WO1999033983A1 - V201 dna and polypeptides - Google Patents

V201 dna and polypeptides Download PDF

Info

Publication number
WO1999033983A1
WO1999033983A1 PCT/US1998/027626 US9827626W WO9933983A1 WO 1999033983 A1 WO1999033983 A1 WO 1999033983A1 US 9827626 W US9827626 W US 9827626W WO 9933983 A1 WO9933983 A1 WO 9933983A1
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
polypeptides
molecular weight
isolated
nucleic acid
Prior art date
Application number
PCT/US1998/027626
Other languages
English (en)
French (fr)
Inventor
Stewart D. Lyman
Original Assignee
Immunex Corporation
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Immunex Corporation filed Critical Immunex Corporation
Priority to JP2000526639A priority Critical patent/JP2002500011A/ja
Priority to CA002315879A priority patent/CA2315879A1/en
Priority to IL13669598A priority patent/IL136695A0/xx
Priority to AU20157/99A priority patent/AU2015799A/en
Priority to EP98964943A priority patent/EP1042473A1/en
Publication of WO1999033983A1 publication Critical patent/WO1999033983A1/en

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants

Definitions

  • the invention is directed to purified and isolated V201 polypeptides, the nucleic acids encoding such polypeptides, processes for production of recombinant forms of such polypeptides, antibodies generated against these polypeptides, fragmented peptides derived from these polypeptides, the use of such polypeptides and fragmented peptides as molecular weight markers, the use of such polypeptides and fragmented peptides as controls for peptide fragmentation, and kits comprising these reagents.
  • Protein molecular weight standards are commercially available to assist in the estimation of molecular weights of unknown protein samples (New England Biolabs Inc. Catalog:130-131, 1995; J. L. Hartley, U.S. Patent No. 5,449,758). However, the molecular weight standards may not correspond closely enough in size to the unknown sample protein to allow an accurate estimation of apparent molecular weight.
  • Enzymatic fragmentation of a protein can also be achieved by incubation of a protein with a protease, such as Achromobacter protease I (F. Sakiyama and A. Nakata, U.S. Patent No. 5,248,599; T. Masaki et al., Biochim. Biophys. Acta 660:44-50, 1981; T. Masaki et al, Biochim. Biophys. Acta 660:51-55, 1981), which leads to cleavage of the peptide bond on the carboxyl side of lysine residues.
  • a protease such as Achromobacter protease I (F. Sakiyama and A. Nakata, U.S. Patent No. 5,248,599; T. Masaki et al., Biochim. Biophys. Acta 660:44-50, 1981; T. Masaki et al, Biochim. Biophys. Acta 660:51-55, 1981), which leads to cleavage of
  • the molecular weights of the fragmented peptides can cover a large range of molecular weights and the peptides can be numerous. Variations in the degree of fragmentation can also be accomplished (D. W. Cleveland et al., J Biol. Chem. 252:1102-1106, 1977).
  • composition of a protein results in a unique positioning of cleavage sites within the protein.
  • Specific fragmentation of a protein by chemical or enzymatic cleavage results in a unique "peptide fingerprint" (D. W. Cleveland et al., J. Biol. Chem. 252: 1102-1106, 1977; M. Brown et al., J. Gen. Virol. 50:309-316, 1980). Consequently, cleavage at specific sites results in reproducible fragmentation of a given protein into peptides of precise molecular weights. Furthermore, these peptides possess unique charge characteristics that determine the isoelectric pH of the peptide. These unique characteristics can be exploited using a variety of electrophoretic and other techniques (T.D. Brock and M.T. Madigan, Biology of Microorganisms 76-77 (Prentice Hall, 6d ed. 1991)).
  • Fragmentation of proteins is further employed for the production of fragments for amino acid composition analysis and protein sequencing (P. Matsudiara, J. Biol. Chem. 262:10035- 10038, 1987; C. Eckerskorn et al., Electrophoresis 1988, 9:830-838, 1988), particularly the production of fragments from proteins with a "blocked" N-terminus.
  • fragmentation of proteins can be used in the preparation of peptides for mass spectrometry (W.J. Henzel et al., Proc. Natl. Acad. Sci. USA 90:5011-5015, 1993; B.
  • the invention aids in fulfilling this need in the art.
  • the invention encompasses an isolated nucleic acid molecule comprising the DNA sequence of SEQ ID NO: 1 and an isolated nucleic acid molecule encoding the amino acid sequence of SEQ ID NO:2.
  • the invention also encompasses nucleic acid molecules complementary to these sequences.
  • the invention includes double-stranded nucleic acid molecules comprising the DNA sequence of SEQ ID NO:l and isolated nucleic acid molecules encoding the amino acid sequence of SEQ ID NO:2.
  • Both single-stranded and double-stranded RNA and DNA V201 nucleic acid molecules are encompassed by the invention. These molecules can be used to detect both single-stranded and double-stranded RNA and DNA variants of V201 encompassed by the invention.
  • a double- stranded DNA probe allows the detection of nucleic acid molecules equivalent to either strand of the nucleic acid molecule.
  • Isolated nucleic acid molecules that hybridize to a denatured, double- stranded DNA comprising the DNA sequence of SEQ ID NO: 1 or an isolated nucleic acid molecule encoding the amino acid sequence of SEQ ID NO: 2 under conditions of moderate stringency in 50% formamide and 6XSSC, at 42 °C with washing conditions of 60°C, 0.5XSSC, 0.1% SDS are encompassed by the invention.
  • the invention further encompasses isolated nucleic acid molecules derived by in vitro mutagenesis from SEQ ID NO: 1.
  • In vitro mutagenesis would include numerous techniques known in the art including, but not limited to, site-directed mutagenesis, random mutagenesis, and in vitro nucleic acid synthesis.
  • the invention also encompasses isolated nucleic acid molecules degenerate from SEQ ID NO: 1 as a result of the genetic code, isolated nucleic acid molecules that are allelic variants of human V201 DNA, or a species homolog of V201 DNA.
  • the invention also encompasses recombinant vectors that direct the expression of these nucleic acid molecules and host cells transformed or transfected with these vectors.
  • the invention also encompasses isolated polypeptides encoded by these nucleic acid molecules, including isolated polypeptides having a molecular weight of approximately 18 kD as determined by SDS-PAGE and isolated polypeptides in non-glycosylated form. Isolated polyclonal or monoclonal antibodies that bind to these polypeptides are encompassed by the invention.
  • the invention further encompasses methods for the production of N201 polypeptides including culturing a host cell under conditions promoting expression and recovering the polypeptide from the culture medium. Especially, the expression of N201 polypeptides in bacteria, yeast, plant, and animal cells is encompassed by the invention.
  • assays utilizing V201 polypeptides to screen for potential inhibitors of activity associated with N201 polypeptide counter-structure molecules and methods of using N201 polypeptides as therapeutic agents for the treatment of diseases mediated by N201 polypeptide counter-structure molecules are encompassed by the invention. Further, methods of using N201 polypeptides in the design of inhibitors thereof are also an aspect of the invention.
  • the invention further encompasses the fragmented peptides produced from N201 polypeptides by chemical or enzymatic treatment.
  • forms of V201 polypeptide molecular weight markers and fragmented peptides thereof, wherein at least one of the sites necessary for fragmentation by chemical or enzymatic means has been mutated, are an aspect of the invention.
  • the invention also encompasses a method for the visualization of V201 polypeptide molecular weight markers and fragmented peptides thereof using electrophoresis.
  • the invention further includes a method for using N201 polypeptide molecular weight markers and fragmented peptides thereof as molecular weight markers that allow the estimation of the molecular weight of a protein or a fragmented protein sample.
  • the invention further encompasses methods for using N201 polypeptides and fragmented peptides thereof as markers, which aid in the determination of the isoelectric point of a sample protein.
  • the invention also encompasses methods for using N201 polypeptides and fragmented peptides thereof as controls for establishing the extent of fragmentation of a protein sample.
  • a cDNA encoding human V201 polypeptide has been isolated and is disclosed in SEQ ID NO:l.
  • the nucleotide sequence of V201 DNA is:
  • V201 polypeptide The amino acid sequence ofV201 polypeptide is: MGST GSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAIS CSRVFSSRWGRGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLGCLRTR ASVLMLLSSLVSLAGS ⁇ LA ILFFVLYDFCIVCITTYAINVSLM LSF RKVQEPQGKAKRH (SEQ ID NO:2).
  • N201 polypeptides enables construction of expression vectors comprising nucleic acid sequences encoding N201 polypeptides; host cells transfected or transformed with the expression vectors; biologically active human V201 polypeptide and N201 molecular weight markers as isolated and purified proteins; and antibodies immunoreactive with N201 polypeptides.
  • V201 Nucleotide sequence similar to V201 DNA was originally seen in the TIGR-HGI database. However, the nucleotide sequence of V201 DNA was generated by sequencing EST clones, and is not identical to the TIGR-HGI nucleotide sequence. V201 was not found to be highly related to any other sequences in the Genbank databases and, therefore, represents unique DNA and protein sequences.
  • V201 polypeptide is a type I single transmembrane protein with a short cytoplasmic tail, and is probably a growth factor.
  • V201 polypeptide has a 23 amino acid leader sequence (amino acids 1 -23 of SEQ ID NO:2), a 90 amino acid extracellular domain (amino acids 24- 113 of SEQ ID NO:2)
  • amino acids 114-133 of SEQ ID NO:2 amino acids 114-133 of SEQ ID NO:2
  • amino acids 134-163 of SEQ ID NO:2 amino acids 134-163 of SEQ ID NO:2
  • V201 RNA is expressed as a mRNA of approximately 0.9kb, that was detected by northern blot in a wide variety of tissues. Expression in various tissues was approximated using Clonetech tissue blots I, II, and III. mRNA expression was detected in heart, liver, pancreas, thyroid, ovary, prostate, testis, stomach, spinal cord, lymph nodes, trachea, adrenal gland, bone marrow, small intestine, colon, pbl, kidney, placenta, spleen, thymus, brain, lung, and skeletal muscle (approximately in order of abundance).
  • the expression of recombinant V201 polypeptides can be accomplished utilizing fusion of sequences encoding V201 polypeptides to sequences encoding another polypeptide to aid in the purification of V201 polypeptides.
  • An example of such a fusion is a fusion of sequences encoding a N201 polypeptide to sequences encoding the product of the malE gene of the pMAL-c2 vector of New England Biolabs, Inc.
  • Such a fusion allows for affinity purification of the fusion protein, as well as separation of the maltose binding protein portion of the fusion protein from the V201 polypeptide after purification. It is understood of course that many different vectors and techniques can be used for the expression and purification of V201 polypeptides and that this embodiment in no way limits the scope of the invention.
  • the insertion of DNA encoding the V201 polypeptide into the pMAL-c2 vector can be accomplished in a variety of ways using known molecular biology techniques.
  • the preferred construction of the insertion contains a termination codon adjoining the carboxyl terminal codon of the N201 polypeptide.
