect both animals and plants. Plant viruses damage plants following infection, and are the cause of substantial agricultural losses. Geminiviruses in particular are extremely devastating plant viruses found all over the world. Natural resistance genes are rare and usually not in the plant species needed and modern biotechnology (including genetic engineering) has not yet provided extremely effective measures to control the geminiviruses, as well as other viruses whose replication involves binding of a replication associated protein (Rep) to an iteron.
- Rep replication associated protein
- Geminiviruses belong to a family of plant viruses that cause economically important diseases in a wide range of cereal, vegetables and fiber crops (Brown,
- the geminiviruses are transmitted by leafhoppers or whitefly vectors and have monopartite or bipartite genomes. Geminiviruses with a bipartite genome have their essential viral functions divided on two DNA components referred to as DNA-A and DNA-B.
- the DNA-A encodes the replication associated protein (Rep), the replication enhancer (REn), the transcriptional activator protein
- DNA-A and DNA-B the open reading frames (ORFs) are arranged in two divergent clusters separated by an intergenic region (LR) of about 200 nucleotides.
- the IR contains sequences that are conserved between the two DNA components and are referred to as the common region (CR).
- the CR contains the origin of replication (ori) sequences that are crucial to initiate replication and consists of a conserved hairpin structure and a binding site for the Rep protein located upstream of the hairpin (Fontes, E.P.B., etal, J. Biol. Chem. 269:8459-8465 (1994); Fontes, E.P.B., etal, Plant Cell 6:405-416 (1994)).
- ori origin of replication
- SqCLV Squash leaf curl virus
- the IR contains a GC rich inverted repeat which is conserved in all geminiviruses and has the potential to form a stem-loop structure. These inverted repeats flank an AT rich sequence of 11-16 bases that contains the conserved nonamer motif, T AAT ATT AC (SEQ LD NO 187)
- AC1 or the replication-associated protein (Rep) is essential for viral DNA replication
- This protein is encoded by the ORF AC 1 and initiates rolling circle replication by a site specific cleavage within the loop of the conserved structure (Laufs, J , et al , FEBS Lett. 377 258-262 (1995a), Laufs, J , et al, Proc. Natl. Acad. Sci. USA 91 3879-3883 (1995b))
- Rep is a multifunctional protein and is involved in both viral replication and transcriptional regulation (Fontes, E P B , et al, J. Biol.
- Rep protein has a nucleoside triphosphate binding domain (Laufs, J , et al, Proc. Natl. Acad. Sci. USA 91 3879-3883 (1995b))
- Rep protein possesses a nicking-closing activity and initiates rolling circle replication by a site specific cleavage within the loop of the conserved nonamer sequence, TAATATTAC (Laufs, J S , et al, FEBS Lett. 377 258-262 (1995), Laufs, J , et al, Proc.
- the Rep protein binding site is located between the TATA box and the transcription start site for the Rep gene and acts as the origin recognition sequence and as a negatively regulatory element for Rep gene transcription (Fontes, E P B , et al, Plant Cell 6405-416 (1994), Eagle, P A , et al, Plant Cell 61 1157-1170 (1994), Eagle, P A , and Hanley- Bowdoin, L , J. Virol.
- Rep interacts with at least two different DNA elements in the geminivirus origin of replication, a conserved nonanucleotide sequence containing a specific nick site for the enzyme (Heyraud-Nitschke, F., et al, Nucleic Acids Res.
- Rep proteins encoded by different geminiviruses show specificity for the replication of their cognate genomes (Lazarowitz, S.G., et al, Plant Cell 4:199-809 (1992); Fontes, E.P.B., etal, Plant Cell 6:405-416 (1994b); Jupin, I., et al, FEBS Lett. 262: 116-120 (1995); Choi, I.R., and Stenger D.C., Virology 116:11-116 (1996)).
- This specificity of origin recognition is determined in part by the high affinity binding site of the Rep (Choi, I.R., and Stenger D.C., Virology 106:904-911 (1995); Choi, I.R, and Stenger D.C., Virology 116:11-116 (1996)) and the N-terminal domain of the Rep protein.
- the N-terminal domain comprises the first 116 amino acid residues of the Rep protein (Jupin, I., et al, FEBSLett. 161: 116-120 (1995)).
- the first step in the replication process of geminiviruses involves recognition of the iterons in the common region of the virus by the Rep protein.
- Circoviruses that have similar replication mechanisms may also be inhibited by blocking a similar step in the process.
- Nanovirus is a genus of virus that includes plant infecting viruses with a genome consisting of a multiple (at least 6) circular ssDNA molecules each of approximately 1 kb in size and encapsidated in an icosahedral (non-geminate) virion about 20 nm in diameter. It includes species such as the Subterranean clover virus (SCSV).
- SCSV Subterranean clover virus
- the virions are 17 to 20 nm in diameter and exhibit icosahedral symmetry. They are not enveloped. Capsomeres may be evident, producing an angular or hexagonal outline. They have buoyant density of 1.24 to 1.30 g/cm 3 in Cs 2 SO 4 , and 1.34 g/cm 3 in CsCl. Instability in CsCl has been reported for SCSV. An S 20w of 46S has been reported for Banana bunchy top virus (BBTV). Particle morphology is not affected by freezing of tissue before virion extraction.
- the nanovirus genome is composed of several species of circular ssDNA ranging in size from 985 to l l l nts.
- the genomic information of the nanovirus is distributed over at least 6 molecules of circular ssDNA. Since the the nanovirus DNAs are structurally similar to those of the geminiviruses and at least one of the DNA components of each species codes for a replication-associated protein (Rep), nanovirus DNAs are proposed to be replicated from transcriptionally and replicationally active dsDNA forms via a rolling circle type of replication mechanism. Nicking and joining activity of the BBTV Rep protein has been demonstrated in vitro. Complementary strand synthesis of BBTV genomic ssDNA is attributed to a population of endogenous primers derived from BBTV-DNA 5, which appears to encode a protein that is potentially involved into cell cycle regulation.
- Rep replication-associated protein
- All ssDNAs found associated with the assigned species contain a major virion sense ORF and appear to be transcribed unidirectionally. Each coding region is preceded by a promoter sequence with a TATA box and followed by a poly(A) addition signal. At least one of the genome components codes for a Rep protein (Rep; Mr 32.4 - 33.6 x 10 3 ). For some isolates of the four assigned species, two to four Rep components have been described, however, some of the additional Rep components may actually be satellite components. A second virion-sense ORF, completely within the Rep ORF and encoding a putative 5 x 10 3 protein of unknown function, was also identified for the BBTV Rep component
- the genus includes species with multiple genomic DNAs that are unidirectionally transcribed, Coconut foliar decay virus (CFDV), a tentative species within the genus, has similar morphology but differs from the assigned members by containing a single circular ssDNA of 1291 nts which is proposed to be transcribed bidirectionally, by having a capsid protein of Mr ca. 24 x 10 3 and by being transmitted by a plant hopper.
- CFDV coconut foliar decay virus
- Nanoviruses there are a number of species of Nanoviruses including, banana bunchy top virus (BBTV) (S56276, U18077 to U18079, L32166 & L32167, U02312, L32166 & L32167, U02312), Faba bean necrotic yellows virus (FBNY) (X80879, Y11405 to Yl 1409, (FBNYV) AJ005964 to AJ005968, Milk vetch dwarf virus (MDV) (AB000920 to 000927, 0009046, 0009047), Subterranean clover stunt virus (SCSV) (U16730 to U16736).
- BBTV banana bunchy top virus
- FBNY Faba bean necrotic yellows virus
- MDV Milk vetch dwarf virus
- SCSV Subterranean clover stunt virus
- the virions contain circular ssDNA
- the genomes of CAV and PCV contain 2,298 and 1,759 bases respectively
- the BFDV genome is about 2 0 kb in size
- the CAV genome is of negative sense Information concerning the sense of the PCV and BFDV genomes has not been reported
- the PCV genome contains a nonanucleotide sequence motif (TAGTATTAC), which is found at the apex of a potential stem loop and which is identical or highly similar to those found in bacterial and plant viruses with circular, ssDNA genomes (Microviridae, Nanovirus and Geminiviridae).
- the non-structural proteins of PCV have not been characterized.
- the N-terminal of the CAV CP shares homologies with histone proteins consistent with it having a DNA-binding role within the virion.
- CAV and PCV DNA replicate using circular ds replicative form (RF) DNAs. Nucleic acid and protein homologies shared with plant geminiviruses are consistent with PCV DNA replicating by a rolling circle mechanism. The origin of replication of PCV DNA has been mapped. Only one strand of the CAV RF is transcribed to produce a polycistronic messenger RNA ( ⁇ 2.1 kb) which contains
- ORFs larger than 200 nts which occur in both positive and negative sense orientations.
- CAV causes transient anemia and immunosuppression in baby chicks.
- BFDV causes chronic and ultimately fatal disease in large psittacine birds.
- PCV-like viruses have been associated with a recently described condition of pigs known as post-weaning multisystemic wasting syndrome.
- Cells of the hematopoietic system are infected by CAV and BFDV At present all assigned members of the family have been classified within a single genus. However differences in virion size, genome size and genome organization may provide the basis for definition of more than one genus in the future.
- Circoviruses include Beak and feather disease virus (BFDV), Chicken anemia virus (M55918, M81223)(CAV) and Porcine circovirus (U49186, Y09921) (PCV).
- BFDV Beak and feather disease virus
- CAV Chicken anemia virus
- PCV Porcine circovirus
- Microviridae in that it exhibits nucleic acid and protein homologies related to rolling circle DNA replication.
- the animal circoviruses are similar to plant nanoviruses such as Banana bunchy top virus, Coconut foliar decay virus and Subterranean clover stunt virus, which possess non-enveloped, icosahedral capsids (18 - 20 nm in diameter) and circular, ssDNA genomes (0.85 - 1.3 kb in size).
- These plant viruses formerly regarded as Ounassigned viruses in the family CircoviridaeO, are now classified in an unassigned genus Nanovirus. Further information cocnerning circoviruses can be found in Mankertz, A et al, J. Virol 71:1561-1566 (1997), Tischer, etal, Nature 195:64-66 (1982), Todd, D. et al, Arch. Virol. 117:119-135 (1991).
- viruses such as geminiviruses or any virus that can be inhibited by a Rep-iteron antagonist.
- a first approach is altering the movement of the virus in the infected plant or animal and the second approach is shutting down the virus replication.
- complications concerning such viruses are that the viruses, are difficult to distinguish from each other with a complicated taxonomy, often infect plants in mixtures and recombine frequently (Padidam et al, Virol. 265:218-225, (1999) and the time frame for these recombinations is unknown.
- the invention is directed to a method for producing resistance in a plant to a geminivirus comprising introducing a geminivirus replication associated protein (Rep)-iteron antagonist into a plant, plant cell or propagule, wherein said antagonist is selected from the group consisting of a nucleotide sequence of a geminivirus iteron capable of binding to a Rep protein and a defective Rep, wherein said defective Rep comprises a conserved geminivirus iteron binding site
- the invention is directed to the use of sequences found in Figs (SEQ LD NOS 1-8, 10-35, 37-41, 43-49, 54-57, 59-62, 64-98)
- Embodiments of the invention are drawn to use of a Rep protein that may form a dimer with a wild- type geminivirus Rep protein or where the Rep protein comprises from two to thirty different or the same conserved iteron binding sites
- Another embodiment of the invention is directed to use in the above method of a defective replication associated protein (Rep) selected from the group consisting of truncated geminivirus Rep protein, a modified Rep protein capable of binding a geminivirus iteron sequence, or a Rep protein fragment capable of binding a geminivirus iteron sequence
- Rep defective replication associated protein
- the invention is further directed to a vector containing a nucleotide sequence that encodes a defective geminivirus replication associated protein, wherein said encoded protein comprises a polypeptide having an amino acid sequence of a conserved geminivirus iteron binding site or a mutant thereof
- the vector is expressed in plants
- the vector also preferably encodes a polypeptide comprising a sequence as shown in Figs 1 A-1C (SEQ LD NO 1-8, 10-35, 37-41, 43-49, 54-57, 59-62, 64-98)
- An embodiment of the invention is directed to a polypeptide that forms a dimer with a wild-type geminivirus Rep protein or one that comprises from two to thirty different conserved iteron binding sites
- Another embodiment of the invention comprises a nucleotide sequence encoding at least two different Rep proteins
- the invention is also directed to a nucleic acid molecule containing a nucleotide sequence comprising an isolated conserved geminivirus iteron
- a preferable embodiment comprises an isolated DNA sequence comprising GGTGTCTGGAGTC (SEQ LD NO: 111).
