WO2000039310A1 - Rubredoxin fusion proteins, protein expression system and methods - Google Patents
Rubredoxin fusion proteins, protein expression system and methods Download PDFInfo
- Publication number
- WO2000039310A1 WO2000039310A1 PCT/US1999/031176 US9931176W WO0039310A1 WO 2000039310 A1 WO2000039310 A1 WO 2000039310A1 US 9931176 W US9931176 W US 9931176W WO 0039310 A1 WO0039310 A1 WO 0039310A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- rubredoxin
- fusion protein
- terminal
- constituent
- fused polypeptide
- Prior art date
Links
- 108060007223 rubredoxin Proteins 0.000 title claims abstract description 312
- 108020001507 fusion proteins Proteins 0.000 title claims abstract description 239
- 102000037865 fusion proteins Human genes 0.000 title claims abstract description 235
- 238000000034 method Methods 0.000 title claims abstract description 49
- 108090000623 proteins and genes Proteins 0.000 title description 94
- 102000004169 proteins and genes Human genes 0.000 title description 78
- 230000014509 gene expression Effects 0.000 title description 37
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 247
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 172
- 229920001184 polypeptide Polymers 0.000 claims abstract description 140
- 239000000470 constituent Substances 0.000 claims abstract description 63
- 125000006850 spacer group Chemical group 0.000 claims abstract description 40
- 238000001261 affinity purification Methods 0.000 claims abstract description 23
- 239000000427 antigen Substances 0.000 claims abstract description 21
- 108091007433 antigens Proteins 0.000 claims abstract description 21
- 102000036639 antigens Human genes 0.000 claims abstract description 21
- 229960005486 vaccine Drugs 0.000 claims abstract description 18
- 230000006337 proteolytic cleavage Effects 0.000 claims abstract description 11
- 210000004027 cell Anatomy 0.000 claims description 85
- 150000001413 amino acids Chemical group 0.000 claims description 56
- 239000002773 nucleotide Substances 0.000 claims description 46
- 125000003729 nucleotide group Chemical group 0.000 claims description 46
- 210000004899 c-terminal region Anatomy 0.000 claims description 40
- 238000003776 cleavage reaction Methods 0.000 claims description 40
- 230000007017 scission Effects 0.000 claims description 39
- 102000040430 polynucleotide Human genes 0.000 claims description 36
- 108091033319 polynucleotide Proteins 0.000 claims description 36
- 239000002157 polynucleotide Substances 0.000 claims description 36
- 239000013604 expression vector Substances 0.000 claims description 35
- 108010011942 LH Receptors Proteins 0.000 claims description 33
- 102000023108 LH Receptors Human genes 0.000 claims description 33
- 108010076181 Proinsulin Proteins 0.000 claims description 21
- 239000012634 fragment Substances 0.000 claims description 21
- 230000004048 modification Effects 0.000 claims description 20
- 238000012986 modification Methods 0.000 claims description 20
- NRYBAZVQPHGZNS-ZSOCWYAHSA-N leptin Chemical compound O=C([C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC(C)C)CCSC)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CS)C(O)=O NRYBAZVQPHGZNS-ZSOCWYAHSA-N 0.000 claims description 19
- 108010092277 Leptin Proteins 0.000 claims description 17
- 102000016267 Leptin Human genes 0.000 claims description 17
- 229940039781 leptin Drugs 0.000 claims description 17
- 241000605762 Desulfovibrio vulgaris Species 0.000 claims description 15
- 230000027455 binding Effects 0.000 claims description 14
- 238000010367 cloning Methods 0.000 claims description 14
- 210000003000 inclusion body Anatomy 0.000 claims description 12
- 230000001580 bacterial effect Effects 0.000 claims description 8
- 238000013467 fragmentation Methods 0.000 claims description 8
- 238000006062 fragmentation reaction Methods 0.000 claims description 8
- 230000028993 immune response Effects 0.000 claims description 8
- 238000001042 affinity chromatography Methods 0.000 claims description 7
- 101710162629 Trypsin inhibitor Proteins 0.000 claims description 4
- 229940122618 Trypsin inhibitor Drugs 0.000 claims description 4
- 239000002671 adjuvant Substances 0.000 claims description 4
- 239000002753 trypsin inhibitor Substances 0.000 claims description 4
- 108010093488 His-His-His-His-His-His Proteins 0.000 claims description 3
- 150000001768 cations Chemical class 0.000 claims description 3
- 108091008146 restriction endonucleases Proteins 0.000 claims description 3
- 239000012504 chromatography matrix Substances 0.000 claims description 2
- 230000004927 fusion Effects 0.000 abstract description 56
- 230000000890 antigenic effect Effects 0.000 abstract description 10
- 239000000463 material Substances 0.000 abstract description 9
- 150000001875 compounds Chemical class 0.000 abstract description 5
- -1 vaccines Chemical class 0.000 abstract description 4
- 239000000203 mixture Substances 0.000 abstract 1
- 238000005215 recombination Methods 0.000 abstract 1
- 230000006798 recombination Effects 0.000 abstract 1
- 235000018102 proteins Nutrition 0.000 description 68
- 235000001014 amino acid Nutrition 0.000 description 58
- 229940024606 amino acid Drugs 0.000 description 56
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 39
- 108010074860 Factor Xa Proteins 0.000 description 33
- 238000000746 purification Methods 0.000 description 24
- 239000013598 vector Substances 0.000 description 22
- 125000003275 alpha amino acid group Chemical group 0.000 description 21
- 230000015572 biosynthetic process Effects 0.000 description 20
- 241000588724 Escherichia coli Species 0.000 description 19
- 238000003786 synthesis reaction Methods 0.000 description 19
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 18
- 239000000047 product Substances 0.000 description 16
- 108010013369 Enteropeptidase Proteins 0.000 description 14
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 14
- 102100029727 Enteropeptidase Human genes 0.000 description 13
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical group [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 13
- 108010064539 amyloid beta-protein (1-42) Proteins 0.000 description 13
- 239000013612 plasmid Substances 0.000 description 13
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 12
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 12
- 241001465754 Metazoa Species 0.000 description 12
- 101001022382 Sus scrofa Leptin Proteins 0.000 description 12
- 238000004519 manufacturing process Methods 0.000 description 12
- 239000000499 gel Substances 0.000 description 11
- 108091026890 Coding region Proteins 0.000 description 10
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 10
- 229910052742 iron Inorganic materials 0.000 description 10
- 229920002704 polyhistidine Polymers 0.000 description 10
- 108010090849 Amyloid beta-Peptides Proteins 0.000 description 9
- 102000013455 Amyloid beta-Peptides Human genes 0.000 description 9
- 108020004414 DNA Proteins 0.000 description 9
- 241000283973 Oryctolagus cuniculus Species 0.000 description 9
- 108091005804 Peptidases Proteins 0.000 description 9
- 239000004365 Protease Substances 0.000 description 9
- 239000000872 buffer Substances 0.000 description 9
- 235000018417 cysteine Nutrition 0.000 description 9
- 230000002163 immunogen Effects 0.000 description 9
- 229930027917 kanamycin Natural products 0.000 description 9
- 229960000318 kanamycin Drugs 0.000 description 9
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 9
- 229930182823 kanamycin A Natural products 0.000 description 9
- 101001039035 Homo sapiens Lutropin-choriogonadotropic hormone receptor Proteins 0.000 description 8
- 102000004877 Insulin Human genes 0.000 description 8
- 108090001061 Insulin Proteins 0.000 description 8
- 108700001237 Nucleic Acid-Based Vaccines Proteins 0.000 description 8
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 8
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 8
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 8
- 238000004220 aggregation Methods 0.000 description 8
- 238000004458 analytical method Methods 0.000 description 8
- ATDGTVJJHBUTRL-UHFFFAOYSA-N cyanogen bromide Chemical compound BrC#N ATDGTVJJHBUTRL-UHFFFAOYSA-N 0.000 description 8
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 8
- 230000029087 digestion Effects 0.000 description 8
- 230000014616 translation Effects 0.000 description 8
- 239000006137 Luria-Bertani broth Substances 0.000 description 7
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 7
- 238000007792 addition Methods 0.000 description 7
- 230000002776 aggregation Effects 0.000 description 7
- 230000008901 benefit Effects 0.000 description 7
- 238000010276 construction Methods 0.000 description 7
- 239000000835 fiber Substances 0.000 description 7
- 229940125396 insulin Drugs 0.000 description 7
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 7
- 235000006109 methionine Nutrition 0.000 description 7
- 238000013518 transcription Methods 0.000 description 7
- 230000035897 transcription Effects 0.000 description 7
- 241000894006 Bacteria Species 0.000 description 6
- 102000014914 Carrier Proteins Human genes 0.000 description 6
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 6
- 241000282324 Felis Species 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 238000004587 chromatography analysis Methods 0.000 description 6
- 239000000284 extract Substances 0.000 description 6
- 239000003550 marker Substances 0.000 description 6
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 6
- 239000006228 supernatant Substances 0.000 description 6
- 230000008685 targeting Effects 0.000 description 6
- 238000013519 translation Methods 0.000 description 6
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- 108010035210 Iron-Binding Proteins Proteins 0.000 description 5
- 102000008133 Iron-Binding Proteins Human genes 0.000 description 5
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 5
- 108010076504 Protein Sorting Signals Proteins 0.000 description 5
- 229920002684 Sepharose Polymers 0.000 description 5
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 5
- 108010064397 amyloid beta-protein (1-40) Proteins 0.000 description 5
- DZHSAHHDTRWUTF-SIQRNXPUSA-N amyloid-beta polypeptide 42 Chemical compound C([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O)[C@@H](C)CC)C(C)C)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C(C)C)C1=CC=CC=C1 DZHSAHHDTRWUTF-SIQRNXPUSA-N 0.000 description 5
- 239000004202 carbamide Substances 0.000 description 5
- 230000000694 effects Effects 0.000 description 5
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 5
- 230000002209 hydrophobic effect Effects 0.000 description 5
- BAUYGSIQEAFULO-UHFFFAOYSA-L iron(2+) sulfate (anhydrous) Chemical compound [Fe+2].[O-]S([O-])(=O)=O BAUYGSIQEAFULO-UHFFFAOYSA-L 0.000 description 5
- 229910000359 iron(II) sulfate Inorganic materials 0.000 description 5
- 238000004949 mass spectrometry Methods 0.000 description 5
- 229930182817 methionine Natural products 0.000 description 5
- 239000006151 minimal media Substances 0.000 description 5
- 239000012071 phase Substances 0.000 description 5
- 229920002401 polyacrylamide Polymers 0.000 description 5
- 230000008569 process Effects 0.000 description 5
- 238000011084 recovery Methods 0.000 description 5
- 229920005989 resin Polymers 0.000 description 5
- 239000011347 resin Substances 0.000 description 5
- 238000004366 reverse phase liquid chromatography Methods 0.000 description 5
- 239000013603 viral vector Substances 0.000 description 5
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 4
- CFBILACNYSPRPM-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;2-[[1,3-dihydroxy-2-(hydroxymethyl)propan-2-yl]amino]acetic acid Chemical compound OCC(N)(CO)CO.OCC(CO)(CO)NCC(O)=O CFBILACNYSPRPM-UHFFFAOYSA-N 0.000 description 4
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 4
- 108020004705 Codon Proteins 0.000 description 4
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 4
- 102000002933 Thioredoxin Human genes 0.000 description 4
- FEWOUVRMGWFWIH-ILZZQXMPSA-N amyloid-beta polypeptide 40 Chemical group C([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(O)=O)[C@@H](C)CC)C(C)C)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C(C)C)C1=CC=CC=C1 FEWOUVRMGWFWIH-ILZZQXMPSA-N 0.000 description 4
- 230000004071 biological effect Effects 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- 239000002299 complementary DNA Substances 0.000 description 4
- 230000002255 enzymatic effect Effects 0.000 description 4
- 210000000987 immune system Anatomy 0.000 description 4
- 230000016784 immunoglobulin production Effects 0.000 description 4
- 230000006698 induction Effects 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 238000003752 polymerase chain reaction Methods 0.000 description 4
- SCVFZCLFOSHCOH-UHFFFAOYSA-M potassium acetate Chemical compound [K+].CC([O-])=O SCVFZCLFOSHCOH-UHFFFAOYSA-M 0.000 description 4
- 238000000926 separation method Methods 0.000 description 4
- 230000002194 synthesizing effect Effects 0.000 description 4
- 108060008226 thioredoxin Proteins 0.000 description 4
- 108010078791 Carrier Proteins Proteins 0.000 description 3
- 229920002101 Chitin Polymers 0.000 description 3
- 108091006149 Electron carriers Proteins 0.000 description 3
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 3
- 238000005481 NMR spectroscopy Methods 0.000 description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 3
- NLXLAEXVIDQMFP-IEOVAKBOSA-N azanium;chloride Chemical compound [15NH4+].[Cl-] NLXLAEXVIDQMFP-IEOVAKBOSA-N 0.000 description 3
- 229940098773 bovine serum albumin Drugs 0.000 description 3
- 230000003196 chaotropic effect Effects 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 239000006167 equilibration buffer Substances 0.000 description 3
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 3
- 230000017730 intein-mediated protein splicing Effects 0.000 description 3
- 239000008188 pellet Substances 0.000 description 3
- 230000012743 protein tagging Effects 0.000 description 3
- 230000002285 radioactive effect Effects 0.000 description 3
- 238000010188 recombinant method Methods 0.000 description 3
- 230000001105 regulatory effect Effects 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 230000001177 retroviral effect Effects 0.000 description 3
- 230000002441 reversible effect Effects 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 238000005063 solubilization Methods 0.000 description 3