  • the preferred construction of the insertion results in the fusion of the amino terminus of the N201 polypeptide directly to the carboxyl terminus of the Factor Xa cleavage site in the pMAL-c2 vector.
  • a D ⁇ A fragment can be generated by PCR using N201 D ⁇ A as the template D ⁇ A and two oligonucleotide primers.
  • oligonucleotide primers generates a blunt-ended fragment of D ⁇ A that can be isolated by conventional means.
  • This PCR product can be ligated together with pMAL-p2 (digested with the restriction endonuclease Xmn I) using conventional means. Positive clones can be identified by conventional means.
  • Induction of expression and purification of the fusion protein can be performed as per the manufacturer's instructions. This construction facilitates a precise separation of the V201 polypeptide from the fused maltose binding protein utilizing a simple protease treatment as per the manufacturer's instructions. In this manner, purified N201 polypeptide can be obtained.
  • such a constructed vector can be easily modified using known molecular biology techniques to generate additional fusion proteins.
  • N201 polypeptides as molecular weight markers to estimate the apparent molecular weight of a sample protein by gel electrophoresis.
  • An isolated and purified N201 polypeptide molecular weight marker according to the invention has a molecular weight of approximately 18,222 Daltons in the absence of glycosylation.
  • the N201 polypeptide, together with a sample protein can be resolved by denaturing polyacrylamide gel electrophoresis by conventional means (U. K. Laemmli, Nature 227:680-685, 1970) in two separate lanes of a gel containing sodium dodecyl sulfate and a concentration of acrylamide between 6-20%. Proteins on the gel can be visualized using a conventional staining procedure.
  • the N201 polypeptide molecular weight marker can be used as a molecular weight marker in the estimation of the apparent molecular weight of the sample protein.
  • the unique amino acid sequence of V201 (SEQ ID ⁇ O:2) specifies a molecular weight of approximately 18,222 Daltons. Therefore, the N201 polypeptide molecular weight marker serves particularly well as a molecular weight marker for the estimation of the apparent molecular weight of sample proteins that have apparent molecular weights close to 18,222 Daltons.
  • the use of this polypeptide molecular weight marker allows an increased accuracy in the determination of apparent molecular weight of proteins that have apparent molecular weights close to 18,222 Daltons.
  • N201 fragmented peptide molecular weight markers generated by chemical fragmentation of N201 polypeptide, as molecular weight markers to estimate the apparent molecular weight of a sample protein by gel electrophoresis.
  • Isolated and purified N201 polypeptide can be treated with cyanogen bromide under conventional conditions that result in fragmentation of the N201 polypeptide molecular weight marker by specific hydrolysis on the carboxyl side of the methionine residues within the N201 polypeptide (E. Gross, Methods in Enz.
  • V201 polypeptide molecular weight markers Due to the unique amino acid sequence of the N201 polypeptide, the fragmentation of V201 polypeptide molecular weight markers with cyanogen bromide generates a unique set of V201 fragmented peptide molecular weight markers. The distribution of methionine residues determines the number of amino acids in each peptide and the unique amino acid composition of each peptide determines its molecular weight.
  • the unique set of V201 fragmented peptide molecular weight markers generated by treatment of V201 polypeptide with cyanogen bromide comprises 3 fragmented peptides of at least 10 amino acids in size.
  • the peptide encoded by amino acids 2-106 of SEQ ID ⁇ O:2 has a molecular weight of approximately 11,573 Daltons.
  • the peptide encoded by amino acids 107- 146 of SEQ ID NO:2 has a molecular weight of approximately 4,460 Daltons.
  • the peptide encoded by amino acids 147-163 of SEQ ID NO:2 has a molecular weight of approximately 2,094 Daltons.
  • V201 fragmented peptide molecular weight markers have molecular weights of approximately 11 ,573; 4,460; and 2,094 Daltons.
  • the N201 fragmented peptide molecular weight markers can be resolved by denaturing polyacrylamide gel electrophoresis by conventional means in two separate lanes of a gel containing sodium dodecyl sulfate and a concentration of acrylamide between 10-20%. Proteins on the gel can be visualized using a conventional staining procedure.
  • the N201 fragmented peptide molecular weight markers can be used as molecular weight markers in the estimation of the apparent molecular weight of the sample protein.
  • the unique amino acid sequence of V201 specifies a molecular weight of approximately 11,573; 4,460; and 2,094 Daltons for the N201 fragmented peptide molecular weight markers.
  • the N201 fragmented peptide molecular weight markers serve particularly well as molecular weight markers for the estimation of the apparent molecular weight of sample proteins that have apparent molecular weights close to 11,573; 4,460; or 2,094 Daltons. Consequently, the use of these fragmented peptide molecular weight markers allows an increased accuracy in the determination of apparent molecular weight of proteins that have apparent molecular weights close to 11,573; 4,460; or 2,094 Daltons.
  • the sample protein and the V201 polypeptide can be simultaneously, but separately, treated with cyanogen bromide under conventional conditions that result in fragmentation of the sample protein and the V201 polypeptide by specific hydrolysis on the carboxyl side of the methionine residues within the sample protein and the V201 polypeptide.
  • the V201 fragmented peptide molecular weight markers generated by cleavage of the N201 polypeptide with cyanogen bromide have molecular weights of approximately 11,573; 4,460; and 2,094 Daltons.
  • the fragmented peptides from both the N201 polypeptide and the sample protein can be resolved by denaturing polyacrylamide gel electrophoresis by conventional means in two separate lanes of a gel containing sodium dodecyl sulfate and a concentration of acrylamide between 10-20%. Fragmented peptides on the gel can be visualized using a conventional staining procedure.
  • the V201 fragmented peptide molecular weight markers can be used as molecular weight markers in the estimation of the apparent molecular weight of the fragmented proteins derived from the sample protein.
  • the N201 fragmented peptide molecular weight markers serve particularly well as molecular weight markers for the estimation of the apparent molecular weight of fragmented peptides that have apparent molecular weights close to 11,573; 4,460; or 2,094 Daltons. Consequently, the use of these N201 fragmented peptide molecular weight markers allows an increased accuracy in the determination of apparent molecular weight of fragmented peptides that have apparent molecular weights close to 11,573; 4,460; or 2,094 Daltons.
  • the extent of fragmentation of the V201 polypeptide is further used as a control to determine the conditions expected for complete fragmentation of the sample protein. It is understood of course that many chemicals could be used to fragment N201 polypeptides and that this embodiment in no way limits the scope of the invention.
  • unique sets of V201 fragmented peptide molecular weight markers can be generated from N201 polypeptide using enzymes that cleave the polypeptide at specific amino acid residues. Due to the unique nature of the amino acid sequence of the N201 polypeptide, cleavage at different amino acid residues will result in the generation of different sets of fragmented peptide molecular weight markers.
  • N201 polypeptide can be treated with Achromobacter protease I under conventional conditions that result in fragmentation of the N201 polypeptide by specific hydrolysis on the carboxyl side of the lysine residues within the V201 polypeptide (T. Masaki et al., Biochim. Biophys. Acta 660:44-50, 1981; T. Masaki et al., Biochim. Biophys. Acta 660:51-55, 1981). Due to the unique amino acid sequence of the N201 polypeptide, the fragmentation of N201 polypeptide molecular weight markers with Achromobacter protease I generates a unique set of N201 fragmented peptide molecular weight markers. The distribution of lysine residues determines the number of amino acids in each peptide and the unique amino acid composition of each peptide determines its molecular weight.
  • the unique set of N201 fragmented peptide molecular weight markers generated by treatment of N201 polypeptide with Achromobacter protease I comprises 2 fragmented peptides of at least 10 amino acids in size.
  • the peptide encoded by amino acids 1-30 of SEQ ID ⁇ O:2 has a molecular weight of approximately 3,227 Daltons.
  • the peptide encoded by amino acids 12-24 of SEQ LD NO:2 has a molecular weight of approximately 13,754 Daltons.
  • cleavage of the V201 polypeptide by enzymatic treatment with Achromobacter protease I generates a unique set of N201 fragmented peptide molecular weight markers.
  • the unique and known amino acid sequence of these fragmented peptides allows the determination of the molecular weight of these N201 fragmented peptide molecular weight markers.
  • these N201 fragmented peptide molecular weight markers have molecular weights of approximately 3,227 and 13,754 Daltons.
  • the N201 fragmented peptide molecular weight markers can be resolved by denaturing polyacrylamide gel electrophoresis by conventional means in two separate lanes of a gel containing sodium dodecyl sulfate and a concentration of acrylamide between 10-20%. Proteins on the gel can be visualized using a conventional staining procedure.
  • the V201 fragmented peptide molecular weight markers can be used as molecular weight markers in the estimation of the apparent molecular weight of the sample protein.
  • the N201 fragmented peptide molecular weight markers serve particularly well as molecular weight markers for the estimation of the apparent molecular weight of proteins that have apparent molecular weights close to 3,227 or 13,754 Daltons.
  • sample protein and the V201 polypeptide can be simultaneously, but separately, treated with Achromobacter protease I under conventional conditions that result in fragmentation of the sample protein and the V201 polypeptide by specific hydrolysis on the carboxyl side of the lysine residues within the sample protein and the N201 polypeptide.
  • V201 fragmented peptide molecular weight markers and the fragmented peptides derived from the sample protein are resolved by denaturing polyacrylamide gel electrophoresis by conventional means in two separate lanes of a gel containing sodium dodecyl sulfate and a concentration of acrylamide between 10-20%. Fragmented peptides on the gel can be visualized using a conventional staining procedure.
  • the N201 fragmented peptide molecular weight markers can be used as molecular weight markers in the estimation of the apparent molecular weight of the sample protein.
  • the N201 fragmented peptide molecular weight markers serve particularly well as molecular weight markers for the estimation of the apparent molecular weight of fragmented peptides that have apparent molecular weights close to 3,227 or 13,754 Daltons.
  • the use of these N201 fragmented peptide molecular weight markers allows an increased accuracy in the determination of apparent molecular weight of fragmented peptides that have apparent molecular weights close to 3,227 or 13,754 Daltons.
  • the extent of fragmentation of the N201 polypeptide is further used as a control to determine the conditions expected for complete fragmentation of the sample protein. It is understood of course that many enzymes could be used to fragment N201 polypeptides and that this embodiment in no way limits the scope of the invention.