- the invention is further directed to compositions for producing resistance to a geminivirus in plants comprising the vectors or nucleic acids of any of the embodiments of the invention.
- Another aspect of the invention is directed to transgenic plants, cells, propagules or seeds that comprise any of the vectors or nucleic acids of the invention.
- a preferred embodiment comprises a nucleic acid molecule having a nucleotide sequence comprising a conserved geminivirus iteron.
- the invention is further directed to an isolated nucleic acid molecule comprising a nucleotide sequence for a conserved geminivirus iteron.
- a preferable embodiment of the invention may be directed to a nucleotide sequence comprising at least two geminivirus iterons.
- Another embodiment of the invention is directed to a nucleotide sequence that comprises from two to thirty different classes of geminivirus iteron shown in Figs. lA-lC.
- the invention is also directed to a truncated Rep protein.
- the truncated Rep protein may be an isolated polypeptide selected from the group consisting of AC1 1-21 , ACl ⁇ , ACl ⁇ , ACl ⁇ AC1 M14; ACl ⁇ and ACl 8a or a nucleic acid encoding said polypeptides.
- the truncated protein comprises at least ACl ⁇ ,,.
- a further aspect of the invention is directed to a method for inhibiting geminivirus replication in a plant comprising introducing a geminivirus replication associated protein (Rep)-iteron antagonist into said plant, said antagonist selected from the group consisting of a nucleotide sequence defining a geminivirus iteron capable of binding to a Rep protein and a defective Rep protein, wherein said defective Rep comprises a conserved geminivirus iteron binding site.
- Rep geminivirus replication associated protein
- the invention is further drawn to a method for providing resistance to infection by geminiviruses in a susceptible plant comprising: a)trans forming susceptible plant cells with a DNA molecule that comprises operatively linked in sequence in the 5' to 3' direction i) a promoter region that functions in plant cells to cause the production of an RNA sequence; and ii) a gene encoding a defective Rep protein, wherein said defective Rep protein comprises a conserved geminivirus iteron binding site; said method further comprising b) selecting said plant cells that have been transformed; c) regenerating said plant cells to provide a differentiated plant; and d) selecting a transformed plant that expresses said defective Rep gene at a level sufficient to render the plant at least partially resistant to infection by the geminivirus.
- the invention is further directed to an at least partially virus-resistant transformed plant normally susceptible to infection by a geminivirus having inserted into its genome a DNA molecule that comprises operatively linked in sequence in the 5' to 3' direction; i) a promoter region that functions in plant cells to cause the production of an RNA sequence; and ii) a gene encoding a defective Rep protein, wherein said defective Rep comprises a conserved geminivirus iteron binding site.
- the invention is directed to a method for producing at least partial resistance to a virus or a method for reducing replication of a virus in a plant, plant cell, propagule, animal or animal cell comprising introducing a replication associated protein (Rep)-iteron antagonist into a plant, plant cell, propagule, animal or animal cell, wherein said antagonist is selected from the group consisting of a nucleotide sequence of an iteron capable of binding to a Rep protein and a defective Rep, wherein said defective Rep comprises a conserved iteron binding site, and wherein said Rep-iteron antagonist renders the infected plant, plant cell, propagule, animal or animal cell at least partially resistant to the infection.
- a replication associated protein (Rep)-iteron antagonist is selected from the group consisting of a nucleotide sequence of an iteron capable of binding to a Rep protein and a defective Rep, wherein said defective Rep comprises a conserved iteron binding site, and wherein said Rep-iteron antagonist renders the in
- the invention is directed to the use of sequences at least 50% identical to those found in Figs 1 A-1C (SEQ LD NOS: 1-8, 10-35, 37-41, 43-49, 54-57, 59- 62, 64-107). More preferably the sequences are at least 60%, 70%, 80%, 90%
- Another preferable embodiment is directed to producing resistance to infection from a Nanovirus or Circoviridae.
- Additional embodiments of the invention are drawn to use of a Rep protein that may form a dimer with a wild-type geminivirus Rep protein or where the Rep protein comprises from two to thirty different or the same conserved iteron binding sites.
- Another embodiment of the invention is drawn to reducing infection or reducing DNA replication of any virus that replicates in a manner similar to the geminivirus, l e dependent on the binding of a Rep protein to an iteron
- Embodiments of the invention are also drawn to use of a Rep protein that may form a dimer with a wild-type geminivirus Rep protein or where the Rep protein comprises from two to thirty different or the same conserved iteron binding sites
- the invention is further directed to a composition for producing at least partial resistance to a virus or for reducing replication of a virus in a plant, plant cell, propagule, animal or animal cell wherein said composition is used in any of the above methods
- compositions may also include solutions that are physiologically compatible with the organism of interest
- the invention is also directed to a Rep-iteron antagonist comprising a nucleic acid sequence encoding a Rep protein or fragment thereof that binds to an iteron wherein viral infection or DNA replication of the virus causing the infection is reduced following said antagonist binding to an iteron
- the invention is further directed to a Rep-iteron antagonist comprising a nucleic acid sequence that competes for binding of a Rep protein with the iteron of the virus causing the infection, wherein viral infection or DNA replication of the virus causing the infection is reduced following said antagonist binding to the Rep protein
- Another embodiment of the invention is directed to a Rep-iteron antagonist comprising a polypeptide or the nucleic acid sequence encoding a polypeptide comprising the sequence FLTY or KAYTDK
- the invention is further directed to a Rep-iteron antagonist comprising a polypeptide or the nucleic acid sequence encoding a polypeptide selected from the group consisting of FLTYPqC wherein q is a basic or a polar amino acid, HTHxUUQ wherein U is a bulky hyrophobic residue and xxYxxK wherein x may be any amino acid
- the invention is also directed to a vector comprising a nucleic acid sequence encoding any of the Rep-iteron antagonists of the invention Brief Description of the Figures
- Figs. lA-lC Sequences of Iterons and Rep N-terminal Sequences.
- Figure 1A - IB Begomoviruses (SEQ ID NOs: l-8 10-41, 76-98, 99-100, 108-110)
- Figure IC - Mastreviruses SEQ ID NO:43-49, 54-69, 101-105
- Curtoviruses SEQ ID NO:70-74,106-107
- Topcuvirus SEQ LD NOS: 75, 107
- Fig. 2A-2C Immuno-precipitation of Rep protein from crude lysates of Sf9 cells using anti AC1 antibody.
- Fig. 2 A. The Rep proteins from the severe strain (Al, lane 1) and the mild strain (A2, lane 2) of ToLC-NdeV were expressed from the polyhedrin promoter of AcNPV in Sf9 cells and detected using anti AC1 polyclonal antiserum.
- Fig. 2B Coomassie blue stained gel showing the purified Rep proteins from the severe (lane 2) and mild (lane 5) strains of ToLC-NdeV. Lane 1 represents the marker and lane 4 shows the crude lysate from the pellet fraction.
- Fig. 2C Western blot using a polyclonal anti- AC 1 antiserum.
- Stepwise eluates of the purified protein were collected from the Ni 2 affinity column in 20mM Tris, 500mM NaCl a 500mM imidazole (pH 7.9) and detected using the anti AC1 antiserum.
- Lanes 1-4 represent stepwise aliquots of the purified protein of the severe strain and the lanes 5-7 show similar fractions of the protein purified from the mild strain of ToLC-NdeV.
- Fig. 3 Electrophoretic mobility shift assays showing the interaction of the Rep protein of severe (Al) and the mild (A2) strains of ToLC-NdeV with different common region fragments.
- CR-s and CR-m refer to the 52 bp common region fragment derived from the intergenic region of the viral DNA.
- bs-s and bs-m denote the 13-bp repeat motifs in the common region of the severe and the mild strain respectively.
- 32 P labeled DNA fragments (CR or bs) were incubated in the presence (+) or absence (-) of competitor DNA to test the specificity of binding. All reactions contained 200 ng of poly dl.dC and were analyzed on 4% polyacrylamide gels.
- lanes 3 and 8 contained 5 Ox molar excess of appropriate, unlabelled 13-bp DNA as the specific competitor and lanes 4 and 9 show the complex formation in the presence of 1000X molar excess of non-specific competitor (pUC 18) DNA.
- the Rep proteins of the two strains did not bind to heterologous binding site sequences as seen in lanes 5 and 10.
- Figs.4A-4B DNA sequence requirements for binding by the Rep protein.
- Fig. 4A Labeled synthetic oligonucleotides with variations in the sequence and arrangement of iterons were used as probes to analyze their effect on binding by the Rep protein of severe (lanes 1-6) and mild (lanes 7 to 10) strains of ToLC-NdeV.
- the key to the sequence of iterons used as probes is as follows: IT 1/2 (5' severe, 3' mild, lanes 1 and 7); I T3/4 (5'unrelated, 3' severe, lanes 2 and 8); IT 5/6 (5' unrelated, 3 'mild, lanes 5 and 9); IT 7/8 (5 'mild, 3'unrelated, lanes 6 and 10); IT 9/10 (5' severe repeated, lane 3); IT 11/12 (3' severe repeated, lane 4).
- Fig. 4B Labeled synthetic oligonucleotides with variations in the spacing and number of iterons were used as probes to analyze their effect on binding by the Rep protein.
- the key to the sequence of iterons used as probes is as follows: IT 13/14 (spacing within the iterons is increased to 6 nucleotides, lanes 1 and 3); IT 15/16 (no spacing between the iterons, lanes 2 and 4); IT 17/18 (5 'monomer iteron, lanes 5 and 7); IT 19/20 (5 'monomer repeated 4 times, lanes 6 and 8). Lane 9 shows the free probe.
- Fig. 5 Replication of Rep protein binding site mutants. Plasmids (2 ⁇ g) containing the viral replicons mutated at their binding site sequence in the origin were electrop orated into tobacco protoplasts. Total DNA was isolated 48h after transfection, resolved on agarose gels and analyzed by Southern hybridization using 32 P -labelled ACl DNA fragment (nts 2113 to 2695) as a probe. The single stranded (ss) and the supercoiled (sc) forms of the viral DNA are indicated. The virus mutants were given identical names as the oligonucleotides used to alter their iteron sequence for the sake of convenience. The key to the mutants is as follows: Lanes 2 and 13 (IT 1/2); lanes 3 and 14
- Lanes 1 and 12 represent the wild type controls for the severe and the mild strain of ToLC-NdeV respectively.
- Fig. 6A-6B Accumulation of Viral DNA in BY-2 Protoplasts. The protoplasts were transfected with truncated and full length Rep proteins.
- Figs. 8A-8C Genome organization of tomato leaf curl virus from New
- FIG. 8A Genome maps of DNA-A and DNA-B of severe strain. The genes encoding conserved proteins in geminiviruses are shown as solid arrows.
- Rep, TrAP, REn and CP on DNA-A represent the replicase associated protein (ACl), the transcriptional activator protein (AC2), the replication enhancer (AC3) and the coat protein (AVI) respectively.
- the MP and NSP on DNA-B are the movement protein (BC1) and the nuclear shuttle protein (BV1) respectively.
- the genome organization of DNA-A of both severe and the mild strain are identical. Relevant restriction sites used for mutagenesis are indicated.
- FIG.8B Schematic representation of mutants made in Rep gene of mild and severe strain DNA-A. Fragments were exchanged at the N-(Nco I to Xba I) or C- (Cla 1 to Cla I) terminal of Rep gene between the strains. The ToLCV severe strain is indicated in white hatched lines whereas the mild strain is shown by black lines.
- FIG. 8C A schematic showing organization of origin of replication in geminiviruses (not to scale). The mutations made in the putative binding site of
- TATA box and the major ORFs in virus sense and complementary sense are indicated.
- the repeat sequence forming the binding site is shown as two solid arrows near the TATA box.
- the putative binding sites identified for the severe strain DNA-A and DNA-B and the mild strain DNA-A are indicated.
- Substitution mutations made in the N-terminal of Rep gene of mild and the severe strain together with point mutations made in the Rep protein binding sites are presented.
- SEQ ID NO: 112-120 The panel on the left shows the sequence of first ten amino acids on the Rep protein of Al and A2 starting with the initiation codon, methionine (M), while the middle panel indicates the putative binding site sequence on the corresponding mutants (indicated on the right).
