WO1999021982A1 - Human m6b1 gene - Google Patents

Abstract

Human M6b1 polypeptides and polynucleotides and methods for producing such polypeptides by recombinant techniques are disclosed. Also disclosed are methods for utilizing human M6b1 polypeptides and polynucleotides in the design of protocols for the treatment of genetic diseases, such as Charcot-Marie-Tooth disease, X-linked mental retardation, Partington syndrome, Aicardis syndrome, Rett syndrome and Pelizaeus-Merzbracher disease, among others, and diagnostic assays for such conditions.

Description

HUMAN M6B1 GENE

FIELD OF INVENTION

This invention relates to newly identified polynucleotides, polypeptides encoded by them and to the use of such polynucleotides and polypeptides, and to their production. More particularly, the polynucleotides and polypeptides of the present invention relate to the PLP gene family, hereinafter referred to as human M6bl. The invention also relates to inhibiting or activating the action of such polynucleotides and polypeptides.

BACKGROUND OF THE INVENTION

PLP is the major component of myelin, a strongly hydrophobic membrane protein. In research on molecules involved in the development of the mouse nervous system, two murine cDNAs, M6a and M6b, were obtained which were highly homologous to PLP. M6a is expressed only in neurons, while M6b is expressed in both neurons and in the glia. By screening a human spinal cord cDNA library with murine M6a and M6b cDNA, the partial cDNA sequence of human M6a (GenBank Accession No. U45956) and M6b (GenBank Accession No. U45955) were cloned and mapped to 4q34 and Xp22.2 respectively.

This indicates that the PLP gene family has an established, proven history as therapeutic targets. Clearly there is a need for identification and characterization of further members of the PLP gene family which can play a role in preventing, ameliorating or correcting dysfunctions or diseases, including, but not limited to, genetic diseases, such as Charcot-Marie-Tooth disease, X-linked mental retardation, Partington syndrome, Aicardis syndrome, Rett syndrome and Pelizaeus-Merzbracher disease.

SUMMARY OF THE INVENTION

In one aspect, the invention relates to human M6bl polypeptides and recombinant materials and methods for their production. Another aspect of the invention relates to methods for using such human M6bl polypeptides and polynucleotides. Such uses include the treatment of genetic diseases, such as Charcot-Marie-Tooth disease, X-linked mental retardation, Partington syndrome, Aicardis syndrome, Rett syndrome and Pelizaeus-Merzbracher disease, among others. In still another aspect, the invention relates to methods to identify agonists and antagonists using the materials provided by the invention, and treating conditions associated with human M6bl imbalance with the identified compounds. Yet another aspect of the invention relates to diagnostic assays for detecting diseases associated with inappropriate human M6b 1 activity or levels .

DESCRIPTION OF THE INVENTION

Definitions

The following definitions are provided to facilitate understanding of certain terms used frequently herein.

"Human M6M" refers, among others, generally to a polypeptide having the amino acid sequence set forth in SEQ ID NO:2 or an allelic variant thereof.

"Human M6bl activity or human M6bl polypeptide activity" or "biological activity of the human M6bl or human M6bl polypeptide" refers to the metabolic or physiologic function of said human M6bl including similar activities or improved activities or these activities with decreased undesirable side-effects. Also included are antigenic and immunogenic activities of said human M6bl.

"Human M6bl gene" refers to a polynucleotide having the nucleotide sequence set forth in SEQ ID NO:l or allelic variants thereof and/or their complements. "Antibodies" as used herein includes polyclonal and monoclonal antibodies, chimeric, single chain, and humanized antibodies, as well as Fab fragments, including the products of an Fab or other immunoglobulin expression library.

"Isolated" means altered "by the hand of man" from the natural state. If an "isolated" composition or substance occurs in nature, it has been changed or removed from its original environment, or both. For example, a polynucleotide or a polypeptide naturally present in a living animal is not "isolated," but the same polynucleotide or polypeptide separated from the coexisting materials of its natural state is "isolated", as the term is employed herein. "Polynucleotide" generally refers to any polyribonucleotide or polydeoxribonucleotide, which may be unmodified RNA or DNA or modified RNA or DNA. "Polynucleotides" include, without limitation single- and double-stranded DNA, DNA that is a mixture of single- and double- stranded regions, single- and double-stranded RNA, and RNA that is mixture of single- and double-stranded regions, hybrid molecules comprising DNA and RNA that may be single-stranded or, more typically, double-stranded or a mixture of single- and double-stranded regions. In addition, "polynucleotide" refers to triple-stranded regions comprising RNA or DNA or both RNA and DNA. The term polynucleotide also includes DNAs or RNAs containing one or more modified bases and DNAs or RNAs with backbones modified for stability or for other reasons. "Modified" bases include, for example, tritylated bases and unusual bases such as inosine. A variety of modifications has been made to DNA and RNA; thus, "polynucleotide" embraces chemically, enzymatically or metabolically modified forms of polynucleotides as typically found in nature, as well as the chemical forms of DNA and RNA characteristic of viruses and cells. "Polynucleotide" also embraces relatively short polynucleotides, often referred to as oligonucleotides. "Polypeptide" refers to any peptide or protein comprising two or more amino acids joined to each other by peptide bonds or modified peptide bonds, i.e., peptide isosteres. "Polypeptide" refers to both short chains, commonly referred to as peptides, oligopeptides or oligomers, and to longer chains, generally referred to as proteins. Polypeptides may contain amino acids other than the 20 gene-encoded amino acids. "Polypeptides" include amino acid sequences modified either by natural processes, such as posttranslational processing, or by chemical modification techniques which are well known in the art. Such modifications are well described in basic texts and in more detailed monographs, as well as in a voluminous research literature. Modifications can occur anywhere in a polypeptide, including the peptide backbone, the amino acid side-chains and the amino or carboxyl termini. It will be appreciated that the same type of modification may be present in the same or varying degrees at several sites in a given polypeptide. Also, a given polypeptide may contain many types of modifications. Polypeptides may be branched as a result of ubiquitination, and they may be cyclic, with or without branching. Cyclic, branched and branched cyclic polypeptides may result from posttranslation natural processes or may be made by synthetic methods. Modifications include acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphotidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent cross-links, formation of cystine, formation of pyroglutamate, formylation, gamma- carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristoylation, oxidation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquitination. See, for instance, PROTEINS - STRUCTURE AND MOLECULAR PROPERTIES, 2nd Ed., T. E. Creighton, W. H. Freeman and Company, New York, 1993 and Wold, F., Posttranslational Protein Modifications: Perspectives and Prospects, pgs. 1-12 in POSTTRANSLATIONAL COVALENT MODIFICATION OF PROTEINS, B. C. Johnson, Ed., Academic Press, New York, 1983; Seifter et al, "Analysis for protein modifications and nonprotein cofactors", Meth Enzymol (1990) 182:626-646 and Rattan et al, "Protein Synthesis: Posttranslational Modifications and Aging", Ann NYAcad Sci (1992) 663:48-62.

"Variant" as the term is used herein, is a polynucleotide or polypeptide that differs from a reference polynucleotide or polypeptide respectively, but retains essential properties. A typical variant of a polynucleotide differs in nucleotide sequence from another, reference polynucleotide. Changes in the nucleotide sequence of the variant may or may not alter the amino acid sequence of a polypeptide encoded by the reference polynucleotide. Nucleotide changes may result in amino acid substitutions, additions, deletions, fusions and truncations in the polypeptide encoded by the reference sequence, as discussed below. A typical variant of a polypeptide differs in amino acid sequence from another, reference polypeptide. Generally, differences are limited so that the sequences of the reference polypeptide and the variant are closely similar overall and, in many regions, identical. A variant and reference polypeptide may differ in amino acid sequence by one or more substitutions, additions, deletions in any combination. A substituted or inserted amino acid residue may or may not be one encoded by the genetic code. A variant of a polynucleotide or polypeptide may be a naturally occurring such as an allelic variant, or it may be a variant that is not known to occur naturally. Non-naturally occurring variants of polynucleotides and polypeptides may be made by mutagenesis techniques or by direct synthesis.