  • monoclonal and polyclonal antibodies against N201 polypeptides can be generated.
  • Balb/c mice can be injected intraperitoneally on two occasions at 3 week intervals with 10 ⁇ g of isolated and purified N201 polypeptide or peptides based on the amino acid sequence of N201 polypeptides in the presence of RIBI adjuvant (RIBI Corp., Hamilton, Montana).
  • Mouse sera are then assayed by conventional dot blot technique or antibody capture (ABC) to determine which animal is best to fuse.
  • mice are given an intravenous boost of 3 ⁇ g of the V201 polypeptide or peptides, suspended in sterile PBS.
  • mice Three days later, mice are sacrificed and spleen cells fused with Ag8.653 myeloma cells (ATCC) following established protocols. Briefly, Ag8.653 cells are washed several times in serum-free media and fused to mouse spleen cells at a ratio of three spleen cells to one myeloma cell.
  • the fusing agent is 50% PEG: 10% DMSO (Sigma). Fusion is plated out into twenty 96-well flat bottom plates (Corning) containing HAT supplemented DMEM media and allowed to grow for eight days. Supernatants from resultant hybridomas are collected and added to a 96-well plate for 60 minutes that is first coated with goat anti-mouse Ig.
  • 125 I-V201 polypeptide or peptides are added to each well, incubated for 60 minutes at room temperature, and washed four times. Positive wells can be subsequently detected by autoradiography at -70°C using Kodak X-Omat S film. Positive clones can be grown in bulk culture and supernatants are subsequently purified over a Protein A column (Pharmacia). It is understood of course that many techniques could be used to generate antibodies against V201 polypeptides and fragmented peptides thereof and that this embodiment in no way limits the scope of the invention.
  • antibodies generated against N201 and fragmented peptides thereof can be used in combination with V201 polypeptide or fragmented peptide molecular weight markers to enhance the accuracy in the use of these molecular weight markers to determine the apparent molecular weight and isoelectric point of a sample protein.
  • V201 polypeptide or fragmented peptide molecular weight markers can be mixed with a molar excess of a sample protein and the mixture can be resolved by two dimensional electrophoresis by conventional means.
  • Polypeptides can be transferred to a suitable protein binding membrane, such as nitrocellulose, by conventional means.
  • Polypeptides on the membrane can be visualized using two different methods that allow a discrimination between the sample protein and the molecular weight markers.
  • N201 polypeptide or fragmented peptide molecular weight markers can be visualized using antibodies generated against these markers and conventional immunoblotting techniques. This detection is performed under conventional conditions that do not result in the detection of the sample protein. It is understood that it may not be possible to generate antibodies against all N201 polypeptide fragments, since small peptides may not contain immunogenic epitopes. It is further understood that not all antibodies will work in this assay; however, those antibodies which are able to bind N201 polypeptides and fragments can be readily determined using conventional techniques. The sample protein is visualized using a conventional staining procedure.
  • the molar excess of sample protein to V201 polypeptide or fragmented peptide molecular weight markers is such that the conventional staining procedure predominantly detects the sample protein.
  • the level of V201 polypeptide or fragmented peptide molecular weight markers is such as to allow little or no detection of these markers by the conventional staining method.
  • the preferred molar excess of sample protein to V201 polypeptide molecular weight markers is between 2 and 100,000 fold. More preferably, the preferred molar excess of sample protein to N201 polypeptide molecular weight markers is between 10 and 10,000 fold and especially between 100 and 1,000 fold.
  • the N201 polypeptide or fragmented peptide molecular weight markers can be used as molecular weight and isoelectric point markers in the estimation of the apparent molecular weight and isoelectric point of the sample protein.
  • the N201 polypeptide or fragmented peptide molecular weight markers serve particularly well as molecular weight and isoelectric point markers for the estimation of apparent molecular weights and isoelectric points of sample proteins that have apparent molecular weights and isoelectric points close to that of the N201 polypeptide or fragmented peptide molecular weight markers.
  • the ability to simultaneously resolve the N201 polypeptide or fragmented peptide molecular weight markers and the sample protein under identical conditions allows for increased accuracy in the determination of the apparent molecular weight and isoelectric point of the sample protein. This is of particular interest in techniques, such as two dimensional electrophoresis, where the nature of the procedure dictates that any markers should be resolved simultaneously with the sample protein.
  • N201 polypeptide or fragmented peptide molecular weight markers can be used as molecular weight and isoelectric point markers in the estimation of the apparent molecular weight and isoelectric point of fragmented peptides derived by treatment of a sample protein with a cleavage agent. It is understood of course that many techniques can be used for the determination of molecular weight and isoelectric point of a sample protein and fragmented peptides thereof using V201 polypeptide molecular weight markers and peptide fragments thereof and that this embodiment in no way limits the scope of the invention.
  • N201 polypeptide molecular weight markers encompassed by invention can have variable molecular weights, depending upon the host cell in which they are expressed. Glycosylation of N201 polypeptide molecular weight markers and peptide fragments thereof in various cell types can result in variations of the molecular weight of these markers, depending upon the extent of modification.
  • the size of V201 polypeptide molecular weight markers can be most heterogeneous with fragments of N201 polypeptide derived from the extracellular portion of the polypeptide. Consistent molecular weight markers can be obtained by using polypeptides derived entirely from the transmembrane and cytoplasmic regions, pretreating with ⁇ -glycanase to remove glycosylation, or expressing the polypeptides in bacterial hosts.
  • V201 The interaction between V201 and its counter-structure enables screening for small molecules that interfere with the N201/N201 counter-structure association and inhibit activity of V201 or its counter-structure.
  • yeast two-hybrid system developed at SU ⁇ Y
  • V201 can be used to screen for inhibitors of V201 as follows.
  • V201 and its counter-structure, or portions thereof responsible for their interaction can be fused to the Gal4 DNA binding domain and Gal 4 transcriptional activation domain, respectively, and introduced into a strain that depends on Gal4 activity for growth on plates lacking histidine.
  • Compounds that prevent growth can be screened in order to identify IL-
  • the screen can be modified so that V201/V201 counter-structure interaction inhibits growth, so that inhibition of the interaction allows growth to occur.
  • Another, in vitro, approach to screening for V201 inhibition would be to immobilize one of the components (either N201 or its counter-structure) in wells of a microtiter plate, and to couple an easily detected indicator to the other component. An inhibitor of the interaction is identified by the absence of the detectable indicator from the well.
  • N201 polypeptides according to the invention are useful for the structure- based design of N201 inhibitor. Such a design would comprise the steps of determining the three-dimensional structure of such the N201 polypeptide, analyzing the three-dimensional structure for the likely binding sites of substrates, synthesizing a molecule that incorporates a predictive reactive site, and determining the inhibiting activity of the molecule.
  • Antibodies immunoreactive with N201 polypeptides and in particular, monoclonal antibodies against N201 polypeptides, are now made available through the invention. Such antibodies can be useful for inhibiting N201 polypeptide activity in vivo and for detecting the presence of V201 polypeptides in a sample.
  • N201 polypeptides refers to a genus of polypeptides that further encompasses proteins having the amino acid sequence 1-163 of SEQ ID ⁇ O:2, as well as those proteins having a high degree of similarity (at least 90% identity) with such amino acid sequences and which proteins are biologically active.
  • N201 polypeptides refers to the gene products of the nucleotides 1-492 of SEQ ID ⁇ O:l.
  • the isolated and purified V201 polypeptide according to the invention has a molecular weight of approximately 18,222 Daltons in the absence of glycosylation. It is understood that the molecular weight of V201 polypeptides can be varied by fusing additional peptide sequences to both the amino and carboxyl terminal ends of V201 polypeptides. Fusions of additional peptide sequences at the amino and carboxyl terminal ends of V201 polypeptides can be used to enhance expression of V201 polypeptides or aid in the purification of the protein.
  • V201 polypeptides will alter some, but usually not all, of the fragmented peptides of V201 polypeptides generated by enzymatic or chemical treatment.
  • mutations can be introduced into V201 polypeptides using routine and known techniques of molecular biology. It is further understood that a mutation can be designed so as to eliminate a site of proteolytic cleavage by a specific enzyme or a site of cleavage by a specific chemically induced fragmentation procedure. It is also understood that the elimination of the site will alter the peptide fingerprint of V201 polypeptides upon fragmentation with the specific enzyme or chemical procedure.
  • isolated and purified means that the V201 polypeptide molecular weight markers or fragments thereof are essentially free of association with other proteins or polypeptides, for example, as a purification product of recombinant host cell culture or as a purified product from a non-recombinant source.
  • substantially purified refers to a mixture that contains V201 polypeptide molecular weight markers or fragments thereof and is essentially free of association with other proteins or polypeptides, but for the presence of known proteins that can be removed using a specific antibody, and which substantially purified V201 polypeptides or fragments thereof can be used as molecular weight markers.
  • nucleotide sequence refers to a polynucleotide molecule in the form of a separate fragment or as a component of a larger nucleic acid construct, that has been derived from DNA or RNA isolated at least once in substantially pure form (i.e., free of contaminating endogenous materials) and in a quantity or concentration enabling identification, manipulation, and recovery of its component nucleotide sequences by standard biochemical methods (such as those outlined in Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1989)).
  • sequences are preferably provided in the form of an open reading frame uninterrupted by internal non-translated sequences, or introns, that are typically present in eukaryotic genes. Sequences of non-translated DNA can be present 5' or 3' from an open reading frame, where the same do not interfere with manipulation or expression of the coding region.
  • a V201 polypeptide "variant” as referred to herein means a polypeptide substantially homologous to native V201 polypeptides, but which has an amino acid sequence different from that of native N201 polypeptides (human, murine or other mammalian species) because of one or more deletions, insertions or substitutions.
