WO1998051351A1 - Therapeutic and diagnostic tools for impaired glucose tolerance conditions - Google Patents
Therapeutic and diagnostic tools for impaired glucose tolerance conditions Download PDFInfo
- Publication number
- WO1998051351A1 WO1998051351A1 PCT/US1998/010080 US9810080W WO9851351A1 WO 1998051351 A1 WO1998051351 A1 WO 1998051351A1 US 9810080 W US9810080 W US 9810080W WO 9851351 A1 WO9851351 A1 WO 9851351A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- daf
- gene
- polypeptide
- akt
- human
- Prior art date
Links
- 208000002705 Glucose Intolerance Diseases 0.000 title claims abstract description 68
- 201000009104 prediabetes syndrome Diseases 0.000 title claims abstract description 58
- 230000001225 therapeutic effect Effects 0.000 title abstract description 11
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 221
- 238000000034 method Methods 0.000 claims abstract description 184
- 238000012216 screening Methods 0.000 claims abstract description 27
- 101100008646 Caenorhabditis elegans daf-3 gene Proteins 0.000 claims description 271
- 230000035772 mutation Effects 0.000 claims description 202
- 101100447050 Caenorhabditis elegans daf-16 gene Proteins 0.000 claims description 190
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 183
- 150000001875 compounds Chemical class 0.000 claims description 180
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 174
- 229920001184 polypeptide Polymers 0.000 claims description 173
- 230000000694 effects Effects 0.000 claims description 153
- 101100386237 Caenorhabditis elegans daf-7 gene Proteins 0.000 claims description 138
- 241000282414 Homo sapiens Species 0.000 claims description 126
- 210000004027 cell Anatomy 0.000 claims description 125
- 241001465754 Metazoa Species 0.000 claims description 108
- 230000014509 gene expression Effects 0.000 claims description 103
- 108020004414 DNA Proteins 0.000 claims description 84
- 208000008589 Obesity Diseases 0.000 claims description 59
- 235000020824 obesity Nutrition 0.000 claims description 58
- 241000244206 Nematoda Species 0.000 claims description 55
- 238000012360 testing method Methods 0.000 claims description 47
- 230000009261 transgenic effect Effects 0.000 claims description 44
- 239000013615 primer Substances 0.000 claims description 31
- 230000007423 decrease Effects 0.000 claims description 30
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 29
- 108700019146 Transgenes Proteins 0.000 claims description 28
- 150000007523 nucleic acids Chemical group 0.000 claims description 25
- 230000000295 complement effect Effects 0.000 claims description 21
- 210000004602 germ cell Anatomy 0.000 claims description 20
- 230000003247 decreasing effect Effects 0.000 claims description 19
- 241000124008 Mammalia Species 0.000 claims description 18
- 210000001082 somatic cell Anatomy 0.000 claims description 17
- 101000877727 Homo sapiens Forkhead box protein O1 Proteins 0.000 claims description 16
- 101100391199 Homo sapiens FOXO4 gene Proteins 0.000 claims description 15
- 210000005260 human cell Anatomy 0.000 claims description 15
- 238000001514 detection method Methods 0.000 claims description 14
- 239000002773 nucleotide Substances 0.000 claims description 14
- 125000003729 nucleotide group Chemical group 0.000 claims description 14
- 102100035427 Forkhead box protein O1 Human genes 0.000 claims description 13
- 102100035416 Forkhead box protein O4 Human genes 0.000 claims description 13
- 206010018429 Glucose tolerance impaired Diseases 0.000 claims description 13
- 238000009396 hybridization Methods 0.000 claims description 12
- 238000002360 preparation method Methods 0.000 claims description 11
- 108091034117 Oligonucleotide Proteins 0.000 claims description 10
- 230000001418 larval effect Effects 0.000 claims description 10
- 239000003155 DNA primer Substances 0.000 claims description 5
- 101100386242 Homo sapiens CD55 gene Proteins 0.000 claims description 5
- 230000002401 inhibitory effect Effects 0.000 claims description 5
- 108700039749 C elegans DAF-3 Proteins 0.000 claims 1
- 239000003814 drug Substances 0.000 abstract description 27
- 239000000203 mixture Substances 0.000 abstract description 6
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 269
- LTYUPYUWXRTNFQ-UHFFFAOYSA-N 5,6-diamino-3',6'-dihydroxyspiro[2-benzofuran-3,9'-xanthene]-1-one Chemical compound C12=CC=C(O)C=C2OC2=CC(O)=CC=C2C11OC(=O)C2=C1C=C(N)C(N)=C2 LTYUPYUWXRTNFQ-UHFFFAOYSA-N 0.000 description 140
- 102000004877 Insulin Human genes 0.000 description 135
- 108090001061 Insulin Proteins 0.000 description 135
- 229940125396 insulin Drugs 0.000 description 134
- 108091008611 Protein Kinase B Proteins 0.000 description 123
- 230000011664 signaling Effects 0.000 description 116