"Identity" is a measure of the identity of nucleotide sequences or amino acid sequences. In general, the sequences are aligned so that the highest order match is obtained. "Identity" per se has an art-recognized meaning and can be calculated using published techniques. See, e.g.: (COMPUTATIONAL MOLECULAR BIOLOGY, Lesk, A.M., ed., Oxford University Press, New York, 1988; BIOCOMPUTING: INFORMATICS AND GENOME PROJECTS, Smith, D.W., ed., Academic Press, New York, 1993; COMPUTER ANALYSIS OF SEQUENCE DATA, PART I, Griffin, A.M., and Griffin, H.G., eds., Humana Press, New Jersey, 1994; SEQUENCE ANALYSIS IN MOLECULAR BIOLOGY, von Heinje, G., Academic Press, 1987; and SEQUENCE ANALYSIS PRIMER, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991). While there exist a number of methods to measure identity between two polynucleotide or polypeptide sequences, the term "identity" is well known to skilled artisans (Carillo, H., and Lipton, D., SUM J Applied Math (1988) 48:1073). Methods commonly employed to determine identity or similarity between two sequences include, but are not limited to, those disclosed in Guide to Huge Computers, Martin J. Bishop, ed., Academic Press, San Diego, 1994, and Carillo, H, and Lipton, D., SIAM J Applied Math (1988) 48:1073. Methods to determine identity and similarity are codified in computer programs. Preferred computer program methods to determine identity and similarity between two sequences include, but are not limited to, GCS program package (Devereux, J., et al, Nucleic Acids Research (1984) 12(1):387), BLASTP, BLASTN, FASTA (Atschul, S.F. et al, JMolec Biol (1990) 215:403).

As an illustration, by a polynucleotide having a nucleotide sequence having at least, for example, 95% "identity" to a reference nucleotide sequence of SEQ ID NO: 1 is intended that the nucleotide sequence of the polynucleotide is identical to the reference sequence except that the polynucleotide sequence may include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence of SEQ ID NO: 1. In other words, to obtain a polynucleotide having a nucleotide sequence at least 95% identical to a reference nucleotide sequence, up to 5% of the nucleotides in the reference sequence may be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence may be inserted into the reference sequence. These mutations of the reference sequence may occur at the 5 or 3 terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either individually among nucleotides in the reference sequence or in one or more contiguous groups within the reference sequence.

Similarly, by a polypeptide having an amino acid sequence having at least, for example, 95% "identity" to a reference amino acid sequence of SEQ ID NO:2 is intended that the amino acid sequence of the polypeptide is identical to the reference sequence except that the polypeptide sequence may include up to five amino acid alterations per each 100 amino acids of the reference amino acid of SEQ ID NO: 2. In other words, to obtain a polypeptide having an amino acid sequence at least 95% identical to a reference amino acid sequence, up to 5% of the amino acid residues in the reference sequence may be deleted or substituted with another amino acid, or a number of amino acids up to 5% of the total amino acid residues in the reference sequence may be inserted into the reference sequence. These alterations of the reference sequence may occur at the amino or carboxy terminal positions of the reference amino acid sequence or anywhere between those terminal positions, interspersed either individually among residues in the reference sequence or in one or more contiguous groups within the reference sequence.

Polypeptides of the Invention In one aspect, the present invention relates to human M6bl polypeptides (or human M6bl proteins). The human M6bl polypeptides include the polypeptide of SEQ ID NO:2; as well as polypeptides comprising the amino acid sequence of SEQ ID NO: 2; and polypeptides comprising the amino acid sequence which have at least 80% identity to that of SEQ ID NO:2 over its entire length, and still more preferably at least 90% identity, and even still more preferably at least 94- 95% identity to SEQ ID NO: 2. Furthermore, those with at least 97-99% are highly preferred. Also included within human M6bl polypeptides are polypeptides having the amino acid sequence which have at least 80% identity to the polypeptide having the amino acid sequence of SEQ ID NO:2 over its entire length, and still more preferably at least 90% identity, and still more preferably at least 94-95% identity to SEQ ID NO:2. Furthermore, those with at least 97-99% are highly preferred. Preferably human M6bl polypeptide exhibit at least one biological activity of human M6bl.

The human M6bl polypeptides may be in the form of the "mature" protein or may be a part of a larger protein such as a fusion protein. It is often advantageous to include an additional amino acid sequence which contains secretory or leader sequences, pro-sequences, sequences which aid in purification such as multiple histidine residues, or an additional sequence for stability during recombinant production.

Fragments of the human M6bl polypeptides are also included in the invention. A fragment is a polypeptide having an amino acid sequence that entirely is the same as part, but not all, of the amino acid sequence of the aforementioned human M6bl polypeptides. As with human M6bl polypeptides, fragments may be "free-standing," or comprised within a larger polypeptide of which they form a part or region, most preferably as a single continuous region. Representative examples of polypeptide fragments of the invention, include, for example, fragments from about amino acid number 1-20, 21-40, 41-60, 61- 80, 81-100, and 101 to the end of human M6bl polypeptide. In this context "about" includes the particularly recited ranges larger or smaller by several, 5, 4, 3, 2 or 1 amino acid at either extreme or at both extremes.

Preferred fragments include, for example, truncation polypeptides having the amino acid sequence of human M6bl polypeptides, except for deletion of a continuous series of residues that includes the amino terminus, or a continuous series of residues that includes the carboxyl terminus or deletion of two continuous series of residues, one including the -imino terminus and one including the carboxyl terminus. Also preferred are fragments characterized by structural or functional attributes such as fragments that comprise alpha-helix and alpha-helix forming regions, beta-sheet and beta-sheet- forming regions, turn and turn-forming regions, coil and coil-forming regions, hydrophilic regions, hydrophobic regions, alpha amphipathic regions, beta amphipathic regions, flexible regions, surface- forming regions, substrate binding region, and high antigenic index regions. Other preferred fragments are biologically active fragments. Biologically active fragments are those that mediate human M6bl activity, including those with a similar activity or an improved activity, or with a decreased undesirable activity. Also included are those that are antigenic or immunogenic in an animal, especially in a human. Preferably, all of these polypeptide fragments retain the biological activity of the human M6b 1 , including antigenic activity. Variants of the defined sequence and fragments also form part of the present invention. Preferred variants are those that vary from the referents by conservative amino acid substitutions - i.e., those that substitute a residue with another of like characteristics. Typical such substitutions are among Ala, Val, Leu and lie; among Ser and Thr; among the acidic residues Asp and Glu; among Asn and Gin; and among the basic residues Lys and Arg; or aromatic residues Phe and Tyr. Particularly preferred are variants in which several, 5-10, 1-5, or 1-2 amino acids are substituted, deleted, or added in any combination.

The human M6b 1 polypeptides of the invention can be prepared in any suitable manner. Such polypeptides include isolated naturally occurring polypeptides, recombinantly produced polypeptides, synthetically produced polypeptides, or polypeptides produced by a combination of these methods. Means for preparing such polypeptides are well understood in the art.