- Fig. 9 Southern blot analysis of viral DNA in N. tabacum protoplasts inoculated with different mutants of ToLCV. Total DNA was extracted from protoplasts 48h after transfection and electrophoresed through 1% agarose gel without ethidium bromide, transferred to nylon membrane and hybridized with 32 p labelled DNA-A and DNA-B specific probes. Panel A shows replication ability of mutants made in severe strain DNA-A and probed with A-component (lanes 1 -
- Panel B shows replication efficiency of mutants made in the mild strain DNA-A probed with A-component (lanes 1-9) and B-component (lanes 10-18) specific probes.
- the positions of single stranded (ss) and supercoiled (sc) viral DNA are indicated.
- Each lane contains 4 ⁇ g of DNA obtained from protoplasts in a single transfection.
- Fig. 10 Southern blot analysis of viral DNA in N. benthamiana plants inoculated with ToLCV mutants. Total DNA was extracted from newly emerging leaves three weeks after bombardment and electrophoresed in 1% agarose gels without ethidium bromide, transferred to nylon membrane and hybridised with 32 p labeled DNA-A and DNA-B specific probes.
- Panel A shows replication competence of severe strain mutants probed with A-component (lanes 1-7) and B-component (lanes 8-14) specific probes.
- Panel B shows replication efficiency of mutants made in the mild strain DNA-A and probed with A-component (lanes 1-9) and B-component (lanes 10- 18) specific probes. The position of single stranded (ss) and supercoiled (sc) viral DNA are indicated.
- Rep protein the geminivirus replication associated protein
- Rep protein specifically recognizes and binds to short stretches of geminivirus DNA sequences called binding sites or iterons, and this binding marks the first step in the replication of the virus in plants.
- amino acid sequences herein use either the single letter or three letter designations for the amino acids. These designations are well known to one of skill in the art and can be found in numerous readily available references, such as for example in Cooper, G.M., The Cell 1997, ASM
- Cloning vector A plasmid or phage DNA or other DNA sequence which is able to replicate autonomously in a host cell, and which is characterized by one or a small number of restriction endonuclease recognition sites at which such DNA sequences may be cut in a determinable fashion, and into which a DNA fragment may be spliced in order to bring about its replication and cloning.
- the cloning vector may further contain a marker suitable for use in the identification of cells transformed with the cloning vector. Markers, for example, provide tetracycline resistance or ampicillin resistance.
- DNA construct should be understood to refer to a recombinant, man-made DNA, either linear or circular.
- Derivative or Functional Derivative The term “derivative” or “functional derivative” is intended to include “variants,” the “derivatives,” or “chemical derivatives” of the Rep molecule.
- a “variant” of a molecule or derivative thereof is meant to refer to a molecule substantially similar to either the entire molecule, or a fragment thereof.
- An “analog” of a molecule or derivative thereof is meant to refer to a non-natural molecule substantially similar to either the Rep molecules or fragments thereof.
- Chemical and functional derivatives of the Rep protein are considered embodiments of the application.
- Rep derivatives contain changes in the polypeptide relative to the native Rep polypeptide of the same size.
- a molecule is said to be "substantially similar” to another molecule if the sequence of amino acids in both molecules is substantially the same, and if both molecules possess a similar biological activity.
- two molecules that possess a similar activity may be considered variants, derivatives, or analogs as that term is used herein even if one of the molecules contains additional amino acid residues not found in the other, or if the sequence of amino acid residues is not identical.
- Rep derivatives need not have substantially similar biological activity to the native molecule.
- a molecule is said to be a "chemical derivative" of another molecule when it contains additional chemical moieties not normally a part of the molecule. Such moieties may improve the molecule's solubility, absorption, strength, specificity, affinity, biological half-life, etc. The moieties may alternatively decrease the toxicity of the molecule, eliminate or attenuate any undesirable side effect of the molecule, etc. and will be apparent to those of ordinary skill in the art. "Functional derivatives" include those polypeptides that bind iteron sequences and those nucleic acid sequences that bind Rep proteins. Expression vector.
- an "expression vector” is a DNA construct that contains a structural gene operably linked to an expression control sequence so that the structural gene can be expressed when the expression vector is transformed into an appropriate host cell.
- Two DNA sequences (such as a promoter region sequence and a sequence encoding a Rep derivative) are said to be "operably linked” if the nature of the linkage between the two DNA sequences does not ( 1 ) result in the introduction of a frame- shift mutation, (2) interfere with the ability of the promoter region sequence to direct the transcription of the desired sequence, or (3) interfere with the ability of the desired sequence to be transcribed by the promoter region sequence.
- a promoter region would be operably linked to a desired DNA sequence if the promoter were capable of effecting transcription of that DNA sequence.
- Fragment A "fragment" of a molecule is meant to refer to any polypeptide subset of these molecules.
- a truncated Rep may considered to be a fragment of the whole molecule
- Fusion protein By the term “fusion protein” is intended a fused protein comprising a protein or polypeptide either with or without a “selective cleavage site” linked at its N-terminus, which is in turn linked to an additional amino acid leader polypeptide sequence.
- % Identity Whether any two polypeptides or polynucleotides are for example, at least 90% “identical” can be determined using known computer algorithms such as the "FAST A” program, using for example, the default parameters as in Pearson and Lipman, Proc. Natl. Acad. Sci. USA 85:1444 (1988). Alternatively the BLAST function of the National Center for Biotechnology Information database may be used to determine identity
- homology and identity are often used interchangeably.
- percent homology or identity may be determined by methods known to those of skill in the art. For example, by comparing sequence information using a GAP computer program, version 6.0, available from the University of Wisconsin Genetics Computer Group (UWGCG).
- the GAP program utilizes the alignment method of Needleman and Wunsch (/. Mol. Biol. 48:443 (1970), as revised by Smith and Waterman (Adv. Appl. Math. 1:481 (1981). Briefly, the GAP program defines similarity as the number of aligned symbols (i.e. , nucleotides or amino acids) which are similar, divided by the total number of symbols in the shorter of the two sequences.
- sequences are aligned so that the highest order match is obtained "Identity" per se has an art-recognized meaning and can be calculated using published techniques (See, e.g. Computational Molecular Biology, Lesk,
- identity is well known to skilled artisans (Carillo, H & Lipton, D , SIAM J Applied Math 48 1073 (1988)) Methods commonly employed to determine identity or similarity between two sequences include, but are not limited to, those disclosed in Guide to Huge Computers, Martin J Bishop, ed , Academic Press, San Diego, 1994, and Carillo, H & Lipton, D , SIAM J Applied Math 48 1073 (1988) Methods to determine identity and similarity are codified in computer programs Preferred computer program methods to determine identity and similarity between two sequences include, but are not limited to, GCG program package (Devereux, J , et al, Nucleic Acids Research 11(1) 387 (1984)), BLASTP, BLASTN, FASTA (Atschul, S F ,
- a test polypeptide may be defined as any polypeptide that is 90% or more identical to a reference polypeptide
- at least “90% identical to” refers to percent identities from 90 to 99 99 relative to the reference polypeptides Identity at a level of 90% or more is indicative of the fact that, assuming for exemplification purposes a test and reference polynucleotide length of 100 amino acids, that no more than 10% (i e , 10 out of 100) amino acids in the test polypeptides differ from that of the reference polypeptides.
- differences may be represented as point mutations randomly distributed over the entire length of the amino acid sequence of the invention or they may be clustered in one or more locations of varying length up to the maximum allowable, e.g. 1/14 amino acid difference (approximately 90% identity). Differences are defined as amino acid substitutions, or deletions.
- Embodiments of the claimed invention may include those polypeptides or nucleic acid sequences that are at least 90% identical to specifically claimed sequences.
- Isolated A term meaning altered from the natural state. For example, a polynucleotide or a polypeptide naturally present in a living animal is not
- isolated but the same polynucleotide or polypeptide separated from the coexisting materials of its natural state is “isolated,” as the term is employed herein.
- a polypeptide or polynucleotide produced and/or contained within a recombinant host cell is considered isolated for purposes of the present invention.
- polypeptides or polynucleotides that have been purified, partially or substantially, from a recombinant host cell or from a native source.
- a recombinantly produced version of a compound or derivatives thereof can be substantially purified by the one-step method described in Smith and Johnson, Gene 67:31-40 (1988). The terms isolated and purified are sometimes used interchangeably.
- isolated DNA is included DNA free of the coding sequences of those genes that, in the naturally-occurring genome of the organism (if any) from which the DNA of the invention is derived, immediately flank the gene encoding the DNA of the invention.
- the isolated DNA may be single-stranded or double-stranded, and may be genomic DNA, cDNA, recombinant hybrid DNA, or synthetic DNA. It may be identical to a native DNA sequence, or may differ from such sequence by the deletion, addition, or substitution of one or more nucleotides.
- Isolated single-stranded DNAs of the invention may be detectably labeled for use as hybridization probes, and may be antisense.
- Isolated or purified as it refers to preparations made from biological cells or hosts should be understood to mean any cell extract containing the indicated DNA or protein including a crude extract of the DNA or protein of interest.
- a purified preparation can be obtained following an individual technique or a series of preparative or biochemical techniques and the DNA or protein of interest can be present at various degrees of purity in these preparations.
- the procedures may include for example, but are not limited to, ammonium sulfate fractionation, gel filtration, ion exchange change chromatography, affinity chromatography, density gradient centrifugation and electrophoresis.
- a preparation of DNA or protein that is "pure” or “isolated” should be understood to mean a preparation free from naturally occurring materials with which such DNA or protein is normally associated in nature. "Essentially pure” should be understood to mean a “highly” purified preparation that contains at least 95% of the DNA or protein of interest.
- a cell extract that contains the DNA or protein of interest should be understood to mean a homogenate preparation or cell-free preparation obtained from cells that express the protein or contain the DNA of interest.
- the term "cell extract” is intended to include culture media, especially spent culture media from which the cells have been removed.
- iteron refers to a direct repeat motif of 6-12 bp within the common region of the viral genome between the TATA box and the start site for the transcription of for example, the ACl gene. Iterons have been proposed to serve as the high affinity binding sites of the Rep protein and therefore function as origin recognition sequences.
- Plant The term "plant” should be understood as referring to a multicellular differentiated organism capable of photosynthesis including angiosperms (monocots and dicots) and gymnosperms.
- Plant cell The term “plant cell” should be understood as referring to the structural and physiological unit of plants.
- plant cell refers to any cell which is either part of or derived from a plant.
- Some examples of cells encompassed by the present invention include differentiated cells that are part of a living plant; differentiated cells in culture; undifferentiated cells in culture; and the cells of undifferentiated tissue such as callus or tumors.
- Plant cell progeny should be understood as referring to any cell or tissue derived from plant cells including callus; plant parts such as stems, roots, fruits, leaves or flowers; plants; plant seed; pollen; and plant embryos.
- Propagules should be understood as referring to any plant material capable of being sexually or asexually propagated, or being propagated in vivo or in vitro. Such propagules preferably consist of the protoplasts, cells, calli, tissues, embryos or seeds of the regenerated plants.
- Polynucleotide This term generally refers to any polyribonucleotide or polydeoxribonucleotide, which may be unmodified RNA or DNA or modified RNA or DNA.
- Polynucleotides include, without limitation single- and double- stranded DNA, DNA that is a mixture of single- and double-stranded regions, single- and double-stranded RNA, and RNA that is mixture of single- and double- stranded regions, hybrid molecules comprising DNA and RNA that may be single- stranded or, more typically, double-stranded or a mixture of single- and double- stranded regions.
- polynucleotide refers to triple-stranded regions comprising RNA or DNA or both RNA and DNA.
- polynucleotide also includes DNAs or RNAs containing one or more modified bases and DNAs or RNAs with backbones modified for stability or for other reasons.
- Modified bases include, for example, tritylated bases and unusual bases such as inosine.
- polynucleotide embraces chemically, enzymatically or metabolically modified forms of polynucleotides as typically found in nature, as well as the chemical forms of DNA and RNA characteristic of viruses and cells.
- Polynucleotide also embraces relatively short polynucleotides, often referred to as oligonucleotides.
- Polypeptide Polypeptide, protein and peptide are used interchangeably.