  • the variant amino acid sequence preferably is at least 80% identical to a native N201 polypeptide amino acid sequence, most preferably at least 90% identical. The percent identity can be determined, for example, by comparing sequence information using the GAP computer program, version 6.0 described by Devereux et al. (Nucl.
  • the GAP program utilizes the alignment method of ⁇ eedleman and Wunsch (J. Mol. Biol. 48:443, 1970), as revised by Smith and Waterman (Adv. Appl. Math 2:482, 1981).
  • the preferred default parameters for the GAP program include: (1) a unary comparison matrix (containing a value of 1 for identities and 0 for non-identities) for nucleotides, and the weighted comparison matrix of Gribskov and Burgess, Nucl. Acids Res. 14:6745, 1986, as described by Schwartz and Dayhoff, eds., Atlas of Protein Sequence and Structure, National Biomedical Research Foundation, pp.
  • Variants can comprise conservatively substituted sequences, meaning that a given amino acid residue is replaced by a residue having similar physiochemical characteristics. Examples of conservative substitutions include substitution of one aliphatic residue for another, such as He, Nal, Leu, or Ala for one another, or substitutions of one polar residue for another, such as between Lys and Arg; Glu and Asp; or Gin and Asn. Other such conservative substitutions, for example, substitutions of entire regions having similar hydrophobicity characteristics, are well known. Naturally occurring N201 variants are also encompassed by the invention.
  • variants are proteins that result from alternate mR ⁇ A splicing events or from proteolytic cleavage of the V201 polypeptides.
  • Variations attributable to proteo lysis include, for example, differences in the N- or C-termini upon expression in different types of host cells, due to proteolytic removal of one or more terminal amino acids from the V201 polypeptides (generally from 1-5 terminal amino acids).
  • the invention provides isolated and purified, or homogeneous, V201 polypeptides, both recombinant and non-recombinant.
  • Variants and derivatives of native V201 polypeptides that can be used as molecular weight markers can be obtained by mutations of nucleotide sequences coding for native V201 polypeptides.
  • Alterations of the native amino acid sequence can be accomplished by any of a number of conventional methods. Mutations can be introduced at particular loci by synthesizing oligonucleotides containing a mutant sequence, flanked by restriction sites enabling ligation to fragments of the native sequence. Following ligation, the resulting reconstructed sequence encodes an analog having the desired amino acid insertion, substitution, or deletion.
  • oligonucleotide-directed site-specific mutagenesis procedures can be employed to provide an altered gene wherein predetermined codons can be altered by substitution, deletion or insertion.
  • Exemplary methods of making the alterations set forth above are disclosed by Walder et al. (Gene 42:133, 1986); Bauer et al. (Gene 37:73, 1985); Craik (BioTechniques, January 1985, 12-19); Smith et al. (Genetic Engineering: Principles and Methods, Plenum Press, 1981); Kunkel (Proc. Natl. Acad. Sci. USA 82:488, 1985); Kunkel et al. (Methods in Enzymol. 154:367, 1987); and U.S. Patent Nos. 4,518,584 and 4,737,462, all of which are incorporated by reference.
  • V201 polypeptides can be modified to create V201 polypeptide derivatives by forming covalent or aggregative conjugates with other chemical moieties, such as glycosyl groups, polyethylene glycol (PEG) groups, lipids, phosphate, acetyl groups and the like.
  • Covalent derivatives of V201 polypeptides can be prepared by linking the chemical moieties to functional groups on V201 polypeptide amino acid side chains or at the N-terminus or C-terminus of a V201 polypeptide or the extracellular domain thereof.
  • V201 polypeptides within the scope of this invention include covalent or aggregative conjugates of V201 polypeptides or peptide fragments with other proteins or polypeptides, such as by synthesis in recombinant culture as N-terminal or C-terminal fusions.
  • the conjugate can comprise a signal or leader polypeptide sequence (e.g. the ⁇ -factor leader of Saccharomyces) at the N-terminus of a V201 polypeptide.
  • the signal or leader peptide co-translationally or post- translationally directs transfer of the conjugate from its site of synthesis to a site inside or outside of the cell membrane or cell wall.
  • V201 polypeptide conjugates can comprise peptides added to facilitate purification and identification of V201 polypeptides.
  • peptides include, for example, poly-His or the antigenic identification peptides described in U.S. Patent No. 5,011,912 and in Hopp et al.,
  • the invention further includes V201 polypeptides with or without associated native- pattern glycosylation.
  • V201 polypeptides expressed in yeast or mammalian expression systems e.g., COS-1 or COS-7 cells
  • yeast or mammalian expression systems e.g., COS-1 or COS-7 cells
  • expression of V201 polypeptides in bacterial expression systems, such as E. coli provides non-glycosylated molecules. Glycosyl groups can be removed through conventional methods, in particular those utilizing glycopeptidase.
  • glycosylated V201 polypeptides can be incubated with a molar excess of glycopeptidase (Boehringer Mannheim).
  • N-glycosylation sites in the V201 polypeptide extracellular domain can be modified to preclude glycosylation, allowing expression of a reduced carbohydrate analog in mammalian and yeast expression systems.
  • N-glycosylation sites in eukaryotic polypeptides are characterized by an amino acid triplet Asn-X-Y, wherein X is any amino acid except Pro and Y is Ser or Thr.
  • nucleotide sequence encoding these triplets will result in prevention of attachment of carbohydrate residues at the Asn side chain.
  • Known procedures for inactivating N-glycosylation sites in proteins include those described in U.S. Patent 5,071,972 and EP 276,846, hereby incorporated by reference.
  • sequences encoding Cys residues that are not essential for biological activity can be altered to cause the Cys residues to be deleted or replaced with other amino acids, preventing formation of incorrect intramolecular disulfide bridges upon renaturation.
  • Other equivalents are prepared by modification of adjacent dibasic amino acid residues to enhance expression in yeast systems in which KEX2 protease activity is present.
  • EP 212,914 discloses the use of site-specific mutagenesis to inactivate KEX2 protease processing sites in a protein.
  • KEX2 protease processing sites are inactivated by deleting, adding, or substituting residues to alter Arg-Arg, Arg-Lys, and Lys-Arg pairs to eliminate the occurrence of these adjacent basic residues. Lys-Lys pairings are considerably less susceptible to KEX2 cleavage, and conversion of Arg-Lys or Lys-Arg to Lys-Lys represents a conservative and preferred approach to inactivating KEX2 sites.
  • the invention further encompasses isolated fragments and oligonucleotides derived from the nucleotide sequence of SEQ ID NO:l.
  • the invention also encompasses polypeptides encoded by these fragments and oligonucleotides.
  • Nucleic acid sequences within the scope of the invention include isolated DNA and RNA sequences that hybridize to the native V201 nucleotide sequences disclosed herein under conditions of moderate or severe stringency, and which encode V201 polypeptides. As used herein, conditions of moderate stringency, as known to those having ordinary skill in the art, and as defined by Sambrook et al. Molecular Cloning: A Laboratory Manual, 2 ed. Vol. 1, pp.
  • a DNA sequence can vary from that shown in SEQ ED NO: 1 and still encode a V201 polypeptide having the amino acid sequence of SEQ ID NO:2.
  • DNA sequences can result from silent mutations (e.g., occurring during PCR amplification), or can be the product of deliberate mutagenesis of a native sequence.
  • the invention thus provides equivalent isolated DNA sequences encoding V201 polypeptides, selected from: (a) DNA derived from the coding region of a native mammalian V201 gene; (b) cDNA comprising the nucleotide sequence 1 -492 of SEQ ID NO: 1 ; (c) DNA capable of hybridization to a DNA of (a) under conditions of moderate stringency and which encodes V201 polypeptides; and (d) DNA which is degenerate as a result of the genetic code to a DNA defined in (a), (b) or (c) and which encodes V201 polypeptides.
  • V201 polypeptides encoded by such DNA equivalent sequences are encompassed by the invention.
  • V201 polypeptides encoded by such DNA include, but are not limited to, V201 polypeptide fragments and V201 polypeptides comprising inactivated N-glycosylation site(s), inactivated protease processing site(s), or conservative amino acid substitution(s), as described above.
  • V201 polypeptides encoded by DNA derived from other mammalian species, wherein the DNA will hybridize to the complement of the DNA of SEQ ID NO:l are also encompassed.
  • V201 polypeptide-binding proteins such as the anti-V201 polypeptide antibodies of the invention, can be bound to a solid phase such as a column chromatography matrix or a similar substrate suitable for identifying, separating or purifying cells that express V201 polypeptides on their surface.
  • Adherence of V201 polypeptide-binding proteins to a solid phase contacting surface can be accomplished by any means, for example, magnetic microspheres can be coated with V201 polypeptide-binding proteins and held in the incubation vessel through a magnetic field. Suspensions of cell mixtures are contacted with the solid phase that has V201 polypeptide- binding proteins thereon.
  • V201 polypeptides bind to the fixed V201 polypeptide-binding protein and unbound cells then are washed away.
  • This affmity- binding method is useful for purifying, screening or separating such V201 polypeptide- expressing cells from solution.
  • Methods of releasing positively selected cells from the solid phase are known in the art and encompass, for example, the use of enzymes. Such enzymes are preferably non-toxic and non-injurious to the cells and are preferably directed to cleaving the cell-surface binding partner.
  • mixtures of cells suspected of containing V201 polypeptide-expressing cells first can be incubated with a biotinylated V201 polypeptide-binding protein.
  • Incubation periods are typically at least one hour in duration to ensure sufficient binding to V201 polypeptides.
  • the resulting mixture then is passed through a column packed with avidin-coated beads, whereby the high affinity of biotin for avidin provides the binding of the V201 polypeptide-binding cells to the beads.
  • avidin-coated beads is known in the art. See
  • V201 polypeptide-binding proteins are anti- V201 polypeptide antibodies, and other proteins that are capable of high-affinity binding of V201 polypeptides.
  • a preferred V201 polypeptide-binding protein is an anti-V201 polypeptide monoclonal antibody.
  • V201 polypeptides can exist as oligomers, such as covalently linked or non-covalently linked dimers or trimers. Oligomers can be linked by disulfide bonds formed between cysteine residues on different V201 polypeptides.
  • a V201 polypeptide dimer is created by fusing V201 polypeptides to the Fc region of an antibody (e.g., IgGl) in a manner that does not interfere with biological activity of V201 polypeptides.
  • the Fc polypeptide preferably is fused to the C-terminus of a soluble V201 polypeptide (comprising only the extracellular domain).