Polynucleotides of the Invention

Another aspect of the invention relates to human M6bl polynucleotides. Human M6bl polynucleotides include isolated polynucleotides which encode the human M6b 1 polypeptides and fragments, and polynucleotides closely related thereto. More specifically, human M6bl polynucleotide of the invention include a polynucleotide comprising the nucleotide sequence contained in SEQ ID NO: 1 encoding a human M6b 1 polypeptide of SEQ ID NO: 2, and polynucleotide having the particular sequence of SEQ ID NO: 1. human M6b 1 polynucleotides further include a polynucleotide comprising a nucleotide sequence that has at least 80% identity over its entire length to a nucleotide sequence encoding the human M6bl polypeptide of SEQ ID NO:2, and a polynucleotide comprising a nucleotide sequence that is at least 80% identical to of SEQ ID NO: 1 over its entire length. In this regard, polynucleotides at least 90% identical are particularly preferred, and those with at least 95% are especially preferred. Furthermore, those with at least 97% are highly preferred and those with at least 98-99% are most highly preferred, with at least 99% being the most preferred. Also included under human M6bl polynucleotides are a nucleotide sequence which has sufficient identity to a nucleotide sequence contained in SEQ ID NO: 1 to hybridize under conditions useable for amplification or for use as a probe or marker. The invention also provides polynucleotides which are complementary to such human M6bl polynucleotides.

Human M6bl of the invention is structurally related to other proteins of the PLP gene family family, as shown by the results of sequencing the cDNA of Table 1 (SEQ ID NO: 1) encoding human M6bl. The cDNA sequence of SEQ ID NO:l contains an open reading frame (nucleotide number 255 to 1049) encoding a polypeptide of 265 amino acids of SEQ ID NO:2. The amino acid sequence of

Table 2 (SEQ ID NO:2) has about 50% identity (using FASTA) in 265 amino acid residues with human Proteolipid Protein (H.J. Diehl et al Proc. Natl. Acad. Sci. USA 83:9807-9811, 1986). Furthermore, human M6bl is 93.4% identical to murine M6b protein over 258 amino acid residues. (Y. Yan et al., Neuron. 11:423-431, 1993). The nucleotide sequence of Table 1 (SEQ ID NO:l) has about 64.4% identity (using FASTA) in 410 nucleotide residues with human proteolipid gene (L.D. Hudson et al. Proc. Natl. Acad. Sci. USA. 86(20):8128-8131, 1989). Furthermore, human M6bl is 89.8% identical to murine M6b over 888 nucleotide residues (Y Yan et al., Neuron. 11 :423-431, 1993). Thus human M6bl polypeptides and polynucleotides of the present invention are expected to have, inter alia, similar biological functions/properties to their homologous polypeptides and polynucleotides, and their utility is obvious to anyone skilled in the art.

Table l^a

TAAAAAGCAAAAGAATTCCGGGGTAGTTATGGG.W-GAACCTAGAGAGCAAGAAGAAAAG AGGAATGGTGCCCGAATCTGGGAGAGATAGACTTCAGGATGGCCAGTCATTGAATGGGGG ATAGGTGAAGAACAGAGCCTCTCAATCAGACGGGTGTAAATAAGAGACGGAGGGGAGTCC AAAAGAAAAGGAAGAGGAGGAAAAACAAGTGTGTGTTGGGGGGAACAGGGGGAAAAGCAT TTTTGGTGGATGGTATGAAGCCAGCCATGGAAACTGCAGCCGAGGAAAATACTGAACAAA GCCAAGAGAGAAAAGGCTGCTTTGAATGCTGCATCAAGTGTCTGGGAGGAGTCCCCTACG CCTCCCTGGTGGCCACCATCCTCTGCTTCTCCGGGGTGGCCTTATTCTGCGGCTGTGGGC ATGTGGCTCTCGCAGGCACCGTGGCGATTCTTGAGCAACACTTCTCCACCAACGCCAGTG ACCATGCCTTGCTGAGCGAGGTGATACAACTGATGCAGTATGTCATCTATGGAATTGCGT CCTTTTTCTTCTTGTATGGGATCATTCTGTTGGCAGAAGGCTTTTACACCACAAGTGCAG TGAAAGAACTGCACGGTGAGTTTAAAACAACCGCTTGTGGCCGATGCATCAGTGGAATGT TCGTTTTCCTCACCTATGTGCTTGGAGTGGCCTGGCTGGGTGTGTTTGGTTTCTCAGCGG TGCCCGTGTTTATGTTCTACAACATATGGTCAACTTGTGAAGTCATCAAGTCACCGCAGA CCAACGGGACCACGGGTGTGGAGCAGATCTGTGTGGATATCCGACAATACGGTATCATTC CTTGGAATGCTTTCCCCGGAAAAATATGTGGCTCTGCCCTGGAGAACATCTGCAACACAA ACGAGTTCTACATGTCCTATCACCTGTTCATTGTGGCCTGTGCAGGAGCTGGTGCCACCG TCATTGCCCTGCTGATCTACATGATGGCTACTACATATAACTATGCGGTTTTGAAGTTTA AGAGTCGGGAAGATTGCTGCACTAAATTCTAAATTGCATAAGGAGTTTTAGAGAGCTATG CTCTGTAGCATGAAATATCACTGACACTCCAGACTAAAGCAGAGTCTAGGTTTCTGCAAT TTTGTTACAGTAATTTGTAAATAGCTTTAGTAAACTCACCTTGCATGGTAGATTAATAAG ATGACTTACTGTACATGAATTACACAATAATGAGATCTGGTGGCTATTTCCACATTTTGA AAAGGATTCAGTTATTTACTGACAGTGGTGAGCATCCTTTTTAAAATAATGTTCTGATAC TTAAACATTAGAGAGCAGTATCTTTAAATGAATTATTAACACTTTGGAATACTTACATTT TCTGTTATTTTTGATTGCCTGATAACCAGTTTCAATGATGAAAATGAAAACAAGTGCTGA AGATGAAATGGAAGAGAACCGTTTTAATCTGGATTTTGTTTTGTCACACCTGGAAAATAC TTTGCAAATATGTTCTAAATTGAAAACAATTTTTTTATGATCACATGGTTCACTACCAAA TGACCCTCAAATAAGCCAGATGAAAATTTGAAGAAAAAGGTCACCCAGTTCTCTGGAAAA AAAAAAAAAAAAAAAAAAAAAA

A nucleotide sequence of a human M6bl (SEQ ID NO: 1).

Table 2^b

MKPAMETAAEENTEQSQERKGCFECCIKCLGGVPYASLVATI CFSGVALFCGCGHVALA GTVAILEQHFSTNASDHALLSEVIQLMQYVIYGIAS FFFLYGIILLAEGFYTTSAVKELH GEFKTTACGRCI SGMFVFLTWLGVAW GVFGFSAVPVFMFYNIWSTCEVIKSPQTNGTT GVEQICVDIRQYGII PWNAFPGKICGSALENICNTNEF3ιrMSYHLFIVACAGAGATVIALL IYMMATTYNYAVLKFKSREDCCTKF . .

An amino acid sequence of a human M6bl (SEQ ID NO: 2).

