WO1999027126A1 - ribG - Google Patents

Abstract

The invention provides ribG polypeptides and polynucleotides encoding ribG polypeptides and methods for producing such polypeptides by recombinant techniques. Also provided are methods for utilizing ribG polypeptides to screen for antibacterial compounds.

Description

ribG

RELATED APPLICATIONS

This application claims benefit to US Patent Application Number 08/979,616 filed

November 25, 1997

FIELD OF THE INVENTION

This invention relates to newly identified polynucleotides and polypeptides. and their production and uses, as well as their vanants, agonists and antagonists, and their uses In particular, the invention relates to novel polynucleotides and polypeptides of the nboflavin-specific deammase family, hereinafter referred to as "nbG"

BACKGROUND OF THE INVENTION

The Streptococci make up a medically important genera of microbes known to cause several types of disease in humans, including, for example, otitis media, conjunctivitis, pneumonia, bacteremia, meningitis, sinusitis, pleural empyema and endocarditis, and most particularly meningitis, such as for example infection of cerebrospinal fluid Since its isolation more than 100 years ago. Streptococcus pneumomae has been one of the more intensively studied microbes For example, much of our early understanding that DNA is, in fact, the genetic matenal was predicated on the work of Griffith and of Avery, Macleod and McCarty usmg this microbe Despite the vast amount of research with S pneumomae, many questions concerning the virulence of this microbe remain It is particularly preferred to employ Streptococcal genes and gene products as targets for the development of antibiotics

Riboflavm (vitamin B2) is a member of the B complex of vitamins which function as coenzymes in metabolic reactions Riboflavm has two coenzyme forms, flavm mononucleotide (FMN) and flavm adenme dinucleotide (FAD) which act m oxidation-reduction reactions such as the cytochrome system of electron transport and the oxidative degradation of pyruvate, fatty acids and ammo acids The first committed step in the biosynthesis of nboflavm is the opemng of the imidazole ring of GTP In the presence of 3 H2O and Mg⁺⁺, the C-8 carbon of GTP is released as formate accompanied by the release of pyrophosphate by the action of GTP cyclohyrolase II (GCH2, EC 3 5 4 25) This enzyme function is encoded by nbA m bacteria and nbl m yeast species Through a series of steps, involving 3,4-dιhydroxy-2-butanone 4 phosphate synthase (nbA), 6,7-dιmethyl-8-nbιtyllumazιne synthase (ribH), nboflavm synthase (ribB), pyπmidme deammase and pynmidme reductase (nbG), enzymes encoded b> genes withm the nboflavm biosynthesis operon, nboflavm is formed Because the genes required for nboflavm biosynthesis are present in many pathogenic microorganisms, and since riboflavm biosynthesis has shown to be required for virulence in the swine pathogen Actinobacillus pleuropneumomae (Fuller, TE, et al (1996) A riboflavm auxotroph of Actinobacillus pleuropneumomae is attenuated in swme Infect Immun 64 4659-4664), these gene products represent broad spectrum antibacterial as well as antifungal targets

The frequency of Streptococcus pneumomae infections has nsen dramatically m the past few decades This has been attributed to the emergence of multiply antibiotic resistant strains and an increasing population of people with weakened immune systems It is no longer uncommon to isolate Streptococcus pneumomae strains which are resistant to some or all of the standard antibiotics This phenomenon has created a demand for both new anti-microbial agents, vaccmes, and diagnostic tests for this organism

Clearly, there exists a need for factors, such as the nbG embodiments of the invention, that have a present benefit of being useful to screen compounds for antibiotic activity Such factors are also useful to determine their role in pathogenesis of infection, dysfunction and disease There is also a need for identification and characterization of such factors and their antagomsts and agomsts to find ways to prevent, ameliorate or conect such infection, dysfunction and disease

Certain of the polypeptides of the invention possess ammo acid sequence homology to a known Actinobacillus pleuropneumomae nbG protein

SUMMARY OF THE INVENTION

It is an object of the mvention to provide polypeptides that have been identified as novel nbG polypeptides by homology between the ammo acid sequence set out in Table 1 [SEQ ID NO 2 or 4] and a known ammo acid sequence or sequences of other protems such as Actinobacillus pleuropneumomae nbG protem (GenBank Accession no U27202, GenBank Accession no U27202) It is a further object of the invention to provide polynucleotides that encode nbG polypeptides, particularly polynucleotides that encode the polypeptide herem designated nbG

In a particularly prefened embodiment of the mvention the polynucleotide compnses a region encodmg nbG polypeptides compnsmg a sequence set out m Table 1 [SEQ ID NO 1 or 3] which mcludes a full length gene, or a variant thereof

In another particularly preferred embodiment of the invention there is a novel nbG protem from Streptococcus pneumomae compnsmg the ammo acid sequence of Table 1 [SEQ ID NO 2 or 4], or a variant thereof

In accordance with another aspect of the mvention there is provided an isolated nucleic acid molecule encodmg a mature polypeptide expressible by the Streptococcus pneumomae 0100993 strain, which nucleic acid is contained in the deposited strain

A further aspect of the mvention there are provided isolated nucleic acid molecules encodmg nbG. particularly Streptococcus pneumomae nbG. including mRNAs, cDNAs, genomic DNAs Further embodiments of the mvention mclude biologically, diagnostically, prophylactically. clinically or therapeutically useful vanants thereof, and compositions compnsmg the same

In accordance with another aspect of the invention, there is provided the use of a polynucleotide of the invention for therapeutic or prophylactic purposes, in particular genetic immunization Among the particularly prefened embodiments of the mvention are naturally occurring allelic vanants of nbG and polypeptides encoded thereby Another aspect of the mvention there are provided novel polypeptides of Streptococcus pneumomae referred to herem as nbG as well as biologically, diagnostically, prophylactically. clinically or therapeutically useful vanants thereof, and compositions compnsmg the same

Among the particularly prefened embodiments of the mvention are vanants of nbG polypeptide encoded by naturally occurring alleles of the nbG gene In a prefened embodiment of the mvention there are provided methods for producmg the aforementioned nbG polypeptides

In accordance with yet another aspect of the mvention, there are provided inhibitors to such polypeptides. useful as antibacterial agents, including, for example, antibodies

In accordance with certain prefened embodiments of the mvention, there are provided products, compositions and methods for assessmg nbG expression, treatmg disease, assaying genetic vanation, and administering a nbG polypeptide or polynucleotide to an organism to raise an lmmunological response agamst a bactena, especially a Streptococcus pneumomae bactena In accordance with certain prefened embodiments of this and other aspects of the mvention there are provided polynucleotides that hybndize to nbG polynucleotide sequences, particularly under stringent conditions

In certain prefened embodiments of the mvention there are provided antibodies against nbG polypeptides

In other embodiments of the mvention there are provided methods for identifying compounds which bind to or otherwise interact with and inhibit or activate an activity of a polypeptide or polynucleotide of the mvention compnsmg contacting a polypeptide or polynucleotide of the mvention with a compound to be screened under conditions to permit bmdmg to or other mteraction between the compound and the polypeptide or polynucleotide to assess the bmdmg to or other mteraction with the compound, such bmdmg or mteraction being associated with a second component capable of providing a detectable signal m response to the bmdmg or mteraction of the polypeptide or polynucleotide with the compound, and determining whether the compound bmds to or otherwise interacts with and activates or inhibits an activity of the polypeptide or polynucleotide by detectmg the presence or absence of a signal generated from the bmdmg or mteraction of the compound with the polypeptide or polynucleotide

In accordance with yet another aspect of the mvention, there are provided nbG agomsts and antagomsts, preferably bactenostatic or bactenocidal agomsts and antagomsts

In a further aspect of the mvention there are provided compositions compnsmg a nbG polynucleotide or a nbG polypeptide for administration to a cell or to a multicellular organism

Vanous changes and modifications within the spmt and scope of the disclosed mvention will become readil) apparent to those skilled m the art from reading the following descnptions and from reading the other parts of the present disclosure

DESCRIPTION OF THE INVENTION

The mvention relates to novel nbG polypeptides and polynucleotides as descnbed m greater detail below In particular, the mvention relates to polypeptides and polynucleotides of a novel nbG of Streptococcus pneumomae, which is related by ammo acid sequence homology to Actinobacillus pleuropneumomae nbG polypeptide The mvention relates especially to nbG havmg the nucleotide and ammo acid sequences set out in Table 1 as SEQ ID NO 1 and SEQ ID NO 2 respectivelynbG TABLE 1 ribG Polynucleotide and Polypeptide Sequences

(A) Sequences from Streptococcus pneumoniae ribG polynucleotide sequence [SEQ ID NO:l].

5 ' -

ATGAGCGATTCAAAATATATGAAATTAGCAATAAAACTGGCACAAAAAGGGGCTGGTTACGTCAATCCC AATCCTATGGTTGGCGCAATTATTGTAAAAGATAATCACATTATCGGACAAGGTTATCATGAGTTTTTT GGTGGCCCACATGCTGAGAGAAATGCTCTTAAAAACTGTAGAAAATCCCCTGTCGGAGCGACGCTTTAT GTAACACTTGAACCCTGTTGTCACTTCGGGAAAACACCTCCCTGTATAGATGCTATAATCGATAGTGGT A TACAAGAGTAGTCATTGGAAGCCTAGACTGTAATCCTATTGTATCTGGAAAAGGAGTAAAGATACTT GAGGAAAATAATCTTCAAGTTACTGTTGGAATTTTAGAAAATGAGTGTCTTAACTTAATAAAAAGTTTT AGAAAGTATATTACCCAGCATGTACCCTATGTTTTTATGAAATATGCAATGTCAATGGATGGAAAAATA GCCACTAAAACAAATCAATCCAAATGGATTACTGAAGAAGAAGCAAGAAAGCATGTGCATCAGTTACGA CACTATGTTAGTGCAATTATGGTGGGAGTCAATACTGTTATTCAAGACGATCCTTTGCTGACATGTAGA TTGGAGGAAGGGAAAAATCCTATCCGTATCATATGCGATACACATTTACGAACTCCTCTTACCTCTAAA ATCGTAAAAACAGCAAATGATATTAAAACTTACATTGCCACTTCCTCTGAAGACAAAAATAAAATGAAG CTATATCAAAATCATGGCTGTGAAATACTTTCCATAAAGAAAAAAGGCAATCATATAGACTTATCGAGT TTAATGCAACAT CTAGGAAACATGCAGATTGATAGCCTAGTTCTAGAGGGGGGCAGTCTAATGAATTGGAGTGCTTTGGAA CAACAAATTGTTGATGAGCTGAAAATATATATTGCACCAAAAATTTTTGGAGGCAGTGCCAAGTTTCCT GTCGGAGGTGAAGGCATTTCTTTGCCAAATGACGCTATTAGATTGAAACCTTATGCTTTTTCTCAAATA GGAAATGACTATCTCATAGAAAGTGAAGTGATTTATCCATGTTCACAGGAATAA-3 '

(B) Streptococcus pneumomae ribG polypeptide sequence deduced from the polynucleotide sequence in this table [SEQ ID NO:2].