- the term polypeptide refers to any peptide or protein comprising two or more amino acids joined to each other by peptide bonds or modified peptide bonds, i.e., peptide isosteres
- Polypeptide refers to both short chains, commonly referred to as peptides, oligopeptides or oligomers, and to longer chains, generally referred to as proteins
- Polypeptides may contain amino acids other than the 20 gene- encoded amino acids and include amino acid sequences modified either by natural processes, such as post-translational processing, or by chemical modification techniques which are well known in the art Such modifications are well described in basic texts and in more detailed monographs, as well as in the research literature Modifications can occur anywhere in a polypeptide, including the peptide backbone, the amino acid side-chains and the amino or carboxyl termini It will be appreciated that the same type of modification may be present in the same or varying degrees at several sites in a
- Polypeptides may be branched and they may be cyclic, with or without branching Cyclic, branched and branched cyclic polypeptides may result from post-translational modifications or may be made by synthetic methods
- Modifications include acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphotidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent crosslinks, formation of cystine, formation of pyroglutamate, formylation, gamma- carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristoylation, oxidation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquitination.
- Promoter A DNA sequence generally described as the 5 ' region of a gene, located proximal to the start codon The transcription of an adjacent gene(s) is initiated at the promoter region If a promoter is an inducible promoter, then the rate of transcription increases in response to an inducing agent In contrast, the rate of transcription is not regulated by an inducing agent if the promoter is a constitutive promoter Examples of promoters include, but are not limited to the CMV promoter (InVitrogen, San Diego, CA), the SV40, MMTV, and hMTIIa promoters (U S Pat No 5,457,034), the HSV-1 4/5 promoter (U SMV)
- tissue-specific enhancer elements may be employed Additionally, such promoters may include tissue and cell-specific promoters of an organism
- a recombinant host may be any prokaryotic or eukaryotic host cell which contains the desired cloned genes on an expression vector or cloning vector This term is also meant to include those prokaryotic or eukaryotic cells that have been genetically engineered to contain the desired gene(s) in the chromosome or genome of that organism
- Preferred recombinant hosts are eukaryotic cells transformed with the DNA construct of the invention More specifically, mammalian cells are preferred
- Rep-iteron antagonist refers to a defective Rep protein or single or multiple iteron nucleotide sequences that are effective at inhibiting replication of any geminivirus that infects plants
- Selective cleavage site refers to an amino acid residue or residues which can be selectively cleaved with either chemicals or enzymes in a predictable manner
- a selective enzyme cleavage site is an amino acid or a peptide sequence which is recognized and hydrolyzed by a proteolytic enzyme Examples of such sites include, without limitation, trypsin or chymotrypsin cleavage sites
- stringent hybridization conditions should be understood to be those conditions normally used by one of skill in the art to establish at least a 95% homology between complementary pieces of DNA or DNA and RNA
- the ultimate hybridization stringency reflects both the actual hybridization conditions as well as the washing conditions following the hybridization, and one of skill in the art would know the appropriate manner in which to change these conditions to obtain a desired result
- a prehybridization solution should contain sufficient salt and nonspecific DNA to allow for hybridization to non-specific sites on the solid matrix, at the desired temperature and in the desired prehybridization time
- such prehybridization solution could contain 6x sodium chloride/sodium citrate (lxSSC is 0 15 M NaCl, 0 015 M Na citrate, pH 7 0), 5x Denhardt's solution, 0 05% sodium pyrophosphate and 100 ⁇ g perml of herring sperm DNA
- An appropriate stringent hybridization mixture might then contain 6x SSC, lx Denhardt's solution, 100 ⁇ g per ml of yeast tRNA and 0.05% sodium pyrophosphate.
- DNA-DNA analysis could entail the following: 1 ) prehybridization at room temperature and hybridization at 68 ° C; 2) washing with 0.2x SSC/0.1% SDS at room temperature;
- Transgenic plant should be understood as referring to a plant having stably incorporated exogenous DNA in its genetic material.
- the term also includes exogenous DNA which may be introduced into a cell or protoplast in various forms, including, for example, naked DNA in circular, linear or supercoiled form, DNA contained in nucleosomes or chromosomes or nuclei or parts thereof, DNA complexed or associated with other molecules , DNA enclosed in liposomes , spheroplasts , cells or protoplasts .
- Transgenic plants are also considered to include at least the progeny of such created plants that express the transgene originally inserted into the first generation plant.
- the iteron binding domain is located in the amino-terminus portion of the Rep protein, and in particular, conserved and variable domains in the amino terminus of the Rep protein have been discovered which allow binding to the iteron, and the variable domain maps to residues 1-10 of the Rep protein which defines the sequence specificity of the iteron binding site.
- the binding of Rep to its cognate site is therefore now known to be sequence-specific and the efficiency of the binding is related to the sequence of the first 10-12 aa of the Rep protein and to the sequence of the iterons (i.e., a pair of typically 5 nucleotides separated by two to twenty spacer nucleotides). See Figure 1 for the structure and sequence of an iteron and Rep N-terminal sequences.
- molecular control examples include expressing truncated Reps in single or multiple combinations, each of which bind to one or more geminivirus iterons, and thereby inhibit viral replication, or expressing nucleotide sequences which contain one or more geminivirus iteron sites that would bind and trap the wild type Rep protein, and thereby interfere with geminivirus replication.
- Figs. 1A-1C are a table which shows the amino acid residue sequence of the iteron binding domain of a large number of Rep proteins from different geminivirus isolates, shows the conserved nature of the binding site domain by arranging the geminvirus Rep protein in different conserved groups, and illustrates the conserved relationship between the different geminivirus isolates and the known iterons Figs.
- 1A-1C also define iteron "classes" which distinguish the Rep protein binding specificity such that a Rep protein from one iteron class will not bind the iteron from another iteron class
- the invention describes in one embodiment the use of a single iteron; in another embodiment, the use of two or more iterons, preferably about two to about thirty iterons, although the number can vary widely in view of the fact that Figs. 1A-1C illustrate the iteron sequence for about 28 isolates and because it is likely that additional field isolates will be cloned and sequenced.
- the invention therefore describes a method for producing in a plant resistance to infection by a geminivirus
- the method can be practiced using a variety of approaches based on the basic scientific finding that a conserved iteron binding site is located in the amino terminus of a Rep protein.
- the invention describes in one embodiment a method for producing in a plant resistance to a geminivirus comprising introducing a geminivirus replication associated protein (Rep)-iteron antagonist into said plant, where the antagonist is selected from the group consisting of (1) a nucleotide sequence defining a geminivirus iteron capable of binding to a Rep protein, and (2) a defective Rep protein, wherein the defective Rep comprises a conserved geminivirus iteron binding site.
- the functional viral Rep protein competes with the viral iteron sequence for binding and therby inhibits viral replication.
- a Rep- iteron antagonist can be used in a variety of methods and compositions according to the invention
- the defective Rep protein can be any of a variety of polypeptides which possess the ability to bind a geminivirus iteron sequence, but lack any of a variety of other functions required for geminivirus replication, such as the nicking site activity, the NTP binding site, the AC3 protein interaction site, and the like which render the defective Rep protein incapable of supporting replication
- the Rep protein functions to be deleted or mutated are located in the wild-type protein's carboxy-terminal region, whereas the iteron-binding domain has been discovered to map to the amino-terminal portion of the wild-type Rep protein
- a preferred defective Rep protein of this invention is a truncated Rep protein which contains the amino terminus at least amino acid residues 1-52, preferably amino acid residues 1-52
- a typical protein contains a binding site shown in Figs 1 A-1C, comprising a Rep amino acid sequence and has at least 25 to 30 amino acid residues
- a preferred Rep protein has amino acid residues 1-52
- a defective Rep protein of this invention further has the ability to interact with (i.e., bind to) another Rep protein and form a multimer
- Rep proteins The ability of Rep proteins to interact is shown in the Examples, and can be measured by any of a variety of methods, including the interactions as measured herein
- a Rep protein corresponding to amino acid residues 1 -56 has the ability to bind an iteron and to bind with defective or wild-type Rep protein
- the term "defective replication associated protein” or "defective Rep protein” means any of a variety of peptides and proteins including active fragments, fusion proteins containing an active iteron binding site fragment, and derivatives thereof which possess the geminivirus iteron DNA binding activity Exemplary variations include the deletion mutants and fragmented Rep proteins described in the Exhibits
- a preferred defective Rep protein includes residues 1-56 of the geminivirus Rep protein.
- a preferred Rep protein is based on the natural sequence of a tomato leaf curl virus from New Dehli (ToLCV-Nde), which has been described in several strains, particularly the mild and severe isolates.
- the complete nucleotide sequence of the DNA-A, including the gene which encodes replication associated protein (Rep), of both mild and severe strains of tomato leaf curl virus from New Dehli (ToLCV-Nde) has been determined.
- the nucleotide sequence for DNA-A of both strains of ToLCV-Nde is deposited with Genebank having accession numbers of UI 5015 and UI 5016 for the severe and mild strains, respectively.
- the invention describes a method for simultaneously inhibiting the infection of plants by a large number of different isolates of geminivirus using a broad spectrum defective Rep protein which binds to a conserved iteron present in different geminivirus isolates.
- An exemplary "broad spectrum defective Rep protein” comprises an amino-terminal Rep protein amino acid residue sequence shown in Figs. 1 A- 1 C .
- An exemplary combination includes a small number of different polypeptides, each of which comprises a different amino acid residue sequence for the iteron binding site selected from the corresponding different iteron binding site classes shown in Figs.1 A-IC.
- viruses may originate in different geographical regions, or have diverse host ranges, some isolates share the same iteron sequence and have certain amino acid sequences in the N-terminal region of the Rep protein which give them a common iteron target sequence.
- GGTAC iteron sequence GGTAC
- FQIN amino acids common between them, other than the motif 1, FLTY (SEQ. ED NO: ) , which is conserved throughout the geminiviridae.
- FLTY SEQ. ED NO:
- the homology is not so remarkable.
- the fourth residue downstream of the conserved Phe (F) residue is almost always identical between different isolates having the same iteron sequence.
- a Rep protein can comprise any one of the known iteron binding site sequences shown in Figs. 1A-1C, such as an amino acid residue sequence comprising a formula selected from the group consisting of -FRVQ- (SEQ. LD
- replication associated protein may bind to an iteron sequence selected from the group of sequences selected from GGAGAXGGAGA (SEQ LD NO:99), GGTGTXGGTGT (SEQ ID NO: 100) ,
- GGTACXGGTAC (SEQ LD NO: 107 ), GGGGAXGGGGA (SEQ ID NO: 109 ), GGGGGXGGGGG (SEQ ID NO: 110), GGTGCCCXGGGCGCACC (SEQ ID NO: 101) GCGCCTTCXGAAGGCGCG (SEQ ID NO: 102) GGTTTGCGXCGCAAACC (SEQ ID NO: 103) GGAGGTGCGTCCX- CCTCCACGGG(SEQ tDNO: 105), GGAGTXGGAGT (SEQ LD NO: 106 ) and
- GGTACXGGTAC (SEQ ID NO: 107), GTGAGTGXCACTCAC (SEQ. ED NO: 9), GGTACXGGTAC (SEQ. EDNO:36), GGGGAXGGGGA(SEQ. EDNO:42), GGGGGXGGGGG (SEQ. ED NO:50) wherein "X” is 3-30 nucleotides.
- the replication associated protein (Rep) may bind to a DNA sequence comprising GGTGTCTGGAGTC (SEQ ID NO: 111).
- the Rep protein can have a modified amino acid residue sequence which comprises a modified (mutated or altered) iteron binding site sequence which is produced using combinatorial library screening methods to produce a sequence which exhibits high efficiency binding to a preselected iteron sequence, or which has been selected for specific binding to one or a few related iteron sequences.
- the invention contemplates a nucleic acid comprising a geminivirus iteron nucleotide sequence that defines a geminivirus iteron capable of binding to a Rep protein.
- the iteron sequence can be used to compete for binding to geminivirus Rep protein, and thereby prevent Rep protein from binding iteron sequences present on infective geminiviral replicative forms, thereby inhibiting virus replication and preventing symptoms of infection in the plant.
- the invention contemplates a method for producing resistance to geminivirus infection in a plant comprising introducing a nucleotide sequence into the plant, wherein the nucleotide sequence comprises a geminivirus iteron sequence capable of binding a Rep protein.
- a single nucleic acid molecule may contain multiple iteron sequences.
- the nucleic acid comprises each class of iteron sequences shown in Figsl A-IC.
- Introduction of a defective Rep protein or iteron nucleotide sequence into plants can be accomplished by a variety of methods including standard gene transfer methods, inoculation of the plant with a transfer or carrier vector, "biolistic” (i.e., ballistic) introduction of nucleic acids into mature plant tissue, direct DNA uptake into plant protoplast, transformation of plants with Agrobacterium tumefaciens-based vectors, and the like.
- the Rep protein is typically expressed using a nucleotide sequence which encodes a defective Rep protein and which contains expression control elements which provide for expression of the protein in plants.