- 230000007928 solubilization Effects 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 238000006467 substitution reaction Methods 0.000 description 3
- 229940094937 thioredoxin Drugs 0.000 description 3
- 235000002374 tyrosine Nutrition 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- 241000701161 unidentified adenovirus Species 0.000 description 3
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 2
- 102000009091 Amyloidogenic Proteins Human genes 0.000 description 2
- 108010048112 Amyloidogenic Proteins Proteins 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 241000271566 Aves Species 0.000 description 2
- 241000193171 Clostridium butyricum Species 0.000 description 2
- 241000193469 Clostridium pasteurianum Species 0.000 description 2
- 108700010070 Codon Usage Proteins 0.000 description 2
- 108090000695 Cytokines Proteins 0.000 description 2
- 102000004127 Cytokines Human genes 0.000 description 2
- LEVWYRKDKASIDU-QWWZWVQMSA-N D-cystine Chemical compound OC(=O)[C@H](N)CSSC[C@@H](N)C(O)=O LEVWYRKDKASIDU-QWWZWVQMSA-N 0.000 description 2
- 102000053602 DNA Human genes 0.000 description 2
- 241000776608 Desulfarculus baarsii Species 0.000 description 2
- 241000605716 Desulfovibrio Species 0.000 description 2
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 2
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 241000672609 Escherichia coli BL21 Species 0.000 description 2
- 241000620209 Escherichia coli DH5[alpha] Species 0.000 description 2
- XZWYTXMRWQJBGX-VXBMVYAYSA-N FLAG peptide Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(O)=O)CC1=CC=C(O)C=C1 XZWYTXMRWQJBGX-VXBMVYAYSA-N 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- 102000005720 Glutathione transferase Human genes 0.000 description 2
- 108010070675 Glutathione transferase Proteins 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 102000004457 Granulocyte-Macrophage Colony-Stimulating Factor Human genes 0.000 description 2
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- AVXURJPOCDRRFD-UHFFFAOYSA-N Hydroxylamine Chemical compound ON AVXURJPOCDRRFD-UHFFFAOYSA-N 0.000 description 2
- 102000013462 Interleukin-12 Human genes 0.000 description 2
- 108010065805 Interleukin-12 Proteins 0.000 description 2
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 2
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- 102000009151 Luteinizing Hormone Human genes 0.000 description 2
- 108010073521 Luteinizing Hormone Proteins 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 108010038807 Oligopeptides Proteins 0.000 description 2
- 102000015636 Oligopeptides Human genes 0.000 description 2
- 108700026244 Open Reading Frames Proteins 0.000 description 2
- 102000000447 Peptide-N4-(N-acetyl-beta-glucosaminyl) Asparagine Amidase Human genes 0.000 description 2
- 108010055817 Peptide-N4-(N-acetyl-beta-glucosaminyl) Asparagine Amidase Proteins 0.000 description 2
- 101710118538 Protease Proteins 0.000 description 2
- 108090000783 Renin Proteins 0.000 description 2
- 102100028255 Renin Human genes 0.000 description 2
- 101710137500 T7 RNA polymerase Proteins 0.000 description 2
- 108090000190 Thrombin Proteins 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 125000000539 amino acid group Chemical group 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 230000000975 bioactive effect Effects 0.000 description 2
- 210000004556 brain Anatomy 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 239000013592 cell lysate Substances 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 238000007385 chemical modification Methods 0.000 description 2
- 238000011210 chromatographic step Methods 0.000 description 2
- 239000013611 chromosomal DNA Substances 0.000 description 2
- 238000002983 circular dichroism Methods 0.000 description 2
- 239000002131 composite material Substances 0.000 description 2
- 239000000356 contaminant Substances 0.000 description 2
- 229960003067 cystine Drugs 0.000 description 2
- 239000003599 detergent Substances 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- 229940088598 enzyme Drugs 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 238000000855 fermentation Methods 0.000 description 2
- 230000004151 fermentation Effects 0.000 description 2
- 239000007850 fluorescent dye Substances 0.000 description 2
- 238000005194 fractionation Methods 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- ZJYYHGLJYGJLLN-UHFFFAOYSA-N guanidinium thiocyanate Chemical compound SC#N.NC(N)=N ZJYYHGLJYGJLLN-UHFFFAOYSA-N 0.000 description 2
- 150000003278 haem Chemical class 0.000 description 2
- 210000002443 helper t lymphocyte Anatomy 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 238000013383 initial experiment Methods 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 229940117681 interleukin-12 Drugs 0.000 description 2
- 229940040129 luteinizing hormone Drugs 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 150000002742 methionines Chemical class 0.000 description 2
- 230000003278 mimic effect Effects 0.000 description 2
- LGQLOGILCSXPEA-UHFFFAOYSA-L nickel sulfate Chemical compound [Ni+2].[O-]S([O-])(=O)=O LGQLOGILCSXPEA-UHFFFAOYSA-L 0.000 description 2
- 229910000363 nickel(II) sulfate Inorganic materials 0.000 description 2
- 238000012261 overproduction Methods 0.000 description 2
- 230000003647 oxidation Effects 0.000 description 2
- 238000007254 oxidation reaction Methods 0.000 description 2
- 244000045947 parasite Species 0.000 description 2
- 239000008363 phosphate buffer Substances 0.000 description 2
- 235000011056 potassium acetate Nutrition 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 239000002243 precursor Chemical class 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 101150086350 rub gene Proteins 0.000 description 2
- 238000004062 sedimentation Methods 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 239000000377 silicon dioxide Substances 0.000 description 2
- 238000003756 stirring Methods 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 229960004072 thrombin Drugs 0.000 description 2
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 2
- BHNQPLPANNDEGL-UHFFFAOYSA-N 2-(4-octylphenoxy)ethanol Chemical compound CCCCCCCCC1=CC=C(OCCO)C=C1 BHNQPLPANNDEGL-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 208000024827 Alzheimer disease Diseases 0.000 description 1
- 208000037259 Amyloid Plaque Diseases 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 101000755953 Bacillus subtilis (strain 168) Ribosome maturation factor RimP Proteins 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 241000701822 Bovine papillomavirus Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 102000005572 Cathepsin A Human genes 0.000 description 1
- 108010059081 Cathepsin A Proteins 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- 241000193403 Clostridium Species 0.000 description 1
- 238000011537 Coomassie blue staining Methods 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 241000212406 Desulfoarculus Species 0.000 description 1
- 108010016626 Dipeptides Proteins 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 102100031780 Endonuclease Human genes 0.000 description 1
- 241000701832 Enterobacteria phage T3 Species 0.000 description 1
- 241001198387 Escherichia coli BL21(DE3) Species 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 108700007698 Genetic Terminator Regions Proteins 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- 102000005298 Iron-Sulfur Proteins Human genes 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 241000713869 Moloney murine leukemia virus Species 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 108060008487 Myosin Proteins 0.000 description 1
- GHAZCVNUKKZTLG-UHFFFAOYSA-N N-ethyl-succinimide Natural products CCN1C(=O)CCC1=O GHAZCVNUKKZTLG-UHFFFAOYSA-N 0.000 description 1
- HDFGOPSGAURCEO-UHFFFAOYSA-N N-ethylmaleimide Chemical compound CCN1C(=O)C=CC1=O HDFGOPSGAURCEO-UHFFFAOYSA-N 0.000 description 1
- 230000004988 N-glycosylation Effects 0.000 description 1
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 208000008589 Obesity Diseases 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 239000002033 PVDF binder Substances 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 241000205160 Pyrococcus Species 0.000 description 1
- 108020005067 RNA Splice Sites Proteins 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 101001022386 Rattus norvegicus Leptin Proteins 0.000 description 1
- 108091027981 Response element Proteins 0.000 description 1
- 241000714474 Rous sarcoma virus Species 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 102000004896 Sulfotransferases Human genes 0.000 description 1
- 108090001033 Sulfotransferases Proteins 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 102000013090 Thioredoxin-Disulfide Reductase Human genes 0.000 description 1
- 108010079911 Thioredoxin-disulfide reductase Proteins 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 239000008346 aqueous phase Substances 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 230000010310 bacterial transformation Effects 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000000740 bleeding effect Effects 0.000 description 1
- 238000009835 boiling Methods 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 230000021235 carbamoylation Effects 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 229920001429 chelating resin Polymers 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 239000003433 contraceptive agent Substances 0.000 description 1
- 230000002254 contraceptive effect Effects 0.000 description 1
- 230000037029 cross reaction Effects 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 150000001945 cysteines Chemical class 0.000 description 1
- 210000000172 cytosol Anatomy 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 239000007857 degradation product Substances 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 238000000635 electron micrograph Methods 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 239000011536 extraction buffer Substances 0.000 description 1
- 239000003889 eye drop Substances 0.000 description 1
- 229940012356 eye drops Drugs 0.000 description 1
- 230000004720 fertilization Effects 0.000 description 1
- 239000012091 fetal bovine serum Substances 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 230000022244 formylation Effects 0.000 description 1
- 238000006170 formylation reaction Methods 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 235000004554 glutamine Nutrition 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 229960000789 guanidine hydrochloride Drugs 0.000 description 1
- PJJJBBJSCAKJQF-UHFFFAOYSA-N guanidinium chloride Chemical compound [Cl-].NC(N)=[NH2+] PJJJBBJSCAKJQF-UHFFFAOYSA-N 0.000 description 1
- 239000000383 hazardous chemical Substances 0.000 description 1
- IXCSERBJSXMMFS-UHFFFAOYSA-N hcl hcl Chemical compound Cl.Cl IXCSERBJSXMMFS-UHFFFAOYSA-N 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 230000033444 hydroxylation Effects 0.000 description 1
- 238000005805 hydroxylation reaction Methods 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 239000003999 initiator Substances 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000004026 insulin derivative Substances 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 125000003473 lipid group Chemical group 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 235000020824 obesity Nutrition 0.000 description 1
- 229920001542 oligosaccharide Polymers 0.000 description 1
- 150000002482 oligosaccharides Chemical class 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 210000001322 periplasm Anatomy 0.000 description 1
- 238000005191 phase separation Methods 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 108010066381 preproinsulin Proteins 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 230000016434 protein splicing Effects 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 230000008707 rearrangement Effects 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 210000004994 reproductive system Anatomy 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 102220277134 rs776745497 Human genes 0.000 description 1
- 238000013341 scale-up Methods 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 235000004400 serine Nutrition 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 238000011191 terminal modification Methods 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 235000008521 threonine Nutrition 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 108010060175 trypsinogen activation peptide Proteins 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 238000001429 visible spectrum Methods 0.000 description 1
- 238000011179 visual inspection Methods 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 239000008207 working material Substances 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4711—Alzheimer's disease; Amyloid plaque core protein
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/5759—Products of obesity genes, e.g. leptin, obese (OB), tub, fat
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/62—Insulins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/72—Receptors; Cell surface antigens; Cell surface determinants for hormones
- C07K14/723—G protein coupled receptor, e.g. TSHR-thyrotropin-receptor, LH/hCG receptor, FSH receptor
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- the invention relates to a fusion protein comprising a fusion partner, in this case rubredoxin, fused directly or indirectly to a protein or peptide of interest, together with methods and materials for producing the fusion protein in a host cell and purifying the fusion protein.
- the fusion protein can, in some embodiments of the invention, be cleaved to release the peptide or protein of interest for further use or analysis.
- the invention further relates to immunogenic compounds comprising a rubredoxin as a carrier molecule linked to an antigen or a hapten.
- Some of the strategies employed to overcome the problems of protein stability and solubility in E. coli include the use of fusion partners such as maltose binding protein (31 kD) (P. Riggs, in Ausebel, F.M. et al. (Eds)
- fusion partners maltose binding protein, glutathione-S-transferase and thioredoxin are typically derived from bacteria or protozoa
- the existence of closely related mammalian and avian analogues of these fusion partners makes them unsuitable for use as anchor proteins for haptens in antibody production or in vaccines.