NH₂-

MS DS KYMK AI KLAQKGAGYVNPNPMVGAI I VKDNHI I GQGYHEFFGGPHAERNALKNCRKS PVGATLY

V LEPCCHFGKTPPCIDAI IDSGITRWIGSLDCNPIVSGKGVKILEENNLQVTVGI LENECLNLIKSF

RKYITQHVPYVFMKYi MSMDGKIATKTNQSKWITEEEARKH\ QLRHYVSAIMVGVNTVIQDDPLLTCR

LEEGKNPIRI I CDTHLRTPLTSKIVKTANDIKTYIATS SEDKNKMKLYQNHGCEILS IKKKGNHIDLS S

LMQHLGNMQIDSLVLEGGSLMN SALEQQIVDELKIYIAPKI FGGSAKFPYGGEGI SLPNDAIRLKPYA

FSQI GNDYLI ESEVIYPCSQE-COOH

(C) Polynucleotide sequences comprising Streptococcus pneumomae ribG ORF sequence

[SEQ ID NO:3]

5'- TGGGAGTCAATACTGTTATTCAAGACGATCCTTTGCTGACATGTAGATTGGAGGAAGGGGAAAATCCTA TCCGTATCATATGCGATACACATTTACGAACTCCTCTTACCTCTAAAATCGTAAAAACAGCAAATGATA TTAAAACTTACATTGCCACTTCCTCTGAAGACAAAAATAAAATGAAGCTATATCAAAATCATGGCTGTG AAATACTTTCCATAAAGAAAAAAGGCAATCATATAGACTTATCGAGTTTAATGCAACATCTAGGAAACA TGCAGATTGATAGCCTAGTTCTAGAGGGGGGCAGTCTAATGAATTGGAGTGCTTTGGAACAACAAATTG TTGATGAGCTGAAAATATATATTGCACCAAAAATTTTTGGAGGCAGTGCCAAGTTTCCTGTCGGAGGTG AAGGCATTTCTTTGCCAAATGACGCTATTAGATTGAAACCTTATGCTTTTTCTCAAATAGGAAATGACT ATCTCATAGAAAGTGAAGTGATTTATCCATGTTCACAGGAATAATTGAAGAAATCGGAAAAGTTGAAAG AATACAGAAAGACTCTCGTAATTGTAAACTATCAATTAAAGCCTCAAAAATATTAACGGATATCCATTT AGGCGATAGTATAGCAGTAAATGGTATCTGTCTTACAGTTACTCATTTCAATCATCAATCCTTTACAGT TGATGTAATGAATGAAACATGGAGTCGAACAGCTCTCTTACTCTATTAAAACATGGAAGTGAGGTGAAT CTAGAAAGAGCCTTATCTGTCAACGGTCGACTTGGGGGTCACGTCGTTACAGGACACATTGATGGTACA GGAAAAATCTCGTCAATAAAAAAAGATGATAATGCTGTATGGTATCAAATCAACACACAAAAAGAAATT TTAGATTTAATAGTTGAAAAAGGATCTATTACAATTGACGGCATTAGTCTGACTGTCGCTAAAGTCTCC AAAGTAAACTTTTCAGTATCTGTTATCCCTCATACCTTGAAACAAACCATTCTTAAGAGTAAACAAGTC GGGAGTACAGTAAATCTTGAAAATGATATCTTAGGTAAATATGTGCAAAAACTGATGGATAACTCTCCA AAATCAGAAATATCGAAGGAACTATTATATCAAAATGGATTTTAGCAGAAAGGATAATCAGTCAATGGA ATATCGAAAAATACAAGAAGCATTAGAAGCATTGCAGAAGGGACGACTTGTTCTTGTTATAGACGACAA GGATAGAGAAAATGAAGGAGACTTAATTTGTTCTGCACAAGCAGCTACAACAGAAAATGTTAATTTTAT GGCTACTTATGCCAAAGGATTAATTTGTATGCCTATGAGCGAAAGTTTAG -3 '

(D) Streptococcus pneumomae ribG polypeptide sequence deduced from the polynucleotide ORF sequence in this table [SEQ ID NO:4]. NH₂-

MQHLGNMQIDSLVLEGGSLMN SALEQQIVDELKIYIAPKIFGGSAKFPVGGEGISLPNDAIRLKPYAF

SQIGNDYLIESEVIYPCSQE-COOH

Deposited materials

A deposit containing a Streptococcus pneumomae 0100993 strain has been deposited with the National Collections of Industnal and Marine Bactena Ltd (herem "NCIMB"). 23 St Machar Dnve. Aberdeen AB2 1RY, Scotland on 11 Apnl 1996 and assigned deposit number 40794 The deposit was descnbed as Streptococcus peumnoiae 0100993 on deposit On 17 Apnl 1996 a Streptococcus peumnoiae 0100993 DNA library E co was similarly deposited with the NCIMB and assigned deposit number 40800 The Streptococcus pneumomae stram deposit is refened to herem as "the deposited stram" or as "the DNA of the deposited stram "

The deposited stram contains the full length nbG gene The sequence of the polynucleotides contained m the deposited stram, as well as the ammo acid sequence of the polypeptide encoded thereby, are controlling m the event of any conflict with any descnption of sequences herem

The deposit of the deposited stram has been made under the terms of the Budapest Treaty on the International Recognition of the Deposit of Micro-organisms for Purposes of Patent Procedure The stram will be rnevocably and without restnction or condition released to the public upon the issuance of a patent The deposited stram is provided merely as convemence to those of skill in the art and is not an admission that a deposit is required for enablement. such as that required under 35 U S C §112

A license may be required to make, use or sell the deposited stram, and compounds denved therefrom, and no such license is hereby granted

One aspect of the mvention there is provided an isolated nucleic acid molecule encodmg a mature polypeptide expressible by the Streptococcus pneumomae 0100993 strain contained m the deposited stram Further provided by the mvention are nbG nucleotide sequences of the DNA m the deposited stram and ammo acid sequences encoded thereby Also provided by the mvention are nbG polypeptide sequences isolated from the deposited stram and ammo acid sequences denved therefrom Polypeptides

The polypeptides of the mvention include a polypeptide of Table 1 [SEQ ID NO 2 or 4] (m particular the mature polypeptide) as well as polypeptides and fragments, particularly those which have the biological activity of nbG. and also those which have at least 70% identity to a polypeptide of Table 1 [SEQ ID NO 1 or 3]or the relevant portion, preferably at least 80% identity to a polypeptide of Table 1 [SEQ ID NO 2 or 4and more preferably at least 90% similanty (more preferably at least 90% identity) to a polypeptide of Table 1 [SEQ ID NO 2 or 4] and still more preferably at least 95% similanty (still more preferably at least 95% identity) to a polypeptide of Table 1 [SEQ ID NO 2 or 4] and also mclude portions of such polypeptides with such portion of the polypeptide generally containing at least 30 ammo acids and more preferably at least 50 ammo acids The mvention also includes polypeptides of the formula

X-(R, )_m-(R₂)-(R₃)_n-Y wherem. at the ammo terminus, X is hydrogen, and at the carboxyl terminus. Y is hydrogen or a metal, Ri and R3 are any ammo acid residue, m is an mteger between 1 and 1000 or zero, n is an mteger between 1 and 1000 or zero, and R₂ is an ammo acid sequence of the mvention. particularly an ammo acid sequence selected from Table 1 In the formula above R₂ is onented so that its ammo terminal residue is at the left, bound to Ri and its carboxy terminal residue is at the nght, bound to R3 Am stretch of ammo acid residues denoted by either R group, where m and/or n is greater than 1. may be either a heteropolymer or a homopolymer, preferably a heteropolymer

A fragment is a vanant polypeptide havmg an ammo acid sequence that entirely is the same as part but not all of the ammo acid sequence of the aforementioned polypeptides As with nbG polypeptides fragments may be "free-standing," or compnsed within a larger polypeptide of which they form a part or region, most preferably as a smgle contmuous region, a smgle larger polypeptide Prefened fragments mclude, for example, truncation polypeptides havmg a portion of an ammo acid sequence of Table 1 [SEQ ID NO 2 or 4], or of vanants thereof, such as a contmuous senes of residues that mcludes the ammo terminus, or a contmuous senes of residues that mcludes the carboxyl terminus Degradation forms of the polypeptides of the mvention m a host cell, particularly a Streptococcus pneumomae, are also prefened Further prefened are fragments characterized b structaral or functional attnbutes such as fragments that compnse alpha-hehx and alpha-hehx forming regions, beta-sheet and beta-sheet-forming regions, turn and turn-forming regions, coil and coil-forming regions, hydrophilic regions, hydrophobic regions, alpha amphipathic regions, beta amphipathic regions, flexible regions, surface-forming regions, substrate bmdmg region, and high antigenic index regions Also prefened are biologically active fragments which are those fragments that mediate activities of nbG. including those with a similar activity or an improved activity, or with a decreased undesirable actmty Also mcluded are those fragments that are antigenic or lmmunogenic m an animal, especially m a human Particularly prefened are fragments compnsmg receptors or domains of enzymes that confer a function essential for viability of Streptococcus pneumomae or the ability to initiate, or maintain cause disease m an individual, particularly a human