One polynucleotide of the present invention encoding human M6b 1 may be obtained using standard cloning and screening, from a cDNA library derived from mRNA in cells of human brain using the expressed sequence tag (EST) analysis (Adams, M.D., et al. Science (1991) 252: 1651-1656; Adams, M.D. et al, Nature, (1992) 3.5.5:632-634; Adams, M.D., etal, Nature (1995) 377 Supp:3-174). Polynucleotides of the invention can also be obtained from natural sources such as genomic DNA libraries or can be synthesized using well known and commercially available techniques. The nucleotide sequence encoding human M6b 1 polypeptide of SEQ ID NO:2 may be identical to the polypeptide encoding sequence contained in Table 1 (nucleotide number 255 to 1049 of SEQ ID NO: 1), or it may be a sequence, which as a result of the redundancy (degeneracy) of the genetic code, also encodes the polypeptide of SEQ ID NO:2.

When the polynucleotides of the invention are used for the recombinant production of human M6b 1 polypeptide, the polynucleotide may include the coding sequence for the mature polypeptide or a fragment thereof, by itself; the coding sequence for the mature polypeptide or fragment in reading frame with other coding sequences, such as those encoding a leader or secretory sequence, a pre-, or pro- or prepro- protein sequence, or other fusion peptide portions. For example, a marker sequence which facilitates purification of the fused polypeptide can be encoded. In certain preferred embodiments of this aspect of the invention, the marker sequence is a hexa-histidine peptide, as provided in the pQE vector (Qiagen, Inc.) and described in Gentz et al.,Proc Natl Acad Sci USA (1989) 86:821- 824, or is an HA tag. The polynucleotide may also contain non-coding 5 ' and 3 ' sequences, such as transcribed, non-translated sequences, splicing and polyadenylation signals, ribosome binding sites and sequences that stabilize mRNA.

Further preferred embodiments are polynucleotides encoding human M6bl variants comprise the amino acid sequence human M6bl polypeptide of Table 2 (SEQ ID NO:2) in which several, 5-10, 1-5, 1-3, 1-2 or 1 amino acid residues are substituted, deleted or added, in any combination. The present invention further relates to polynucleotides that hybridize to the herein above- described sequences. In this regard, the present invention especially relates to polynucleotides which hybridize under stringent conditions to the herein above-described polynucleotides. As herein used, the term "stringent conditions" means hybridization will occur only if there is at least 80%, and preferably at least 90%), and more preferably at least 95%, yet even more preferably 91-99% identity between the sequences.

Polynucleotides of the invention, which are identical or sufficiently identical to a nucleotide sequence contained in SEQ ID NO: 1 or a fragment thereof, may be used as hybridization probes for cDNA and genomic DNA, to isolate full-length cDNAs and genomic clones encoding human M6b 1 polypeptide and to isolate cDNA and genomic clones of other genes (including genes encoding homologs and orthologs from species other than human) that have a high sequence similarity to the human M6b 1 gene. Such hybridization techniques are known to those of skill in the art. Typically these nucleotide sequences are 80% identical, preferably 90% identical, more preferably 95% identical to that of the referent. The probes generally will comprise at least 15 nucleotides. Preferably, such probes will have at least 30 nucleotides and may have at least 50 nucleotides. Particularly preferred probes will range between 30 and 50 nucleotides.

In one embodiment, to obtain a polynucleotide encoding human M6bl polypeptide, including homologs and orthologs from species other than human, comprises the steps of screening an appropriate library under stingent hybridization conditions with a labeled probe having the SEQ ID NO: 1 or a fragment thereof; and isolating full-length cDNA and genomic clones containing said polynucleotide sequence. Thus in another aspect, human M6b 1 polynucleotides of the present invention further include a nucleotide sequence comprising a nucleotide sequence that hybridize under stringent condition to a nucleotide sequence having SEQ ID NO: 1 or a fragment thereof. Also included with human M6b 1 polypeptides are polypeptide comprising amino acid sequence encoded by nucleotide sequence obtained by the above hybridization condition. Such hybridization techniques are well known to those of skill in the art. Stringent hybridization conditions are as defined above or, alternatively, conditions under overnight incubation at 42°C in a solution comprising: 50% formamide, 5xSSC (150mM NaCl, 15mM trisodium citrate), 50 mM sodium phosphate (pH7.6), 5x Denhardt's solution, 10 % dextran sulfate, and 20 microgram/ml denatured, sheared salmon sperm DNA, followed by washing the filters in 0. Ix SSC at about 65°C.

The polynucleotides and polypeptides of the present invention may be employed as research reagents and materials for discovery of treatments and diagnostics to animal and human disease.

Vectors, Host Cells, Expression

The present invention also relates to vectors which comprise a polynucleotide or polynucleotides of the present invention, and host cells which are genetically engineered with vectors of the invention and to the production of polypeptides of the invention by recombinant techniques. Cell-free translation systems can also be employed to produce such proteins using RNAs derived from the DNA constructs of the present invention.

For recombinant production, host cells can be genetically engineered to incorporate expression systems or portions thereof for polynucleotides of the present invention. Introduction of polynucleotides into host cells can be effected by methods described in many standard laboratory manuals, such as Davis et al, BASIC METHODS IN MOLECULAR BIOLOG (1986) and Sambrook et .,MOLECULAR CLONING: A LABORATORY MANUAL, 2nd Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989) such as calcium phosphate transfection, DEAE-dextran mediated transfection, transvection, microinjection, cationic lipid-mediated transfection, electroporation, transduction, scrape loading, ballistic introduction or infection.

Representative examples of appropriate hosts include bacterial cells, such as streptococci, staphylococci, E. coli, Streptomyces and Bacillus subtilis cells; fungal cells, such as yeast cells and Aspergillus cells; insect cells such as Drosophila S2 and Spodoptera Sf9 cells; animal cells such as CHO, COS, HeLa, C127, 3T3, BHK, HEK 293 and Bowes melanoma cells; and plant cells.

A great variety of expression systems can be used. Such systems include, among others, chromosomal, episomal and virus-derived systems, e.g., vectors derived from bacterial plasmids, from bacteriophage, from transposons, from yeast episomes, from insertion elements, from yeast chromosomal elements, from viruses such as baculoviruses, papova viruses, such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses and retroviruses, and vectors derived from combinations thereof, such as those derived from plasmid and bacteriophage genetic elements, such as cosmids and phagemids. The expression systems may contain control regions that regulate as well as engender expression. Generally, any system or vector suitable to maintain, propagate or express polynucleotides to produce a polypeptide in a host may be used. The appropriate nucleotide sequence may be inserted into an expression system by any of a variety of well-known and routine techniques, such as, for example, those set forth in Sambrook et al, MOLECULAR CLONING, A LABORATORY MANUAL (supra).

For secretion of the translated protein into the lumen of the endoplasmic reticulum, into the periplasmic space or into the extracellular environment, appropriate secretion signals may be incorporated into the desired polypeptide. These signals may be endogenous to the polypeptide or they may be heterologous signals .

If the human M6bl polypeptide is to be expressed for use in screening assays, generally, it is preferred that the polypeptide be produced at the surface of the cell. In this event, the cells may be harvested prior to use in the screening assay. If human M6bl polypeptide is secreted into the medium, the medium can be recovered in order to recover and purify the polypeptide; if produced intracellularly, the cells must first be lysed before the polypeptide is recovered. human M6bl polypeptides can be recovered and purified from recombinant cell cultures by well-known methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. Most preferably, high performance liquid chromatography is employed for purification. Well known techniques for refolding proteins may be employed to regenerate active conformation when the polypeptide is denatured during isolation and or purification.

Diagnostic Assays This invention also relates to the use of human M6b 1 polynucleotides for use as diagnostic reagents. Detection of a mutated form of human M6b 1 gene associated with a dysfunction will provide a diagnostic tool that can add to or define a diagnosis of a disease or susceptibility to a disease which results from under-expression, over-expression or altered expression of human M6b 1. Individuals carrying mutations in the human M6bl gene may be detected at the DNA level by a variety of techniques.