- continued development of new protein expression systems based on recombinant protein fusions with a stable carrier is necessary to advance the art of recombinant protein production.
- the present invention provides a recombinant rubredoxin fusion protein containing an N-terminal rubredoxin constituent and a C-terminal fused polypeptide.
- the fusion protein is capable of binding Fe 2+ when properly folded, giving it a red color that makes it easy to follow during purification.
- the N- teraiinal rubredoxin constituent of the rubredoxin fusion protein preferably contains a rubredoxin obtained from an anaerobic bacterium, more preferably Desulfovibrio vulgaris, or a biologically active analogue, fragment, or modification thereof.
- the C-terminal fused polypeptide can be a polypeptide that is insoluble or known to form inclusion bodies in a host cell.
- amyloid peptide, leptin, proinsulin, trypsin inhibitor, and the extracellular domain of luteinizing hormone receptor can be fused to rubredoxin to yield rubredoxin fusion proteins of the invention.
- the linkage between the N-terminal rubredoxin constituent and C-terminal fused polypeptide can, but need not, be a cleavable linkage.
- Antigenic or immunogenic rubredoxin fusion proteins of the invention have C-terminal fused polypeptides that are antigens (including polyfusion antigens) or haptens.
- the rubredoxin constituent serves as the carrier molecule to yield an immunogenic fusion product. Because rubredoxin itself is only negligibly antigenic, there is no need to include in the antigenic or immunogenic fusion protein a cleavage site to allow cleavage of the N-terminal rubredoxin constituent from C-terminal fused polypeptide.
- the invention includes a method for producing an antibody to a C-terminal fused polypeptide by eliciting in a host cell, preferably a mammalian host cell, an immune response to a rubredoxin fusion protein containing the C-terminal fused polypeptide.
- the antibodies thus generated can be polyclonal or monoclonal, and are preferably not, but can be, cross-reactive with rubredoxin.
- the invention further provides a polypeptide vaccine containing an antigenic or immunogenic rubredoxin fusion protein of the invention, and a polynucleotide vaccine containing a polynucleotide encoding an antigenic or immunogenic rubredoxin fusion protein.
- the N-terminal rubredoxin constituent of the rubredoxin fusion protein can be directly or indirectly linked to the C-terminal fused polypeptide.
- the fusion protein contains a spacer region positioned between the N-terminal rubredoxin constituent and the C-terminal fused polypeptide. This intervening spacer region optionally contains a proteolytic cleavage site, an affinity purification sequence, or both.
- the N-terminal rubredoxin constituent can be directly linked to the C-terminal fused polypeptide, with no intervening spacer region.
- the present invention further provides a recombinant polynucleotide having a nucleotide sequence that encodes a rubredoxin fusion protein as described herein.
- the invention includes an expression vector that contains a promoter operably linked to a nucleotide sequence encoding a rubredoxin fusion protein, and a host cell transformed with an expression vector comprising a recombinant polynucleotide comprising a nucleotide sequence encoding a rubredoxin fusion protein.
- the host cell is a bacterial cell.
- an expression vector that contains a nucleotide sequence encoding rubredoxin or a biologically active analogue, fragment, or modification thereof; an intervening nucleotide sequence encoding a spacer region; and a multiple cloning region that contains at least one restriction endonuclease recognition site.
- the intervening nucleotide sequence preferably includes all or a portion of the multiple cloning region, and the spacer region encoded by the intervening nucleotide sequence preferably contains at least one of one of a proteolytic cleavage site and an affinity purification sequence.
- a preferred expression vector is pRUBEX3.
- the invention further provides a method for making a rubredoxin fusion protein that involves introducing into a host cell a recombinant polynucleotide having a nucleotide sequence encoding a rubredoxin fusion protein, followed by expressing the fusion protein in the host cell.
- the fusion protein is removed from the host cell and further purified as desired.
- the fusion protein contains an affinity purification sequence that permits reversible binding of the fusion protein to an affinity chromatography matrix thereby facilitating removal of contaminants.
- the invention also provides a recombinant method for making a polypeptide that includes introducing into a host cell a recombinant polynucleotide having a nucleotide sequence encoding a rubredoxin fusion protein; expressing the fusion protein in the host cell; removing the fusion protein from the host cell; and cleaving the fusion protein to yield the rubredoxin constituent and the polypeptide.
- this method further includes separating the polypeptide from the rubredoxin constituent after cleavage.
- Figure 1 depicts (a) a schematic of the vector pRUBEX3, including the Multiple Cloning Region (MCR); and (b) the nucleotide sequence (SEQ ID NO: 1) of a portion of pRUBEX3 together with the amino acid sequence encoded thereby (SEQ ID NO: 2) wherein the 52 amino acids of rubredoxin (SEQ ID NO:3) are underlined; the amino acids of the polyhistidine (polyHis) sequence (i.e., His-His-His-His-His-His) (SEQ ID NO:4) are in bold; the eight amino acids of the flag peptide are double-underlined (DYKDDDDK; i.e., Asp- Tyr-Lys-Asp-Asp-Asp-Asp-Lys) (SEQ ID NO:5); the five amino acids of the enterokinase site (DDDDK; i.e., Asp-Asp-Asp-Asp-
- pRUBEX3 includes, in place of the polyhistidine sequence, the affinity tag His-Gly-Leu-His (SEQ ID NO:7).
- Figure 2 shows a portion of the nucleotide sequence (SEQ ID NO:7)
- the underlined amino acid sequence (SEQ ID NO: 10) represents the A ⁇ M2 peptide and the intervening spacer region comprises a flag peptide sequence (SEQ ID NO: 5), a polyhistidine (polyHis) sequence for use in affinity purification (SEQ ID NO:4), and the amino acid sequence IEGR (in bold) (i.e., Ile-Glu-Gly-Arg) (SEQ ID NO:l 1), which is the recognition site for the restriction protease Factor Xa.
- Another embodiment of the A ⁇ M2 rubredoxin fusion construct includes, in place of the polyhistidine sequence, the affinity tag His-Gly-Leu-His (SEQ ID NO:7).
- Figure 3 is a schematic of the expression vector pRUBEX2-LHR, which contains the amino-terminal 298 amino acid residues of human luteinizing hormone receptor (LHR), representing the extracellular domain, cloned into the Ndel/BamH ⁇ site of pRUBEX2; the resulting construct encodes a fusion protein consisting of rubredoxin followed by a spacer region comprising a polyhistidine tag to facilitate purification of the fusion protein and a Factor Xa recognition site that directly precedes the LHR coding region.
- Another embodiment of pRUBEX2-LHR includes, in place of the polyhistidine sequence, the affinity tag His-Gly-Leu-His (SEQ ID NO:7).
- Figure 4 is a schematic of the expression vector pRUBEXl-LHR, which contains cDNA encoding the amino-terminal 340 amino acids of human luteinizing hormone receptor (LHR), representing the extracellular domain, cloned into the BamH ⁇ site of pRUBEXl ; the resulting construct encodes a fusion protein consisting of the N-terminal extracellular domain of human LHR directly fused to the carrier protein rubredoxin at the C-terminal end of rubredoxin.
- LHR luteinizing hormone receptor
- Figure 5 shows Tris-tricine gel electrophoresis of rubredoxin fusion proteins and digestion products.
- Figure 6 is a Western-blot analysis of purified pig leptin/rubredoxin fusion protein and a Factor Xa digest of the fusion protein.
- Rubredoxin is an electron carrier protein originally isolated and then cloned from the anaerobic sulfate reducing bacteria, Desulfovibrio vulgar is. Since then, rubredoxins from several different anaerobic organisms have been discovered and characterized. Rubredoxin is a small redox protein (5.6 kD) carrying a single non-haem iron center. The crystal structure of the protein has been solved and reveals a free carboxy-terminal end, making it well-suited for fusing peptides. The iron center imparts a red color to the protein (abso ⁇ tion maxima at 390 nm and 495 nm) providing a visible marker for easy monitoring during purification protocols.
- the red color also serves indicator as to whether the fusion protein has folded correctly, since an incorrectly folded protein will not bind the metal.
- Recombinant rubredoxin can be produced at high levels (50- 60 mg/L of purified protein) in E. coli and is very soluble, biologically active and stable. Conveniently, rubredoxin is a thermostable protein and can withstand 70°C-80°C for more than an hour without denaturation. It also retains its metal center in denaturing agents like 0.5% SDS and 6M urea.
- the present invention utilizes rubredoxin as a protein fusion partner in the creation of a simple, reliable, reproducible, scalable and economical recombinant protein expression system.
- the presence of a correctly folded fusion protein can be visually tracked during purification due to the effects of the iron atom.
- proper folding of the fused protein may be facilitated by the redox functionality of rubredoxin. That is, the presence of high levels of an active, foreign electron carrier protein like rubredoxin is likely to beneficially alter the redox microenvironment of the fusion protein. Folding of a protein fused to an electron carrier protein such as rubredoxin is thus likely to be affected by the redox state of the carrier as well as the oxidation state within the cell.
- the protein expression system of the invention is particularly useful for producing proteins and peptides, such as ⁇ -amyloid peptide, leptin and pro- insulin, that are otherwise insoluble or tend to form inclusion bodies in recombinant systems.
- proteins and peptides such as ⁇ -amyloid peptide, leptin and pro- insulin
- leptin from both rat and pig are known to form inclusion bodies and require the use of chaotropic agents for solubilization, and pig leptin can be efficiently produced using the protein expression system of the present invention.
- the invention provides a rubredoxin fusion protein and, further, a recombinant polynucleotide containing a nucleotide sequence that encodes the rubredoxin fusion protein of the invention, as well as a polynucleotide having a nucleotide sequence complementary thereto.
- a rubredoxin fusion protein is a protein that comprises a rubredoxin constituent and a polypeptide of interest.
- the rubredoxin constituent comprises the N- terminus of the fusion protein, and the fused polypeptide constitutes the C- terminus of the fusion protein.
- the rubredoxin fusion protein contains an intervening spacer region between the rubredoxin constituent and the fused polypeptide, as described more fully below.
- the rubredoxin constituent of the rubredoxin fusion protein is composed primarily of a rubredoxin polypeptide and serves as a "carrier" or
- the rubredoxin constituent can assist in stabilization, folding, solublization and/or targeting of the fused polypeptide, while providing additional options for detecting, isolating and purifying the polypeptide.
- the rubredoxin constituent of the rubredoxin fusion protein optionally contains one or more of an affinity purification sequence (described below), a signal sequence or a targeting sequence, for example a sequence targeting the fusion protein to a bacterial periplasm or causing the fusion protein to be secreted into the surrounding media, which is particularly useful in eukaryotic expression systems.
- a signal sequence or targeting sequence is preferably located at the N-terminus of the rubredoxin fusion protein (and hence is located at the N-terminal end of the rubredoxin constituent), whereas an affinity purification sequence can be positioned at the N-terminus of the fusion protein, within the rubredoxin polypeptide sequence itself, or C- terminal to the rubredoxin polypeptide.
- the affinity purification sequence may be thought of as part of the intervening spacer region rather than part of the rubredoxin constituent per se. Inclusion of the optional affinity sequence, signal sequence and/or targeting sequence must not prevent the rubredoxin polypeptide from folding properly.
- Whether or not the rubredoxin polypeptide folds properly can be easily assayed by determining whether it can bind a divalent cation, particularly Fe 2+ , as discussed in more detail below.
- a divalent cation particularly Fe 2+
- engineering a histidine tag His-His-His-His-His-His-His, SEQ ID NO:4 as an affinity purification sequence at the N-terminus of the fusion protein caused the rubredoxin polypeptide to fail to bind iron.
- use of an N-terminal affinity sequence that is less highly charged could result in a rubredoxin polypeptide that does bind iron, i.e., a rubredoxin fusion protein of the invention.
- the rubredoxin fusion protein is a single polypeptide chain wherein the rubredoxin constituent is linked by way of a peptide bond, either directly or indirectly, to the polypeptide of interest. This linkage is termed “direct” in embodiments of the rubredoxin fusion protein containing no intervening spacer region; it is termed “indirect” in embodiments of the rubredoxin fusion protein that contain an intervening spacer region.
- the fused polypeptide can have a preselected or predetermined a ino acid sequence, a random amino acid sequence, or an unknown amino acid sequence.
- peptide polypeptide
- protein as used herein are interchangeable, as the invention is not limited by the length or the function of the amino acid sequence linked to the rubredoxin constituent. As used herein these terms all refer generally to a plurality of amino acids joined together in a linear chain via peptide bonds.