  • fusion proteins comprising heterologous polypeptides fused to various portions of antibody-derived polypeptides (including the Fc domain) has been described, e.g., by Ashkenazi et al. (PNAS USA 55:10535, 1991) and Byrn et al.
  • V201 polypeptide:Fc fusion protein A gene fusion encoding the V201 polypeptide:Fc fusion protein is inserted into an appropriate expression vector.
  • V201 polypeptide:Fc fusion proteins are allowed to assemble much like antibody molecules, whereupon interchain disulfide bonds form between Fc polypeptides, yielding divalent V201 polypeptides. If fusion proteins are made with both heavy and light chains of an antibody, it is possible to form a V201 polypeptide oligomer with as many as four V201 polypeptides extracellular regions. Alternatively, one can link two soluble V201 polypeptide domains with a peptide linker.
  • Recombinant expression vectors containing a nucleic acid sequence encoding V201 polypeptides can be prepared using well known methods.
  • the expression vectors include a V201 DNA sequence operably linked to suitable transcriptional or translational regulatory nucleotide sequences, such as those derived from a mammalian, microbial, viral, or insect gene.
  • suitable transcriptional or translational regulatory nucleotide sequences such as those derived from a mammalian, microbial, viral, or insect gene.
  • regulatory sequences include transcriptional promoters, operators, or enhancers, an mRNA ribosomal binding site, and appropriate sequences which control transcription and translation initiation and termination.
  • Nucleotide sequences are "operably linked" when the regulatory sequence functionally relates to the V201 DNA sequence.
  • a promoter nucleotide sequence is operably linked to a V201 DNA sequence if the promoter nucleotide sequence controls the transcription of the V201 DNA sequence.
  • the ability to replicate in the desired host cells, usually conferred by an origin of replication, and a selection gene by which transformants are identified can additionally be incorporated into the expression vector.
  • sequences encoding appropriate signal peptides that are not naturally associated with V201 polypeptides can be incorporated into expression vectors.
  • a DNA sequence for a signal peptide secretory leader
  • a signal peptide that is functional in the intended host cells enhances extracellular secretion of the V201 polypeptide.
  • the signal peptide can be cleaved from the V201 polypeptide upon secretion of V201 polypeptide from the cell.
  • Suitable host cells for expression of V201 polypeptides include prokaryotes, yeast or higher eukaryotic cells.
  • Prokaryotes include gram negative or gram positive organisms, for example, E. coli or Bacilli. Suitable prokaryotic host cells for transformation include, for example, E. coli, Bacillus subtilis, Salmonella typhimurium, and various other species within the genera Pseudomonas, Streptomyces, and Staphylococcus.
  • a V201 polypeptide can include an N-terminal methionine residue to facilitate expression of the recombinant polypeptide in the prokaryotic host cell. The N-terminal Met can be cleaved from the expressed recombinant V201 polypeptide.
  • Expression vectors for use in prokaryotic host cells generally comprise one or more phenotypic selectable marker genes.
  • a phenotypic selectable marker gene is, for example, a gene encoding a protein that confers antibiotic resistance or that supplies an autotrophic requirement.
  • useful expression vectors for prokaryotic host cells include those derived from commercially available plasmids such as the cloning vector pBR322 (ATCC 37017).
  • pBR322 contains genes for ampicillin and tetracycline resistance and thus provides simple means for identifying transformed cells.
  • an appropriate promoter and a V201 DNA sequence are inserted into the pBR322 vector.
  • vectors include, for example, pKK223-3 (Pharmacia Fine Chemicals, Uppsala, Sweden) and pGEMl (Promega Biotec, Madison, WI, USA).
  • Other commercially available vectors include those that are specifically designed for the expression of proteins; these would include pMAL-p2 and pMAL-c2 vectors that are used for the expression of proteins fused to maltose binding protein (New England Biolabs, Beverly, MA, USA).
  • Promoter sequences commonly used for recombinant prokaryotic host cell expression vectors include ⁇ -lactamase (penicillinase), lactose promoter system (Chang et al., Nature
  • a particularly useful prokaryotic host cell expression system employs a phage ⁇ P promoter and a cI857ts thermolabile repressor sequence. Plasmid vectors available from the American Type
  • Culture Collection which incorporate derivatives of the ⁇ P L promoter, include plasmid pHUB2 (resident in E. coli strain JMB9 (ATCC 37092)) and pPLc28 (resident in E. coli RR1 (ATCC 53082)).
  • V201 DNA may be cloned in-frame into the multiple cloning site of an ordinary bacterial expression vector.
  • the vector would contain an inducible promoter upstream of the cloning site, such that addition of an inducer leads to high-level production of the recombinant protein at a time of the investigator's choosing.
  • expression levels may be boosted by incorporation of codons encoding a fusion partner (such as hexahistidine) between the promoter and the gene of interest.
  • the resulting "expression plasmid" may be propagated in a variety of strains of E. coli.
  • the bacterial cells are propagated in growth medium until reaching a pre-determined optical density. Expression of the recombinant protein is then induced, e.g. by addition of IPTG (isopropyl-b-D-thiogalactopyranoside), which activates expression of proteins from plasmids containing a lac operator/promoter. After induction (typically for 1-4 hours), the cells are harvested by pelleting in a centrifuge, e.g. at 5,000 x G for IPTG (isopropyl-b-D-thiogalactopyranoside), which activates expression of proteins from plasmids containing a lac operator/promoter. After induction (typically for 1-4 hours), the cells are harvested by pelleting in a centrifuge, e.g. at 5,000 x G for
  • the pelleted cells may be resuspended in ten volumes of 50 mM Tris-HCl (pH 8)/l M NaCl and then passed two or three times through a French press. Most highly-expressed recombinant proteins form insoluble aggregates known as inclusion bodies. Inclusion bodies can be purified away from the soluble proteins by pelleting in a centrifuge at 5,000 x G for 20 minutes, 4°C. The inclusion body pellet is washed with 50 mM Tris-HCl (pH 8)/l% Triton X-100 and then dissolved in 50 mM Tris-HCl (pH 8)/8 M urea/ 0.1 M DTT.
  • the protein of interest will, in most cases, be the most abundant protein in the resulting clarified supernatant.
  • This protein may be "refolded" into the active conformation by dialysis against 50 mM Tris-HCl (pH 8)/5 mM CaCL/5 mM Zn(OAc) 2 /l mM GSSG/0.1 mM GSH.
  • purification can be carried out by a variety of chromatographic methods such as ion exchange or gel filtration. In some protocols, initial purification may be carried out before refolding.
  • hexahistidine-tagged fusion proteins may be partially purified on immobilized Nickel.
  • N201 polypeptides alternatively can be expressed in yeast host cells, preferably from the Saccharomyces genus (e.g., S. cerevisiae). Other genera of yeast, such as Pichia , K. lactis, or
  • yeast vectors will often contain an origin of replication sequence from a 2 ⁇ yeast plasmid, an autonomously replicating sequence (ARS), a promoter region, sequences for polyadenylation, sequences for transcription termination, and a selectable marker gene.
  • ARS autonomously replicating sequence
  • Suitable promoter sequences for yeast vectors include, among others, promoters for metallothionein, 3-phosphoglycerate kinase (Hitzeman et al., J. Biol. Chem. 255:2073, 1980), or other glycolytic enzymes (Hess et al., J. Adv. Enzyme Reg. 7:149, 1968; and Holland et al., Biochem.
  • enolase such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase, 3- phosphoglycerate mutase, pyruvate kinase, triosephosphate isomerase, phosphoglucose isomerase, and glucokinase.
  • suitable vectors and promoters for use in yeast expression are further described in Hitzeman, EPA-73,657 or in Fleer et. al, Gene, 107:285-195 (1991); and van den Berg et.
  • Shuttle vectors replicable in both yeast and E. coli can be constructed by inserting D ⁇ A sequences from pBR322 for selection and replication in E. coli (Amp r gene and origin of replication) into the above-described yeast vectors.
  • the yeast ⁇ -factor leader sequence can be employed to direct secretion of a V201 polypeptide.
  • the ⁇ -factor leader sequence is often inserted between the promoter sequence and the structural gene sequence. See, e.g., Kurjan et al, Cell 30:933, 1982; Bitter et al., Proc. Natl.
  • leader sequences suitable for facilitating secretion of recombinant polypeptides from yeast hosts are known to those of skill in the art.
  • a leader sequence can be modified near its 3' end to contain one or more restriction sites. This will facilitate fusion of the leader sequence to the structural gene.
  • Yeast transformation protocols are known to those of skill in the art.
  • One such protocol is described by Hinnen et al., Proc. Natl. Acad. Sci. USA 75:1929, 1978.
  • the Hinnen et al. protocol selects for Trp + transformants in a selective medium, wherein the selective medium consists of 0.67% yeast nitrogen base, 0.5% casamino acids, 2% glucose, 10 ⁇ g/ml adenine, and 20 g/ml uracil.
  • Yeast host cells transformed by vectors containing ADH2 promoter sequence can be grown for inducing expression in a "rich" medium.
  • a rich medium is one consisting of 1% yeast extract, 2% peptone, and 1% glucose supplemented with 80 ⁇ g/ml adenine and 80 ⁇ g/ml uracil. Derepression of the ADH2 promoter occurs when glucose is exhausted from the medium.
  • Mammalian or insect host cell culture systems could also be employed to express recombinant V201 polypeptides.
  • Baculovirus systems for production of heterologous proteins in insect cells are reviewed by Luckow and Summers, Bio/Technology 6:47 (1988). Established cell lines of mammalian origin also can be employed.
  • suitable mammalian host cell lines include the COS-7 line of monkey kidney cells (ATCC CRL 1651) (Gluzman et al., Cell 23:175, 1981), L cells, C127 cells, 3T3 cells (ATCC CCL 163), Chinese hamster ovary (CHO) cells, HeLa cells, and BHK (ATCC CRL 10) cell lines, and the CV-l/EBNA-1 cell line (ATCC CRL 10478) derived from the African green monkey kidney cell line CVI (ATCC CCL 70) as described by McMahan et al. (EMBO J. 10: 2821, 1991).
  • electroporation can be used to transfect mammalian cells using conventional procedures, such as those in Sambrook et al. Molecular Cloning: A Laboratory Manual, 2 ed. Vol. 1-3, Cold Spring Harbor Laboratory Press, 1989). Selection of stable transformants can be performed using resistance to cytotoxic drugs as a selection method. Kaufman et al., Meth. in Enzymology 755:487-511, 1990, describes several selection schemes, such as dihydrofolate reductase (DHFR) resistance.
  • a suitable host strain for DHFR selection can be CHO strain DX- B 11 , which is deficient in DHFR (Urlaub and Chasin, Proc. Natl. Acad. Sci. USA 77:42 X 6-4220,
  • a plasmid expressing the DHFR cDNA can be introduced into strain DX-B11, and only cells that contain the plasmid can grow in the appropriate selective media.
  • selectable markers include cDNAs conferring resistance to antibiotics, such as G418 and hygromycin B. Cells harboring the vector can be selected on the basis of resistance to these compounds.
  • Transcriptional and translational control sequences for mammalian host cell expression vectors can be excised from viral genomes.
  • Commonly used promoter sequences and enhancer sequences are derived from polyoma virus, adenovirus 2, simian virus 40 (SV40), and human cytomegalovirus.