- the DNA can contain the iteron sequence, and no protein expression is required.
- Plant expression elements for a nucleotide sequence are generally well known in the art and are not to be considered limiting to the invention.
- the nucleotide sequence which encodes the Rep protein can be present on an expression vector, as a DNA fragment, or as a component of a "transfer” or carrier vector such as the infectious Agrobacterium gene transfer system commonly used in plants.
- iteron sequences can be introduced into plants by a variety of methods, and therefore the invention is not to be construed as so limited.
- the nucleotide sequence can be introduced directly such as by biolistics, can be present on a vector capable of transcribing a nucleic acid copy of the iteron sequence inside a plant cell, or can be present as a component part of the plant genome of a transgenic plant. Preferred iteron sequences are described in the Examples.
- a Rep-iteron antagonist ie., a defective Rep protein, single or multiple iteron nucleotide sequence
- a Rep-iteron antagonist is effective at inhibiting replication of any geminivirus that infects plants and whose replication depends upon the interaction of functional replication associated protein (Rep) with the iteron sequence of the infecting viral genome.
- Such antagonist may also include mutated Rep or iterons.
- Preferred viruses are the Geminiviridae family of viruses, which includes Mastrevirus, Curtovirus, Topcuvirus and Begomovirus genera, and the Nanovirus and Circoviridae viruses or other viruses that replicate using Rep proteins that bind to an iteron, wherein use of a Rep-iteron antagonist reduces infection of the organism.
- Preferred Mastrevirus genus species are selected from the group consisting of Bajra streak virus, Bean yellow dwarf virus, Bromus striate mosaic virus, Chickpea chlorotic dwarf virus, Chloris striate mosaic virus, Digitaria streak virus,
- Digitaria striate mosaic virus Maize streak virus//Ethiopia, Maize streak virus//Ghanal, Maize streak virus//Ghana2, Maize streak virus//Kenya, Maize streak virus// Komatipoort, Maize streak virus/ZMalawi, Maize streak virus//Mauritius, Maize streak virus//Mozambique, Maize streak virus//Nigerial, Maize streak virus//Nigeria2, Maize streak virus//Nigeria3, Maize streak virus/ZPort Elizabeth, Maize streak virus/ZReunionl , Maize streak virus//Reunion2,
- Maize streak virus//Setaria Maize streak virus//South Africa, Maize streak virus//Tas, Maize streak virus//Uganda, Maize streak virus//Vaalhart maize, Maize streak virus//Vaalhart wheat, Maize streak virus/ ⁇ Vheat-eleusian, Maize streak virus//Zaire, Maize streak virus//Zimbabwel, Maize streak virus//Zimbabwe2, Miscanthus streak virus, Panicum streak virus/Karino, Panicum streak virus/Kenya, Paspalum striate mosaic virus, Sugarcane streak virus//Egypt, Sugarcane streak virus/Natal, Sugarcane streak virus/Mauritius, Tobacco yellow dwarf virus, Wheat dwarf virus/Czech Republic (Wheat dwarf virus-CJI, WDV-CJI), Wheat dwarf virus/France and Wheat dwarf virus/Sweden.
- Preferred Curtovirus genus species are selected from the group consisting of Beet curly top virus-California, Beet curly top virus-California//Logan, Beet curly top virus-CFH, Beet curly top virus//Iran, Beet curly top virus-Worland,Horseradish curly top virus, Tomato leafroll virus and Tomato pseudo-curly top virus.
- Preferred Begomovirus genus species are selected from the group consisting of Abutilon mosaic virus, Acalypha yellow mosaic virus, African cassava mosaic virus//Ghana, African cassava mosaic virus/Kenya, African cassava mosaic virus/Nigeria, African cassava mosaic virus/Uganda, Ageratum yellow vein virus, Althea rosea enation virus, Asystasia golden mosaic virus, Bean calico mosaic virus, Bean dwarf mosaic virus, Bean golden mosaic virus-Brazil, Bean golden mosaic virus-Puerto Rico, Bean golden mosaic virus-Puerto Rico/Dominican Rep.
- Lupin leaf curl virus Macroptilium golden mosaic virus-Jamaica//2, Macroptilium goldenmosaicvirus-Jamaica//3, Macrotyloma mosaic virus, Malvaceous chlorosis virus, Melon leaf curl virus, Mungbean yellow mosaic virus, Okra leaf curl virus//Ivory Coast, Okra leaf curl virus//India, Papaya leaf curl virus, Pepper huasteco virus, Pepper golden mosaic virus, (Texas pepper virus), Pepper mild tigrA virus, Potato yellow mosaic virus//Guadeloupe, Potato yellow mosaic virus/Trinidad and Tobago, Potato yellow mosaic virus/Venezuela, Pseuderanthemum yellow vein virus, Rhynchosia mosaic virus, Serrano golden mosaic virus, Sida golden mosaic virus/Costa Guatemala, Sida golden mosaic virus Honduras, Sida golden mosaic virus/Honduras//Yellow vein, Sida yellow vein virus, Solanum apical leaf curl virus, Soy
- Tomato leaf curl virus- Australia Tomato leaf curl virus-Bangalore 1 (Indian tomato leaf curl virus-Bangalorel), Tomato leaf curl virus-Bangalore2, (Indian tomato leaf curl virus, ItoLCV), Tomato leaf curl virus-Bangalore3 (Indian tomato leaf curl virus- Bangalorell), Tomato leaf curl virus-New Delhi/Severe (Tomato leaf curl virus-India2, ToLCV-INl), Tomato leaf curl virus-New Delhi/Mild (Tomato leaf curl virus-India2, ToLCV-IN2), Tomato leaf curl virus-New DelhiLucknow (Indian tomato leaf curl virus), Tomato leaf curl virus//Senegal, Tomato leaf curl virus-Sinaloa (Sinaloa tomato leaf curl virus, STLCV), Tomato leaf curl virus-Taiwan, Tomato leaf curl virus-Tanzania, Tomato mottle virus, Tomato mottle virus-Taino (Taino tomato mottle virus, TTMo V), Tomato severe leaf curl virus//Guate
- the invention also contemplates a nucleic acid molecule, such as a DNA expression vector, useful for expression of a Rep protein of this invention in plants.
- the nucleic acid molecule contains a nucleotide sequence which encodes a geminivirus Rep protein, variant or fragment thereof capable of binding a geminivirus iteron nucleotide sequence, and further contains elements for regulation and control of gene expression in plants Exemplary elements are described in United States Patent Nos 5,188,642, 5,202,422, 5,463,175 and 5,639,947, the disclosures of which are hereby incorporated by reference
- the invention further contemplates a transgenic plant containing a nucleotide sequence of this invention for expressing the geminivirus Rep protein, variants and fragments thereof Preparation of transgenic plants is well known in the art and described at least in the above-mentioned U S patents
- compositions useful for introducing a nucleotide sequence of this invention into plants The composition comprises an effective amount of the nucleotide sequence for introducing the geminivirus Rep protein into a plant, and depends upon the method used for introducing the protein to the plant
- the composition is an aqueous solution containing nucleic acid and buffers to facilitate uptake by protoplast, as is well known
- the composition contains a suspension of Agrobacteria containing the nucleotide sequence capable of expressing the dsDNA-binding protein
- a vector is employed that is capable of integrating the desired gene sequences into the host cell chromosome.
- Cells that have stably integrated the introduced DNA into their chromosomes can be selected by also introducing one or more markers which allow for selection of host cells which contain the expression vector.
- the marker may provide for prototrophy to an auxotrophic host, biocide resistance, e.g. , antibiotics, or heavy metals, such as copper, or the like.
- the selectable marker gene sequence can either be directly linked to the DNA gene sequences to be expressed, or introduced into the same cell by co-transfection.
- the introduced sequence will be incorporated into a plasmid or viral vector capable of autonomous replication in the recipient host.
- any of a wide variety of vectors may be employed for this purpose. Factors of importance in selecting a particular plasmid or viral vector include: the ease with which recipient cells that contain the vector may be recognized and selected from those recipient cells which do not contain the vector; the number of copies of the vector which are desired in a particular host; and whether it is desirable to be able to "shuttle" the vector between host cells of different species.
- DNA encoding the desired protein is preferably operably linked to a promoter region, a transcription initiation site, and a transcription termination sequence, functional in plants.
- a promoter region Any of a number of promoters which direct transcription in a plant cell is suitable.
- the promoter can be either constitutive or inducible.
- Some examples of promoters functional in plants include the nopaline synthase promoter and other promoters derived from native Ti plasmids, viral promoters including the 35S and 19S RNA promoters of cauliflower mosaic virus (Odell et al., Nature 373:810-812 (1985)), and numerous plant promoters.
- Overproducing plant promoters that may be used include nos, ocs, and CaMV promoters. Overproducing plant promoters may also be used. Such promoters, operably linked to the Rep gene, should increase the expression of the Rep protein.
- Overproducing plant promoters that may be used in this invention include the promoter of the small subunit (ss) of ribulose-l ,5-biphosphate carboxylase from soybean (Berry-Lowe et al. , J. Molecular and App. Gen. 7:483-498 (1982), and the promoter of the chlorophyll a/b binding protein. These two promoters are known to be light-induced in eukaryotic plant cells (see, for example, Genetic Engineering of Plants, an Agricultural Perspective,
- Genetic sequences comprising the desired gene or antisense sequence operably linked to a plant promoter may be joined to secretion signal sequences and the construct ligated into a suitable cloning vector.
- plasmid or viral (bacteriophage) vectors containing replication and control sequences derived from species compatible with the host cell are used.
- the cloning vector may typically carry a replication origin, as well as specific genes that are capable of providing phenotypic selection markers in transformed host cells, typically antibiotic resistance genes.
- the present invention relates to a transformed plant cell comprising exogenous copies of DNA (that is, copies that originated outside of the plant) encoding a Rep gene expressible in the plant cell wherein said plant cell is free of other foreign marker genes (preferably, other foreign selectable marker genes); a plant regenerated from the plant cell; progeny or a propagule of the plant; and seed produced by the progeny.
- Plant transformation techniques are well known in the art and include direct transformation (which includes, but is not limited to: microinjection
- modulation of Rep expression may entail the enhancement or reduction of the naturally occurring levels of the protein.
- the translation of RNA encoding Rep may also be reduced or inhibited by the expression of an antisense gene or RNA.
- antisense cloning entails the generation of an expression module which encodes an RNA complementary (antisense) to the RNA encoding Rep (sense).
- antisense RNA By expressing the antisense RNA in a cell which expresses the sense strand, hybridization between the two RNA species will occur resulting in the blocking of translation.
- overexpression of the Rep protein might be accomplished by use of appropriate promoters, enhancers, and other modifications.
- the genetic construct for expressing the desired protein can be microinjected directly into plant cells by use of micropipettes to mechanically transfer the recombinant DNA.
- the genetic material may also be transferred into plant cells using polyethylene glycol to form a precipitation complex with the genetic material that is taken up by cells.
- the desired gene may also be introduced into plant cells by electroporation. (Fromm et al. , "Expression of Genes Transferred into Monocot and Dicot Plant Cells by Electroporation," Proc. Nat' I. Acad. Sci. U. S.A. 82:5824 (1985)).
- plant protoplasts are electroporated with plasmids containing the desired genetic construct. Electrical impulses of high field strength reversibly permeabilize biomembranes allowing the introduction of plasmids. Electroporated plant protoplasts reform cell walls, divide, and form plant calli. Selection of the transformed plant cells expressing the desired gene can be accomplished using phenotypic markers as described above.
- microprojectile bombardment may be used (Daniel H. Methods Mol. Biol. 62:463-489 (1997).
- Another method of introducing the desired gene into plant cells is to infect the plant cells with Agrobacterium tumefaciens transformed with the desired gene. Under appropriate conditions well-known in the art, transformed plant cells are grown to form shoots, roots, and develop further into plants.
- the desired genetic sequences can be joined to the Ti plasmid of Agrobacterium tumefaciens.
- the Ti plasmid is transmitted to plant cells on infection by Agrobacterium tumefaciens and is stably integrated into the plant genome. See Horsch et al , "Inheritance of Functional Foreign Genes in Plants," Science
- Method (1) requires an established culture system that allows culturing protoplasts and plant regeneration from cultured protoplasts.
- Method (2) requires that the plant cells or tissues can be transformed by Agrobacterium and that the transformed cells or tissues can be induced to regenerate into whole plants.