Vanants that are fragments of the polypeptides of the mvention may be employed for producing the conespondmg full-length polypeptide by peptide synthesis, therefore, these vanants may be employed as intermediates for producmg the full-length polypeptides of the mvention

In addition to the standard single and triple letter representations for ammo acids, the term "X" or "Xaa" may also be used m describing certain polypeptides of the invention "X" and "Xaa" mean that any of the twenty naturally occurmg ammo acids may appear at such a designated position m the polypeptide sequence Polynucleotides

Another aspect of the mvention relates to isolated polynucleotides, including the full length gene, that encode the nbG polypeptide havmg a deduced ammo acid sequence of Table 1 [SEQ ID NO 2 or 4] and polynucleotides closely related thereto and vanants thereof Us g the information provided herem. such as a polynucleotide sequence set out in Table 1

[SEQ ID NO 1 or 3], a polynucleotide of the mvention encodmg nbG polypeptide may be obtained usmg standard cloning and screening methods, such as those for cloning and sequencmg chromosomal DNA fragments from bactena usmg Streptococcus pneumomae 0100993 cells as starting matenal, followed by obtaining a full length clone For example, to obtain a polynucleotide sequence of the invention, such as a sequence given in Table 1 [SEQ ID NO 1 or 3], typically a library of clones of chromosomal DNA of Streptococcus pneumomae 0100993 m E coh or some other suitable host is probed with a radiolabeled ohgonucleotide, preferably a 17-mer or longer, denved from a partial sequence Clones carrying DNA identical to that of the probe can then be distinguished using strmgent conditions By sequencmg the individual clones thus identified with sequencing primers designed from the original sequence it is then possible to extend the sequence in both directions to determine the full gene sequence Conveniently, such sequencing is performed using denatured double stranded DNA prepared from a plasmid clone Suitable techniques are descnbed by Mamatis, T , Fritsch, E F and Sambrook et al , MOLECULAR CLONING, A LABORATORY MANUAL, 2nd Ed , Cold Sprmg Harbor Laboratory Press, Cold Sprmg Harbor, New York (1989) (see m particular Screening By Hybridization 1 90 and Sequencmg Denatured Double-Stranded DNA Templates 13 70) Illustrative of the mvention, the polynucleotide set out m Table 1 [SEQ ID NO 1 or 3] was discovered m a DNA library denved from Streptococcus pneumomae 0100993

The DNA sequence set out in Table 1 [SEQ ID NO 1 or 3] contains an open reading frame encodmg a protem having about the number of a mo acid residues set forth m Table 1 [SEQ ID NO 2 or 4] with a deduced molecular weight that can be calculated usmg ammo acid residue molecular weight values well known m the art The polynucleotide of SEQ ID NO 1, between nucleotide number 1 and the stop codon which begms at nucleotide number 1099 of SEQ ID NO 1, encodes the polypeptide of SEQ ID NO 2

RibG of the mvention is structurally related to other protems of the nboflavin-specific deaminase family

The mvention provides a polynucleotide sequence identical over its entire length to a coding sequence m Table 1 [SEQ ID NO 1 or 3] Also provided by the mvention is the coding sequence for the mature polypeptide or a fragment thereof, by itself as well as the coding sequence for the mature polypeptide or a fragment m reading frame with other coding sequence, such as those encodmg a leader or secretory sequence, a pre-, or pro- or prepro- protem sequence The polynucleotide may also contain non-coding sequences, including for example, but not limited to non-coding 5' and 3^" sequences, such as the transcnbed, non-translated sequences, termination signals, nbosome bmdmg sites, sequences that stabilize mRNA, mtrons, polyadenylation signals, and additional coding sequence which encode additional ammo acids For example, a marker sequence that facilitates punfication of the fused polypeptide can be encoded In certam embodiments of the mvention. the marker sequence is a hexa-histidine peptide, as provided m the pQE vector (Qiagen, Inc ) and descnbed in Gentz et al , Proc Natl Acad Sci , USA 86 821-824 (1989). or an HA tag (Wilson et al , Cell 37 767 (1984) Polynucleotides of the mvention also mclude. but are not limited to, polynucleotides compnsmg a structural gene and its naturally associated sequences that control gene expression

A prefened embodiment of the mvention is a polynucleotide of compnsmg nucleotide 1 to the nucleotide immediately upstream of or including nucleotide 1099 set forth m SEQ ID NO 1 of Table 1, both of which encode the nbG polypeptide

The mvention also mcludes polynucleotides of the formula X-(R₁)_m-(R₂)-(R₃)_n-Y wherein, at the 5' end of the molecule, X is hydrogen, and at the 3' end of the molecule, Y is hydrogen or a metal, Ri and R3 is any nucleic acid residue, m is an mteger between 1 and 3000 or zero , n is an integer between 1 and 3000 or zero, and R₂ is a nucleic acid sequence of the mvention, particularly a nucleic acid sequence selected from Table 1 In the polynucleotide formula above R₂ is onented so that its 5' end residue is at the left, bound to R and its 3' end residue is at the nght, bound to R3 Any stretch of nucleic acid residues denoted by either R group, where m and/or n is greater than 1. may be either a heteropolymer or a homopolymer, preferably a heteropolymer In a prefened embodiment m and/or n is an mteger between 1 and 1000.

It is most prefened that the polynucleotides of the inventions are denved from Streptococcus pneumomae. however, they may preferably be obtained from organisms of the same taxonomic genus They may also be obtained, for example, from organisims of the same taxonomic family or order

The term "polynucleotide encodmg a polypeptide" as used herem encompasses polynucleotides that mclude a sequence encodmg a polypeptide of the mvention. particularly a bactenal pohpeptide and more particularly a polypeptide of the Streptococcus pneumomae nbG havmg an ammo acid sequence set out m Table 1 [SEQ ID NO 2 or 4] The term also encompasses polynucleotides that mclude a smgle contmuous region or discontmuous regions encodmg the polypeptide (for example, interrupted by mtegrated phage or an insertion sequence or editing) together with additional regions, that also may contain coding and/or non-coding sequences

The mvention further relates to vanants of the polynucleotides descnbed herem that encode for vanants of the polypeptide havmg a deduced ammo acid sequence of Table 1 [SEQ ID NO 2 or 4] Vanants that are fragments of the polynucleotides of the mvention may be used to synthesize full- length polynucleotides of the mvention

Further particularly prefened embodiments are polynucleotides encodmg nbG vanants. that have the ammo acid sequence of nbG polypeptide of Table 1 [SEQ ID NO 2 or 4] m which several, a few, 5 to 10 1 to 5. 1 to 3, 2, 1 or no ammo acid residues are substituted, deleted or added, m any combination Especially prefened among these are silent substitutions, additions and deletions, that do not alter the properties and activities of nbG

Further prefened embodiments of the mvention are polynucleotides that are at least 70% identical over their entire length to a polynucleotide encodmg nbG polypeptide havmg an ammo acid sequence set out m Table 1 [SEQ ID NO 2 or 4], and polynucleotides that are complementary to such polynucleotides Alternatively, most highly prefened are polynucleotides that compnse a region that is at least 80% identical over its entire length to a polynucleotide encodmg nbG polypeptide and polynucleotides complementary thereto In this regard, polynucleotides at least 90% identical over their entire length to the same are particularly prefened, and among these particularly prefened polynucleotides, those with at least 95% are especially prefened Furthermore, those with at least 97% are highly prefened among those with at least 95%, and among these those with at least 98% and at least 99% are particularly highly prefened, with at least 99% bemg the more prefened Prefened embodiments are polynucleotides that encode polypeptides that retain substantially the same biological function or activity as the mature polypeptide encoded by a DNA of Table 1 [SEQ ID NO 1 or 3]

The mvention further relates to polynucleotides that hybndize to the herem above-descnbed sequences In this regard, the mvention especially relates to polynucleotides that hybndize under stnngent conditions to the herem above-descnbed polynucleotides As herem used, the terms "stnngent conditions" and "stnngent hybndization conditions" mean hybndization will occur only if there is at least 95% and preferably at least 97% identity between the sequences An example of strmgent hybridization conditions is overnight incubation at 42°C in a solution comprising 50% formamide. 5x SSC (150mM NaCl, 15mM tnsodium citrate), 50 mM sodium phosphate (pH7 6). 5x Denhardt's solution, 10% dextran sulfate, and 20 micrograms/ml denatured, sheared salmon sperm DNA, followed by washing the hybridization support in 0 lx SSC at about 65 °C Hybridization and wash conditions are well known and exemplified in Sambrook, et al . Molecular Cloning A Laboratory Manual, Second Edition, Cold Sprmg Harbor, N Y , (1989). particularly Chapter 11 therein The invention also provides a polynucleotide consisting essentially of a polynucleotide sequence obtamable by screening an appropriate library containing the complete gene for a polynucleotide sequence set forth in SEQ ID NO 1 under stringent hybridization conditions with a probe having the sequence of said polynucleotide sequence set forth m SEQ ID NO 1 or a fragment thereof, and isolating said DNA sequence Fragments useful for obtaining such a polynucleotide mclude. for example, probes and primers described elsewhere herem

As discussed additionally herem regarding polynucleotide assays of the mvention, for instance, polynucleotides of the mvention as discussed above, may be used as a hybndization probe for RNA. cDNA and genomic DNA to isolate full-length cDNAs and genomic clones encodmg nbG and to isolate cDNA and genomic clones of other genes that have a high sequence similanty to the nbG gene Such probes generally will compnse at least 15 bases Preferably, such probes will have at least 30 bases and may have at least 50 bases Particularly prefened probes will have at least 30 bases and will have 50 bases or less For example, the coding region of the nbG gene may be isolated by screening usmg a DNA sequence provided m Table 1 [SEQ ID NO 1 or 3] to synthesize an oligonucleotide probe A labeled oligonucleotide havmg a sequence complementary to that of a gene of the mvention is then used to screen a library of cDNN genomic DNA or mRNA to determine which members of the library the probe hybndizes to