  • DNA sequences derived from the SV40 viral genome for example, SV40 origin, early and late promoter, enhancer, splice, and polyadenylation sites can be used to provide other genetic elements for expression of a structural gene sequence in a mammalian host cell.
  • Viral early and late promoters are particularly useful because both are easily obtained from a viral genome as a fragment, which can also contain a viral origin of replication (Fiers et al., Nature 275:113, 1978; Kaufman, Meth. in Enzymology, 1990). Smaller or larger SV40 fragments can also be used, provided the approximately 250 bp sequence extending from the
  • Hind III site toward the Bgl I site located in the SV40 viral origin of replication site is included. Additional control sequences shown to improve expression of heterologous genes from mammalian expression vectors include such elements as the expression augmenting sequence element (EASE) derived from CHO cells (Morris et al., Animal Cell Technology, 1997, pp. 529- 534) and the tripartite leader (TPL) and VA gene RNAs from Adenovirus 2 (Gingeras et al., J.
  • EASE expression augmenting sequence element
  • TPL tripartite leader
  • VA gene RNAs from Adenovirus 2
  • Exemplary expression vectors that employ dicistronic mRNAs are pTR-DC/GFP described by Mosser et al, Biotechniques 22:150-161, 1997, and p2A5I described by Morris et al., Animal Cell Technology, 1997, pp. 529-534.
  • a useful high expression vector, pCAVNOT has been described by Mosley et al., Cell 59:335-348, 1989.
  • Other expression vectors for use in mammalian host cells can be constructed as disclosed by Okayama and Berg (Mol. Cell. Biol. 5:280, 1983).
  • a useful system for stable high level expression of mammalian cDNAs in C 127 murine mammary epithelial cells can be constructed substantially as described by Cosman et al. (Mol. Immunol. 25:935, 1986).
  • a useful high expression vector, PMLSV N1/N4 described by Cosman et al., Nature 572:768, 1984, has been deposited as ATCC 39890.
  • Additional useful mammalian expression vectors are described in EP-A-0367566, and in U.S. Patent Application Serial No. 07/701,415, filed May 16, 1991, incorporated by reference herein.
  • the vectors can be derived from retroviruses.
  • a heterologous signal sequence can be added, such as the signal sequence for IL-7 described in United States Patent 4,965,195; the signal sequence for IL-2 receptor described in Cosman et al., Nature 312:768 (1984); the IL-4 signal peptide described in EP 367,566; the type I IL-1 receptor signal peptide described in U.S. Patent 4,968,607; and the type
  • V201 polypeptide molecular weight marker can be produced by recombinant expression systems as described above or purified from naturally occurring cells.
  • V201 polypeptides can be substantially purified, as indicated by a single protein band upon analysis by SDS-polyacrylamide gel electrophoresis (SDS-PAGE).
  • One process for producing V201 polypeptides comprises culturing a host cell transformed with an expression vector comprising a DNA sequence that encodes a V201 polypeptide under conditions sufficient to promote expression of the V201 polypeptide.
  • V201 polypeptide is then recovered from culture medium or cell extracts, depending upon the expression system employed.
  • procedures for purifying a recombinant protein will vary according to such factors as the type of host cells employed and whether or not the recombinant protein is secreted into the culture medium.
  • the culture medium first can be concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit.
  • the concentrate can be applied to a purification matrix such as a gel filtration medium.
  • a purification matrix such as a gel filtration medium.
  • an anion exchange resin can be employed, for example, a matrix or substrate having pendant diethylaminoethyl (DEAE) groups.
  • the matrices can be acrylamide, agarose, dextran, cellulose or other types commonly employed in protein purification.
  • a cation exchange step can be employed. Suitable cation exchangers include various insoluble matrices comprising sulfopropyl or carboxymethyl groups. Sulfopropyl groups are preferred.
  • one or more reversed-phase high performance liquid chromatography (RP-HPLC) steps employing hydrophobic RP-HPLC media, (e.g., silica gel having pendant methyl or other aliphatic groups) can be employed to further purify V201 polypeptides.
  • RP-HPLC reversed-phase high performance liquid chromatography
  • Some or all of the foregoing purification steps, in various combinations, are well known and can be employed to provide an isolated and purified recombinant protein. It is possible to utilize an affinity column comprising a V201 polypeptide-binding protein, such as a monoclonal antibody generated against V201 polypeptides, to affinity-purify expressed V201 polypeptides.
  • V201 polypeptides can be removed from an affinity column using conventional techniques, e.g., in a high salt elution buffer and then dialyzed into a lower salt buffer for use or by changing pH or other components depending on the affinity matrix utilized.
  • Recombinant protein produced in bacterial culture is usually isolated by initial disruption of the host cells, centrifugation, extraction from cell pellets if an insoluble polypeptide, or from the supernatant fluid if a soluble polypeptide, followed by one or more concentration, salting-out, ion exchange, affinity purification or size exclusion chromatography steps. Finally, RP-HPLC can be employed for final purification steps.
  • Microbial cells can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents.
  • Transformed yeast host cells are preferably employed to express V201 polypeptides as a secreted polypeptide in order to simplify purification.
  • Secreted recombinant polypeptide from a yeast host cell fermentation can be purified by methods analogous to those disclosed by Urdal et al. (J. Chromatog. 29(5:171, 1984).
  • Urdal et al. describe two sequential, reversed-phase HPLC steps for purification of recombinant human IL-2 on a preparative HPLC column.
  • V201 polypeptide molecular weight markers can be analyzed by methods including sedimentation, gel electrophoresis, chromatography, and mass spectrometry. V201 polypeptides can serve as molecular weight markers using such analysis techniques to assist in the determination of the molecular weight of a sample protein. A molecular weight determination of the sample protein assists in the identification of the sample protein. V201 polypeptides can be subjected to fragmentation into peptides by chemical and enzymatic means. Chemical fragmentation includes the use of cyanogen bromide to cleave under neutral or acidic conditions such that specific cleavage occurs at methionine residues (E. Gross, Methods in Enz. 11 :238-255, 1967).
  • Enzymatic fragmentation includes the use of a protease such as Asparaginylendopeptidase, Arginylendopeptidase, Achrombobacter protease I, Trypsin, Staphlococcus aureus V8 protease, Endoproteinase Asp-N, or Endoproteinase Lys-C under conventional conditions to result in cleavage at specific amino acid residues.
  • Asparaginylendopeptidase can cleave specifically on the carboxyl side of the asparagine residues present within V201 polypeptides.
  • Arginylendopeptidase can cleave specifically on the carboxyl side of the arginine residues present within V201 polypeptides.
  • Achrombobacter protease I can cleave specifically on the carboxyl side of the lysine residues present within V201 polypeptides (Sakiyama and Nakat, U.S. Patent No. 5,248,599; T. Masaki et al., Biochim. Biophys. Acta 660:44-50, 1981; T. Masaki et al., Biochim. Biophys. Acta 660:51-55, 1981). Trypsin can cleave specifically on the carboxyl side of the arginine and lysine residues present within V201 polypeptides.
  • V8 protease can cleave specifically on the carboxyl side of the aspartic and glutamic acid residues present within V201 polypeptides (D. W. Cleveland, J. Biol. Chem. 3:1102-1106, 1977).
  • Endoproteinase Asp-N can cleave specifically on the amino side of the asparagine residues present within V201 polypeptides.
  • Endoproteinase Lys-C can cleave specifically on the carboxyl side of the lysine residues present within V201 polypeptides.
  • Other enzymatic and chemical treatments can likewise be used to specifically fragment V201 polypeptides into a unique set of specific peptide molecular weight markers.
  • the resultant fragmented peptides can be analyzed by methods including sedimentation, electrophoresis, chromatograpy, and mass spectrometry.
  • V201 polypeptides can serve as molecular weight markers using such analysis techniques to assist in the determination of the molecular weight of a sample protein. Such a molecular weight determination assists in the identification of the sample protein.
  • V201 fragmented peptide molecular weight markers are preferably between 10 and 162 amino acids in size. More preferably, V201 fragmented peptide molecular weight markers are between 10 and 100 amino acids in size. Even more preferable are V201 fragmented peptide molecular weight markers between 10 and 50 amino acids in size and especially between 10 and 35 amino acids in size. Most preferable are V201 fragmented peptide molecular weight markers between 10 and 20 amino acids in size.
  • V201 polypeptides into specific peptides can be used as a control for the extent of cleavage of a sample protein.
  • cleavage of the same amount of V201 polypeptide and sample protein under identical conditions can allow for a direct comparison of the extent of fragmentation.
  • Conditions that result in the complete fragmentation of V201 polypeptide can also result in complete fragmentation of the sample protein.
  • V201 polypeptides and fragmented peptides thereof possess unique charge characteristics and, therefore, can serve as specific markers to assist in the determination of the isoelectric point of a sample protein or fragmented peptide using techniques such as isoelectric focusing.
  • the technique of isoelectric focusing can be further combined with other techniques such as gel electrophoresis to simultaneously separate a protein on the basis of molecular weight and charge.
  • An example of such a combination is that of two-dimensional electrophoresis (T.D.
  • V201 polypeptides and fragmented peptides thereof can be used in such analyses as markers to assist in the determination of both the isoelectric point and molecular weight of a sample protein or fragmented peptide.
  • Kits to aid in the determination of apparent molecular weight and isoelectric point of a sample protein can be assembled from V201 polypeptides and peptide fragments thereof. Kits also serve to assess the degree of fragmentation of a sample protein.
  • the constituents of such kits can be varied, but typically contain V201 polypeptide and fragmented peptide molecular weight markers.
  • kits can contain V201 polypeptides wherein a site necessary for fragmentation has been removed.
  • the kits can contain reagents for the specific cleavage of V201 and the sample protein by chemical or enzymatic cleavage. Kits can further contain antibodies directed against V201 polypeptides or fragments thereof.
  • Antisense or sense oligonucleotides comprising a single-stranded nucleic acid sequence (either RNA or DNA) capable of binding to a target V201 mRNA sequence (forming a duplex) or to the V201 sequence in the double-stranded DNA helix (forming a triple helix) can be made according to the invention.
  • Antisense or sense oligonucleotides, according to the present invention comprise a fragment of the coding region of V201 cDNA (SEQ ID NO:l). Such a fragment generally comprises at least about 14 nucleotides, preferably from about 14 to about 30 nucleotides.