- two plasmids are needed: a T- DNA containing plasmid and a vir plasmid.
- explant inoculation which involves incubation of sectioned tissue with
- Agrobacterium containing the appropriate transformation vector Plant Genetic Transformation and Gene Expression, A Laboratory Manual, Oxford: Blackwell Scientific Publications (1988); Walden, Genetic Transformation in Plants, Milton Koynes: Open University Press (1988)).
- Methods for inserting viral DNA into plant material are known in the art, see for example, U.S. Patent No. 5,569,597 or Porta C. et al, 5:109-111 (1996).
- Suitable plants include, for example but are not limited to, species from the genera Fragaria, Lotus, Medicago, Onobrychis, Trifolium, Trigonella, Vigna, Citrus, Linum, Geranium, Manicot, Daucus, Arabidopsis, Brassica, Raphanus, Sinapis, Atropa, Capsicum, Datura, Hyoscyamus, Lycopersion, Nicotiana, Solanum, Petunia, Digitalis, Majorana, Cichorium, Helianthus, Lactuca, Bromus, Asparagus, Antirrhinum, Hemerocallis, Nemesia, Pelargonium,
- a suspension of transformed protoplasts containing multiple copies of the desired gene is first provided. Embryo formation can then be induced from the protoplast suspensions, to the stage of ripening and germination as natural embryos.
- the culture media will generally contain various amino acids and hormones, such as auxins and cytokinins. It is also advantageous to add glutamic acid and proline to the medium, especially for such species as corn and alfalfa.
- Mature plants, grown from transformed plant cells, are selfed to produce an inbred plant.
- the inbred plant produces seed containing the recombinant DNA sequences promoting increased resistance to geminivirus infection.
- regenerated plants such as flowers, seeds, leaves, branches, fruit, and the like are covered by the invention provided that these parts comprise the geminivirus resistant cells.
- Progeny and variants, and mutants of the regenerated plants are also included within the scope of this invention.
- mutant describes variation as a result of environmental conditions, such as radiation, or as a result of genetic variation in which a trait is transmitted meiotically according to well-established laws of inheritance.
- plants which can be transformed are intended to be hosts included within the scope of the invention (preferably, dicotyledonous plants).
- Such plants include, but are not limited to, species from the genera Fragaria, Lotus, Medicago, Onobrychis, Trifolium, Trigonella, Vigna, Citrus, Linum, Geranium, Manihot, Daucus, Arabidopsis, Brassica, Raphanus, Sinapis, Atropa, Capsicum, Datura, Hyoscyamus, Lycopersicon, Nicotiana, Solanum, Petunia, Digitalis, Majorana, Cichorium, Helianthus, Lactuca, Bromus,
- Some examples of commercially useful agricultural plants to which methods of the invention may be applied include Abutilon, Acalypha, apple,
- Initiation of replication is a function of site specific binding of the Rep protein to its cognate site in the common region.
- the binding site comprises of a small sequence of 5-8 bases in the origin of replication that are repeated and occur in close proximity to the TATA box. Each of these repeats is referred to as iterons.
- ToLCV-Nde the binding site of the Rep protein has not been determined so far.
- Electromobility shift assays EMS A were used to identify the Rep protein binding site in the intergenic region of the viral genome and determine the specificity of this interaction using two homologous strains of ToLCV-Nde which differ in their binding site sequence in the common region.
- the binding site sequence in the severe strain was identified as GGTGTCTGGAGTC (SEQ ED NO : 121 ) while in the mild strain the repeat motif was GGCGTCTGGCGTC GGTGTCTGGAGTC (SEQ ED NO: 159).
- a 13 nucleotide sequence was used comprising this repeat in binding assays.
- the 52 bp common region was used as a probe to interact with the Rep protein. Results showed the formation of a similar complex with both, the identified 13 mer sequence as well as the full length common region suggesting that the identified sequence may well be the binding site for the Rep protein.
- the Rep protein of the mild strain could shift either of the probes resulting in complex. The specificity of this binding was confirmed by competition assays.
- Synthetic oligonucleotides were designed to address several parameters. These were a the sequence of the repeat motif, i.e. changing the 5 ' or the 3 ' iteron from the related strain or any unrelated virus sequence, b) the spacing within the two repeat motifs and c) the numbers of the repeat motifs: one, two or four.
- Rep proteins from the mild or the severe strain could generate a complex with this probe.
- Binding domain of Rep protein may lie on its N-terminus
- T-Repl has only the 1-52 amino acids of the Rep protein and consists of the motif FLTYPKC (SEQ ED NO: 172), a conserved sequence present in all the organisms that replicate via a rolling circle mechanism and the helices ⁇ - 1 and -l .
- T-Rep2 has the 1-111 amino acids from the N-terminus of the Rep protein and comprises of all the three conserved motifs 1, 2 and 3 as well as the helices ⁇ -1 and a-l.
- T-Rep3 has the amino acids 1 - 160 from the N-terminus of the Rep. All three proteins were checked in gel shift assays using the 19 mer repeat sequence to confirm if they still retain DNA binding activity. Of the three truncated Rep proteins, T-Rep 1 and 2 formed a weak complex that appeared as a faint, retarded band, but T-Rep3 generated a complex similar to the wild type full length protein, suggesting that amino acids 1-160 may contain sufficient information to allow in vitro binding of the Rep protein to its cognate site in the origin of replication.
- Electrophoretic mobility shift assays were performed using different synthetic oligonucleotides as probes or competitors to show specificity of binding in our assays.
- the nature and significance of DNA-protein interaction was studied in vivo using transient replication assays in tobacco protoplasts. Alterations were found with respect to sequence, size or number of iterons that reduced binding by the Rep protein and resulted in drastic reduction in virus replication. In addition, it was found that the inability of the Rep protein of the mild strain to accumulate DNA B of the severe strain was related to its inability to recognize the binding site sequence of the severe strain DNA-B.
- ToLCV Rep proteins The full length ACl gene from the severe and the mild strains of ToLC-NdeV was amplified from pMPAl (DNA-A of the severe strain, ToLC-NdeV) and pMPA2 (DNA-A of the mild strain, ToLC-NdeV) (Padidam,
- the amplified sequence was ligated between Bam HI and Hind III sites in baculovirus expression vector, pBAC4x-l (Novagen) resulting in an in-frame fusion of the ACl gene sequence with the vector sequence encoding a methionine and six histidine residues under the polh promoter.
- the clones were identified and confirmed by restriction digestion and sequence analysis.
- Recombinant baculovirus was isolated by co-transfecting 0.5 (g of recombinant plasmid with 1 g of linearized Autographa calif ornica nuclear polyhedrosis virus DNA (Smith, G.E., and Summers, M.D., Virology 59:517-527 (1978)) into Spodopterafrugiperda Sf9 cells (Summers, M.D., and Smith, G.E.,
- Tn-5 cells were harvested 60 h post infection by centrifugation at 3000 rpm for 10 minutes. The pellets were washed in IX PBS and suspended in ice cold IX binding buffer (5 mM imidazole, 0.5 M NaCl, and 20 mM Tris, pH 7.9). The cells were lysed by three cycles of freeze-thaw and the lysate was clarified at 15,000 rpm for 30 minutes. The resulting supernatant was loaded on a Ni-NTA column (Novagen) previously equilibrated with binding buffer and washed with 10 column volumes of wash buffer (70 mM imidazole, 0.5 mM NaCl, and 20 mM Tris, pH7.9).
- wash buffer 70 mM imidazole, 0.5 mM NaCl, and 20 mM Tris, pH7.9
- the protein was eluted with IM imidazole, 0.5 mM NaCl and 20 mM Tris, pH7.9. The eluted fractions were dialyzed against 20mM Tris, pH7.9, 150mM NaCl to remove imidazole, concentrated using Centricon filters (Amicon) and protein concentration was estimated using Bradford's reagent (Biorad).
- ToLC-NdeV specific primers were used to amplify a 52 bp fragment from the ER of the virus genome. This fragment contains the iterons, the transcription start site as well as the TATA box and the conserved hairpin sequence.
- the amplified fragment was end labeled with ( 32 P ATP and T4 polynucleotide kinase, purified on polyacrylamide gels and was used as a probe in the EMSAs.
- the 18mer oligonucleotides containing the potential binding sites (underlined) for the Rep proteins of the two strains were synthesized and annealed to their complementary strands.
- oligonucleotide probes were named bs-m, 5'-GGCGTCTGGCGTCT-3 ' (UI 5017) (SEQ ID NO: 180) for the mild strain and bs-s, 5'- GGTGTCTGGAGTCT-3 ' (U15015) (SEQ ED NO: 189) for the severe strain.
- the final concentrations of the probes were 500 pM (30,000cpm).
- the concentration of competitor DNA used was 100 pM per reaction.
- Probe and competitor DNAs were purified on Sephadex G-25 columns, quantified by a scintillation counting followed by dilution to 30,000 cpm for the binding assays.
- the binding assays were performed using the purified Rep protein from the two strains.
- the binding reactions contained 500 ng of pure protein, 1 ng of labeled DNA and 0.2 ⁇ g of poly dl-dC.
- Binding buffer contained
- a The values shown represent the amount of radioactivity (%) bound in the shifted DNA-protein complex band as a result of the Rep protein binding to the 32 P labeled DNA protein in gel shift assays.
- b The values shown are average (%) amounts of single stranded (ss) and supercoiled (sc) viral DNA detected in four independent protoplasts transfections per mutant.
- Protoplasts prepared from N. tabacum BY2 cells were transfected with 2 ⁇ g of D ⁇ A-A and harvested 48h after electroporation. Viral D ⁇ A was quantitated using a phosphorimager. Standard error values between different transfections were in the range of ⁇ 2-5%.
- the amount of radioactivity bound in the complex shifted as a result of Rep protein binding to its respective CR sequences was assigned a value of 100.
- the amounts of viral D ⁇ A observed in protoplasts inoculated with the wild type D ⁇ A-A of the severe or the mild strain were assigned a value of 100.
- Rep protein was immunopreciptated from 50 ( ⁇ g of Sf9 cell extract using
- mutants were given names identical to the synthetic oligonucleotides used to create the nucleotide changes in the iteron sequence
- the high titer virus stock was used to infect Tn-5 cells for large-scale purification of the target protein
- the soluble protein extracts were loaded on a Ni-NTA column and the eluted fractions were analyzed by SDS PAGE
- the purified Rep protein had an estimated MW of 41 KD in coomassie stained polyacrylamide gels (Fig 2B, lanes 2, 5) and its identity was further confirmed by immunoblotting using ACl polyclonal antibody (Fig 2C, lanes 1 to 7)
- GGTGTCTGGAGTC (nts 2640-2653) (U15015) ( SEQ ED NO: 121) while in the mild strain the repeat motif identified was GGCGTCTGGCGTC (nts 2640-2653) (SEQ ED NO: 122 ) (U15017) (Chatterji, A., etal, J. Virol 73:5541-5549 (1999)).
- the 13-bp sequence (nts 2640-2653) containing the repeat motifs was used as the probe in EMSAs with the purified Rep protein.
- the 52-bp fragment of the common region (nts 2614 to 2666) from the respective strains was used as a probe in similar assays.
- the iterons comprising the binding site of the severe strain Rep protein are not identical repeats
- synthetic oligonucleotides were designed with GGTGTCTGGTGTC TIT 9/10) (SEQ ED NO 165)and GGAGTCTGGAGTC TIT 1 1/12) (SEQ ID NO 193) as perfect repeats and tested in EMSAs for their capacity to bind the Rep protein of the severe strain
- the Rep protein bound to GGTGTCTGGTGTC SEQ ID NO 194as visualized by a retarded band but the binding to GGAGTCTGGAGTC (SEQ ID NO 195)was weaker in comparison to the mutant, 9/10 (Fig 4A, lanes 3 and 4)
- both mutants replicated viral DNA indistinguishable from the wild type controls
- strain of ToLCV-Nde are separated by a single nucleotide.
- the distance between the iterons was either increased to six nucleotides (IT 13/14) or reduced to none by deleting the single
- This example defines DNA sequences in the viral origin of replication that are specifically recognized by the respective Rep protein of two strains of ToLC-NdeV and demonstrates that binding of the Rep protein to their cognate sequences is essential for viral replication.
- the binding of the Rep proteins to their cognate iterons is found to be highly specific between the strains and is dependent upon several criteria including the sequence, spacing and the number of iterons. Further, evidence is provided that any mutation in the iteron that affects DNA binding in vitro impacts viral DNA accumulation in vivo.