- peptide may be used to connote a shorter polypeptide such as dipeptide, tripeptide, or oligopeptide; the term oligopeptide typically connoting a polypeptide having between 2 and about 50 or more amino acids.
- peptide is not limited to polypeptides of any particular length.
- protein is sometimes used herein to mean a functionally folded polypeptide of any length having structural, enzymatic or other active properties. Regardless of the nomenclature used, however, no limitations on the length or the function of the fused polypeptide or protein are intended.
- the rubredoxin constituent of the fusion protein comprises a rubredoxin polypeptide.
- the rubredoxin polypeptide has the wild- type amino acid sequence of a rubredoxin protein obtained from an anaerobic bacterium, preferably from Desulfovibrio, Clostridium, Desulfoarculus or
- Pyrococcus spp. more preferably from D. vulgaris, D. vulgaris (Hildenborough), C. pasteurianum, C. butyricum, D. baarsii or P. furiosa.
- GenBank Accession numbers for nucleotide sequences encoding rubredoxins include D76419 (rub gene for D. vulgaris), M28848 (rub gene for D. vulgaris (Hildenborough), M60116 (C. pasteurianum rubredoxin gene), Yl 1875 (C. butyricum rubredoxin gene), and X99543 for D. baarsii.
- a particularly preferred amino acid sequence for the rubredoxin polypeptide is an amino acid sequence of a rubredoxin from D.
- the amino acid sequence of the rubredoxin polypeptide useful in the fusion protein of the invention is not intended to be limited to the exact wild-type amino acid sequence of naturally occurring rubredoxin proteins; rather, the rubredoxin polypeptide includes biologically active analogues, fragments, or modifications of any and all naturally occurring rubredoxin proteins.
- biologically active means that the rubredoxin analogue, fragment or modification thereof can, when present as a component of the fusion protein of the invention, can bind a divalent cation.
- biologically active rubredoxin or analogue, fragment, or modification thereof binds Zn 2+ or Fe 2+ ; more preferably it binds Fe 2+ .
- Biological activity e.g., iron- binding activity
- iron binding can be visually detected because the bound complex is red. Binding of Fe 2+ by the fusion protein is indicative of proper folding of its rubredoxin polypeptide.
- rubredoxin is a small protein; for example, rubredoxin from D. vulgaris contains about 52 amino acids.
- a "fragment" of rubredoxin means a rubredoxin that has been truncated at the C-terminus; preferably, the fragment is at least about 40 amino acids in length, more preferably it is at least about 45 amino acids in length.
- an "analogue" of rubredoxin means a rubredoxin that contains one or more amino acid substitutions, deletions, additions, or rearrangements.
- an amino acid belonging to a grouping of amino acids having a particular size or characteristic such as charge, hydrophobicity and hydrophilicity
- a rubredoxin polypeptide useful in a fusion protein according to the invention includes a rubredoxin that contains amino acid substitutions at sites such that the iron-binding activity of the polypeptide is not eliminated.
- Substitutes for an amino acid may be selected from other members of the class to which the amino acid belongs.
- nonpolar (hydrophobic) amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan, and tyrosine.
- Polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine and glutamine.
- the positively charged (basic) amino acids include arginine, lysine and histidine.
- the negatively charged (acidic) amino acids include aspartic acid and glutamic acid.
- a rubredoxin analogue has at least about 80% amino acid identity with a reference rubredoxin protein; more preferably it has at least about 90% amino acid identity with a reference rubredoxin protein.
- the reference rubredoxin protein is preferably a rubredoxin from D. vulgaris; more preferably it is SEQ ID NO:3.
- Amino acid identity is defined in the context of a homology comparison between the rubredoxin analogue and the reference rubredoxin protein.
- the two amino acid sequences are aligned in a way that maximizes the number of amino acids that they have in common along the lengths of their sequences; gaps in either or both sequences are permitted in making the alignment in order to maximize the number of shared amino acids, although the amino acids in each sequence must nonetheless remain in their proper order.
- the percentage amino acid identity is the higher of the following two numbers: (a) the number of amino acids that the two polypeptides have in common within the alignment, divided by the number of amino acids in the rubredoxin analogue, multiplied by 100; or (b) the number of amino acids that the two polypeptides have in common within the alignment, divided by the number of amino acids in the reference rubredoxin protein, e.g., SEQ ID NO:3, multiplied by 100.
- Modified rubredoxin includes rubredoxins chemically or enzymatically derivatized at one or more constituent amino acid, including side chain modifications, backbone modifications, and N- and C- terminal modifications including acetylation, hydroxylation, methylation, amidation, and the attachment of carbohydrate or lipid moieties, cofactors, and the like.
- the fused polypeptide of the rubredoxin fusion protein can be a polypeptide that has, in the past, been difficult to isolate in biologically active form using other recombinant expression systems.
- polypeptides include, for example, hydrophobic peptides, (that is, peptides that are insoluble in aqueous solutions), peptides and proteins that produce insoluble sedimentation aggregates known as "inclusion bodies" when overexpressed (e.g., amyloid peptides, such as ⁇ -amyloid 1-42 peptide and ⁇ -amyloid 1-40 peptide, leptins, including pig leptin and rat leptin, preproinsulin, trypsin inhibitor, and the extracellular domain of luteinizing hormone receptor), and those that become insoluble when present the high concentrations found in typical protein overproduction systems.
- amyloid peptides such as ⁇ -amyloid 1-42 peptide and ⁇ -amyloid 1-40 peptide
- the rubredoxin fusion protein of the invention in contrast, is preferably soluble in aqueous solutions. More preferably, the rubredoxin fusion protein does not form insoluble sedimentation aggregates during recombinant overproduction of the fusion protein; that is, it remains soluble when overexpressed in the host cell. "Overexpression" in this context means expression of the rubredoxin fusion protein at a level of at least about 10 mg fusion protein per 100 mL cell extract (i.e., about 100 mg/L).
- aggregates of the rubredoxin fusion protein do form, they are preferably capable of being resolubilized using a nonionic detergent to yield a fusion protein having a biologically active (i.e., iron-binding) rubredoxin constituent.
- a biologically active i.e., iron-binding
- the rubredoxin fusion protein of the invention when it binds Fe 2+ , is detectably labeled as a result of its red color.
- the rubredoxin fusion protein is further detectably labeled.
- the detectable label is a radioisotope, a heavy isotope, or a fluorescent label.
- Isotope labels can be conveniently incorporated into the fusion protein using isotopically labeled amino acids or precursor compounds during synthesis in the host cell using methods well known in the art. Examples of useful radiolabels include 3 H, 14 C and 35 S; useful heavy isotope labels are exemplified by 13 C and 15 N.
- a preferred fluorescent label is isofluorothiocyanate (IFTC), which can be chemically attached to the fusion protein following biosynthesis.
- a particularly preferred embodiment of the fusion protein of the invention comprises a rubredoxin constituent fused, directly or indirectly, to an amyloid peptide.
- the amyloid peptide is ⁇ -amyloid 1-40 or ⁇ -amyloid 1 -42, or a biologically active analogue, modification or derivative thereof.
- Amyloid peptides that are isotopically labeled, as described above, are also especially useful.
- a biologically active ⁇ -amyloid peptide is one that retains the ability to aggregate into fibrils such as are observed in Alzheimer's plaques.
- tyrosine at the 10 position in ⁇ -amyloid can be changed to tryptophan to yield a bioactive ⁇ -amyloid peptide analogue, and the tryptophan can be detectably labeled using IFTC to generate modified bioactive peptide having a chartreuse color.
- IFTC ⁇ -amyloid peptide analogue
- the production of biologically inactive amyloid fusion proteins for instance those having one or two amino acid deletions, additions or changes that reduce or eliminate aggregation activity, is useful for comparative or mechanistic studies and is also encompassed by the present invention.
- arginine at the 5 position in ⁇ -amyloid can be changed to cysteine to yield a ⁇ -amyloid peptide analogue, and the cysteine can be labeled with IFTC to generate modified amyloid peptide that is less biologically active than the naturally occurring peptide.
- fusion protein of the invention is a fusion protein comprising a rubredoxin constituent linked, directly or indirectly, to the extracellular domain of luteinizing hormone receptor (LHR) or biologically active fragment, modification or analogue thereof.
- LHR luteinizing hormone receptor
- Another embodiment of the invention that is particularly well suited for use in generating mammalian antibodies to the fused polypeptide is a rubredoxin fusion protein comprising an N-terminal rubredoxin constituent directly linked to a C-terminal fused polypeptide antigen or hapten.
- a hapten is a low-molecular weight compound that reacts specifically with an antibody but does not stimulate antibody production (i.e., is not antigenic) unless complexed with a carrier protein.
- the carrier protein i.e., rubredoxin
- the hapten portion of the immunogenic rubredoxin fusion protein is preferably at least about four amino acids in length, more preferably at least about six amino acids in length, most preferably at least about eight amino acids in length, and is preferably less than about 50 amino acids in length, more preferably less than about 35 amino acids in length, most preferably less than about 25 amino acids in length.
- polypeptide antigen that is advantageously linked to the rubredoxin constituent in this embodiment of the rubredoxin fusion protein is a protein that would be insoluble or form inclusion bodies in the absence of a rubredoxin carrier.
- the polypeptide antigen portion of the rubredoxin fusion protein can contain more than one antigenic epitope fused in tandem, forming what is known as a polyfusion antigen.
- Rubredoxin has a significant advantage over other known carrier proteins for antibody production (such as thioredoxin, glutathione sulfotransferase and maltose binding protein) in that rubredoxins are never present in mammalian systems.
- the corresponding recombinant polynucleotide encoding this embodiment of the rubredoxin fusion protein includes, in the 5' to 3' direction, a nucleotide sequence encoding the rubredoxin constituent directly followed by an in-frame nucleotide sequence encoding the fused polypeptide.
- a rubredoxin fusion protein comprising a fused polypeptide antigen can, if desired, contain one or both of a cleavage site between the rubredoxin polypeptide and the fused polypeptide antigen, and an affinity purification sequence.
- a preferred embodiment of the invention includes a rubredoxin fusion protein comprising a rubredoxin constituent that is linked indirectly to the fused polypeptide.
- the rubredoxin fusion protein comprises an intervening spacer region positioned between the rubredoxin constituent and the fused polypeptide. The invention is not to be limited by any particular upper limit on the size of the spacer region.
- the optimal length of the spacer region depends on the nature of the fused peptide and can be readily determined by one of skill in the art. For example, where the spacer region contains a cleavage site, the optimal length of the spacer region can be determined by analyzing the efficiency of cleavage in test fusion proteins having spacer regions of varying lengths. Preferably, the intervening spacer region consists of less than about 100 amino acids.
- the spacer region preferably contains between 0 and about 100 amino acids, more preferably between about 10 and about 60 amino acids, more preferably between about 20 and about 40 amino acids.
- the spacer region preferably contains between 0 and about 100 amino acids, more preferably between about 10 and about 60 amino acids, more preferably between about 20 and about 40 amino acids.
- the intervening space region (MHGGSEFENHHHHHHNDYKDDDDKDLIEGR (i.e., Met-His-Gly-Gly-Ser- Glu-Phe-Glu-Asn-His-His-His-His-His-His-His-His-His-Asn-Asp-Tyr-Lys-Asp-Asp-Asp- Asp-Lys-Asp-Leu-Ile-Glu-Gly-Arg, SEQ ID NO: 12) for the rubredoxin/ ⁇ - amyloid fusion protein consists of 30 amino acids.
- An analogous intervening spacer region that includes a His-Gly-Leu-His (SEQ ID NO:7) affinity tag contains 28 amino acids.
- the intervening spacer region optionally comprises one or more proteolytic cleavage sites, one or more affinity purification sequences, and/or one or more amino acids that happen to be encoded by that portion of the multiple cloning region of the vector positioned between the nucleotide sequence encoding the rubredoxin constituent and nucleotide sequence encoding the fused polypeptide, as described in more detail below.
- the proteolytic cleavage site allows enzymatic or chemical cleavage of the fusion protein into two portions, permitting separation of the fused polypeptide from the rubredoxin constituent. Thus, it must be positioned in between the rubredoxin constituent and the fused polypeptide to serve its intended function. Preferably, it is positioned at the end of the intervening spacer region so as to minimize the attachment of additional amino acids to the fused polypeptide.
- Chemical cleavage can be achieved, for example, by cyanogen bromide or hydroxylamine.
- a cleavage site that comprises methionine allows cleavage to release the polypeptide of interest upon contact of the rubredoxin fusion protein with cyanogen bromide.
- Enzymatic cleavage can be facilitated by including as a cleavage site an amino acid sequence recognized by a restriction protease, also called an endoprotease.
- a restriction protease also called an endoprotease.