  • binding of antisense or sense oligonucleotides to target nucleic acid sequences results in the formation of complexes that block translation (RNA) or transcription (DNA) by one of several means, including enhanced degradation of the duplexes, premature termination of transcription or translation, or by other means.
  • the antisense oligonucleotides thus can be used to block expression of V201 polypeptides.
  • Antisense or sense oligonucleotides further comprise oligonucleotides having modified sugar-phosphodiester backbones (or other sugar linkages, such as those described in WO91/06629) and wherein such sugar linkages are resistant to endogenous nucleases.
  • Such oligonucleotides with resistant sugar linkages are stable in vivo (i.e., capable of resisting enzymatic degradation), but retain sequence specificity to be able to bind to target nucleotide sequences.
  • Other examples of sense or antisense oligonucleotides include those oligonucleotides that are covalently linked to organic moieties, such as those described in WO
  • intercalating agents such as ellipticine, and alkylating agents or metal complexes can be attached to sense or antisense oligonucleotides to modify binding specificities of the antisense or sense oligonucleotide for the target nucleotide sequence.
  • Antisense or sense oligonucleotides can be introduced into a cell containing the target nucleic acid sequence by any gene transfer method, including, for example, CaPO 4 -mediated DNA transfection, electroporation, or by using gene transfer vectors such as Epstein-Barr virus.
  • Antisense or sense oligonucleotides are preferably introduced into a cell containing the target nucleic acid sequence by insertion of the antisense or sense oligonucleotide into a suitable retroviral vector, then contacting the cell with the retrovirus vector containing the inserted sequence, either in vivo or ex vivo.
  • Suitable retroviral vectors include, but are not limited to, the murine retrovirus M-MuLV, N2 (a retrovirus derived from M-MuLV), or the double copy vectors designated DCT5A, DCT5B and DCT5C (see PCT Application US 90/02656).
  • Sense or antisense oligonucleotides also can be introduced into a cell containing the target nucleotide sequence by formation of a conjugate with a ligand binding molecule, as described in WO 91/04753.
  • Suitable ligand binding molecules include, but are not limited to, cell surface receptors, growth factors, other cytokines, or other ligands that bind to cell surface receptors.
  • conjugation of the ligand binding molecule does not substantially interfere with the ability of the ligand binding molecule to bind to its corresponding molecule or receptor, or block entry of the sense or antisense oligonucleotide or its conjugated version into the cell.
  • a sense or an antisense oligonucleotide can be introduced into a cell containing the target nucleic acid sequence by formation of an oligonucleotide-lipid complex, as described in WO 90/10448.
  • the sense or antisense oligonucleotide-lipid complex is preferably dissociated within the cell by an endogenous lipase.
  • V201 polypeptides or a fragment thereof can also be useful itself as a therapeutic agent in inhibiting IL-1 and TNF signaling.
  • V201 polypeptides are introduced into the intracellular environment by well-known means, such as by encasing the protein in liposomes or coupling it to a monoclonal antibody targeted to a specific cell type.
  • V201 DNA, V201 polypeptides, and antibodies against V201 polypeptides can be used as reagents in a variety of research protocols.
  • a sample of such research protocols are given in Sambrook et al. Molecular Cloning: A Laboratory Manual, 2 ed. Vol. 1-3, Cold Spring Harbor
  • V201 DNA can be used to determine the chromosomal location of V201 DNA and to map genes in relation to this chromosomal location. V201 DNA can also be used to examine genetic heterogeneity and heredity through the use of techniques such as genetic fingerprinting, as well as to identify risks associated with genetic disorders. V201 DNA can be further used to identify additional genes related to V201 DNA and to establish evolutionary trees based on the comparison of sequences. V201 DNA and polypeptides can be used to select for those genes or proteins that are homologous to V201 DNA or polypeptides, through positive screening procedures such as
  • V201 polypeptides can also be used as a reagent to identify (a) any protein that V201 polypeptide regulates, and (b) other proteins with which it might interact.
  • V201 polypeptides could be used by coupling recombinant protein to an affinity matrix, or by using them as a bait in the 2-hybrid system.
  • V201 polypeptides and fragments thereof can be used as reagents in the study of the IL-1 signaling pathway as a reagent to block IL-1 signaling.
  • V201 polypeptides can be formulated into pharmaceutical compositions according to known methods.
  • V201 polypeptides can be combined in admixture, either as the sole active material or with other known active materials, with pharmaceutically suitable diluents (e.g., Tris-HCl, acetate, phosphate), preservatives (e.g., Thimerosal, benzyl alcohol, parabens), emulsifiers, solubilizers, adjuvants and/or carriers.
  • diluents e.g., Tris-HCl, acetate, phosphate
  • preservatives e.g., Thimerosal, benzyl alcohol, parabens
  • emulsifiers e.g., solubilizers, adjuvants and/or carriers.
  • compositions can contain V201 polypeptides complexed with polyethylene glycol (PEG), metal ions, or incorporated into polymeric compounds such as polyacetic acid, polyglycolic acid, hydrogels, etc., or incorporated into liposomes, microemulsions, micelles, unilamellar or multilamellar vesicles, erythrocyte ghosts or spheroblasts.
  • PEG polyethylene glycol
  • metal ions or incorporated into polymeric compounds such as polyacetic acid, polyglycolic acid, hydrogels, etc.
  • liposomes such as polyacetic acid, polyglycolic acid, hydrogels, etc.
  • Such compositions will influence the physical state, solubility, stability, rate of in vivo release, and rate of in vivo clearance of V201 polypeptides.
  • V201 polypeptides and peptides based on the amino acid sequence of V201, can be utilized to prepare antibodies that specifically bind to V201 polypeptides.
  • the term "antibodies” is meant to include polyclonal antibodies, monoclonal antibodies, fragments thereof such as F(ab')2, and Fab fragments, as well as any recombinantly produced binding partners. Antibodies are defined to be specifically binding if they bind V201 polypeptides with a K ⁇ of greater than or equal to about 10 7 M "1 . Affinities of binding partners or antibodies can be readily determined using conventional techniques, for example those described by Scatchard et al., Ann. N Y Acad. Sci., 57:660 (1949).
  • Polyclonal antibodies can be readily generated from a variety of sources, for example, horses, cows, goats, sheep, dogs, chickens, rabbits, mice, or rats, using procedures that are well- known in the art.
  • purified N201 polypeptides, or a peptide based on the amino acid sequence of N201 polypeptides that is appropriately conjugated is administered to the host animal typically through parenteral injection.
  • the immunogenicity of N201 polypeptides can be enhanced through the use of an adjuvant, for example, Freund's complete or incomplete adjuvant.
  • small samples of serum are collected and tested for reactivity to N201 polypeptides. Examples of various assays useful for such determination include those described in: Antibodies: A Laboratory Manual, Harlow and Lane (eds.), Cold Spring Harbor Laboratory Press, 1988; as well as procedures such as countercurrent immuno-electrophoresis
  • the host animals such as mice are injected intraperitoneally at least once, and preferably at least twice at about 3 week intervals with isolated and purified N201 polypeptides or conjugated N201 polypeptides, optionally in the presence of adjuvant.
  • Mouse sera are then assayed by conventional dot blot technique or antibody capture (ABC) to determine which animal is best to fuse.
  • ABSC antibody capture
  • the mice are given an intravenous boost of V201 polypeptides or conjugated V201 polypeptides.
  • Mice are later sacrificed and spleen cells fused with commercially available myeloma cells, such as Ag8.653 (ATCC), following established protocols.
  • ATCC Ag8.653
  • the myeloma cells are washed several times in media and fused to mouse spleen cells at a ratio of about three spleen cells to one myeloma cell.
  • the fusing agent can be any suitable agent used in the art, for example, polyethylene glycol (PEG). Fusion is plated out into plates containing media that allows for the selective growth of the fused cells. The fused cells can then be allowed to grow for approximately eight days. Supernatants from resultant hybridomas are collected and added to a plate that is first coated with goat anti-mouse Ig. Following washes, a label, such as, 125 I-V201 polypeptides is added to each well followed by incubation. Positive wells can be subsequently detected by autoradiography. Positive clones can be grown in bulk culture and supernatants are subsequently purified over a Protein A column (Pharmacia).
  • the monoclonal antibodies of the invention can be produced using alternative techniques, such as those described by Alting-Mees et al., "Monoclonal Antibody Expression Libraries: A Rapid Alternative to Hybridomas", Strategies in Molecular Biology 5:1-9 (1990), which is incorporated herein by reference.
  • binding partners can be constructed using recombinant D ⁇ A techniques to incorporate the variable regions of a gene that encodes a specific binding antibody. Such a technique is described in Larrick et al., Biotechnology, 7:394 (1989).
  • antibodies that have been engineered to contain elements of human antibodies that are capable of specifically binding V201 polypeptides are also encompassed by the invention.
  • the antibodies against V201 polypeptides can be used to detect the presence of V201 polypeptides in a sample using established assay protocols.
  • the antibodies of the invention can be used therapeutically to bind to V201 polypeptides and inhibit its activity in vivo.
  • the purified V201 polypeptides according to the invention will facilitate the discovery of inhibitors of V201 polypeptides.
  • the use of a purified V201 polypeptide in the screening of potential inhibitors thereof is important and can eliminate or reduce the possibility of interfering reactions with contaminants.
  • V201 polypeptides can be used for structure-based design of V201 polypeptide-inhibitors. Such structure-based design is also known as "rational drug design.”
  • the V201 polypeptides can be three-dimensionally analyzed by, for example, X-ray crystallography, nuclear magnetic resonance or homology modeling, all of which are well-known methods.
  • the use of V201 polypeptide structural information in molecular modeling software systems to assist in inhibitor design and inhibitor- V201 polypeptide interaction is also encompassed by the invention.
  • Such computer-assisted modeling and drug design can utilize information such as chemical conformational analysis, electrostatic potential of the molecules, protein folding, etc.
  • a particular method of the invention comprises analyzing the three dimensional structure of V201 polypeptides for likely binding sites of substrates, synthesizing a new molecule that incorporates a predictive reactive site, and assaying the new molecule as described above.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Biochemistry (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Immunology (AREA)
  • Biophysics (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Cell Biology (AREA)
  • Peptides Or Proteins (AREA)
PCT/US1998/027626 1997-12-24 1998-12-23 V201 dna and polypeptides WO1999033983A1 (en)