Nucleic acids for diagnosis may be obtained from a subject's cells, such as from blood, urine, saliva, tissue biopsy or autopsy material. The genomic DNA may be used directly for detection or may be amplified enzymatically by using PCR or other amplification techniques prior to analysis. RNA or cDNA may also be used in similar fashion. Deletions and insertions can be detected by a change in size of the amplified product in comparison to the normal genotype. Point mutations can be identified by hybridizing amplified DNA to labeled human M6bl nucleotide sequences. Perfectly matched sequences can be distinguished from mismatched duplexes by RNase digestion or by differences in melting temperatures. DNA sequence differences may also be detected by alterations in electrophoretic mobility of DNA fragments in gels, with or without denaturing agents, or by direct DNA sequencing. See, e.g., Myers et al. , Science (1985) 230: 1242. Sequence changes at specific locations may also be revealed by nuclease protection assays, such as RNase and S 1 protection or the chemical cleavage method. See Cotton etal, Proc Natl Acad Sci USA (1985) 85: 4397-4401. In another embodiment, an array of oligonucleotides probes comprising human M6b 1 nucleotide sequence or fragments thereof can be constructed to conduct efficient screening of e.g., genetic mutations. Array technology methods are well known and have general applicability and can be used to address a variety of questions in molecular genetics including gene expression, genetic linkage, and genetic variability. (See for example: M.Chee et al., Science, Vol 274, pp 610-613 (1996)). The diagnostic assays offer a process for diagnosing or determining a susceptibility to genetic diseases, such as Charcot-Marie-Tooth disease, X-linked mental retardation, Partington syndrome, Aicardis syndrome, Rett syndrome and Pelizaeus-Merzbracher disease through detection of mutation in the human M6b 1 gene by the methods described.

In addition, genetic diseases, such as Charcot-Marie-Tooth disease, X-linked mental retardation, Partington syndrome, Aicardis syndrome, Rett syndrome and Pelizaeus-Merzbracher disease, can be diagnosed by methods comprising determining from a sample derived from a subject an abnormally decreased or increased level of human M6bl polypeptide or human M6bl mRNA. Decreased or increased expression can be measured at the RNA level using any of the methods well known in the art for the quantitation of polynucleotides, such as, for example, PCR, RT-PCR, RNase protection, Northern blotting and other hybridization methods . Assay techniques that can be used to determine levels of a protein, such as an human M6bl polypeptide, in a sample derived from a host are well-known to those of skill in the art. Such assay methods include radioimmunoassays, competitive-binding assays, Western Blot analysis and ELISA assays.

Thus in another aspect, the present invention relates to a diagonostic kit for a disease or suspectability to a disease, particularly genetic diseases, such as Charcot-Marie-Tooth disease, X- linked mental retardation, Partington syndrome, Aicardis syndrome, Rett syndrome and Pelizaeus- Merzbracher disease, which comprises: (a) a human M6bl polynucleotide, preferably the nucleotide sequence of SEQ ID NO: 1, or a fragment thereof;

(b) a nucleotide sequence complementary to that of (a);

(c) a human M6bl polypeptide, preferably the polypeptide of SEQ ID NO: 2, or a fragment thereof; or

(d) an antibody to a human M6bl polypeptide, preferably to the polypeptide of SEQ ID NO: 2. It will be appreciated that in any such kit, (a), (b), (c) or (d) may comprise a substantial component.

Chromosome Assays

The nucleotide sequences of the present invention are also valuable for chromosome identification. The sequence is specifically targeted to and can hybridize with a particular location on an individual human chromosome. The mapping of relevant sequences to chromosomes according to the present invention is an important first step in correlating those sequences with gene associated disease. Once a sequence has been mapped to a precise chromosomal location, the physical position of the sequence on the chromosome can be correlated with genetic map data. Such data are found, for example, in V. McKusick, Mendelian Inheritance in Man (available on line through Johns Hopkins University Welch Medical Library). The relationship between genes and diseases that have been mapped to the same chromosomal region are then identified through linkage analysis (coinheritance of physically adjacent genes).

The differences in the cDNA or genomic sequence between affected and unaffected individuals can also be determined. If a mutation is observed in some or all of the affected individuals but not in any normal individuals, then the mutation is likely to be the causative agent of the disease. The m6bl gene was mapped by FISH to chromosome Xp22.2 where Charcot-Marie- Tooth disease, X-linked mental retardation, Partington syndrome, Aicardis syndrome and Rett syndrome etc were localized.

Antibodies

The polypeptides of the invention or their fragments or analogs thereof, or cells expressing them can also be used as immunogens to produce antibodies immunospecific for the human M6b 1 polypeptides. The term "immunospecific" means that the antibodies have substantiall greater affinity for the polypeptides of the invention than their affinity for other related polypeptides in the prior art. Antibodies generated against the human M6b 1 polypeptides can be obtained by administering the polypeptides or epitope-bearing fragments, analogs or cells to an animal, preferably a nonhuman, using routine protocols. For preparation of monoclonal antibodies, any technique which provides antibodies produced by continuous cell line cultures can be used. Examples include the hybridoma technique (Kohler, G. and Milstein, C, Nature (1975) 256:495-497), the trioma technique, the human B-cell hybridoma technique (Kozbor et al, Immunology Today (1983) 4:72) and the EBV-hybridoma technique (Cole et al. , MONOCLONAL ANTIBODIES AND CANCER THERAPY, pp. 77-96, Alan R. Liss, hie, 1985).

Techniques for the production of single chain antibodies (U.S. Patent No. 4,946,778) can also be adapted to produce single chain antibodies to polypeptides of this invention. Also, transgenic mice, or other organisms including other mammals, may be used to express humanized antibodies.

The above-described antibodies may be employed to isolate or to identify clones expressing the polypeptide or to purify the polypeptides by affinity chromatography.

Antibodies against human M6bl polypeptides may also be employed to treat genetic diseases, such as Charcot-Marie-Tooth disease, X-linked mental retardation, Partington syndrome, Aicardis syndrome, Rett syndrome and Pelizaeus-Merzbracher disease, among others.

Vaccines

Another aspect of the invention relates to a method for inducing an immunological response in a mammal which comprises inoculating the mammal with human M6bl polypeptide, or a fragment thereof, adequate to produce antibody and/or T cell immune response to protect said animal from genetic diseases, such as Charcot-Marie-Tooth disease, X-linked mental retardation, Partington syndrome, Aicardis syndrome, Rett syndrome and Pelizaeus-Merzbracher disease, among others. Yet another aspect of the invention relates to a method of inducing immunological response in a mammal which comprises, delivering human M6bl polypeptide via a vector directing expression of human M6bl polynucleotide in vivo in order to induce such an immunological response to produce antibody to protect said animal from diseases.

Further aspect of the invention relates to an immunological/vaccine formulation (composition) which, when introduced into a mammalian host, induces an immunological response in that mammal to a human M6bl polypeptide wherein the composition comprises a human M6bl polypeptide or human M6bl gene. The vaccine formulation may further comprise a suitable carrier. Since human M6bl polypeptide may be broken down in the stomach, it is preferably administered parenterally (including subcutaneous, intramuscular, intravenous, intradermal etc. injection). Formulations suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation instonic with the blood of the recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents or thickening agents. The formulations may be presented in unit-dose or multi-dose containers, for example, sealed ampoules and vials and may be stored in a freeze-dried condition requiring only the addition of the sterile liquid carrier immediately prior to use. The vaccine formulation may also include adjuvant systems for enhancing the immunogenicity of the formulation, such as oil-in water systems and other systems known in the art. The dosage will depend on the specific activity of the vaccine and can be readily determined by routine experimentation.