- cleavage sites recognized by thrombin, Factor Xa, renin, or enterokinase can be utilized.
- cleavage of the rubredoxin fusion protein at the cleavage site yields a polypeptide having no extraneous, unintended or non-native N-terminal amino acids.
- An affinity purification sequence is an amino acid sequence designed to facilitate purification of the fusion peptide using affinity chromatography.
- a polyhistidine (SEQ ID NO:4) or His-Gly-Leu- His (SEQ ID NO: 7) site or "tag” can be engineered into the fusion protein to allow purification of the fusion protein using Ni-chelating affinity chromatography (commercially available from numerous sources, for example Qiagen, Boehringer Mannheim Biochemicals, and Novagen).
- an affinity purification system commercially available from IBI Kodak (Rochester, NY) utilizes the "flag" peptide (YKDDDDK, i.e., Tyr-Lys-Asp-Asp- Asp-Asp-Lys, SEQ ID NO: 13) and a monoclonal antibody-linked resin (IGM2) that is highly specific for that peptide.
- YKDDDDK i.e., Tyr-Lys-Asp-Asp- Asp-Asp-Lys, SEQ ID NO: 13
- IGM2 monoclonal antibody-linked resin
- a chitin-binding tag can be combined with a self-cleaving protein splicing element (an intein) to permit purification of the rubredoxin fusion protein and cleavage of the fused polypeptide in a single chromatographic step.
- an intein self-cleaving protein splicing element
- the fusion protein binds to a chitin column.
- a disulfide reducing agent such as dithiothreitol, ⁇ -mercaptoethanol or cysteine
- the intein undergoes specific self-cleavage which releases the fused polypeptide from the chitin-bound intein tag.
- an affinity purification sequence can be positioned at essentially any location along the length of the rubredoxin fusion protein as long as it does not prevent the rubredoxin polypeptide from folding properly.
- the recombinant polynucleotide of the invention includes a nucleotide sequence encoding the rubredoxin fusion protein of any of the various embodiments described above.
- the recombinant polynucleotide encodes, in a 5' to 3' direction, a rubredoxin constituent linked, directly or indirectly, to a polypeptide of interest; alternatively it encodes, in the 5' to 3' direction, a polypeptide of interest linked, directly or indirectly, to a rubredoxin constituent. It optionally encodes an intervening spacer region, one or more affinity sites, cleavage sites, targeting sites, and the like, as described generally for the rubredoxin fusion protein.
- the invention further provides an expression vector capable of directing expression of a rubredoxin fusion protein in a host cell.
- the expression vector can be circular or linear, single-stranded or double stranded, and can include DNA, RNA, or any modification or combination thereof.
- the vector can be a plasmid, a viral vector or a cosmid. Selection of a vector or plasmid backbone depends upon a variety of desired characteristics in the resulting construct, such as a selection marker, plasmid reproduction rate, and the like. Suitable plasmids for expression in E.
- coli for example, include pUC(X), pKK223-3, pKK233-2, pTrc99A, and p ⁇ T-(X) wherein (X) denotes a vector family in which numerous constructs are available.
- pUC(X) vectors can be obtained from Pharmacia Biotech (Piscataway, NH) or Sigma Chemical Co. (St. Louis, MO).
- pKK223-3, pKK233-2 and pTrc99A can be obtained from Pharmacia Biotech.
- pET-(X) vectors can be obtained from Promega (Madison, WI) Stratagene (La Jolla, CA) and Novagen (Madison, WI).
- the vector preferably includes an origin of replication (known as an "ori") or replicon.
- an origin of replication known as an "ori"
- ColEl and P15A replicons are commonly used in plasmids that are to be propagated in E. coli.
- the expression vector preferably takes the form of a DNA molecule containing a nucleotide sequence encoding the rubredoxin fusion protein of the invention, and optionally includes a promoter sequence operably linked to the coding sequence.
- a promoter is a DNA fragment that facilitates transcription of genetic material. Transcription is the formation of an RNA chain in accordance with the genetic information contained in the DNA.
- the invention is not limited by the use of any particular promoter, and a wide variety are known.
- Promoters act as regulatory signals that bind RNA polymerase in a cell to initiate transcription of a downstream (3' direction) coding sequence.
- a promoter is "operably linked" to a nucleotide sequence if it does, or can be used to, control or regulate transcription of that nucleotide sequence.
- the promoter used in the invention can be a constitutive or an inducible promoter. It can be, but need not be, heterologous with respect to the host cell.
- Preferred promoters for bacterial transformation include lac, lac ⁇ JV5, tac, trc, T7, SP6 and ara.
- the expression vector optionally includes a Shine Dalgarno site (e.g., a ribosome binding site), and a start site (e.g., the codon ATG) to initiate translation of the transcribed message to produce the enzyme. It can also include a termination sequence to end translation. A termination sequence is typically a codon for which there exists no corresponding aminoacetyl-tRNA, thus ending polypeptide synthesis.
- the expression vector optionally further includes a transcription termination sequence.
- the rrnB terminators which is a stretch of DNA that contains two terminators, Tl and T2, is the most commonly used terminator that is incorporated into bacterial expression systems (J. Brosius et al., J. Mol. Biol, 148:107-127 (1981)).
- the expression vector optionally includes one or more marker sequences, which typically encode a gene product, usually an enzyme, that inactivates or otherwise detects or is detected by a compound in the growth medium.
- a marker sequence can render the transformed cell resistant to an antibiotic, or it can confer compound-specific metabolism on the transformed cell.
- Examples of a marker sequence are sequences that confer resistance to kanamycin, ampicillin, chloramphenicol and tetracycline.
- the expression vector comprises a nucleotide sequence encoding a rubredoxin polypeptide and a multiple cloning region for the insertion of a polypeptide of interest.
- the multiple cloning region comprises at least one restriction site and preferably comprises a multiplicity of restriction sites (see, for Example, Fig. 1 showing the multiple cloning region of pRUBEX3).
- the multiple cloning region (sometimes referred to as a polyclonal site) is positioned such that cloning a nucleotide sequence encoding a polypeptide of interest into that site will permit expression of a rubredoxin fusion protein comprising the polypeptide of interest; for example, the polypeptide of interest will be in frame with respect to the rubredoxin constituent and the intervening spacer region, if it is present.
- the expression vector comprises a nucleotide sequence encoding rubredoxin or a biologically active analogue, fragment, or modification thereof, an intervening nucleotide sequence, and a multiple cloning region comprising a multiplicity of restriction endonuclease recognition site.
- the intervening nucleotide sequence preferably encodes at least one of a proteolytic cleavage site and an affinity purification sequence.
- expression vectors include pRUBEXl, in which the coding sequence for D. vulgaris rubredoxin and the fused polypeptide are directly linked; i.e., there is no intervening spacer region between the two components; pRUBEX2, which contains an intervening spacer region comprising a histidine tag and a Factor Xa cleavage site; and pRUBEX3, which, in addition to the histidine tag and a Factor Xa cleavage site of pRUBEX2, contains as part of the intervening spacer a portion of a multiple cloning region to facilitate cloning of the nucleotide sequence encoding the fused polypeptide into the vector.
- the invention also provides a method for making a rubredoxin fusion protein.
- An expression vector as described above that contains a nucleotide sequence capable of directing expression of a rubredoxin fusion protein is introduced into a host cell and the rubredoxin fusion protein is then expressed in the transformed cell.
- Any suitable host cell can be used, without limitation.
- the expression vector is a DNA molecule that comprises a nucleotide sequence encoding the rubredoxin fusion protein.
- the expression vector comprises RNA
- the host cell preferably comprises a reverse transcriptase enzyme in order to facilitate expression of the rubredoxin fusion protein.
- Viral vectors are especially useful in eukaryotic protein expression systems, which facilitate protein glycosylation.
- the fusion protein can be removed from the transformed host cell and purified.
- the rubredoxin fusion protein can be labeled with a radioisotope such as 3 H, 13 C, 15 N or 35 S during synthesis using methods well-known in the art.
- the host cell in which the rubredoxin fusion protein is expressed in accordance with the present invention can be a bacterium, a protozoan, or a eukaryotic cell.
- Eukaryotic cells include, for example, plant cells and animal cells, including for example mammalian cells, yeast cells and insect cells.
- the fusion protein is preferably targeted to the endoplasmic recticulum.
- Suitable host cells can be differentiated or undifferentiated, and include cells growing in mammalian tissue culture, including hybridoma cells. Particularly suitable host cells are those that have been used in other protein expression systems, such as E. coli, Bacillus spp., and Streptomyces spp. Methods of introducing expression vectors into host cells are well-known in the art; electroporation is preferred.
- Rubredoxin fusion proteins that contain a polyhistidine (S ⁇ Q ID NO:4) or His-Gly-Leu-His (S ⁇ Q LD NO:7) tag can be purified by Ni-chelating chromatography.
- Imidazole can be used to elute the fusion protein.
- purification can be achieved at moderate temperatures using a single affinity chromatographic step.
- Ni-chelating chromatography can be performed at temperatures from about 4°C to about 60 °C, depending on the thermal stability of the fused polypeptide; typically the process is performed at room temperature or colder temperatures.
- the affinity chromatography can be followed with high performance liquid chromatography for further purification of the fusion proteins.
- the invention further provides a method for making a polypeptide using the protein expression system described herein.
- a rubredoxin fusion protein comprising a cleavage site is expressed in a host cell as described herein, then removed from the host cell.
- the rubredoxin fusion protein can be affinity purified at this point, if it also contains an affinity purification sequence.
- the polypeptide of interest is then chemically or enzymatically cleaved away from the rubredoxin constituent of the fusion protein.
- a preferred cleavage site comprises Ile-Glu-Gly-Arg (I ⁇ GR, S ⁇ Q ID NO: 11) and the restriction protease Factor Xa is used to cleave the fusion protein to obtain the free polypeptide.
- the free polypeptide can be further purified away from the rubredoxin constituent by reverse phase chromatography, typically at about pH 6 to about pH 8.5, depending on the stability of the polypeptide to acid and base.
- reverse phase chromatography is preferably carried out at temperatures between about 45 °C and about 65 °C, although reverse phase high pressure liquid chromatography for most other polypeptides is typically carried out at room temperature or colder temperatures.
- Other useful restriction proteases include thrombin. renin, and enterokinase, provided their recognition site has been engineered into the intervening spacer region of the fusion protein.
- Cyanogen bromide can also be used if a methionine intervenes between the peptide of interest and the rubredoxin component, provided the peptide of interest contains no internal methionines that would result in undesired cleavage of the peptide upon contact with CNBr.
- the invention further provides a method for making antibodies to a polypeptide of interest (i.e., a polypeptide antigen or hapten) using a rubredoxin fusion protein.
- a rubredoxin fusion protein comprising a rubredoxin polypeptide and the polypeptide antigen or hapten is introduced into a host, eliciting an immune response to the peptide antigen in a host cell.
- a cleavage site between the rubredoxin component and the fused polypeptide is not required as the rubredoxin moiety is negligibly antigenic.
- the fusion protein used in this method preferably does not contain a cleavage site.
- the method for making antibodies is not limited by the selection of a particular host; rather any desired host can be used such as a rabbit, goat, mouse, rat, cow or chicken.
- Antibodies are isolated and purified from the host using methods well-known in the art.
- the antibody is preferably a polyclonal antibody; however, the rubredoxin fusion protein can also be used to generate monoclonal antibodies to the polypeptide of interest.
- the invention also provides a polypeptide vaccine comprising a rubredoxin fusion protein of the invention and a polynucleotide vaccine comprising a polynucleotide comprising a nucleotide sequence encoding a rubredoxin fusion protem.
- a preferred rubredoxin fusion protein for use in this embodiment of the invention includes, for example, a rubredoxin constituent linked to a polypeptide antigen or hapten.
- the rubredoxin fusion protein used in or encoded by the vaccine is one wherein the N-terminal rubredoxin constituent is directly linked to the C-terminal fused polypeptide.
- a vaccine is capable of generating an immune response in the animal to which it is administered.
- An immune response includes either or both of a cellular immune response or production of antibodies, and can include activation of the subject's B cells, T cells, helper T cells or other cells of the subject's immune system.
- Immunogenicity of rubredoxin fusion protein can be determined, for example, by administering the adjuvanted fusion protein to the subject, then observing of the associated immune response by analyzing antibody titers in the subject's serum.
- the rubredoxin fusion protein used in the vaccine or encoded by the polynucleotide used in the vaccine further includes at least one epitope or epitope mimic, such as a T cell, helper T cell or B cell epitope or epitope mimic.
- Epitopes or epitope mimics can be derived from the species to which the vaccine is to be administered, from the species that was the source of the polypeptide antigen or hapten, or from any other species, including a virus, bacterium, or parasite.