The polynucleotides and polypeptides of the mvention may be employed, for example, as research reagents and matenals for discovery of treatments of and diagnostics for disease, particularly human disease, as further discussed herem relatmg to polynucleotide assays

Polynucleotides of the invention that are o gonucleotides derived from the sequences of Table 1 [SEQ ID NOS 1 or 2 or 3 or 4] may be used in the processes herein as described, but preferably for PCR, to determine whether or not the polynucleotides identified herein in whole or m part are transcribed m bacteria m infected tissue It is recognized that such sequences will also have utility m diagnosis of the stage of infection and type of infection the pathogen has attained The mvention also provides polynucleotides that may encode a polypeptide that is the mature protem plus additional ammo or carboxyl-terminal ammo acids, or ammo acids mtenor to the mature polypeptide (when the mature form has more than one polypeptide chain, for instance) Such sequences may play a role m processmg of a protem from precursor to a mature form, may allow protem transport, may lengthen or shorten protem half-life or may facilitate manipulation of a protem for assay or production, among other thmgs As generally is the case in vivo, the additional ammo acids may be processed away from the mature protem by cellular enzymes

A precursor protem. havmg the mature form of the polypeptide fused to one or more prosequences may be an mactive form of the polypeptide When prosequences are removed such inactive precursors generally are activated Some or all of the prosequences may be removed before activation Generally, such precursors are called proproteins

In addition to the standard A, G. C, T U representations for nucleic acid bases, the term "N" may also be used in describing certain polynucleotides of the mvention "N" means that any of the four DNA or RNA bases may appear at such a designated position in the DNA or RNA sequence, except it is preferred that N is not a base that when taken in combmation with adjacent nucleotide positions, when read in the correct readmg frame, would have the effect of generating a premature termination codon in such readmg frame In sum. a polynucleotide of the mvention may encode a mature protem. a mature protem plus a leader sequence (which may be refened to as a preprotem), a precursor of a mature protem havmg one or more prosequences that are not the leader sequences of a preprotem, or a preproprotein, which is a precursor to a proprotem, havmg a leader sequence and one or more prosequences, which generally are removed during processmg steps that produce active and mature forms of the polypeptide

Vectors, host cells, expression

The mvention also relates to vectors that compnse a polynucleotide or polynucleotides of the mvention. host cells that are genetically engmeered with vectors of the mvention and the production of polypeptides of the mvention by recombmant techniques Cell-free translation systems can also be employed to produce such proteins usmg RNAs denved from the DNA constructs of the mvention

For recombmant production, host cells can be genetically engmeered to incorporate expression systems or portions thereof or polynucleotides of the mvention Introduction of a polynucleotide mto the host cell can be effected by methods descnbed m many standard laboratory manuals, such as Davis et al , BASIC METHODS IN MOLECULAR BIOLOGY, (1986) and Sambrook et al . MOLECULAR CLONING A LABORATORY MANUAL, 2nd Ed , Cold Sprmg Harbor Laboratory Press. Cold Sprmg Harbor, N Y (1989), such as, calcium phosphate transfection, DEAE-dextran mediated transfection, transvection, micromjection, catiomc lipid- mediated transfection, electroporation, transduction, scrape loading, ballistic mtroduction and infection

Representative examples of appropnate hosts mclude bacteπal cells, such as streptococci. staphylococci, enterococci E cob, streptomyces and Bacillus subtil s cells, fungal cells, such as yeast cells and Aspergillus cells, insect cells such as Drosophύa S2 and Spodoptera Sf9 cells, animal cells such as CHO. COS, HeLa, C127, 3T3, BHK, 293 and Bowes melanoma cells, and plant cells

A great vanety of expression systems can be used to produce the polypeptides of the mvention Such vectors mclude. among others, chromosomal, episomal and vrrus-denved vectors, e g , vectors denved from bactenal plasmids, from bactenophage, from transposons, from yeast episomes, from insertion elements, from yeast chromosomal elements, from viruses such as baculovmises. papova viruses, such as SV40, vaccmia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses and retrovrruses. and vectors denved from combinations thereof, such as those denved from plasmid and bactenophage genetic elements, such as cosnuds and phagemids The expression system constructs may contain control regions that regulate as well as engender expression Generally, any system or vector suitable to maintain, propagate or express polynucleotides and/or to express a polypeptide m a host may be used for expression m this regard The appropnate DNA sequence may be inserted to the expression system by any of a vanety of well-known and routme techniques, such as, for example, those set forth m Sambrook et al , MOLECULAR CLONING, A LABORATORY MANUAL, (supra)

For secretion of the translated protem mto the lumen of the endoplasmic reticulum, mto the penplasmic space or mto the extracellular environment, appropnate secretion signals may be incorporated mto the expressed polypeptide These signals may be endogenous to the polypeptide or they may be heterologous signals

Polypeptides of the mvention can be recovered and punfied from recombmant cell cultures by well-known methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic mteraction chromatography, affinity chromatography, hydroxylapatite chromatography. and lectm chromatography Most preferably, high performance liquid chromatography is employed for punfication Well known techniques for refolding protem may be employed to regenerate active conformation when the polypeptide is denatured during isolation and or punfication Diagnostic Assays This mvention is also related to the use of the nbG polynucleotides of the mvention for use as diagnostic reagents Detection of nbG m a eukaryote, particularly a mammal, and especially a human, will provide a diagnostic method for diagnosis of a disease Eukaryotes (herem also "mdιvιdual(s)"), particularly mammals, and especially humans, particularly those infected or suspected to be infected with an organism compnsmg the nbG gene may be detected at the nucleic acid level by a vanety of techniques Nucleic acids for diagnosis may be obtained from an infected individual's cells and tissues, such as bone, blood, muscle, cartilage, and skin Genomic DNA may be used directly for detection or may be amplified enzymatically by usmg PCR or other amplification technique pnor to analysis RNA, cDNA and genomic DNA may also be used m the same ways Usmg amplification, characterization of the species and stram of prokaryote present m an individual, may be made by an analysis of the genotype of the prokaryote gene Deletions and insertions can be detected by a change m size of the amplified product m companson to the genotype of a reference sequence Pomt mutations can be identified by hybndizmg amplified DNA to labeled nbG polynucleotide sequences Perfectly matched sequences can be distinguished from mismatched duplexes by RNase digestion or by differences m meltmg temperatures DNA sequence differences may also be detected by alterations in the electrophoretic mobility of the DNA fragments m gels, with or without denaturing agents, or by direct DNA sequencmg See, e g , Myers et al , Science, 230 1242 (1985) Sequence changes at specific locations also may be revealed by nuclease protection assays, such as RNase and SI protection or a chemical cleavage method See, e g . Cotton et al , Proc Natl Acad Set , USA, 85 4397-4401 (1985)

Cells carrying mutations or polymorphisms m the gene of the mvention may also be detected at the DNA level by a vanety of techniques, to allow for serotyping. for example For example, RT- PCR can be used to detect mutations It is particularly prefened to used RT-PCR m conjunction with automated detection systems, such as, for example. GeneScan RNA, cDNA or genomic DNA may also be used for the same purpose, PCR or RT-PCR As an example. PCR primers complementary to a nucleic acid encodmg nbG can be used to identify and analyze mutations Examples of representative primers are shown below in Table 2

Table 2 Primers for amplification of ribG polynucleotides SEQ ID NO PRIMER SEQUENCE

5 5'-CACATTATCGGACAAGGTTATCAT-3'

6 5'-TTTTTCCCTTCCTCCAATCTACAT-3'

The mvention also mcludes primers of the formula

X-(R₁)_m-(R₂)-(R₃)_n-Y wherein, at the 5' end of the molecule. X is hydrogen, and at the 3' end of the molecule, Y is hydrogen or a metal, Ri and R3 is any nucleic acid residue, m is an mteger between 1 and 20 or zero , n is an mteger between 1 and 20 or zero, and R is a primer sequence of the mvention. particularh a primer sequence selected from Table 2 In the polynucleotide formula above R₂ is onented so that its 5' end residue is at the left, bound to R_j and its 3' end residue is at the nght, bound to R3 Am stretch of nucleic acid residues denoted by either R group, where m and/or n is greater than 1. may be either a heteropolymer or a homopolymer, preferably a heteropolymer bemg complementary to a region of a polynucleotide of Table 1 hi a prefened embodiment m and/or n is an mteger between 1 and 10. The mvention further provides these primers with 1, 2. 3 or 4 nucleotides removed from the 5' and/or the 3' end These primers may be used for, among other thmgs, amplifying nbG DNA isolated from a sample denved from an individual The primers may be used to amplify the gene isolated from an infected individual such that the gene may then be subject to vanous techmques for elucidation of the DNA sequence In this way, mutations m the DNA sequence may be detected and used to diagnose infection and to serotype and/or classify the infectious agent

The mvention further provides a process for diagnosing, disease, preferably bactenal infections, more preferably infections by Streptococcus pneumomae. comprising determining from a sample derived from an individual a increased level of expression of polynucleotide havmg a sequence of Table 1 [SEQ ID NO 1 or 3] Increased or decreased expression of nbG polynucleotide can be measured using any on of the methods well known m the art for the quantation of polynucleotides. such as. for example, amplification. PCR. RT-PCR, RNase protection, Northern blotting and other hybridization methods

In addition, a diagnostic assay in accordance with the mvention for detecting over- expression of nbG protem compared to normal control tissue samples may be used to detect the presence of an infection, for example Assay techmques that can be used to determine levels of a nbG protem in a sample denved from a host are well-known to those of skill m the art Such assay methods mclude radioimmunoassays, competitive-binding assays, Western Blot analysis and ELISA assays Antibodies

The polypeptides of the mvention or vanants thereof, or cells expressmg them can be used as an lmmunogen to produce antibodies lmmunospecific for such polypeptides "Antibodies" as used herem mcludes monoclonal and polyclonal antibodies, chimenc, smgle cham, simiamzed antibodies and humanized antibodies, as well as Fab fragments, including the products of an Fab lmmimolglobu n expression library