Screening Assays

The human M6bl polypeptide of the present invention may be employed in a screening process for compounds which activate (agonists) or inhibit activation of (antagonists, or otherwise called inhibitors) the human M6b 1 polypeptide of the present invention. Thus, polypeptides of the invention may also be used to assess identify agonist or antagonists from, for example, cells, cell-free preparations, chemical libraries, and natural product mixtures. These agonists or antagonists may be natural or modified substrates, ligands, receptors, enzymes, etc., as the case may be, of the polypeptide of the present invention; or may be structural or functional mimetics of the polypeptide of the present invention. See Coligan et al, Current Protocols in Immunology l(2):Chapter 5 (1991). human M6bl polypeptides are responsible for many biological functions, including many pathologies. Accordingly, it is desirous to find compounds and drugs which stimulate human M6bl polypeptide on the one hand and which can inhibit the function of human M6bl polypeptide on the other hand. In general, agonists are employed for therapeutic and prophylactic purposes for such conditions as genetic diseases, such as Charcot-Marie-Tooth disease, X-linked mental retardation, Partington syndrome,

Aicardis syndrome, Rett syndrome and Pelizaeus-Merzbracher disease. Antagonists may be employed for a variety of therapeutic and prophylactic purposes for such conditions as genetic diseases, such as Charcot-Marie-Tooth disease, X-linked mental retardation, Partington syndrome, Aicardis syndrome, Rett syndrome and Pelizaeus-Merzbracher disease. In general, such screening procedures may involve using appropriate cells which express the human M6b 1 polypeptide or respond to human M6b 1 polypeptide of the present invention. Such cells include cells from mammals, yeast, Drosophila or E. coli. Cells which express the human M6b 1 polypeptide (or cell membrane containing the expressed polypeptide) or respond to human M6bl polypeptide are then contacted with a test compound to observe binding, or stimulation or inhibition of a functional response. The ability of the cells which were contacted with the candidate compounds is compared with the same cells which were not contacted for human M6b 1 activity.

The assays may simply test binding of a candidate compound wherein adherence to the cells bearing the human M6bl polypeptide is detected by means of a label directly or indirectly associated with the candidate compound or in an assay involving competition with a labeled competitor. Further, these assays may test whether the candidate compound results in a signal generated by activation of the human M6bl polypeptide, using detection systems appropriate to the cells bearing the human M6bl polypeptide. Inhibitors of activation are generally assayed in the presence of a known agonist and the effect on activation by the agonist by the presence of the candidate compound is observed.

Further, the assays may simply comprise the steps of mixing a candidate compound with a solution containing a human M6bl polypeptide to form a mixture, measuring human M6bl activity in the mixture, and comparing the human M6bl activity of the mixture to a standard. The human M6bl cDNA, protein and antibodies to the protein may also be used to configure assays for detecting the effect of added compounds on the production of human M6bl mRNA and protein in cells. For example, an ELISA may be constructed for measuring secreted or cell associated levels of human M6bl protein using monoclonal and polyclonal antibodies by standard methods known in the art, and this can be used to discover agents which may inhibit or enhance the production of human M6bl (also called antagonist or agonist, respectively) from suitably manipulated cells or tissues.

The human M6bl protein may be used to identify membrane bound or soluble receptors, if any, through standard receptor binding techniques known in the art. These include, but are not limited to, ligand binding and crosslinking assays in which the human M6bl is labeled with a radioactive isotope (eg 1251), chemically modified (eg biotinylated), or fused to a peptide sequence suitable for detection or purification, and incubated with a source of the putative receptor (cells, cell membranes, cell supernatants, tissue extracts, bodily fluids). Other methods include biophysical techniques such as surface plasmon resonance and spectroscopy. In addition to being used for purification and cloning of the receptor, these binding assays can be used to identify agonists and antagonists of human M6bl which compete with the binding of human M6bl to its receptors, if any. Standard methods for conducting screening assays are well understood in the art.

Examples of potential human M6bl polypeptide antagonists include antibodies or, in some cases, oligonucleotides or proteins which are closely related to the ligands, substrates, receptors, enzymes, etc., as the case may be, of the human M6bl polypeptide, e.g., a fragment of the ligands, substrates, receptors, enzymes, etc.; or small molecules which bind to the polypetide of the present invention but do not elicit a response, so that the activity of the polypeptide is prevented.

Thus in another aspect, the present invention relates to a screening kit for identifying agonists, antagonists, ligands, receptors, substrates, enzymes, etc. for human M6bl polypeptides; or compounds which decrease or enhance the production of human M6bl polypeptides, which comprises:

(a) a human M6bl polypeptide, preferably that of SEQ ID NO:2;

(b) a recombinant cell expressing a human M6bl polypeptide, preferably that of SEQ ID NO:2; (c) a cell membrane expressing a human M6bl polypeptide; preferably that of SEQ ID NO: 2; or

(d) antibody to a human M6bl polypeptide, preferably that of SEQ ID NO: 2.

It will be appreciated that in any such kit, (a), (b), (c) or (d) may comprise a substantial component.

Prophylactic and Therapeutic Methods

This invention provides methods of treating abnormal conditions such as, genetic diseases, such as Charcot-Marie-Tooth disease, X-linked mental retardation, Partington syndrome, Aicardis syndrome, Rett syndrome and Pelizaeus-Merzbracher disease, related to both an excess of and insufficient amounts of human M6bl polypeptide activity. If the activity of human M6bl polypeptide is in excess, several approaches are available. One approach comprises administering to a subject an inhibitor compound (antagonist) as hereinabove described along with a pharmaceutically acceptable carrier in an amount effective to inhibit the function of the human M6bl polypeptide, such as, for example, by blocking the binding of ligands, substrates, receptors, enzymes, etc., or by inhibiting a second signal, and thereby alleviating the abnormal condition. In another approach, soluble forms of human M6bl polypeptides still capable of binding the ligand, substrate, enzymes, receptors, etc. in competition with endogenous human M6bl polypeptide may be administered. Typical embodiments of such competitors comprise fragments of the human M6bl polypeptide.

In still another approach, expression of the gene encoding endogenous human M6bl polypeptide can be inhibited using expression blocking techniques. Known such techniques involve the use of antisense sequences, either internally generated or separately administered. See, for example, O'Connor, JNeurochem (1991) 56:560 in Oligodeoxynucleotides as Antisense Inhibitors of Gene Expression. CRC Press, Boca Raton, FL (1988). Alternatively, oligonucleotides which form triple helices with the gene can be supplied. See, for example, Lee et al, Nucleic Acids Res (1979) 6:3073; Cooney et σ/„ Science (1988) 241:456; Dervan et al, Science (1991) 251:1360. These oligomers can be administered per se or the relevant oligomers can be expressed in vivo.

For treating abnormal conditions related to an under-expression of human M6bl and its activity, several approaches are also available. One approach comprises administering to a subject a therapeutically effective amount of a compound which activates human M6bl polypeptide, i.e., an agonist as described above, in combination with a pharmaceutically acceptable carrier, to thereby alleviate the abnormal condition. Alternatively, gene therapy may be employed to effect the endogenous production of human M6bl by the relevant cells in the subject. For example, a polynucleotide of the invention may be engineered for expression in a replication defective retroviral vector, as discussed above. The retroviral expression construct may then be isolated and introduced into a packaging cell transduced with a retroviral plasmid vector containing RNA encoding a polypeptide of the present invention such that the packaging cell now produces infectious viral particles containing the gene of interest. These producer cells may be administered to a subject for engineering cells in vivo and expression of the polypeptide in vivo. For overview of gene therapy, see Chapter 20, Gene Therapy and other Molecular Genetic-based Therapeutic Approaches, (and references cited therein) in Human Molecular Genetics, T Strachan and A P Read, BIOS Scientific Publishers Ltd (1996). Another approach is to administer a therapeutic amount of human M6bl polypeptides in combination with a suitable pharmaceutical carrier.