- a polynucleotide encoding a rubredoxin fusion protein can include DNA, RNA, a modified nucleic acid, or any combination thereof.
- the polynucleotide can be supplied as part of a vector or as a "naked" polynucleotide.
- Polynucleotide vaccines are known in the art, e.g. F. Vogel et al., Clin. Microbiol. Rev. 8:406-410 (1995).
- Polynucleotides can be generated by means standard in the art, such as by recombinant techniques, or by enzymatic or chemical synthesis.
- a polynucleotide used in a vaccine of the invention is preferably one that functionally encodes a rubredoxin fusion protein.
- a protein is "functionally encoded” if it is capable of being expressed from the genetic construct that contains it.
- the polynucleotide can include one or more expression control sequences, such as ez ' s-acting transcription/translation regulatory sequences, including one or more of the following: a promoter, response element, an initiator sequence, an enhancer, a ribosome binding site, an RNA splice site, an intron element, a polyadenylation site, and a transcriptional terminator sequence, which are operably linked to the coding sequence and are, either alone or in combination, capable of directing expression in the target animal.
- An expression control sequence is "operably linked" to a coding sequence if it is positioned on the construct such that it does, or can be used to, control or regulate transcription or translation of that coding sequence.
- Prefened expression control sequences include strong and/or inducible cz ' s-acting transcription translation regulatory sequences such as those derived from metallothionine genes, actin genes, myosin genes, immunoglobulin genes, cytomegalovirus (CMN), SN40, Rous sarcoma virus, adenovirus, bovine papilloma virus, and the like.
- the coding and expression control sequences for the rubredoxin fusion protein are preferably constructed in a vector, such as a plasmid of bacterial origin, a cosmid, episome, or a viral vector, for administration to a target animal.
- a vector useful in the vaccine of the present invention can be circular or linear, single-stranded or double stranded.
- a specific embodiment employs constructs using the plasmid pcD ⁇ A3.1 as the vector (InVitrogen Corporation, Carlsbad, CA).
- the vector construct can contain immunostimulatory sequences (ISS) that stimulate the animal's immune system.
- ISS immunostimulatory sequences
- nucleotide sequences coding cytokines such as granulocyte macrophage colony stimulating factor (GM-CSF) or interleukin-12 (IL-12).
- cytokines can be used in various combinations to fine-tune the response of the animal's immune system, including both antibody and cytotoxic T lymphocyte responses, to bring out the specific level of response needed to affect the animal's reproductive system.
- the vector can be a viral vector, including an adenovirus vector, and adenovirus associated vector, or a retroviral vector.
- the viral vector is a nonreplicating retroviral vector such as the Moloney murine leukemia virus (N2) backbone as described by Irwin et al. (J. Virology 68:5036-5044 (1994)).
- the polypeptide or polynucleotide vaccine is administered in a manner and an amount effective to cause the desired immune response in the animal.
- a polypeptide vaccine can be administered in one or more doses, and typically includes between about 10 ⁇ g to about 2 mg of rubredoxin fusion protein.
- a polynucleotide vaccine containing polynucleotide in an amount of about 5 ⁇ g to about 500 ⁇ g can be administered in one or more doses.
- One of skill in the art can readily determine a suitable dosage for a particular animal, depending on the nature, size and overall health of the animal, as well as the condition to be treated.
- a polypeptide or polynucleotide vaccine of the invention can be administered in any convenient manner.
- forms of ao riinistration include intramuscular administration, subcutaneous or intradermal administration, oral administration, as by food or water, topical administration, including transdermal administration, aerosol administration, cloacal or vaginal administration, intracoelomic administration, intranasal aolministration, and transconjunctival administration, including the use of eye drops.
- liposome-mediated, microsphere-mediated, and microencapsulation systems are all included as delivery vehicles for the vaccine of the present invention.
- the vaccine includes an adjuvant, the selection of which is a matter well-known to those of skill in the art and is influenced by the nature of the intended recipient.
- the pET-24a expression system utilizes the bacteriophage T7 promoter that serves as a binding site for T7 RNA polymerase and was incorporated into the chromosomal DNA of E. coli strain BL21 (DE3) (Novagen).
- T7 RNA polymerase is synthesized only upon the addition of isopropyl ⁇ -D- thiogalactoside (IPTG) to growing cultures since the gene for the T7 polymerase has been spliced into the chromosomal DNA of the E. coli host.
- IPTG isopropyl ⁇ -D- thiogalactoside
- the pET-24a plasmid also contains the gene for kanamycin resistance for selection of plasmid- containing colonies.
- a nucleotide sequence encoding the flag peptide (YKDDDDK, SEQ ID NO: 13) affinity tag (IBI/KODAK, Rochester, NY), a polyhistidine sequence, and an enterokinase protease site was attached in frame at the C-terminal end of the rubredoxin gene, yielding pRUBEXl .
- the encoded peptide sequence provides two independent sites for affinity purification of the fusion protein along with a protease site for removal of the protein of interest from the fusion.
- a resulting fusion protein can be purified by Ni-chelating affinity chromatography due to the presence of the polyhistidine tag, and the flag peptide offers a second method for affinity purification using the monoclonal antibody-linked resin (IGM2) available from IBI Kodak.
- IGM2 monoclonal antibody-linked resin
- All plasmids containing fusion constructs were transformed into E. coli strain BL-21, and the host cells were grown induced as described above for the rubredoxin optimization. After induction, the temperature was brought to 20 °C for the final 7 hour growth period. Cells were harvested and stored at - 70 °C until needed. For expression of 15 N-labeled proteins and peptides, cultures were grown in M9 minimal media. Cells were initially streaked on M9 minimal media plates containing 50ug/ml kanamycin. A well-isolated colony was transfened to 100ml of M9 minimal media containing lg/L ammonium- 15 N chloride. The culture was grown at 37°C overnight.
- additional FeSO 4 was added to bring the final concentration to 80uM.
- the cultures were induced with ImM IPTG at an OD 590 of 1 and were then transfened to 20°C and allowed to grow for an additional 15 hours. Cells were harvested and stored at - 70°C until needed.
- Frozen cell paste (12-15 grams, representing cells from 3 liters of media) was suspended in 100ml phosphate buffer (20mM, pH 7.4; 0.5M NaCl; Buffer A) and the resuspended cells were sonicated using a Branson Ultrasonic disrupter for 15 minutes (10 second pulses). The cell sonicate was spun at
- High flow metal-chelating columns (5ml; Pharmacia) were used for purification of the fusion proteins.
- the column was washed and charged with 0.1M NiSO 4 , washed again and then equilibrated with Buffer A containing 25mM imidazole. Imidazole was added to the cell-free extract to give a final concentration of 25 mM.
- This material was loaded onto the column at 3ml min and was washed with the equilibration buffer until the flow through was clear (4- 6 bed volumes).
- the column was subsequently washed with 4 bed volumes of Buffer A containing 75mM and 150mM imidazole in order to elute several incomplete fusion products which were most likely formed as a result of incomplete translation.
- the complete fusion protein was finally eluted with Buffer A containing 300mM imidazole. Elution of the fusion proteins was monitored during purification by visual inspection of the column and flow through since the fusion products are red in color (due to the iron-sulfur center of rubredoxin).
- the purified protein (approximate volume 50-60 ml) was dialyzed overnight in 4 liter batches against a total of 12 liters of Tris HCl buffer (20mM, pH7.5). Total protein obtained after purification was estimated using the BCA assay (Pierce Biochemicals) with BSA as the standard.
- the dialyzed fusion protein was brought to a concentration of 5-6 mgs/ml using an Amicon Centriprep (10K cut off) and was filtered using a 0.22 ⁇ m syringe filter (Whatman) prior to storage in sterile falcon tubes.
- the protein keeps well at a concentration of 5-6mgs/ml at 4°C at pH 8.0 in the dark. Prolonged exposure to light (as in cold cabinets) leads to photobleaching of the protein and formation of a precipitate.
- DAEFRHDSGYENHHQKLNFFAEDVGSNKGA ⁇ GLMVGGNV[IA], SEQ ID ⁇ OS:10 and 14 represents a major constituent of the senile plaques which are deposited in the brains and cerebrovasculature of patients affected by Alzheimer's disease.
- the plaques are formed by ordered, self-aggregation of the peptides to form amyloid fibers. Onset of this disease is marked by enhanced levels of the longer and more hydrophobic A ⁇ M2 peptide in the brain (Iwatsubo et al., Neuron 13:45-53 (1994)); Lemere et al., Nat. Med.
- ⁇ -amyloid peptides 1-40 and 1-42 were synthesized as soluble recombinant fusion proteins using rubredoxin as a fusion partner.
- the fusion protein was purified by Ni-chelating chromatography and average yields of purified fusion product varied from 40-50 mg/L of culture.
- the fusion product was cleaved by restriction protease Factor Xa to separate the ⁇ -amyloid peptide from the rubredoxin carrier.
- the peptide was further purified by reverse phase chromatography at pH 6-8.5 at temperatures between about 45-65 °C. The quality of the peptide was consistent from batch to batch and showed no chemical modification as judged by mass spectrometric analysis.
- the purified peptides were biologically active and formed fibers at pH 2.5 as well as pH 6.5.
- the DNA sequence encoding the ⁇ -amyloid 1-42 peptide was amplified by PCR using the human Alzheimers precursor protein (human ⁇ APP) gene as template (provided by Dr. Sangram Sisodia, Johns Hopkins University, Boston, MA). During the PCR process (Bej et al., Crit. Rev. Biochem. Mol Biol.
- a restriction protease site for Factor Xa was introduced at the amino terminal end of the ⁇ -amyloid 1-42 peptide for proteolytic cleavage from rubredoxin, in that the N-terminus primer designed and used for amplifying the ⁇ -amyloid 1-42 sequence encoded the residues Ile-Glu-Gly-Arg, the tetrapeptide recognition site for Factor Xa, along with a Pstl restriction site (35 bases total).
- the C-terminus primer contained the sequence for the C-terminal region of the relevant peptide followed by a Kpnl restriction site.
- the amplified DNA product was digested by Pstl and Kpnl and was ligated into the Pstl-Kpnl site of the polylinker region of pRUBEX3 (Example I) and sequenced.
- the final construct encoded a 13.6 kD fusion protein containing the rubredoxin gene, the His-Flag affinity site, the Factor Xa restriction site and the ⁇ -amyloid 1-40 or 1- 42 peptides (Fig. 2). All constructs were initially made in pUC 18, sequenced and then transfened into the expression vector pET24a at the Nde-BamHl site.
- Expression of the fusion protein in one liter cultures was carried out essentially as described above in Example I.
- Expression in 20L fermentors were started by inoculating 50mls of overnight culture into a 24L fermentors containing 20L of LB supplemented with lOOuM FeSO 4 .
- the culture was grown at 37 °C with stining at 240 rpm and 3L of air/min. At an OD of 1.2 IPTG was added to a final concentration of ImM and the temperature lowered to 20 °C. Cultures were allowed to grow for another 6 hours. Cells were harvested and stored at -70°C. Average cell yield from a 20L fermentor run was 5.5-6g/liter. Cells were disrupted, and Ni-chelating chromatography was carried out, substantially as described in Example I.
- Low temperature purification is of further advantage since the stability and possible biohazards of subjecting peptides incorporating S 35 methionine and the non-radioactive isotopes ⁇ 15 or C 13 to temperatures above 60 ° C are not known.
- Load capacity of a semi-preparative column in this material (10mm x 25cm) with good resolution of peaks was in the range of 100- 200ugs of ⁇ -amyloid 1-42 peptide. It is expected that load levels in the range of 1.5-2mgs per run (25mm diameter X 25cm length) can be achieved. This would minimize loss in recovery of the peptide because of multiple runs and make the procedure much more economical.
- a soluble rubredoxin ⁇ -amyloid fusion protein was produced.
- the rubredoxin moiety folded conectly as judged by the successful inco ⁇ oration of iron into the protein.
- the fusion protein was easily purified by Ni-chelating chromatography.
- Ni-chelating resins from several companies can be used (for example, Qiagen, Invitrogen and Boehringer Mannheim Biochemicals), but they do differ in binding and elution characteristics with respect to imidazole concentrations.
- the red color of the fusion provided a visible intrinsic marker to follow the protein during purification.
- Typical yields of the fusion protein were in the range of 40-50mgs/L as estimated by the BCA method.
- the fusion protein remained soluble at concentrations of 5-6mgs/ml at 4°C.