Antibodies generated against the polypeptides of the mvention can be obtained by administering the polypeptides or epitope-beanng fragments, analogues or cells to an animal, preferably a nonhuman, usmg routme protocols For preparation of monoclonal antibodies, any technique known m the art that provides antibodies produced by contmuous cell line cultures can be used Examples mclude vanous techmques, such as those m Kohler, G and Milstem, C , Nature 256 495-497 (1975). Kozbor et al , Immunology Today 4 72 (1983), Cole et al , pg 77-96 m MONOCLONAL ANTIBODIES AND CANCER THERAPY. Alan R Liss, Inc (1985) Techmques for the production of smgle chain antibodies (U S Patent No 4,946.778) can be adapted to produce smgle chain antibodies to polypeptides of this mvention Also, transgenic mice, or other organisms such as other mammals, may be used to express humanized antibodies

Alternatively phage display technology may be utilized to select antibody genes with bmdmg activities towards the polypeptide either from repertoires of PCR amplified v-genes of lymphocytes from humans screened for possessing anti-nbG or from naive libraries (McCafferty, J et al . (1990). Nature 348, 552-554, Marks, J et al . (1992) Biotechnology 10, 779-783) The affinity of these antibodies can also be improved by chain shuffling (Clackson, T et al , (1991) Nature 352, 624-628) If two antigen binding domains are present each domain may be directed against a different epitope - termed 'bispecific' antibodies

The above-descnbed antibodies may be employed to isolate or to identify clones expressmg the polypeptides to punfy the polypeptides by affinity chromatography

Thus, among others, antibodies against nbG- polypeptide may be employed to treat infections, particularly bactenal infections

Polypeptide variants include antigemcally, epitopically or lmmunologically equivalent vanants that form a particular aspect of this invention The term "antigemcally equivalent derivative" as used herein encompasses a polypeptide or its equivalent which will be specifically recognized by certain antibodies which, when raised to the protem or polypeptide according to the invention, interfere with the immediate physical interaction between pathogen and mammalian host The term "nnmunologically equivalent derivative" as used herein encompasses a peptide or its equivalent which when used in a suitable formulation to raise antibodies m a vertebrate, the antibodies act to interfere with the immediate physical interaction between pathogen and mammalian host The polypeptide, such as an antigemcally or lmmunologically equivalent derivative or a fusion protem thereof is used as an antigen to immunize a mouse or other ammal such as a rat or chicken The fusion protem may provide stability to the polypeptide The antigen may be associated, for example by conjugation, with an lmmunogenic carrier protem for example bovme serum albumin (BSA) or keyhole limpet haemocyanm (KLH) Alternatively a multiple antigenic peptide comprising multiple copies of the protem or polypeptide, or an antigemcally or lmmunologically equivalent polypeptide thereof may be sufficiently antigenic to improve lmmunogemcity so as to obviate the use of a carrier Preferably, the antibody or variant thereof is modified to make it less lmmunogenic m the individual For example, if the individual is human the antibody may most preferably be "humanized" where the comphmentarity determining regιon(s) of the hybndoma-denved antibody has been transplanted mto a human monoclonal antibody , for example as descnbed m Jones, P et al (1986). Nature 321, 522-525 or Tempest et al , (1991) Biotechnology 9, 266-273

The use of a polynucleotide of the invention in genetic immunization will preferably employ a suitable delivery method such as direct injection of plasmid DNA mto muscles (Wolff et al , Hum Mol Genet 1992, 1 363. Manthorpe et al , Hum Gene Ther 1963 4. 419). delivery of DNA complexed with specific protem earners (Wu et al , J Biol Chem 1989 264.16985). coprecipitation of DNA with calcium phosphate (Benvemsty & Reshef, PNAS USA 1986 83.9551), encapsulation of DNA in various forms of hposomes (Kaneda et al , Science 1989 243.375), particle bombardment (Tang et al , Nature 1992, 356 152. Eisenbraun et al , DNA Cell Biol 1993, 12 791) and in vivo infection usmg cloned retroviral vectors (Seeger et al . PNAS USA 1984 81 ,5849)

Antagonists and agonists - assays and molecules

Pohpeptides of the mvention may also be used to assess the bmdmg of small molecule substrates and hgands in, for example, cells, cell-free preparations, chemical libraries, and natural product mixtures These substrates and hgands may be natural substrates and hgands or may be structural or functional mimetics See, e g , Coligan et al , Current Protocols in Immunology 1(2) Chapter 5 (1991)

The mvention also provides a method of screening compounds to identify those which enhance (agonist) or block (antagonist) the action of nbG polypeptides or polynucleotides, particularly those compounds that are bactenostatic and/or bactenocidal The method of screening may invohe high-throughput techmques For example, to screen for agomsts or antagoists, a synthetic reaction mix. a cellular compartment, such as a membrane, cell envelope or cell wall, or a preparation of any thereof, compnsmg nbG polypeptide and a labeled substrate or ligand of such polypeptide is mcubated m the absence or the presence of a candidate molecule that may be a nbG agonist or antagonist The ability of the candidate molecule to agomze or antagonize the nbG polypeptide is reflected in decreased bmdmg of the labeled ligand or decreased production of product from such substrate Molecules that bmd gratuitously, i e , without mducmg the effects of nbG polypeptide are most likely to be good antagomsts Molecules that b d well and mcrease the rate of product production from substrate are agomsts Detection of the rate or level of production of product from substrate may be enhanced by usmg a reporter system Reporter systems that may be useful m this regard mclude but are not limited to colonmetnc labeled substrate converted mto product, a reporter gene that is responsive to changes m nbG polynucleotide or polypeptide activity, and bmdmg assays known m the art

Another example of an assay for nbG antagomsts is a competitive assay that combmes nbG and a potential antagonist with nbG-bmdmg molecules, recombmant nbG bmdmg molecules, natural substrates or hgands, or substrate or ligand mimetics, under appropnate conditions for a competitive inhibition assay RibG can be labeled, such as by radioactivity or a colonmetnc compomid. such that the number of nbG molecules bound to a bmd g molecule or com'erted to product can be determined accurately to assess the effectiveness of the potential antagonist

Potential antagomsts mclude small orgamc molecules, peptides. polypeptides and antibodies that bmd to a polynucleotide or polypeptide of the mvention and thereby inhibit or extinguish its activity Potential antagomsts also may be small orgamc molecules, a peptide. a polypeptide such as a closely related protem or antibody that b ds the same sites on a bmdmg molecule, such as a bmdmg molecule, without mducmg nbG-mduced activities, thereby preventing the action of nbG by excluding nbG from bmdmg

Potential antagomsts mclude a small molecule that bmds to and occupies the bmdmg site of the polypeptide thereby preventmg bmdmg to cellular bmdmg molecules, such that normal biological activity is prevented Examples of small molecules mclude but are not limited to small orgamc molecules, peptides or peptide-like molecules Other potential antagomsts mclude antisense molecules (see Okano. J Neurochem 56 560 (1991), OUGODEOXYNUCLEOTIDES AS ANTISENSE INHIBITORS OF GENE EXPRESSION, CRC Press, Boca Raton, FL (1988), for a descnption of these molecules) Prefened potential antagomsts mclude compounds related to and vanants of nbG

Each of the DNA sequences provided herein may be used m the discovery and development of antibacterial compounds The encoded protem, upon expression, can be used as a target for the screening of antibacterial drugs Additionally, the DNA sequences encodmg the ammo terminal regions of the encoded protem or Shine-Delgarno or other translation facilitating sequences of the respective mRNA can be used to construct antisense sequences to control the expression of the coding sequence of interest The invention also provides the use of the polypeptide, polynucleotide or inhibitor of the invention to interfere with the initial physical interaction between a pathogen and mammalian host responsible for sequelae of mfection In particular the molecules of the mvention may be used m the prevention of adhesion of bacteria, m particular gram positive bactena, to mammalian extracellular matnx protems on m-dwelling devices or to extracellular matrix proteins in wounds, to block nbG protem-mediated mammalian cell invasion by. for example, initiating phosphorylation of mammalian tyrosme kmases (Rosenshine et al . Infect Immun 60 2211 (1992), to block bacterial adhesion between mammalian extracellular matrix proteins and bacterial nbG protems that mediate tissue damage and, to block the normal progression of pathogenesis in infections initiated other than by the implantation of in-dwellmg devices or by other surgical techniques

The antagomsts and agomsts of the mvention may be employed, for instance, to inhibit and treat diseases

He cobacter pylori (herein H pylori) bacteria mfect the stomachs of over one-third of the world's population causing stomach cancer, ulcers, and gastritis (International Agency for Research on Cancer (1994) Schistosomes, Liver Flukes and Hehcobacter Pylori (International Agency for Research on Cancer, Lyon, France, http //www uicc ch/ecp/ecp2904 htm) Moreover, the international Agency for Research on Cancer recently recognized a cause-and- effect relationship between H pylori and gastric adenocarcmoma, classifying the bacterium as a Group I (definite) carcmogen Prefened antimicrobial compounds of the invention (agomsts and antagomsts of ribG) found using screens provided by the invention, particularly broad- spectrum antibiotics, should be useful in the treatment of H pylori infection Such treatment should decrease the advent of H #y/σr. -induced cancers, such as gastrointestinal carcinoma Such treatment should also cure gastric ulcers and gastntis Vaccines

Another aspect of the invention relates to a method for mducmg an immunological response m an individual, particularly a mammal which comprises inoculating the individual with nbG, or a fragment or variant thereof, adequate to produce antibody and/ or T cell immune response to protect said individual from infection, particularly bacterial infection and most particularly Streptococcus pneumomae infection Also provided are methods whereby such immunological response slows bacterial replication Yet another aspect of the mvention relates to a method of inducing immunological response m an individual which compnses delivering to such individual a nucleic acid vector to direct expression of nbG, or a fragment or a variant thereof, for expressing nbG, or a fragment or a variant thereof in vivo m order to induce an immunological response, such as, to produce antibody and or T cell immune response, including, for example, cytokme-producmg T cells or cytotoxic T cells, to protect said individual from disease, whether that disease is already established within the individual or not One way of administering the gene is by accelerating it mto the desired cells as a coating on particles or otherwise Such nucleic acid vector may comprise DNA, RNA, a modified nucleic acid, or a DNA/RNA hybnd