- Rep protein of ToLC-NdeV (severe strain) specifically binds to the iterated sequence, 5' GGTGTCTGGAGTC (U15015) (SEQ ED NO: 121) located on the
- Rep protein recognition of the binding site by the Rep protein was also found to be sensitive to any changes made in the spacing between the iterons Drastically reduced levels of virus accumulation were observed in protoplasts when the spacing between the two iterons was changed to either six nucleotides or reduced to none Because the Rep protein may bind as a dimer (Fontes, E P B , et al, J. Biol Chem. 169 8459-8465 (1994a), Fontes, E P B , et al, Plant Cell 6405-416 (1994b)), it is possible that the proximity of the two repeat motifs is congenial for binding to occur and any alterations with respect to spacing between the two iterons does not allow efficient recognition
- GGAGTCTGGAGTC (SEQ ID NO:202) sequence was used as a probe. Also, the probe GGTGTCTGGTGTC (SEQ ED NO: 203) was able to compete out any complex with the wild type repeat sequence, GGTCTGGAGTC (SEQ ED NO: 121) abolishing the binding of the severe strain Rep protein with its wild type iteron sequence. This data suggests that 5' iteron sequences are necessary for efficient binding of the Rep protein to its binding site.
- the DNA binding sites for the replication associated protein (Rep) of two strains of tomato leaf curl virus from New Delhi were identified using electrophoretic mobility shift assays (EMSAs).
- the Rep proteins of the two strains were found to exhibit strict sequence specificity in recognition of their cognate repeat motifs (iterons) in the origin despite the fact that they share 91% sequence identity between them.
- EMSAs electrophoretic mobility shift assays
- GGTAG Beangoldenmosaicvirus(BGMV; iteronsequence, TGGAG), Tomato leaf curl virus (ToLCV-Nde: iteron sequence, GGTGT) and Potato yellow mosaic virus (PYMV; iteron sequence, GGGGG). Differences at amino acid positions 9 and 10 on the N-terminal of their Rep proteins were investigated. Differences were found in the viruses at position 10 as shown in Table 2.
- this strategy is based upon a very fundamental step in virus infection and establishment in the host and because there appear to be limited types of iterons present within the Begomoviruses, it offers a broad application in control of geminiviruses by combining different types of truncated Rep proteins recognizing different types of iterons Based on this experiment, it is possible to compete with the wild type Rep protein by expressing a truncated Rep that will
- ToLCV-Nde Rep The binding sites of ToLCV-Nde Rep are not known Potential binding site sequences were identified in the common region of ToLCV-Nde genome by site directed mutagenesis (Chatterji, A. , et al. , J. Virol 73 5481 -5489 ( 1999)) and further confirmed by gel shift assays using purified Rep protein (Chatterji et al , in preparation)
- the ToLCV-Nde Rep protein binds to the iterated motifs, GGTGTCTGGAGTC (nts 2640-2653) (U15015) (SEQ ED NO 121) in the origin of replication
- GGTGTCTGGAGTC nts 2640-2653
- U15015 SEQ ED NO 121
- Coding sequences corresponding to ACl were PCR amplified and cloned in bacterial expression vector pET 28a (Novagen) and overexpressed in E coli cells
- the recombinant proteins were named according to their C- and N- terminal amino acids
- the C-terminal truncations were made by inserting an in-frame stop codon at positions 2436, p AC 1-1 (1 .
- Transient replication assays in plants were performed as follows. Two week old seedlings of N benthamiana were grown in magenta boxes and inoculated with partial tandem dimers of viral D ⁇ A using a Bio Rad helium driven particle gun (Padidam, M., et al, J. Gen. Virol. 76:25-35 (1995)). Ten plants were inoculated for each mutant using 0.5 ⁇ g each of D ⁇ A-A and D ⁇ A-B genomic components per plant. Plants were observed for symptom development and the newly emerging leaves were harvested for Southern blot analysis after 3 -4 weeks post inoculation. E) Southern blot analysis
- DNA and polypeptide sequences or accession numbers used in the example are as follows: pMPAl-U15015, pMPBl-U15017, pMPA2-U15016, ACMV-K-J02057, J02058, PHV-mex-X70418, 70419 and PYMV/TT-AF039031.
- the peptide sequence of the full length Rep protein of ToLCV-Nde is: MASPRRFRVNAKNYFLTYPKCSLTKEEALSQLQTLETPTKKKFIKICRE LHEDGSPHEHVLIQFEGKFQCKN RFFDLVSPSRSAHFHPNIQGAKSAS
- EPLYSGREMALPEEEEEHSQEAS (SEQ ED NO: 183) (U15015)
- TRepl/pACl-1 has the first 52 amino acids from the N-terminus cloned in plau 6 and the sequence is as follows: MASPRRFRVNAKNYFLTYPKCSLTKEEALSQLQTLETPTKKKFIKICRE LHE (SEQ ED NO: 184) (U15015)
- TRep2/pACl-2 has the first 114 amino acids from the N-terminus cloned in plau 6 and the sequence is as follows:
- TRep3/pACl-3 has the first 160 amino acids from the N-terminus cloned in plau ⁇ and the sequence is as follows:
- the AC 1 binds specifically to a directly repeated motif DNA sequence in the common region of the ToLCV-Nde genome.
- Purified Rep proteins were truncated at amino acids 160, 114 and 52 to map the C-terminal boundary of the ACl DNA binding domain in vitro.
- a full length Rep protein (encoding amino acids 1-360 of the ACl gene) was used in all assays.
- the truncated and full length Rep proteins were over-expressed in E. coli under a T7 promoter and purified on a nickel affinity column.
- the affinity-purified proteins were highly enriched as determined by coomassie stained SDS PAGE gels and were detected in immuno-blots using the anti- histidine antibody.
- Table 5 Virus replication in BY2 protoplasts and Nicotiana benthamiana plants co-inoculated with truncated Rep protein constructs and viral D ⁇ A (Al).
- Reduction in replication levels was estimated by quantifying the amount of radioactivity using a phosphorimager (Storm 860, Molecular Dynamics). The levels of reduction in viral replication was not as dramatic in the presence of expressed plasmids p AC 1 - 1 and p AC 1 -2.
- pAC 1 - 1 encodes 52 amino acids of the N-terminal of ACl followed by an in-frame stop codon immediately after the 52 amino acids.
- pACl-2 has the capacity to encode 114 N-terminal amino acids of the ACl gene.
- Table 6 Virus replication in BY2 protoplasts and Nicotiana benthamiana plants co-inoculated with truncated Rep protein constructs and viral DNA (A2).
- the level of viral DNA in ToLCV infected plants was analyzed by southern blot analysis of young leaves sampled 21 days post inoculation using DNA-A (ACl) and DNA-B (BC1) specific probes (Fig 7).
- the viral DNA levels were variable ranging from undetectable to very low (an average of 15% of the
- the binding site sequences of ToLCV-Nde are not identical repeats, (GGTGTCTGGAGTC) (U15015) (SEQ ID NO:206).
- the putative iteron was identified as GGAGA (J02057) (SEQ ED NO:207); for PHV, the putative origin recognition motif may be GGTGA (SEQ ED NO: ) (X70418) and in case of PYMV, the potential binding sites may be GGTGT (SEQ ED NO: ) (AF039031) .
- T-Rep3 was tested in competition experiments. The numbers indicate virus replication levels as determined by southern blotting and phosphorimage analysis. Since any virus that had identical iteron sequences as the severe strain of ToLCV-Nde was not tested, it can only conclude that replication levels of the virus may go down in cases where competition is afforded by the truncated Rep. And that competition will result in cases where the origin sequences can be recognized by the truncated rep protein.
- the minimal DNA binding domain of the ACl gene of ToLCV to amino acids 1-160 was mapped and it was shown that the transient expression of these N-terminal sequences of the AC 1 significantly inhibits ToLCV DNA accumulation in tobacco protoplasts and plants. It was found that the sequences comprising the first 1 -52 or 1 - 114 amino acids of the Rep protein cannot effectively compete with the full length Rep protein to cause a reduction in virus accumulation even though a minor reduction in virus replication was observed. However, the pACl-3 truncation afforded maximum competition to the full length Rep protein in terms of binding to the ori sequences as well as in reducing viral replication in protoplasts and plants.
- Geminivirus Rep proteins are multifunctional and are involved in both replication and regulation of gene expression.
- the ACl protein of TGMV has been known to bind with high affinity to repeat motifs located between the conserved TATA box and the initiation site of ACl transcription (Fontes, E.P.B., et al, Plant Cell 6:405-416 (1994a); Fontes, E.P.B., et al, J. Biol. Chem. 269:8459-8465 (1994b)). It is presumed that this binding to the origin recognition sequence is responsible for the repression of AC 1 transcription in TGMV (Sunter,
- Virus having identical iteron sequences as the severe strain of ToLCV-Nde was not tested, therefore it may be concluded that replication levels of the virus may go down in cases where competition is afforded by the truncated Rep.
- Several approaches to control of geminiviruses have been developed.
- Transgenic N benthamiana plants expressing defective interfering D ⁇ A (Stanley et al., 1990, Frishmuth, T., and Stanley, J., Virology 753:539-544 (1991)) of ACMV were less susceptible to ACMV infection but resistance was confined to closely related strains of ACMV owing to the need for ACl mediated trans complementation of the Dl D ⁇ A.
- oligonucleotide-directed mutagenesis (Horton, R.M., "In vifro recombination and mutagenesis of DNA,” in PCR cloning protocls., vol 67, White, B.A., ed., Humana Press, Inc., Totowa, NJ (1994), pp. 141-150) was used to substitute the fragments.
- mutagenic oligonucleotides were designed to substitute codons. All mutants were confirmed by DNA sequencing.
- Protoplasts derived from N t ⁇ b ⁇ cum B Y-2 suspension cultures were used for transfection with viral D ⁇ A (Watanbe, E75S Letters 279:65-69 (1989)).
- One million protoplasts were inoculated by electroporation (250 V, 500 ⁇ F) with 2 mg each of D ⁇ A-A and D ⁇ A-B and 40 mg of sheared herring sperm D ⁇ A.
- Protoplasts were collected from cultures 48h post inoculation for D ⁇ A isolation and analysis. Table 7. Description of mutants used in this study
- A2-RepAl DNA-A of mild strain containing the full length Rep gene from the severe strain was digested with Nco I and Bel I and cloned at respective site in the mild strain.
- A2-cRepAl DNA-A of the mild strain containing the 3 ' sequences coding for 256 amino acids from the C-terminal region derived from the severe strain.
- the C-terminal amino acids were cloned as Cla I to Cla I fragment from the severe strain.
- A2-CRB 1 DNA-A of the mild strain containing the common region of severe strain DNA B.
- the common region of DNA B was amplified as Xba I to Spe I fragment.
- the primers designed to amplify common region from DNA-B had 18 nucleotides of the mild strain DNA-A at their ends in addition to DNA-B specific sequences. These sequences of the mild strain were later used as primers to extend and exchange the CR of A2.
- A2- A double mutant of the mild strain containing two amino RepMl/CRAl acid substitutions, Val9 and Asp 10 to Asn in Rep gene and the CR of Al Amino acid substitutions were made by oligonucleotide-directed mutagenesis
- the wild type sequence of the putative binding site GGTGTCTGGAGTC is changed to GGGTCTGGAGTC due to this deletion.
- the wild type sequence in the putative binding site, GGTGTCTGGAGTC is changed to GGTGTCTGGGTC due to this deletion.
- A1-CRM4 DNA-A of the severe strain containing a substitution of 3 rd nucleotide in the putative binding site sequence GGTGTCTGGAGTC at 2642 GGCGTCGGAGTC.
- Viral DNA was detected using DNA-A specific radiolabelled probe (a 900 bp, Afl ll-Pst I fragment containing the Rep, REn and TrAP genes), or a probe specific for the DNA-B (878 bp PCR amplified movement protein gene).
- the amount of viral DNA was quantified as previously described (Padidam, M., et al, Virology 114:390-404 (1996)) by exposing the Southern blots to phosphor screens and counting the radioactivity on a phosphorimager (Molecular Dynamics).
- the amino acid sequence identity between individual genes in Al and A2 ranged from 91-99% with the greatest similarity in the coat protein gene.
- the nucleotide sequence identity between the CRs of Al and BI is 97% as compared to 79% between the CRs of A2 and BI. It was not known whether the mild phenotype in plants inoculated with A2 and BI is due to inefficient replication of the virus or because of its inability to spread in the plant.