Formulation and Administration

Peptides, such as the soluble form of human M6bl polypeptides, and agonists and antagonist peptides or small molecules, may be formulated in combination with a suitable pharmaceutical carrier. Such formulations comprise a therapeutically effective amount of the polypeptide or compound, and a pharmaceutically acceptable carrier or excipient. Such carriers include but are not limited to, saline, buffered saline, dextrose, water, glycerol, ethanol, and combinations thereof. Formulation should suit the mode of administration, and is well within the skill of the art. The invention further relates to pharmaceutical packs and kits comprising one or more containers filled with one or more of the ingredients of the aforementioned compositions of the invention. Polypeptides and other compounds of the present invention may be employed alone or in conjunction with other compounds, such as therapeutic compounds.

Preferred forms of systemic administration of the pharmaceutical compositions include injection, typically by intravenous injection. Other injection routes, such as subcutaneous, intramuscular, or intraperitoneal, can be used. Alternative means for systemic administration include transmucosal and transdeimal administration using penetrants such as bile salts or fusidic acids or other detergents. In addition, if properly formulated in enteric or encapsulated formulations, oral administration may also be possible. Administration of these compounds may also be topical and/or localized, in the form of salves, pastes, gels and the like.

The dosage range required depends on the choice of peptide, the route of administration, the nature of the formulation, the nature of the subject's condition, and the judgment of the attending practitioner. Suitable dosages, however, are in the range of 0.1-100 μg/kg of subject. Wide variations in the needed dosage, however, are to be expected in view of the variety of compounds available and the differing efficiencies of various routes of administration. For example, oral administration would be expected to require higher dosages than administration by intravenous injection. Variations in these dosage levels can be adjusted using standard empirical routines for optimization, as is well understood in the art.

Polypeptides used in treatment can also be generated endogenously in the subject, in treatment modalities often referred to as "gene therapy" as described above. Thus, for example, cells from a subject may be engineered with a polynucleotide, such as a DNA or RNA, to encode a polypeptide ex vivo, and for example, by the use of a retroviral plasmid vector. The cells are then introduced into the subject.

All publications, including but not limited to patents and patent applications, cited in this specification are herein incorporated by reference as if each individual publication were specifically and individually indicated to be incorporated by reference herein as though fully set forth.

SEQUENCE LISTING

(1) GENERAL INFORMATION

(i) APPLICANT: XIA, JIA-HUI LIU, CHUN-YU

RUAN, QING-GUO FU, JUN-JIANG DENG, HAN-XIANG

(ii) TITLE OF THE INVENTION: HUMAN M6B1 GENE

(iii) NUMBER OF SEQUENCES: 2

(iv) CORRESPONDENCE ADDRESS:

(A) ADDRESSEE: RATNER & PRESTIA

(B) STREET: P.O. BOX 980

(C) CITY: VALLEY FORGE

(D) STATE: PA (E) COUNTRY: USA

(F) ZIP: 19482

(v) COMPUTER READABLE FORM:

(A) MEDIUM TYPE: Diskette (B) COMPUTER: IBM Compatible

(C) OPERATING SYSTEM: DOS

(D) SOFTWARE: FastSEQ for Windows Version 2.0

(vi) CURRENT APPLICATION DATA: (A) APPLICATION NUMBER: TO BE ASSIGNED

(B) FILING DATE:

(C) CLASSIFICATION: UNKNOWN

(vii) PRIOR APPLICATION DATA: (A) APPLICATION NUMBER:

(B) FILING DATE:

( iii) ATTORNEY/AGENT INFORMATION:

(A) NAME: PRESTIA, PAUL F

(B) REGISTRATION NUMBER: 23,031 ( C) REFERENCE/DOCKET NUMBER: GP-70297

(ix ) TELECOMMUNICATION INFORMATION :

(A) TELEPHONE: 610-407-0700

(B) TELEFAX: 610-407-0701

(C) TELEX: 846169

(2) INFORMATION FOR SEQ ID NO:l:

(i) SEQUENCE CHARACTERISTICS:

(A) LENGTH: 1642 base pairs

(B) TYPE: nucleic acid

(C) STRANDEDNESS: single (D) TOPOLOGY: linear

(ii) MOLECULE TYPE: cDNA

(xi) SEQUENCE DESCRIPTION: SEQ ID NO : 1 :

TAAAAAGCAA AAGAATTCCG GGGTAGTTAT GGGAAAGAAC CTAGAGAGCA AGAAGAAAAG 60

AGGAATGGTG CCCGAATCTG GGAGAGATAG ACTTCAGGAT GGCCAGTCAT TGAATGGGGG 120

ATAGGTGAAG AACAGAGCCT CTCAATCAGA CGGGTGTAAA TAAGAGACGG AGGGGAGTCC 180

AAAAGAAAAG GAAGAGGAGG AAAAACAAGT GTGTGTTGGG GGGAACAGGG GGAAAAGCAT 240

TTTTGGTGGA TGGTATGAAG CCAGCCATGG AAACTGCAGC CGAGGAAAAT ACTGAACAAA 300 GCCAAGAGAG AAAAGGCTGC TTTGAATGCT GCATCAAGTG TCTGGGAGGA GTCCCCTACG 360

CCTCCCTGGT GGCCACCATC CTCTGCTTCT CCGGGGTGGC CTTATTCTGC GGCTGTGGGC 420

ATGTGGCTCT CGCAGGCACC GTGGCGATTC TTGAGCAACA CTTCTCCACC AACGCCAGTG 480

ACCATGCCTT GCTGAGCGAG GTGATACAAC TGATGCAGTA TGTCATCTAT GGAATTGCGT 540

CCTTTTTCTT CTTGTATGGG ATCATTCTGT TGGCAGAAGG CTTTTACACC ACAAGTGCAG 600 TGAAAGAACT GCACGGTGAG TTTAAAACAA CCGCTTGTGG CCGATGCATC AGTGGAATGT 660

TCGTTTTCCT CACCTATGTG CTTGGAGTGG CCTGGCTGGG TGTGTTTGGT TTCTCAGCGG 720

TGCCCGTGTT TATGTTCTAC AACATATGGT CAACTTGTGA AGTCATCAAG TCACCGCAGA 780

CCAACGGGAC CACGGGTGTG GAGCAGATCT GTGTGGATAT CCGACAATAC GGTATCATTC 840

CTTGGAATGC TTTCCCCGGA AAAATATGTG GCTCTGCCCT GGAGAACATC TGCAACACAA 900 ACGAGTTCTA CATGTCCTAT CACCTGTTCA TTGTGGCCTG TGCAGGAGCT GGTGCCACCG 960

TCATTGCCCT GCTGATCTAC ATGATGGCTA CTACATATAA CTATGCGGTT TTGAAGTTTA 1020

AGAGTCGGGA AGATTGCTGC ACTAAATTCT AAATTGCATA AGGAGTTTTA GAGAGCTATG 1080

CTCTGTAGCA TGAAATATCA CTGACACTCC AGACTAAAGC AGAGTCTAGG TTTCTGCAAT 1140

TTTGTTACAG TAATTTGTAA ATAGCTTTAG TAAACTCACC TTGCATGGTA GATTAATAAG 1200 ATGACTTACT GTACATGAAT TACACAATAA TGAGATCTGG TGGCTATTTC CACATTTTGA 1260