Priority Applications (5)

Application Number Priority Date Filing Date Title
JP2000526639A JP2002500011A (ja) 1997-12-24 1998-12-23 V201dna及びポリペプチド
CA002315879A CA2315879A1 (en) 1997-12-24 1998-12-23 V201 dna and polypeptides
IL13669598A IL136695A0 (en) 1997-12-24 1998-12-23 V201 dna and polypeptides
AU20157/99A AU2015799A (en) 1997-12-24 1998-12-23 V201 dna and polypeptides
EP98964943A EP1042473A1 (en) 1997-12-24 1998-12-23 V201 dna and polypeptides

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US6873997P 1997-12-24 1997-12-24
US60/068,739 1997-12-24

Publications (1)

Publication Number Publication Date
WO1999033983A1 true WO1999033983A1 (en) 1999-07-08

Family

ID=22084415

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US1998/027626 WO1999033983A1 (en) 1997-12-24 1998-12-23 V201 dna and polypeptides

Country Status (6)

Country Link
EP (1) EP1042473A1 (ja)
JP (1) JP2002500011A (ja)
AU (1) AU2015799A (ja)
CA (1) CA2315879A1 (ja)
IL (1) IL136695A0 (ja)
WO (1) WO1999033983A1 (ja)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1241251A2 (en) * 1998-04-23 2002-09-18 Genentech, Inc. Human prostasin-like protein and nucleic acids encoding the same
US7524665B2 (en) * 2003-09-23 2009-04-28 University Of North Carolina At Chapel Hill Methods and compositions for vitamin K epoxide reductase
US7645602B2 (en) 2003-09-23 2010-01-12 The University Of North Carolina At Chapel Hill Methods and compositions for producing vitamin K dependent proteins
US7842477B2 (en) 2003-10-14 2010-11-30 Astrazeneca Ab Methods for producing gamma-carboxylated proteins
US7989193B2 (en) 2005-04-13 2011-08-02 Medimmune Limited Compositions and methods for producing gamma-carboxylated proteins
US8206967B2 (en) 2007-07-06 2012-06-26 Medimmune Limited Method for production of recombinant human thrombin
US9631002B2 (en) 2010-12-21 2017-04-25 The University Of North Carolina At Chapel Hill Methods and compositions for producing active vitamin K-dependent proteins

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
HILLIER L ET AL: "Homo sapiens cDNA clone 729538", EMEST DATABASE ENTRY HS1198456, ACCESSION NUMBER AA398056, 28 April 1997 (1997-04-28), XP002101494 *
NATIONAL CANCER INSTITUTE, CANCER GENOME ANATOMY PROJECT (CGAP): "Homo sapiens cDNA clone IMAGE:1117474", EMEST DATABASE ENTRY AA643840, ACCESSION NUMBER AA643840, 1 November 1997 (1997-11-01), XP002101495 *

Cited By (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1241251A2 (en) * 1998-04-23 2002-09-18 Genentech, Inc. Human prostasin-like protein and nucleic acids encoding the same
EP1241251A3 (en) * 1998-04-23 2003-03-19 Genentech, Inc. Human prostasin-like protein and nucleic acids encoding the same
US8426128B2 (en) 2003-09-23 2013-04-23 The University Of North Carolina At Chapel Hill Methods and compositions for vitamin K epoxide reductase
US7524665B2 (en) * 2003-09-23 2009-04-28 University Of North Carolina At Chapel Hill Methods and compositions for vitamin K epoxide reductase
US7687233B2 (en) 2003-09-23 2010-03-30 The University Of North Carolina At Chapel Hill Methods and compositions for the correlation of single nucleotide polymorphisms in the vitamin K epoxide reductase gene and warfarin dosage
AU2004275828B2 (en) * 2003-09-23 2010-04-29 University Of North Carolina At Chapel Hill Methods and compositions for the correlation of single nucleotide polymorphisms in the vitamin K epoxide reductase gene and warfarin dosage
US9441208B2 (en) 2003-09-23 2016-09-13 The University Of North Carolina At Chapel Hill Methods and compositions for producing vitamin K dependent proteins
US7858318B2 (en) 2003-09-23 2010-12-28 The University Of North Carolina At Chapel Hill Methods and compositions for vitamin K epoxide reductase
US7645602B2 (en) 2003-09-23 2010-01-12 The University Of North Carolina At Chapel Hill Methods and compositions for producing vitamin K dependent proteins
US8097410B2 (en) 2003-09-23 2012-01-17 University Of North Carolina At Chapel Hill Methods and compositions for vitamin K epoxide reductase
US8697440B2 (en) 2003-10-14 2014-04-15 Medimmune Limited Compositions and methods for producing gamma-carboxylated proteins
US7842477B2 (en) 2003-10-14 2010-11-30 Astrazeneca Ab Methods for producing gamma-carboxylated proteins
US8603823B2 (en) 2005-03-15 2013-12-10 The University Of North Carolina At Chapel Hill Methods and compositions for producing vitamin K dependent proteins
US9828588B2 (en) 2005-03-15 2017-11-28 The University Of North Carolina At Chapel Hill Methods and compositions for producing active vitamin K-dependent proteins
US8304224B2 (en) 2005-04-13 2012-11-06 Medimmune Limited Compositions and methods relating to proteins requiring gamma-carboxylation
US7989193B2 (en) 2005-04-13 2011-08-02 Medimmune Limited Compositions and methods for producing gamma-carboxylated proteins
US8206967B2 (en) 2007-07-06 2012-06-26 Medimmune Limited Method for production of recombinant human thrombin
US9631002B2 (en) 2010-12-21 2017-04-25 The University Of North Carolina At Chapel Hill Methods and compositions for producing active vitamin K-dependent proteins

Also Published As

Publication number Publication date
IL136695A0 (en) 2001-06-14
CA2315879A1 (en) 1999-07-08
AU2015799A (en) 1999-07-19
EP1042473A1 (en) 2000-10-11
JP2002500011A (ja) 2002-01-08

Similar Documents

Publication Publication Date Title
US20050233355A1 (en) Human cDNAs encoding polypeptides having kinase functions
WO1999035267A1 (en) Human and murine il-17d, cytokine related to interleukin-17: dna and polypeptides
CA2317918A1 (en) Il-1 delta dna and polypeptides
EP1045905A2 (en) Il-17rh dna and polypeptides
WO1999033983A1 (en) V201 dna and polypeptides
US20090017492A1 (en) SVPH1-26 DNA and polypeptides
EP1045914B1 (en) Testis-specific human svph1-8 proteinase
AU745623B2 (en) V196 DNA and polypeptides
EP1105485B1 (en) Human il-1 epsilon dna and polypeptides
US20030045683A1 (en) H14 DNA and polypeptides
US7217553B2 (en) Nucleic acids encoding human adamalysin SVPH1-8
WO2000008178A2 (en) Murine dna molecules encoding polypeptides having kinase functions
WO1999033984A1 (en) V197 dna and polypeptides

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 136695

Country of ref document: IL

AK Designated states

Kind code of ref document: A1

Designated state(s): AL AM AT AU AZ BA BB BG BR BY CA CH CN CU CZ DE DK EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT UA UG US UZ VN YU ZW

AL Designated countries for regional patents

Kind code of ref document: A1

Designated state(s): GH GM KE LS MW SD SZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
DFPE Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
REG Reference to national code

Ref country code: DE

Ref legal event code: 8642

ENP Entry into the national phase

Ref document number: 2315879

Country of ref document: CA

Ref country code: CA

Ref document number: 2315879

Kind code of ref document: A

Format of ref document f/p: F

ENP Entry into the national phase

Ref country code: JP

Ref document number: 2000 526639

Kind code of ref document: A

Format of ref document f/p: F

WWE Wipo information: entry into national phase

Ref document number: 09602255

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: KR

WWE Wipo information: entry into national phase

Ref document number: 20157/99

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 505713

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: 1998964943

Country of ref document: EP

WWP Wipo information: published in national office

Ref document number: 1998964943

Country of ref document: EP

WWW Wipo information: withdrawn in national office

Ref document number: 1998964943

Country of ref document: EP