- the average yield of ⁇ -amyloid 1-40 or ⁇ -amyloid 1-42 peptide was 3-4mgs/L. These recoveries can be further improved by employing larger columns and reducing the number of chromatographies to purify 3-4mg of peptide from 20 to one. Additionally, one of the main problems with expressing eukaryotic proteins in bacterial hosts is the altered bias in codon usage. By altering the codons of the eukaryotic gene to coincide with bacterial usage (where feasible), it is probable that higher yields can be obtained. According to these data, decreasing the expression temperature may also lead to higher yields.
- a major advantage of this recombinant system is the possibility of synthesizing radioactive peptides using S 35 -labeled methionine. Purification of this peptide is possible at moderate temperatures of 45-50°C, conditions under which S 35 is stable. Another advantage of this system is that it can be used for inco ⁇ orating N 15 , C 13 and, with appropriate auxotrophs, various labeled amino acids into the ⁇ -amyloid peptides.
- LHR luteinizing hormone receptor
- the coding region of the D. vulgaris rubredoxin gene was cloned into the expression vector pET16b (Novagen), which contains a Factor Xa site at the appropriate location, at the XbaVNcol site to yield pRUBEX2.
- LHR human luteinizing hormone receptor
- a Factor Xa recognition site directly precedes the LHR coding region, and a spacer region is located between the rubredoxin coding region and the LHR coding region, thus including the Factor Xa site (Fig. 3).
- the spacer region further contains a poly- histidine tag to facilitate purification of the fusion protein.
- the total length of the spacer region 50 amino acids, which is longer than just the affinity sequence and the Factor Xa recognition sequence, was chosen to maximize the efficiency of Factor Xa cutting to insure efficient separation of rubredoxin and LHR fragments after isolation of the fusion construct.
- the column was washed with four bed volumes of equilibration buffer and then four bed volumes of equilibration buffer containing 150mM imidazole.
- the fusion protein was eluted with Buffer A containing 300mM imidazole. This process could be monitored by the intrinsic red color of the fusion protein.
- the purified protein was dialyzed overnight against three 4L changes of 20mM Tris-HCl pH 7.5.
- the fusion protein was then concentrated and washed with the Tris-HCl buffer using an Amicon Centriprep (10K exclusion) filter to remove all traces of imidazole, since imidazole is an inhibitor of Factor Xa protease . Digestion and cleavage of the rubredoxin-LHR fusion protein.
- Fusion protein was digested with protease Factor Xa (Boehringer Mannheim) at a ratio of 250:1 (fusio protease) at 37°C for 45 minutes with constant stirring. This protocol resulted in the cleavage of about 95% of the fusion protein.
- the Xa-digested material was adjusted to 25mM imidazole and passed once again over the metal-chelating Sepharose resin. In this instance, the rubredoxin, which retained the poly-Histidine on its carboxy-terminus, bound to the resin while the LHR fragment passed through the column.
- the flow-through was successively dialyzed as follows: 1) for 3 hours in IL of 50mM Tris-HCl pH 7.5, 10% glycerol and ImM Cysteine; 2) for 3 hours in IL of 50mM Tris- HCl pH 7.5, 10%) glycerol, ImM cysteine and ImM cystine; and 3) overnight in 2L of 50mM Tris-HCl pH 8.0, 5mM DTT and 10% glycerol. The dialyzed material was concentrated and used for further experiments.
- the rubredoxin protein expression system produced 20-40mg/L of rubredoxin-LHR fusion protein.
- the fusion protein could be purified to greater than 95% purity by passage over a single Ni-Sepharose column. Although a second passage produced greater purity, it did not result in a more homogeneous LHR preparation and gave lower yields as would be expected.
- the fusion protein was readily cleaved by low concentrations of Factor Xa provided that the Ni-Sepharose eluate had been thoroughly dialyzed to remove all traces of imidazole. Repassage over the Ni-Sepharose column resulted in the binding of all of the rubredoxin (and the red coloration); the LHR moiety was, in contrast, included in the flow through from the column. This step removed over 95% of the rubredoxin fusion partner and this purity could be improved by a second passage over the column with relatively small losses.
- the recombinant LHR fragment cross reacted with LHR antibodies and could be used as an antigen for the production of polyclonal antibodies.
- the LHR moiety does not fold conectly as indicated by the failure to bind efficiently to luteinizing hormone (LH).
- LH luteinizing hormone
- the pRUBEX2 vector was not designed to produce a recombinant fusion protein that is secreted, and thus does not effect proper folding of some mammalian polypeptides that contain disulfide linkages.
- the extracellular domain of LHR for example, contains at least four disulfide bonds; this apparently prevented it from folding to the native conformation in the reducing environment of the E. coli cytosol, a result which was not unexpected.
- rubredoxin- LHR fusion that is targeted for secretion would be expected to fold properly in the more oxidized periplasmic environment where the dsb protein, which is involved in disulfide bond formation and shuffling in E. coli, is present.
- the coding region of the D. vulgaris rubredoxin gene was cloned into the expression vector pET21b (Novagen) at the Ndel/BamHl site to yield pRUBEXl.
- a cDNA encoding the amino-terminal 340 amino acids of human luteinizing hormone receptor (hLHR), representing the extracellular domain (see Example III) was then cloned into the BamHl site of pRUBEXl to yield pRUBEXl-LHR which thus encodes a fusion protein consisting of the N- terminal extracellular domain of human LHR fused to the carrier protein rubredoxin at the C-terminal end of rubredoxin (Fig. 4).
- E. coli strain BL21 cells were transformed with pRUBEXl -LHR and a 1.0ml overnight culture of the transformed cells was inoculated into a 100ml culture and grown for 3 hours at room temperature prior to induction with ImM IPTG for 3 hours at room temperature.
- Cells were collected at 5000 x g for 10 minutes and stored overnight at -20 °C and then resuspended in 10ml of 50mMTris-HCl, pH 7.5 and disrupted with 5 second bursts of a sonicator at full power until all cells were broken. The lysate was centrifuged at 25,000 x g for 15 minutes and the supernatant was discarded.
- the pellet was washed successively in water, 50mM Tris-HCl ph 7.5 containing 5mM EDTA, 50mM Tris-HCl pH 7.5, containing 5mM EDTA and 0.4% Triton X-100, water, and 50mM Tris-HCl, pH 7.5, containing ImM EDTA.
- the washed pellet was solubilized in 5.0ml of 8M urea, and EDTA and phenylmethylsulfonylfluoride (PMSF) were added to final concentrations of 5mM and 2mM respectively.
- PMSF phenylmethylsulfonylfluoride
- the solubilized protein was cleared for 30 minutes at 25,000 x g and then successively dialyzed as follows: 1) for 3 hours in 200ml of 50mM Tris-HCl, pH 7.5, 10%) glycerol, and ImM cysteine (Sigma Chemical Co., St. Louis, MO); 2) for 3 hours in IL of 50mM Tris-HCl, pH 7.5, 10% glycerol, ImM cysteine, and ImM cystine (Sigma Chemical Co., St. Louis, MO); and 3) overnight in IL of 50mM Tris-HCl pH 8.0, 5mM DTT, and 10% glycerol.
- the dialyzed material was fractionated in SDS polyacrylamide gels and a 3 kD band which was specific to transformed cells and immunoreactive with human LHR antibodies, was cut from preparative gels and washed with water.
- the excised bands were lyophilized, ground into powder and injected into rabbits. The initial injection was in Freund's complete adjuvant (Pierce Biochemicals) and was followed by three boosts in Freund's incomplete adjuvant (Pierce Biochemicals). Animals were bled and an IgG fraction was prepared from the serum.
- Wild type rat LHR cDNA was cloned into pET24 to form pCDNA3.
- pCDNA3 and the empty vector pET24, as a control, were transiently transfected with lipofectamine into monkey kidney (COS7) cells grown in
- DMEM Dulbecco's modified Eagle's medium; Gibco/BRL
- fetal bovine serum Gibco/BRL
- the induced rubredoxin-LHR fusion protein was readily visible by Coomassie Blue staining after fractionation of whole bacterial cell lysates from transformed BL21 E. coli cells in SDS polyacrylamide gels. Large amounts of the fusion protein were produced; estimates from the stained gels suggest that from 10-20mg of fusion protein was produced in 500ml of cells. The fusion protein was easily centrifuged from cell lysates, but it was also readily soluble in 8M urea.
- Fusion protein bands excised from SDS-polyacrylamide gels and ground into a fine powder were excellent antigens in New Zealand which rabbits. Although three boosts were administered before bleeding the animals, it is not known if they were all necessary.
- the IgG fraction purified from the sera of inoculated rabbits did not react with native human LHR or rubredoxin, but reacted only with the recombinant hLHR fusion protein or deglycosylated native hLHR.
- the fusion protein expressed in E. coli that was used for antigen is not glycosylated, it is not su ⁇ rising that antisera directed against the fusion protein did not react with native hLHR which contains six known N-linked glycosylation sites.
- Leptins are 12-15 kDa proteins which are known to be involved in the regulation of obesity in humans and other mammalian organisms. Expression of various leptins (human, rat, mouse and pig) by themselves or as fusions in E. coli have invariably led to the formation of inclusion bodies (K. Giese et al., Mol Med. 2: 50-58 (1996); A. Fawzi et al., Horm. Metab. Res. 28: 694-697 (1996)). The inclusion bodies can be resolubilized and the proteins refolded to yield active leptin with varying degrees of success.
- Native pig leptin contains a 21 amino acid signal peptide which is absent in the mature processed protein.
- this signal peptide sequence was deleted so that the arnino-terminus originated at Val-22 of the pre-leptin sequence.
- the N-terminus primer was designed according to the amyloid protein scheme and included the Kpnl restriction site and a Factor Xa recognition site just before the initial residues of the leptin sequence.
- the C-terminus primer contained the sequence for the C- terminal region of the protein along with a Hindlll restriction site. The gene was synthesized by PCR amplification using a cDNA clone as the template.
- the amplified product was digested with Kpnl and Hindlll and was ligated into the conesponding site of pRUBEX 3 (Example I). After transformation of the plasmid into E. coli DH5 ⁇ (strain BL-21 as described in Example I), three recombinant clones were isolated and determined by restriction analysis to contain the entire fusion protein gene.
- the fusion protein was purified as described in Examples I and II, and the yield of the soluble leptin fusion was about 10-15mgs/liter.
- Leptin fusions were digested with Factor Xa at a ratio (w/w) of 100: 1 at pH 8.0 at room temperature. Leptin fusions were also digestible with recombinant enterokinase, but not with native enterokinase. The digest was centrifuged at 15,000xg for 15 minutes and the supernatant was used for analysis.
- the purified fusion protein and the Factor Xa digests were analyzed on a 10%) Tris-tricine/sodium dodecyl sulfate (SDS) polyacrylamide gel (see Fig. 5).
- Lane 4 shows purified, undigested fusion protein (anow; 22 kD, 5 ⁇ g) but the mobility of the band is retarded due to the presence of the histidine moiety due to its positive charge; lanes 5 and 6 show a 7-hour digest of fusion protein (15 g and lO ⁇ g, respectively) with Factor Xa.
- the 14 kD band represents pure leptin and the 9.3 kD band (bottom arrow) represents the rubredoxin-histidine portion of the fusion just before the Factor Xa site. Again, the mobility of the 9.3 kD band is retarded due to the presence of the histidine moiety. The presence of leptin in the supernatant indicates that leptin is soluble after digestion with the protease. These results were confirmed by westem-blot analysis (Fig. 6). Lane 1 contains pig leptin fusion protein digested with Factor Xa (150ng); Lane 2 contains purified pig leptin fusion protein (lOOng).
- the membrane was exposed to fluorescent-labeled antibody raised against purified pig leptin.
- the two lanes shown in Fig. 6 were cross-reacted to antibody raised against pig leptin. Both of the products cross-reacted with the antibody thereby indicating the presence of leptin in the fusion and in the digested fusion.
- pro-insulin synthesized in E. coli is the major source of pharmaceutical grade insulin used in the treatment of diabetes.
- insulin is initially produced as a pro-insulin chain composed of three domains, A, B, and C, which contain two intramolecular disulfide bonds.
- domain C is cleaved from the A and B domains and the result is a heterodimeric insulin molecule whose two subunits are joined by two disulfide bonds.
- two strategies have been employed for the synthesis of mature insulin.
- One strategy involves reconstitution of the separately synthesized subunits, A and B, to form active insulin while the second strategy involves synthesizing the pro-insulin (all three domains) as an insoluble single chain in inclusion bodies.
- subunit C After successful solubilization and refolding of the pro-insulin, subunit C is removed by cleavage with trypsin and carboxypeptidase C to yield active insulin.
- the latter method has been reported to give significantly higher levels of active insulin, although pro-insulins from different animal sources have different intrinsic solubilities.
- a feline pro- insulin/rubredoxin fusion was therefore constructed in order to more efficiently recover soluble fusion protein. Construction of the feline pro-insulin/rubredoxin fusion
- the gene encoding feline pro-insulin was synthesized as constituent oligonucleotides which were ligated together to form a single composite gene.