A further aspect of the invention relates to an immunological composition which, when introduced into an individual capable or having mduced within it an immunological response, induces an immunological response in such individual to a nbG or protein coded therefrom, wherein the composition comprises a recombinant nbG or protein coded therefrom compnsmg DNA which codes for and expresses an antigen of said nbG or protein coded therefrom The immunological response may be used therapeutically or prophylactically and may take the form of antibody immunity or cellular immunity such as that ansmg from CTL or CD4+ T cells

A nbG polypeptide or a fragment thereof may be fused with co-protein which may not by itself produce antibodies, but is capable of stabilizing the first protein and producmg a fused protem which will have lmmunogenic and protective properties Thus fused recombmant protem, preferably further comprises an antigenic co-protein, such as hpoprotein D from Hemophilus influenzae Glutathione-S-transferase (GST) or beta-galactosidase, relatively large co-protems which solubi ze the protein and facilitate production and punfication thereof Moreover, the co-protein may act as an adjuvant m the sense of providmg a generalized stimulation of the immune system The co-protem may be attached to either the ammo or carboxy terminus of the first protem Provided by this invention are compositions, particularly vaccine compositions, and methods compnsmg the polypeptides or polynucleotides of the mvention and lmmunostimulatory DNA sequences, such as those described m Sato, Y et al Science 273 352 (1996)

Also, provided by this invention are methods using the described polynucleotide or particular fragments thereof which have been shown to encode non-variable regions of bacterial cell surface protems in DNA constructs used in such genetic immunization experiments in ammal models of infection with Streptococcus pneumomae will be particularly useful for identifying protein epitopes able to provoke a prophylactic or therapeutic immune response It is believed that this approach will allow for the subsequent preparation of monoclonal antibodies of particular value from the requisite organ of the ammal successfully resisting or clearing infection for the development of prophylactic agents or therapeutic treatments of bacterial infection, particularly Streptococcus pneumomae infection, m mammals, particularly humans

The polypeptide may be used as an antigen for vaccination of a host to produce specific antibodies which protect against invasion of bacteria, for example b\ blocking adherence of bacteria to damaged tissue Examples of tissue damage mclude wounds m skin or coimective tissue caused, e g , by mechamcal, chemical or thermal damage or by implantation of indwelling devices, or wounds m the mucous membranes, such as the mouth, mammary glands, urethra or vagma

The invention also includes a vaccine formulation which comprises an lmmunogenic recombinant protem of the mvention together with a suitable carrier Smce the protem may be broken down m the stomach, it is preferably administered parenterally, including, for example, administration that is subcutaneous, mtramuscular, intravenous, or intradermal Formulations suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants. buffers, bactenostats and solutes which render the formulation msotomc with the bodily fluid, preferably the blood, of the individual, and aqueous and non-aqueous sterile suspensions which may include suspending agents or thickenmg agents The formulations may be presented in unit-dose or multi-dose containers, for example, sealed ampules and vials and may be stored m a freeze-d ed condition requirmg only the addition of the sterile liquid carrier immediately pnor to use The vaccme formulation may also mclude adjuvant systems for enhancing the lmmunogenicity of the formulation, such as oil-in water systems and other systems known m the art The dosage will depend on the specific actiMty of the vaccme and can be readily determined by routme experimentation

While the invention has been described with reference to certain nbG protem, it is to be understood that this covers fragments of the naturally occurring protem and similar proteins with additions, deletions or substitutions which do not substantially affect the lmmunogenic properties of the recombinant protem

Compositions, kits and administration The mvention also relates to compositions compnsmg the polynucleotide or the polypeptides discussed above or their agomsts or antagomsts The polypeptides of the mvention may be employed m combination with a non-stenle or stenle earner or earners for use with cells, tissues or organisms, such as a pharmaceutical earner suitable for administration to a subject Such compositions compnse, for instance, a media additive or a therapeutically effective amount of a polypeptide of the mvention and a pharmaceutically acceptable earner or excipient Such earners may mclude, but are not limited to. saline, buffered salme, dextrose, water, glycerol, ethanol and combinations thereof The formulation should suit the mode of administration The mvention further relates to diagnostic and pharmaceutical packs and kits compnsmg one or more containers filled with one or more of the ingredients of the aforementioned compositions of the mvention

Polypeptides and other compounds of the mvention may be employed alone or m conjunction w th other compounds, such as therapeutic compounds

The pharmaceutical compositions may be administered m any effective, convement manner including, for instance, administration by topical, oral, anal, vagmal. mtravenous. mtrapentoneal, intramuscular, subcutaneous, intranasal or intradermal routes among others

In therapy or as a prophylactic, the active agent may be administered to an mdividual as an injectable composition, for example as a sterile aqueous dispersion, preferably lsotomc

Alternatively the composition may be formulated for topical application for example m the form of ointments, creams, lotions, eye omtments, eye drops, ear drops, mouthwash. impregnated dressings and sutures and aerosols, and may contain appropriate conventional additives, including, for example, preservatives, solvents to assist drug penetration, and emollients in omtments and creams Such topical formulations may also contain compatible conventional earners, for example cream or omtment bases, and ethanol or oleyl alcohol for lotions Such earners may constitute from about 1% to about 98% by weight of the formulation, more usually they will constitute up to about 80% by weight of the formulation

For administration to mammals, and particularly humans, it is expected that the daily dosage level of the active agent will be from 0 01 mg/kg to 10 mg/kg, typically around 1 mg/kg The physician m any event will determine the actual dosage which will be most suitable for an mdividual and will vary with the age, weight and response of the particular individual

The above dosages are exemplary of the average case There can, of course, be mdividual instances where higher or lower dosage ranges are mented, and such are withm the scope of this invention

In-dwelling devices mclude surgical implants, prosthetic devices and catheters, 1 e , devices that are introduced to the body of an individual and remam in position for an extended time Such devices mclude, for example, artificial joints, heart valves, pacemakers, vascular grafts, vascular catheters, cerebrospmal fluid shunts, urinary catheters, contmuous ambulatory peritoneal dialysis (CAPD) catheters

The composition of the invention may be administered by injection to achieve a systemic effect agamst relevant bacteria shortly before insertion of an m-dwellmg device Treatment may be continued after surgery during the m-body time of the device In addition, the composition could also be used to broaden perioperative cover for any surgical technique to prevent bacterial wound infections, especially Streptococcus pneumomae wound infections

Many orthopaedic surgeons consider that humans with prosthetic jomts should be considered for antibiotic prophylaxis before dental treatment that could produce a bacteremia Late deep infection is a serious complication sometimes leading to loss of the prosthetic joint and is accompanied by significant morbidity and mortality It may therefore be possible to extend the use of the active agent as a replacement for prophylactic antibiotics m this situation In addition to the therapy described above, the compositions of this invention may be used generally as a wound treatment agent to prevent adhesion of bactena to matrix protems exposed m wound tissue and for prophylactic use m dental treatment as an alternative to, or in conjunction with, antibiotic prophylaxis

Alternatively, the composition of the invention may be used to bathe an indwelling device immediately before insertion The active agent will preferably be present at a concentration of lμg/ml to lOmg/ml for bathing of wounds or indwelling devices A vaccme composition is convemently m mjectable form Conventional adjuvants may be employed to enhance the immune response A suitable unit dose for vaccination is 0 5-5 microgram/kg of antigen, and such dose is preferably administered 1-3 times and with an interval of 1-3 weeks With the indicated dose range, no adverse toxicological effects will be observed with the compounds of the invention which would preclude their administration to suitable individuals Each reference disclosed herein is incorporated by reference herein in its entirety Any patent application to which this application claims pπonty is also incorporated by reference herein m its entirety GLOSSARY The following definitions are provided to facilitate understanding of certam terms used frequently herem

"Dιsease(s)" means and disease caused by or related to infection by a bactena. including otitis media, conjunctivitis, pneumonia, bacteremia. meningitis, sinusitis, pleural empyema and endocarditis, and most particularly meningitis, such as for example infection of cerebrospmal fluid "Host cell" is a cell which has been transformed or transfected. or is capable of transformation or transfection by an exogenous polynucleotide sequence

"Identity." as known m the art, is a relationship between two or more polypeptide sequences or two or more polynucleotide sequences, as determined by comparing the sequences hi the art "identity" also means the degree of sequence relatedness between polypeptide or polynucleotide sequences, as the case may be, as determined by the match between strings of such sequences "Identity" and "similarity" can be readily calculated by known methods, including but not limited to those described in (Computational Molecular Biology, Lesk, A M , ed , Oxford University Press, New York, 1988, Bwcomput ng Informatics and Genome Projects, Smith. D W , ed , Academic Press, New York, 1993, Computer Analysis of Sequence Data, Part I. Griffin, A M . and Gnffin, H G , eds , Humana Press, New Jersey, 1994, Sequence Analysis in Molecular Biology, von Hemje, G , Academic Press, 1987, and Sequence Analysis Primer. Gnbskov, M and Devereux. J , eds , M Stockton Press, New York, 1991, and Caπllo, H . and Lipman, D , SIAM J Applied Math , 48 1073 (1988) Preferred methods to determine identity are designed to give the largest match between the sequences tested Methods to determine identity and similarity are codified in publicly available computer programs Preferred computer program methods to determine identity and similarity between two sequences include, but are not limited to, the GCG program package (Devereux, J , et al , Nucleic Acids Research 12(1) 387 (1984)), BLASTP, BLASTN, and FASTA (Atschul. S F et al , J Molec Biol 215 403-410 (1990) The BLAST X program is publicly available from NCBI and other sources (BLAST Manual Altschul. _ , et al , NCBI NLM NIH Bethesda, MD 20894, Altschul, S , et al , J Mol Biol 215 403-410 (1990) As an illustration, b a polynucleotide having a nucleotide sequence having at least, for example. 95% "identity" to a reference nucleotide sequence of SEQ ID NO 1 it is intended that the nucleotide sequence of the polynucleotide is identical to the reference sequence except that the polynucleotide sequence may include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence of SEQ ID NO 1 In other words, to obtam a polynucleotide havmg a nucleotide sequence at least 95% identical to a reference nucleotide sequence, up to 5% of the nucleotides in the reference sequence may be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence may be inserted mto the reference sequence These mutations of the reference sequence may occur at the 5 or 3 terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either individually among nucleotides m the reference sequence or in one or more contiguous groups withm the reference sequence Analogously