- BY-2 protoplasts were transfected with Al or A2 DNAs and viral DNA replication was quantitated 48h after transfection. A2 does not accumulate to the same level as the Al in protoplasts.
- the 3' region of the Rep gene coding for 256 amino acids (containing 18 of the 22 amino acid differences between the two Rep proteins) from the carboxyl terminal end of Rep (Cla l-Cla I fragment) was exchanged between the strains (A2- cRepAl and Al-cRepA2; Fig. 8B; Table 7) and determined the ability of the Rep chimera to replicate in tobacco protoplasts.
- the hybrid Rep proteins were functional in both strains but did not change the phenotype of the two strains.
- the severe strain mutant, Al-cRepA2 accumulated both D ⁇ A-A and D ⁇ A-B at levels similar to the wild type (Al ) virus
- ERs of pMPAl and pMPA2 are only 80% identical while those of pMPAl and pMPB are 97% identical. Further, pMPA2 and pMPB share only
- RepM and CRM denote mutations in the Rep gene or in the CR respectively.
- the values shown are average (%) amounts of single stranded (ss) and double stranded (ds) viral DNA detected in sixteen independent protoplasts transfections per mutant
- Protoplasts prepared from N tabacum BY2 cells were transfected with 2 ⁇ g each of DNA-A and DNA-B and harvested 48 th after electroporation Viral DNA was quantitated using a phosphorimager Standard error values between different transfections were the range of ⁇ 2-5% b
- the values show average amount of viral DNA in ten inoculated N benthamiana plants per mutant The plants were inoculated with 0 5 ⁇ g each of DNA-A and DNA- B using a particle acceleration gun Standard error values ranged from 2-5% between different plants c
- the amounts of viral DNA observed in protoplasts and plants inoculated with the severe strain were assigned a value of 100 d Not determined
- ACl protein of the two strains displays strict specificity in recognising their respective replication origins and the interaction of the two may be important in driving strain specific replication
- the experiments provided information to delimit two essential features that influence replication specificity of two strains, the common region sequences and the ⁇ -terminal residues in Rep protein. Mutations in the ⁇ -terminal region (amino acids 1-110) of Al and A2 Rep proteins were next introduced with concomitant changes in their viral origin of replication to analyze the precise determinants of a functional, replication competent interaction.
- the Rep protein in geminiviruses shares sequence similarities with other initiator proteins that follow rolling circle mode of replication. Based on comparison of sequences of these proteins, Koonin and Ilyina (Koonin, E. V. and
- Ilyina J.V., J. Gen. Virol 73:2763-2766 (1992) identified a domain amongst geminiviruses in the ⁇ -terminal region of Rep protein that may be involved in initiating rolling circle replication. In this region, at least three motifs have been identified: Motif III, [xxYxxK] is involved in D ⁇ A nicking and closing activities (Laufs, J.S., et al, FEBS Lett. 377.15S-161 (1995); Hoogstraten, R.A, et al,
- Rep protein in geminiviruses is known to bind with high affinity to its binding site in the on Based on comparison of many on sequences in geminiviruses (Arguello-Astorga, G.R , et al, Virology 203 90-100 (1994), Behjatnia, S A , et al, Nucleic Acids Res. 26.925-931 (1998), Fontes, E P B , et al, J. Biol Chem.
- the 3rd and the 10th nucleotides on the potential binding site in A2 (GGCGTCTGGCGTC) (SEQ ED NO: 122)were mutated to T and A respectively (GGTGTCGGAGTC) (SEQ ID NO: 121) to make the repeat sequence identical to that of Al (mutant A2-RepMl/CRM3, Fig. 8C).
- the mutant A2-RepMl/CRM3 was functional in protoplasts and replicated DNA A and B to wild type levels (Fig. 9B, lanes 8, 17; Table 8).
- Asp 10 to Asn is expected to be more significant than Val9 to Ile9; we therefore made another mutant A2- RepM2/CRM3, where only the Asp 10 to Asn of Rep protein in A2 is changed together with 3rd (C to T) and the 10th (C to A) nucleotides of the ori to make it identical to Al (Fig. 10C).
- the AsnlO to Asp was made in Rep protein of Al (Al-RepM3) without any changes in its ori (Fig. 8C).
- Protoplasts transfected with A2-RepM2/CRM3 accumulated high levels of viral DNA (Fig. 9B, Lanes 9, 18; Table 8) comparable to the wild type severe strain.
- This mutant was further modified by substituting Asnl 0 to Asp (Al-RepM4/CRM4, Fig. 10C).
- the mutant A l-RepM4/CRM4 accumulated wild type levels of D ⁇ A-A in protoplasts (Fig. 9 A, lanes, 9, 18; Table 8) indicating that the Asp 10 may indeed interact with the 3rd base of the iteron, GGCGTC sequence.
- the binding site of Rep protein of ToLCV- ⁇ de has not been biochemically determined. Site directed mutagenesis was used to determine whether or not the 13 nucleotide sequence identified in the ori interacts in a functional way with the Rep protein.
- the severe strain mutants Al-CRMl and Al -CRM2 which contain single nucleotide deletions in the 13 -mer sequence, failed to accumulate viral D ⁇ A demonstrating that the CR sequence is essential for virus replication. Since these deletions also affected spacing of the putative binding site, these results indicate that both sequence and spacing may contribute to specificity.
- the mutant A2-RepM2/CRM3 which contains an Asp 10 to Asn mutation in the Rep protein and corresponding changes in the potential binding site sequence GGCGTCTGGCGTC (SEQ ID NO: 122) to GGTGTCTGGAGTC (SEQ ID NO: 121) (identical to the severe strain) restored the replication efficiency of A2 DNA.
- AsnlO may differentiate between Al and A2 strains and determine the specificity in recognizing ori sequences.
- the fact that replication of BI was restored by changing the putative binding site sequence of A2 coupled with mutation of the Rep protein support the conclusion that both components are key factors that determine which DNA template is to undergo replication.
- the role of the other two amino acids Lys40 and Glu54, that are different between the two Rep proteins was not studied and therefore do not conclude that Asn 10 is solely responsible for strain specificity.
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Virology (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Peptides Or Proteins (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
Description
Claims
Priority Applications (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU27366/00A AU2736600A (en) | 1999-01-26 | 2000-01-27 | Control of virus infection using replication associated proteins, compositions and methods of use |
MXPA01007582A MXPA01007582A (en) | 1999-01-26 | 2000-01-27 | Control of virus infection using replication associated proteins, compositions and methods of use. |
EP00905726A EP1147177A4 (en) | 1999-01-26 | 2000-01-27 | Control of virus infection using replication associated proteins, compositions and methods of use |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US11728599P | 1999-01-26 | 1999-01-26 | |
US60/117,285 | 1999-01-26 |
Publications (3)
Publication Number | Publication Date |
---|---|
WO2000043494A2 WO2000043494A2 (en) | 2000-07-27 |
WO2000043494A3 WO2000043494A3 (en) | 2000-11-30 |
WO2000043494A9 true WO2000043494A9 (en) | 2001-08-09 |
Family
ID=22372016
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2000/001849 WO2000043494A2 (en) | 1999-01-26 | 2000-01-27 | Control of virus infection using replication associated proteins, compositions and methods of use |
Country Status (4)
Country | Link |
---|---|
EP (1) | EP1147177A4 (en) |
AU (1) | AU2736600A (en) |
MX (1) | MXPA01007582A (en) |
WO (1) | WO2000043494A2 (en) |
Families Citing this family (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB9920000D0 (en) * | 1999-08-25 | 1999-10-27 | Imp Cancer Res Tech | Polypeptides |
CN1496367A (en) | 2001-05-07 | 2004-05-12 | E | Materials and methods for producing tomato yellow leaf curl virus resistance in plants |
WO2010099320A1 (en) * | 2009-02-25 | 2010-09-02 | University Of Hawaii | Plant resistance to banana bunchy top virus |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU2461297A (en) * | 1996-04-16 | 1997-11-07 | Regents Of The University Of California, The | Transgenic plants expressing geminivirus genes |
-
2000
- 2000-01-27 MX MXPA01007582A patent/MXPA01007582A/en not_active Application Discontinuation
- 2000-01-27 WO PCT/US2000/001849 patent/WO2000043494A2/en not_active Application Discontinuation
- 2000-01-27 AU AU27366/00A patent/AU2736600A/en not_active Abandoned
- 2000-01-27 EP EP00905726A patent/EP1147177A4/en not_active Withdrawn
Also Published As
Publication number | Publication date |
---|---|
AU2736600A (en) | 2000-08-07 |
MXPA01007582A (en) | 2003-06-24 |
EP1147177A4 (en) | 2005-03-16 |
WO2000043494A3 (en) | 2000-11-30 |
WO2000043494A2 (en) | 2000-07-27 |
EP1147177A2 (en) | 2001-10-24 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Briddon et al. | Subviral agents associated with plant single-stranded DNA viruses | |
Brunetti et al. | High expression of truncated viral Rep protein confers resistance to tomato yellow leaf curl virus in transgenic tomato plants | |
Kunik et al. | Transgenic tomato plants expressing the tomato yellow leaf curl virus capsid protein are resistant to the virus | |
Padidam et al. | The role of AV2 (“precoat”) and coat protein in viral replication and movement in tomato leaf curl geminivirus | |
Garrido-Ramirez et al. | Bean dwarf mosaic virus BV1 protein is a determinant of the hypersensitive response and avirulence in Phaseolus vulgaris | |
Tacke et al. | Genetic engineering of potato for broad-spectrum protection against virus infection | |
US7732665B2 (en) | Method for the preparation of transgenic plants characterised by geminivirus lasting resistance | |
Gafni | Tomato yellow leaf curl virus, the intracellular dynamics of a plant DNA virus | |
van der Wilk et al. | Expression of the potato leafroll virus ORF0 induces viral-disease-like symptoms in transgenic potato plants | |
Melgarejo et al. | Molecular and biological characterization of distinct strains of Jatropha mosaic virus from the Dominican Republic reveal a potential to infect crop plants | |
US8039688B2 (en) | Geminivirus resistant transgenic plants | |
WO2000043494A9 (en) | Control of virus infection using replication associated proteins, compositions and methods of use | |
Tao et al. | Function of A-Rich region in DNAβ associated with Tomato yellow leaf curl China virus | |
US6747188B2 (en) | Transgenic plants expressing a mutant geminivirus AL3/C3 coding sequence | |
Cooper et al. | Transgenic resistance genes from nepoviruses: efficacy and other properties | |
US6852907B1 (en) | Resistance in plants to infection by ssDNA virus using inoviridae virus ssDNA-binding protein, compositions and methods of use | |
WO2004065557A2 (en) | PEPTIDE APTAMERS THAT BIND TO THE REP PROTEINS OF ssDNA VIRUSES | |
AU2003244592B2 (en) | Resistance to infection by ssDNA virus using inoviridae virus ssDNA-binding protein, compositions and methods of use | |
US20120159667A1 (en) | Variants of nrr activate plant disease resistance | |
MXPA01003422A (en) | Geminivirus resistant transgenic plants | |
Saeed | The role of a geminiviral DNA β satellite in viral pathogenicity and movement | |
Herrera-Valencia | Molecular characterisation of the intergenic regions of banana bunchy top virus | |
Shepherd | The use of maize streak virus (MSV) replication-associated protein mutants in the development of MSV-resistant plants | |
Dugdale | Promoter activity associated with the intergenic regions of banana bunchy top virus |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CR CU CZ DE DK DM EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GH GM KE LS MW SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
AK | Designated states |
Kind code of ref document: A3 Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CR CU CZ DE DK DM EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A3 Designated state(s): GH GM KE LS MW SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
WWE | Wipo information: entry into national phase |
Ref document number: PA/a/2001/007582 Country of ref document: MX |
|
WWE | Wipo information: entry into national phase |
Ref document number: IN/PCT/2001/00903/MU Country of ref document: IN |
|
AK | Designated states |
Kind code of ref document: C2 Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CR CU CZ DE DK DM EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: C2 Designated state(s): GH GM KE LS MW SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
COP | Corrected version of pamphlet |
Free format text: PAGES 1/12-12/12, DRAWINGS, REPLACED BY NEW PAGES 1/15-15/15; DUE TO LATE TRANSMITTAL BY THE RECEIVING OFFICE |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2000905726 Country of ref document: EP |
|
WWP | Wipo information: published in national office |
Ref document number: 2000905726 Country of ref document: EP |
|
REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
WWW | Wipo information: withdrawn in national office |
Ref document number: 2000905726 Country of ref document: EP |