- the codons were altered according to an E. coli codon usage table to maximize expression.
- a Factor Xa site was included at the 5' end of the pro-insulin oligonucleotide containing the N-tenriinus sequence.
- the composite gene was then digested with Kpnl-Hindlll and was ligated into the conesponding sites of RUB ⁇ X 3 and finally transformed into E. coli DH5 ⁇ (strain BL-21 as described in Example I).
- E. coli DH5 ⁇ strain BL-21 as described in Example I.
- the fusion protein was purified as described in Examples I and II, and the yield of the soluble pro-insulin fusion was about 25 mgs/liter.
- Pro- insulin fusions were digested with Factor Xa at a ratio (w/w) of 100:1 at pH 8.0 at room temperature.
- Pro-insulin fusions were also digestible with recombinant enterokinase, but not with native enterokinase. Digestion with enterokinase reduced the amount of non-specific cleavage products compared to Factor Xa.
- the rubredoxin pro-insulin fusion migrated as a 19 kD band on a 10% Tris-Tricine native gel ( Figure 7, lane 1, 5 ⁇ g).
- Digests of the fusion with Factor Xa showed a number of non-specific cleavage products; therefore, digestion with recombinant enterokinase (an enterokinase site being a part of the flag peptide sequence) was attempted.
- the fusion protein was digested at a w/w ratio of 75 : 1 (fusiomenzyme) overnight at room temperature. The digest was centrifuged at 15,000 x g for 20 minutes and the supernatant was analyzed on a 10% Tris- Tricine gel.
- the digest revealed the two expected bands: a 9.6kDa rubredoxin band (top arrow) and a 9 kD pro-insulin band (bottom arrow; Figure 7, lanes 2 and 3, lO ⁇ g and 7 ⁇ g, respectively).
- the mobility of the 9.6 kD band was retarded due to the presence of the histidine moiety.
- the 9 kD band (bottom arrow) was electrophoretically transfened to a PVDF membrane and was analyzed via amino acid sequencing. The first twenty amino acids were determined and were found to match the expected sequence of pro-insulin, except for an additional portion of the polylinker which was present as a result of the location of the enterokinase restriction site in the fusion protem.
Abstract
Description
Claims
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU24869/00A AU2486900A (en) | 1998-12-29 | 1999-12-29 | Rubredoxin fusion proteins, protein expression system and methods |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US11403498P | 1998-12-29 | 1998-12-29 | |
US60/114,034 | 1998-12-29 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2000039310A1 true WO2000039310A1 (en) | 2000-07-06 |
WO2000039310A9 WO2000039310A9 (en) | 2001-10-04 |
Family
ID=22352998
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US1999/031176 WO2000039310A1 (en) | 1998-12-29 | 1999-12-29 | Rubredoxin fusion proteins, protein expression system and methods |
Country Status (2)
Country | Link |
---|---|
AU (1) | AU2486900A (en) |
WO (1) | WO2000039310A1 (en) |
Cited By (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2002003911A2 (en) * | 2000-07-07 | 2002-01-17 | Lars Lannfelt | Prevention and treatment of alzheimer's disease |
EP1634956A1 (en) * | 2003-06-13 | 2006-03-15 | Japan as Represented by President of National Center for Geriatrics and, Gerontology | Recombinant adeno-associated virus vector for treatment of alzheimer disease |
EP1781703A1 (en) | 2004-06-21 | 2007-05-09 | Bioarctic Neuroscience AB | Antibodies specific for soluble amyloid beta peptide protofibrils and uses thereof |
AU2007200047B2 (en) * | 2000-07-07 | 2009-11-26 | Bioarctic Neuroscience Ab | Prevention and treatment of Alzheimer's disease |
WO2010064748A1 (en) | 2008-12-04 | 2010-06-10 | Korea Research Institute Of Bioscience And Biotechnology | Screening of abundantly secreted proteins and their use as fusion partners for the production of recombinant proteins |
US8025878B2 (en) | 2006-03-23 | 2011-09-27 | Bioarctic Neuroscience Ab | Protofibril selective antibodies and the use thereof |
CN103487393A (en) * | 2013-10-15 | 2014-01-01 | 北京大学 | Rapid protein quantification method |
EP2683649A1 (en) * | 2011-03-07 | 2014-01-15 | Commissariat à l'Énergie Atomique et aux Énergies Alternatives | Biodegradable electroconducting nanowire, its method of manufacture and its uses |
US9573994B2 (en) | 2014-07-10 | 2017-02-21 | Bioarctic Neuroscience Ab | Aβ protofibril binding antibodies |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0781848A2 (en) * | 1995-12-28 | 1997-07-02 | FUJIREBIO Inc. | Fused DNA sequence, fused protein expressed from said fused DNA sequence and method for expressing said fused protein |
-
1999
- 1999-12-29 AU AU24869/00A patent/AU2486900A/en not_active Abandoned
- 1999-12-29 WO PCT/US1999/031176 patent/WO2000039310A1/en active Application Filing
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0781848A2 (en) * | 1995-12-28 | 1997-07-02 | FUJIREBIO Inc. | Fused DNA sequence, fused protein expressed from said fused DNA sequence and method for expressing said fused protein |
Cited By (22)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2002003911A2 (en) * | 2000-07-07 | 2002-01-17 | Lars Lannfelt | Prevention and treatment of alzheimer's disease |
WO2002003911A3 (en) * | 2000-07-07 | 2002-04-11 | Lars Lannfelt | Prevention and treatment of alzheimer's disease |
US7179463B2 (en) | 2000-07-07 | 2007-02-20 | Lars Lannfelt | Treatment of alzheimer's disease |
US8409575B2 (en) | 2000-07-07 | 2013-04-02 | Bioarctic Neuroscience Ab | Antibodies specific for amyloid beta protofibril |
AU2007200047B2 (en) * | 2000-07-07 | 2009-11-26 | Bioarctic Neuroscience Ab | Prevention and treatment of Alzheimer's disease |
US7700719B2 (en) | 2000-07-07 | 2010-04-20 | Bioarctic Neuroscience Ab | Arctic β amyloid protofibril |
EP1634956A1 (en) * | 2003-06-13 | 2006-03-15 | Japan as Represented by President of National Center for Geriatrics and, Gerontology | Recombinant adeno-associated virus vector for treatment of alzheimer disease |
EP1634956A4 (en) * | 2003-06-13 | 2007-01-24 | Japan Government | Recombinant adeno-associated virus vector for treatment of alzheimer disease |
US8318687B2 (en) | 2003-06-13 | 2012-11-27 | Takeshi Tabira | Recombinant adeno-associated virus vector for treatment of Alzheimer disease |
US8106164B2 (en) | 2004-06-21 | 2012-01-31 | Bioarctic Neuroscience Ab | Antibodies specific for soluble amyloid beta peptide protofibrils and uses thereof |
US8404459B2 (en) | 2004-06-21 | 2013-03-26 | Bioarctic Neuroscience Ab | Antibodies specific for soluble amyloid beta peptide protofibrils and uses thereof |
EP1781703A1 (en) | 2004-06-21 | 2007-05-09 | Bioarctic Neuroscience AB | Antibodies specific for soluble amyloid beta peptide protofibrils and uses thereof |
US8999936B2 (en) | 2004-06-21 | 2015-04-07 | Bioarctic Neuroscience Ab | Antibodies specific for soluble amyloid beta peptide protofibrils and uses thereof |
US8025878B2 (en) | 2006-03-23 | 2011-09-27 | Bioarctic Neuroscience Ab | Protofibril selective antibodies and the use thereof |
US9034334B2 (en) | 2006-03-23 | 2015-05-19 | Bioarctic Neuroscience Ab | Protofibril selective antibodies and the use thereof |
WO2010064748A1 (en) | 2008-12-04 | 2010-06-10 | Korea Research Institute Of Bioscience And Biotechnology | Screening of abundantly secreted proteins and their use as fusion partners for the production of recombinant proteins |
EP2573122A2 (en) | 2008-12-04 | 2013-03-27 | Korea Research Institute of Bioscience and Biotechnology | Screening of abundantly secreted proteins and their use as fusion partners for the production of recombinant proteins |
EP2918606A2 (en) | 2008-12-04 | 2015-09-16 | Korea Research Institute of Bioscience and Biotechnology | Screening of abundantly secreted proteins and their use as fusion partners for the production of recombinant proteins |
EP2683649A1 (en) * | 2011-03-07 | 2014-01-15 | Commissariat à l'Énergie Atomique et aux Énergies Alternatives | Biodegradable electroconducting nanowire, its method of manufacture and its uses |
EP2683649B1 (en) * | 2011-03-07 | 2017-06-07 | Commissariat à l'Énergie Atomique et aux Énergies Alternatives | Biodegradable electroconducting nanowire, its method of manufacture and its uses |
CN103487393A (en) * | 2013-10-15 | 2014-01-01 | 北京大学 | Rapid protein quantification method |
US9573994B2 (en) | 2014-07-10 | 2017-02-21 | Bioarctic Neuroscience Ab | Aβ protofibril binding antibodies |
Also Published As
Publication number | Publication date |
---|---|
WO2000039310A9 (en) | 2001-10-04 |
AU2486900A (en) | 2000-07-31 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CA1339208C (en) | Fusion proteins containing a hinge region for enhanced cleavage | |
CA2498502C (en) | Recombinant clostridial toxin fragments with proteolytic activation | |
JP2686090B2 (en) | Novel fusion protein and purification method thereof | |
US5013653A (en) | Product and process for introduction of a hinge region into a fusion protein to facilitate cleavage | |
US6072039A (en) | Hybrid polypeptide comparing a biotinylated avidin binding polypeptide fused to a polypeptide of interest | |
JP2981286B2 (en) | Expression of tetanus toxin fragment C | |
EP0531404B1 (en) | Ubiquitin-specific protease | |
JP4504014B2 (en) | Methods for producing insulinotropic GLP-1 (7-36) polypeptides and / or GLP-1 analogs | |
CA2896157A1 (en) | Methods and compositions relating to crm197 | |
EP2075336A1 (en) | Purification of recombinant proteins fused to multiple epitopes | |
AU714423B2 (en) | Carrier protein having an adjuvant effect, immunogenic complex containing same, preparation method therefor, nucleotide sequence and vaccine | |
WO2000039310A1 (en) | Rubredoxin fusion proteins, protein expression system and methods | |
EP0510018A1 (en) | Lipoprotein signal peptide fused to antigenic polypeptides | |
EP1706494B1 (en) | Method for production of recombinant growth hormone in form of hybrid protein | |
AU8640798A (en) | Recombinant expression of insulin c-peptide | |
Guillén et al. | Expression in Escherichia coli of the lpdA gene, protein sequence analysis and immunological characterization of the P64k protein from Neisseria meningitidis | |
US5888775A (en) | Peptide synthesis and purification by fusion to penI protein or precipitation effective portion thereof | |
RU2144957C1 (en) | Recombinant plasmid dna ppins07 encoding fused polypeptide containing human proinsulin and strain of bacterium escherichia coli - producer of fused polypeptide containing human proinsulin | |
WO2007112676A1 (en) | A human parathyroid hormone 1-34 fusion protein and expression vectors thereof | |
US20030186848A1 (en) | Recombinant iron uptake proteins | |
KR100202958B1 (en) | Expression vector containing insulin fusion protein gene enables enzymatic cleavage in insulin production from insulin fusion protein, and process for the production of human insulin using this | |
CA2000368A1 (en) | Plasmid constructions for high level production of eukaryotic proteins | |
JP2002119284A (en) | Method for producing short peptide | |
KR20000066750A (en) | The Method for Expressing Polypeptides in E.coli Using Carboxypeptidase Y propeptide as a Fusion partner, Recombinant Vector Used thereby and Transformant thereof | |
JPS62228283A (en) | Dna gene and plasmid containing said gene and extracellular secretion of protein using said plasmid |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A1 Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CR CU CZ DE DK DM EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT UA UG US UZ VN YU ZA ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): GH GM KE LS MW SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
WWE | Wipo information: entry into national phase |
Ref document number: 09869446 Country of ref document: US |
|
AK | Designated states |
Kind code of ref document: C2 Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CR CU CZ DE DK DM EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT UA UG US UZ VN YU ZA ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: C2 Designated state(s): GH GM KE LS MW SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
COP | Corrected version of pamphlet |
Free format text: PAGES 1/6-6/6, DRAWINGS, REPLACED BY NEW PAGES 1/5-5/5; DUE TO LATE TRANSMITTAL BY THE RECEIVING OFFICE |
|
REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
122 | Ep: pct application non-entry in european phase |