a polypeptide having an ammo acid sequence having at least, for example, 95%o identity to a reference ammo acid sequence of SEQ ID NO 2 is intended that the ammo acid sequence of the polypeptide is identical to the reference sequence except that the polypeptide sequence may include up to five ammo acid alterations per each 100 ammo acids of the reference ammo acid of SEQ ID NO 2 In other words, to obtam a polypeptide having an ammo acid sequence at least 95% identical to a reference ammo acid sequence, up to 5%> of the ammo acid residues in the reference sequence may be deleted or substituted with another ammo acid, or a number of ammo acids up to 5% of the total ammo acid residues in the reference sequence may be inserted mto the reference sequence These alterations of the reference sequence may occur at the ammo or carboxy terminal positions of the reference ammo acid sequence or anywhere between those terminal positions, interspersed either individually among residues m the reference sequence or in one or more contiguous groups within the reference sequence "Isolated" means altered "by the hand of man" from its natural state, i e , if it occurs m nature, it has been changed or removed from its onginal environment, or both For example, a polynucleotide or a polypeptide naturally present m a living orgamsm is not "isolated," but the same polynucleotide or polypeptide separated from the coexisting matenals of its natural state is "isolated", as the term is employed herem Moreover, a polynucleotide or polypeptide that is mtroduced mto an orgamsm by transformation, genetic mampulation or by any other recombinant method is "isolated" even if it is still present m said orgamsm, which orgamsm may be Irving or nonliving "Polynucleotide(s)" generally refers to any polynbonucleotide or

which may be unmodified RNA or DNA or modified RNA or DNA "Polynucleotide(s)" mclude, without limitation, smgle- and double-stranded DNA, DNA that is a mixture of smgle- and double- stranded regions or smgle-, double- and tnple-stranded regions, smgle- and double-stranded RNA, and RNA that is mixture of smgle- and double-stranded regions, hybnd molecules compnsmg DNA and RNA that may be single-stranded or, more typically, double-stranded, or tnple-stranded regions, or a mixture of smgle- and double-stranded regions In addition, "polynucleotide" as used herem refers to tnple-stranded regions compnsmg RNA or DNA or both RNA and DNA The strands m such regions may be from the same molecule or from different molecules The regions ma\ mclude all of one or more of the molecules, but more typically mvolve only a region of some of the molecules One of the molecules of a tnple-helical region often is an oligonucleotide As used herem. the term "polynucleotide(s)" also mcludes DNAs or RNAs as descnbed above that contain one or more modified bases Thus, DNAs or RNAs with backbones modified for stability or for other reasons are "polynucleotide(s)" as that term is mtended herem Moreo\ er. DNAs or RNAs compnsmg unusual bases, such as mosme, or modified bases, such as tntylated bases, to name just two examples, are polynucleotides as the term is used herem It will be appreciated that a great vanety of modifications have been made to DNA and RNA that serve many useful purposes known to those of skill m the art The term "polynucleotide(s)" as it is employed herem embraces such chemically, enzymatically or metabohcally modified forms of polynucleotides. as well as the chemical forms of DNA and RNA charactenstic of viruses and cells, mcludmg for example, simple and complex cells "Polynucleotide(s)" also embraces short polynucleotides often refened to as olιgonucleotide(s)

"Polypeptide(s)" refers to any peptide or protem compnsmg two or more ammo acids jomed to each other by peptide bonds or modified peptide bonds "Polypeptide(s)" refers to both short chains, commonly refened to as peptides, oligopeptides and oligomers and to longer chains generally refened to as proteins Polypeptides may contain ammo acids other than the 20 gene encoded ammo acids "Polypeptιde(s)" mclude those modified either by natural processes, such as processmg and other post-translational modifications, but also by chemical modification techmques Such modifications are well descnbed m basic texts and in more detailed monographs, as well as m a voluminous research literature, and they are well known to those of skill m the art It will be appreciated that the same type of modification ma be present m the same or varying degree at several sites m a given polypeptide Also, a given polypeptide may contain many types of modifications Modifications can occur anywhere m a polypeptide. mcludmg the peptide backbone, the ammo acid side-chains, and the ammo or carboxyl termini Modifications mclude, for example, acetylation, acylation, ADP-nbosylation, amidation. covalent attachment of flavm, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide denvative, covalent attachment of a hpid or kpid denvative, covalent attachment of phosphotidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent cross-links, formation of cysteine, formation of pyroglutamate, formylation, gamma-carboxylation, glycosylation, GPI anchor formation, hydroxvlation. lodmation, methylation. mynstoylation, oxidation, proteolytic processmg, phosphorylation. prenylation. racemization, glycosylation, pid attachment, sulfation, gamma- carboxylation of glutamic acid residues, hydroxvlation and ADP-nbosylation. selenoylation, sulfation. transfer-RNA mediated addition of ammo acids to proteins, such as arginylation, and ubiquitination See. for instance, PROTEINS - STRUCTURE AND MOLECULAR PROPERTIES, 2nd Ed , T E Creighton, W H Freeman and Company, New York (1993) and Wold, F , Posttranslational Protem Modifications Perspectives and Prospects, pgs 1-12 m POSTTRANSLATIONAL COVALENT MODIFICATION OF PROTEINS, B C Johnson. Ed , Academic Press, New York (1983), Seifter et al , Meth Enzymol 182 626-646 (1990) and Rattan et al , Protein Synthesis Posttranslational Modifications and Aging, Arm N Y Acad Sci 663 48- 62 (1992) Polypeptides may be branched or cyclic, with or without branching Cyclic, branched and branched circular polypeptides may result from post-translational natural processes and may be made by entirely synthetic methods, as well

'Nanant(s)" as the term is used herein, is a polynucleotide or polypeptide that differs from a reference polynucleotide or polypeptide respectively, but retains essential properties A typical variant of a polynucleotide differs in nucleotide sequence from another, reference polynucleotide Changes m the nucleotide sequence of the variant may or may not alter the ammo acid sequence of a polypeptide encoded by the reference polynucleotide Nucleotide changes may result m ammo acid substitutions, additions, deletions, fusions and truncations m the polypeptide encoded by the reference sequence, as discussed below A typical vanant of a polypeptide differs in ammo acid sequence from another, reference polypeptide Generally, differences are limited so that the sequences of the reference polypeptide and the variant are closely similar overall and, m many regions, identical A variant and reference polypeptide may differ in ammo acid sequence by one or more substitutions, additions, deletions m any combmation A substituted or inserted ammo acid residue may or may not be one encoded by the genetic code A variant of a polynucleotide or polypeptide may be a naturally occurnng such as an allehc variant, or it may be a variant that is not known to occur naturally Non- naturally occurnng variants of polynucleotides and polypeptides may be made by mutagenesis techniques, by direct synthesis, and by other recombinant methods known to skilled artisans EXAMPLES

The examples below are earned out usmg standard techmques, which are well known and routme to those of skill m the art, except where otherwise descnbed m detail The examples are illustrative, but do not limit the mvention Example 1 Strain selection, Library Production and Sequencing The polynucleotide having a DNA sequence given in Table 1 [SEQ ID NO 1 or 3] was obtained from a library of clones of chromosomal DNA of Streptococcus pneumomae in E coh The sequencmg data from two or more clones containing overlapping Streptococcus pneumomae DNAs was used to construct the contiguous DNA sequence m SEQ ID NO 1 Libraries may be prepared by routme methods, for example Methods 1 and 2 below

Total cellular DNA is isolated from Streptococcus pneumomae 0100993 according to standard procedures and size-fractionated by either of two methods Method 1 Total cellular DNA is mechanically sheared by passage through a needle in order to size-fractionate according to standard procedures DNA fragments of up to 1 lkbp m size are rendered blunt by treatment with exonuclease and DNA polymerase, and EcoRI linkers added Fragments are hgated mto the vector Lambda ZapII that has been cut with EcoRI. the library packaged by standard procedures and E coh infected with the packaged library The library is amplified by standard procedures Method 2

Total cellular DNA is partially hydrolyzed with a one or a combmation of restriction enzymes appropriate to generate a series of fragments for clomng mto library vectors (e g , Rsal, Pall, AM. Bshl235I). and such fragments are size-fractionated accordmg to standard procedures EcoRI linkers are hgated to the DNA and the fragments then hgated mto the vector Lambda ZapII that have been cut with EcoRI, the library packaged by standard procedures, and E coh infected with the packaged library The library is amplified by standard procedures S. pneumoniae Riboflavin Biosynthesis Operon

This ORF is part of an operon which encodes genes nbG, nbB, nbA and ribH Gene ribG starts at nucleotide 1 and ends at nucleotide 1101 Gene nbB starts at nucleotide 1086 and ends at nucleotide 1721 Gene nbA starts at nucleotide 1711 and ends at nucleotide 2949 Gene ribH starts at nucleotide 2950 and ends at nucleotide 3417 This operon (SEQ ID NO 7) is as follows