AAAGGATTCA GTTATTTACT GACAGTGGTG AGCATCCTTT TTAAAATAAT GTTCTGATAC 1320

TTAAACATTA GAGAGCAGTA TCTTTAAATG AATTATTAAC ACTTTGGAAT ACTTACATTT 1380

TCTGTTATTT TTGATTGCCT GATAACCAGT TTCAATGATG AAAATGAAAA CAAGTGCTGA 1440

AGATGAAATG GAAGAGAACC GTTTTAATCT GGATTTTGTT TTGTCACACC TGGAAAATAC 1500 TTTGCAAATA TGTTCTAAAT TGAAAACAAT TTTTTTATGA TCACATGGTT CACTACCAAA 1560

TGACCCTCAA ATAAGCCAGA TGAAAATTTG AAGAAAAAGG TCACCCAGTT CTCTGGAAAA 1620

AAAAAAAAAA AAAAAAAAAA AA 1642 (2) INFORMATION FOR SEQ ID NO: 2:

(i) SEQUENCE CHARACTERISTICS:

(A) LENGTH: 265 amino acids

(B) TYPE: amino acid

(C) STRANDEDNESS: single

(D) TOPOLOGY: linear

(ii) MOLECULE TYPE: protein

(xi) SEQUENCE DESCRIPTION: SEQ ID NO : 2 :

Met Lys Pro Ala Met Glu Thr Ala Ala Glu Glu Asn Thr Glu Gin Ser 1 5 10 15 Gin Glu Arg Lys Gly Cys Phe Glu Cys Cys He Lys Cys Leu Gly Gly 20 25 30

Val Pro Tyr Ala Ser Leu Val Ala Thr He Leu Cys Phe Ser Gly Val

35 40 45

Ala Leu Phe Cys Gly Cys Gly His Val Ala Leu Ala Gly Thr Val Ala 50 55 60

He Leu Glu Gin His Phe Ser Thr Asn Ala Ser Asp His Ala Leu Leu 65 70 75 80

Ser Glu Val He Gin Leu Met Gin Tyr Val He Tyr Gly He Ala Ser 85 90 95 Phe Phe Phe Leu Tyr Gly He He Leu Leu Ala Glu Gly Phe Tyr Thr 100 105 110

Thr Ser Ala Val Lys Glu Leu His Gly Glu Phe Lys Thr Thr Ala Cys

115 120 125

Gly Arg Cys He Ser Gly Met Phe Val Phe Leu Thr Tyr Val Leu Gly 130 135 140

Val Ala Trp Leu Gly Val Phe Gly Phe Ser Ala Val Pro Val Phe Met

145 150 155 160

Phe Tyr Asn He Trp Ser Thr Cys Glu Val He Lys Ser Pro Gin Thr

165 170 175 Asn Gly Thr Thr Gly Val Glu Gin He Cys Val Asp He Arg Gin Tyr

180 185 190

Gly He He Pro Trp Asn Ala Phe Pro Gly Lys He Cys Gly Ser Ala

195 200 205

Leu Glu Asn He Cys Asn Thr Asn Glu Phe Tyr Met Ser Tyr His Leu 210 215 220

Phe He Val Ala Cys Ala Gly Ala Gly Ala Thr Val He Ala Leu Leu 225 230 235 240

He Tyr Met Met Ala Thr Thr Tyr Asn Tyr Ala Val Leu Lys Phe Lys 245 250 255 Ser Arg Glu Asp Cys Cys Thr Lys Phe 260 265

Claims

What is claimed is:

1. An isolated polynucleotide comprising a nucleotide sequence that has at least 80% identity over its entire length to a nucleotide sequence encoding the human M6b 1 polypeptide of SEQ ID NO:2; or a nucleotide sequence complementary to said isolated polynucleotide.

2. The polynucleotide of claim 1 wherein said polynucleotide comprises the nucleotide sequence contained in SEQ ID NO: 1 encoding the human M6bl polypeptide of SEQ ID N02.

3. The polynucleotide of claim 1 wherein said polynucleotide comprises a nucleotide sequence that is at least 80% identical to that of SEQ ID NO: 1 over its entire length.

4. The polynucleotide of claim 3 which is polynucleotide of SEQ ID NO: 1.

5. The polynucleotide of claim 1 which is DNA or RNA.

6. A DNA or RNA molecule comprising an expression system, wherein said expression system is capable of producing a human M6bl polypeptide comprising an amino acid sequence, which has at least 94% identity with the polypeptide of SEQ ID NO:2 when said expression system is present in a compatible host cell.

7. A host cell comprising the expression system of claim 6.

8. A process for producing a human M6bl polypeptide comprising culturing a host of claim 7 under conditions sufficient for the production of said polypeptide and recovering the polypeptide from the culture.

9. A process for producing a cell which produces a human M6bl polypeptide thereof comprising transforming or transfecting a host cell with the expression system of claim 6 such that the host cell, under appropriate culture conditions, produces a human M6bl polypeptide.

10. A human M6bl polypeptide comprising an amino acid sequence which is at least 94%o identical to the amino acid sequence of SEQ ID NO:2 over its entire length.

11. The polypeptide of claim 10 which comprises the amino acid sequence of SEQ ID

NO:2.

12. An antibody immunospecific for the human M6b 1 polypeptide of claim 10.

13. A method for the treatment of a subject in need of enhanced activity or expression of human M6bl polypeptide of claim 10 comprising:

(a) administering to the subject a therapeutically effective amount of an agonist to said polypeptide; and/or

(b) providing to the subject an isolated polynucleotide comprising a nucleotide sequence that has at least 80% identity to a nucleotide sequence encoding the human M6b 1 polypeptide of SEQ

ID NO:2 over its entire length; or a nucleotide sequence complementary to said nucleotide sequence in a form so as to effect production of said polypeptide activity in vivo.

14. A method for the treatment of a subject having need to inhibit activity or expression of human M6bl polypeptide of claim 10 comprising:

(a) administering to the subject a therapeutically effective amount of an antagonist to said polypeptide; and/or

(b) administering to the subject a nucleic acid molecule that inhibits the expression of the nucleotide sequence encoding said polypeptide; and/or (c) administering to the subject a therapeutically effective amount of a polypeptide that competes with said polypeptide for its ligand, substrate , or receptor.

15. A process for diagnosing a disease or a susceptibility to a disease in a subject related to expression or activity of human M6bl polypeptide of claim 10 in a subject comprising: (a) determining the presence or absence of a mutation in the nucleotide sequence encoding said human M6bl polypeptide in the genome of said subject; and/or

(b) analyzing for the presence or amount of the human M6bl polypeptide expression in a sample derived from said subject.

16. A method for identifying compounds which inhibit (antagonize) or agonize the human M6bl polypeptide of claim 10 which comprises:

(a) contacting a candidate compound with cells which express the human M6bl polypeptide (or cell membrane expressing human M6bl polypeptide) or respond to human M6b 1 polypeptide; and

(b) observing the binding, or stimulation or inhibition of a functional response; or comparing the ability of the cells (or cell membrane) which were contacted with the candidate compounds with the same cells which were not contacted for human M6bl polypeptide activity.

17. An agonist identified by the method of claim 16.

18. An antagonist identified by the method of claim 16.

19. A recombinant host cell produced by a method of Claim 9 or a membrane thereof expressing a human M6bl polypeptide.