ATGAGCGATTCAAAATATATGAAATTAGCAATAAAACTGGCACAAAAAGGGGCTGGTTACGTCAATCCC AATCCTATGGTTGGCGCAATTATTGTAAAAGATAATCACATTATCGGACAAGGTTATCATGAGTTTTTT GGTGGCCCACATGCTGAGAGAAATGCTCTTAAAAACTGTAGAAAATCCCCTGTCGGAGCGACGCTTTAT GTAACACTTGAACCCTGTTGTCACTTCGGGAAAACACCTCCCTGTATAGATGCTATAATCGATAGTGGT ATTACAAGAGTAGTCATTGGAAGCCTAGACTGTAATCCTATTGTATCTGGAAAAGGAGTAAAGATACTT GAGGAAAATAATCTTCAAGTTACTGTTGGAATTTTAGAAAATGAGTGTCTTAACTTAATAAAAAGTTTT AGAAAGTATATTACCCAGCATGTACCCTATGTTTTTATGAAATATGCAATGTCAATGGATGGAAAAATA GCCACTAAAACAAATCAATCCAAATGGATTACTGAAGAAGAAGCAAGAAAGCATGTGCATCAGTTACGA CACTATGTTAGTGCAATTATGGTGGGAGTCAATACTGTTATTCAAGACGATCCTTTGCTGACATGTAGA TTGGAGGAAGGGAAAAATCCTATCCGTATCATATGCGATACACATTTACGAACTCCTCTTACCTCTAAA ATCGTAAAAACAGCAAATGATATTAAAACTTACATTGCCACTTCCTCTGAAGACAAAAATAAAATGAAG CTATATCAAAATCATGGCTGTGAAATACTTTCCATAAAGAAAAAAGGCAATCATATAGACTTATCGAGT TTAATGCAACATCTAGGAAACATGCAGATTGATAGCCTAGTTCTAGAGGGGGGCAGTCTAATGAATTGG AGTGCTTTGGAACAACAAATTGTTGATGAGCTGAAAATATATATTGCACCAAAAATTTTTGGAGGCAGT GCCAAGTTTCCTGTCGGAGGTGAAGGCATTTCTTTGCCAAATGACGCTATTAGATTGAAACCTTATGCT TTTTCTCAAATAGGAAATGACTATCTCATAGAAAGTGAAGTGATTTATCCATGTTCACAGGAATAATTG AAGAAATCGGAAAAGTTGAAAGAATACAGAAAGACTCTCGTAATTGTAAACTATCAATTAAAGCCTCAA AAATATTAACGGATATCCATTTAGGCGATAGTATAGCAGTAAATGGTATCTGTCTTACAGTTACTCATT TCAATCATCAATCCTTTACAGTTGATGTAATGAATGAAACATGGAGTCGAACAGCTCTTACTCTATTAA AACATGGAAGTGAGGTGAATCTAGAAAGAGCCTTATCTGTCAACGGTCGACTTGGGGGTCACGTCGTTA CAGGACACATTGATGGTACAGGAAAAATCTCGTCAATAAAAAAAGATGATAATGCTGTATGGTATCAAA TCAACACACAAAAAGAAATTTTAGATTTAATAGTTGAAAAAGGATCTATTACAATTGACGGCATTAGTC TGACTGTCGCTAAAGTCTCCAAAGTAAACTTTTCAGTATCTGTTATCCCTCATACCTTGAAACAAACCA TTCTTAAGAGTAAACAAGTCGGGAGTACAGTAAATCTTGAAAATGATATCTTAGGTAAATATGTGCAAA AACTGATGGATAACTCTCCAAAATCAGAAATATCGAAGGAACTATTATATCAAAATGGATTTTAGCAGA AAGGATAATCAGTCAATGGAATATCGAAAAATGACAAGAAGCATTGAGGAAGCATTGCAGAAGGGACGA CTTGTTCTTGTTATAGACGACAAGGATAGAGAAAATGAAGGAGACTTAATTTGTTCTGCACAAGCAGCT ACAACAGAAAATGTTAATTTTATGGCTACTTATGCCAAAGGATTAATTTGTATGCCTATGAGCGAAAGT TTAGCTAATCAATTAATGCTTTCACCTATGGTTGAAAACAATACAGATAATCATAAGACTGCTTTTACA GTTTCAATTGATTATAAAGAAACGACCACAGGTATTTCTGCCGAGGAAAGAGGACTGACCGCACGTATG TGTGTAGCTGAAGATATAACACCCTCTGATTTTCGCAGGCCAGGACACATGTTTCCTTTAATTGCAAAA AAAGGTGGTGTTCTAGAAAGAAATGGACACACAGAAGCAACTGTTGATTTATTAAAATTAGCTGGACTA AAAGAGTGTGGCCTATGTTGTGAAATAATGAATCATGATGGCAAAATGATGAGAACAGATGATTTAATT CAGTTCTCGAAGAAACACAACATTCCACTAATTACCATCAAAGAATTACAAGAATATAGAAAAGTATAT GATCAGCTGGTAGAACGAGTTTCAACTGTCAATATGCCTACTAGATACGGTAATTTCAAAGCAATTAGC TATATAGATAAACTAAATGGGGAACATCATCTTGCTCTTATTATGGGAAACATAGAGGATGAAGCCAAT GTATTATGTCGGGTCCACTCCGAATGTTTAACAGGAGATGTTTTAGGCTCTTTACGTTGCGATTGTGGA CAGCAATTCGATAAAGCTATGAAAATGATTGTTGAGAATGGTTCGGGTGTCTTACTTTACTTGCGACAG GAGGGACAAGGAATTGGACTTATCAATAAATTAAAAGCCTATCATTTACAAAATCAAGGCATGGATACG CTTGATGCCAATCTTGCATTAGGCTTTGAAGGTGATTTAAGAGAATATCATATTGGAGCACAAATGCTT AAAGATCTGGGACTTCAGTCACTTCATTTACTGACAAATAATCCTGACAAGGTTGAACAGTTAGAAAAA TATGGAATTACCATTTCCAGTAGAATATCAATCGAAATAGAAGCCAATCCTTACGATAGTTTTTATTTA GAAACAAAGAAAAATCGAATGGGTCACATTTTAAATATGGAGGAAAAATAAATGAACACTTATGAAGGT AATTTAGTAGCAAACAATATTAAAATAGGTATTGTTGTAGCGAGATTTAATGAATTTATAACTTCAAAA TTATTATCTGGAGCACTAGATAATCTCAAAAGAGAGAATGTAAACGAGAAAGATATCGAGGTAGCCTGG GTTCCAGGAGCTTTTGAAATACCACTGATTGCATCAAAAATGGCAAAAAGTAAAAAATATGATGCAATT ATCTGCTTGGGAGCTGTCATTAGAGGGAATACAAGTCATTATGATTATGTATGTAGCGAGGTATCTAAA GGAATCGCCCAAATCAGTTTAAATAGCGAAATTCCTGTTATGTTTGGTGTGCTAACGACAGATACAATT GAACAAGCCATAGAACGAGCTGGTACTAAAGCAGGAAATAAGGGTTCTGAGTGTGCACAAGGAGCTATT GAAATGGTCAACCTAATTCGTACATTAGACGCATAG

Claims

What is claimed is:

1 An isolated polynucleotide compnsmg a polynucleotide havmg at least a 70% identity to a polynucleotide encoding a polypeptide compnsmg the ammo acid sequence of SEQ ID NO 2

2 An isolated polynucleotide compnsmg a polynucleotide havmg at least a 70% identity to a polynucleotide encoding the same mature polypeptide expressed by the nbG gene contained in the Streptococcus pneumomae of the deposited stram

3 An isolated polynucleotide compnsmg a polynucleotide encodmg a polypeptide compnsmg an ammo acid sequence which is at least 70% identical to the ammo acid sequence of SEQ ID NO 2

4 An isolated polynucleotide that is complementary to the polynucleotide of claim 1

5 The polynucleotide of Claim 1 where the polynucleotide is DNA or RNA

6 The polynucleotide of Claim 1 compnsmg the nucleic acid sequence set forth m SEQ ID NO 1

7 The polynucleotide of Claim 1 compnsmg nucleotide 1 to the stop codon which begins at nucleotide number 1099 set forth in SEQ ID NO 1

8 The polynucleotide of Claim 1 which encodes a polypeptide compnsmg the ammo acid sequence of SEQ ID NO 2

9 A vector compnsmg the polynucleotide of Claim 1

10 A host cell compnsmg the vector of Claim 9

11 A process for producmg a polypeptide compnsmg expressmg from the host cell of Claim 10 a po peptide encoded by said DNA

12 A process for producing a nbG polypeptide or fragment compnsmg culturmg a host of claim 10 under conditions sufficient for the production of said polypeptide or fragment

13 A polypeptide compnsmg an ammo acid sequence which is at least 70% identical to the ammo acid sequence of SEQ ID NO 2

14 A polypeptide compnsmg an ammo acid sequence as set forth m SEQ ID NO 2

15 An antibody against the polypeptide of claim 14

16 An antagonist which inhibits the activity or expression of the polypeptide of claim 14

17 A method for the treatment of an mdividual m need of nbG polypeptide compnsmg administering to the mdividual a therapeutically effective amount of the polypeptide of claim 14

18 A method for the treatment of an mdividual havmg need to inhibit nbG polypeptide compnsmg administering to the mdividual a therapeutically effective amount of the antagomst of Claim 14

19 A process for diagnosing a disease related to expression or activity of the polypeptide of claim 14 m an mdividual compnsmg

(a) determining a nucleic acid sequence encoding said polypeptide. and/or

(b) analyzing for the presence or amount of said polypeptide m a sample denved from the mdividual

20 A method for identifying compounds which mteract with and inhibit or activate an activity of the polypeptide of claim 14 compnsmg contacting a composition compnsmg the polypeptide with the compound to be screened under conditions to permit mteraction between the compound and the polypeptide to assess the mteraction of a compound, such mteraction bemg associated with a second component capable of providing a detectable signal m response to the mteraction of the polypeptide with the compound, and determining whether the compound interacts with and activates or inhibits an activity of the polypeptide by detectmg the presence or absence of a signal generated from the mteraction of the compound with the polypeptide

21 A method for inducing an immunological response in a mammal which comprises moculatmg the mammal with nbG polypeptide of claim 14, or a fragment or variant thereof, adequate to produce antibody and or T cell immune response to protect said animal from disease

22 A method of mducmg immunological response m a mammal which compnses delivering a nucleic acid vector to direct expression of nbG polypeptide of claim 14, or fragment or a variant thereof, for expressing said nbG polypeptide, or a fragment or a variant thereof in vivo in order to induce an immunological response to produce antibody and/ or T cell immune response to protect said animal from disease

23 An isolated polynucleotide compnsmg a polynucleotide havmg at least a 70% identity to a polynucleotide encoding a polypeptide compnsmg the ammo acid sequence of SEQ ID NO 4

24. An isolated polynucleotide comprising a polynucleotide having at least a 70% identity to the polynucleotide sequence of SEQ ID NO:3.