- 239000005090 green fluorescent protein Substances 0.000 description 102
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 101
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 101
- 102100033810 RAC-alpha serine/threonine-protein kinase Human genes 0.000 description 97
- 125000003275 alpha amino acid group Chemical group 0.000 description 79
- 101100322915 Caenorhabditis elegans akt-1 gene Proteins 0.000 description 77
- 101150014742 AGE1 gene Proteins 0.000 description 74
- 108010001127 Insulin Receptor Proteins 0.000 description 67
- 102000003746 Insulin Receptor Human genes 0.000 description 66
- 230000002503 metabolic effect Effects 0.000 description 65
- 101100008648 Caenorhabditis elegans daf-4 gene Proteins 0.000 description 62
- 230000037361 pathway Effects 0.000 description 57
- 235000001014 amino acid Nutrition 0.000 description 56
- 235000018102 proteins Nutrition 0.000 description 55
- 102000004169 proteins and genes Human genes 0.000 description 55
- 230000002608 insulinlike Effects 0.000 description 53
- 230000006870 function Effects 0.000 description 49
- 230000002068 genetic effect Effects 0.000 description 49
- 229940024606 amino acid Drugs 0.000 description 46
- 108700028369 Alleles Proteins 0.000 description 45
- 206010012601 diabetes mellitus Diseases 0.000 description 45
- 230000019491 signal transduction Effects 0.000 description 45
- 150000001413 amino acids Chemical group 0.000 description 43
- 102000005962 receptors Human genes 0.000 description 42
- 108020003175 receptors Proteins 0.000 description 42
- 101100162366 Caenorhabditis elegans akt-2 gene Proteins 0.000 description 41
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 40
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 40
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 40
- 230000018109 developmental process Effects 0.000 description 38
- 230000001105 regulatory effect Effects 0.000 description 38
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 37
- 230000015572 biosynthetic process Effects 0.000 description 36
- 238000011161 development Methods 0.000 description 36
- 229940088597 hormone Drugs 0.000 description 36
- 239000005556 hormone Substances 0.000 description 36
- 101100386238 Caenorhabditis elegans daf-8 gene Proteins 0.000 description 35
- 239000002299 complementary DNA Substances 0.000 description 35
- 238000003752 polymerase chain reaction Methods 0.000 description 35
- 101100008636 Caenorhabditis elegans daf-14 gene Proteins 0.000 description 34
- 230000004060 metabolic process Effects 0.000 description 34
- 210000002569 neuron Anatomy 0.000 description 34
- 108091000080 Phosphotransferase Proteins 0.000 description 33
- 102000020233 phosphotransferase Human genes 0.000 description 33
- 108700008625 Reporter Genes Proteins 0.000 description 31
- 230000026731 phosphorylation Effects 0.000 description 29
- 238000006366 phosphorylation reaction Methods 0.000 description 29
- 230000001850 reproductive effect Effects 0.000 description 29
- 210000001519 tissue Anatomy 0.000 description 29
- 108090000852 Forkhead Transcription Factors Proteins 0.000 description 28
- 238000004458 analytical method Methods 0.000 description 28
- 102000004315 Forkhead Transcription Factors Human genes 0.000 description 27
- 230000001965 increasing effect Effects 0.000 description 27
- 230000007547 defect Effects 0.000 description 24
- 239000000284 extract Substances 0.000 description 24
- 229940079593 drug Drugs 0.000 description 23
- 238000006467 substitution reaction Methods 0.000 description 23
- 239000013598 vector Substances 0.000 description 23
- 239000012634 fragment Substances 0.000 description 22
- 230000012010 growth Effects 0.000 description 22
- 102000007374 Smad Proteins Human genes 0.000 description 21
- 108010007945 Smad Proteins Proteins 0.000 description 21
- 238000011144 upstream manufacturing Methods 0.000 description 21
- 230000004913 activation Effects 0.000 description 20
- 230000027455 binding Effects 0.000 description 20
- 210000004940 nucleus Anatomy 0.000 description 20
- 101100297694 Arabidopsis thaliana PIP2-7 gene Proteins 0.000 description 19
- 101100456541 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) MEC3 gene Proteins 0.000 description 19
- 101100483663 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) UFD1 gene Proteins 0.000 description 19
- 201000001320 Atherosclerosis Diseases 0.000 description 18
- 101100008638 Caenorhabditis elegans daf-1 gene Proteins 0.000 description 18
- 230000000875 corresponding effect Effects 0.000 description 18
- 102000040945 Transcription factor Human genes 0.000 description 17
- 108091023040 Transcription factor Proteins 0.000 description 17
- 230000005058 diapause Effects 0.000 description 17
- 108090000430 Phosphatidylinositol 3-kinases Proteins 0.000 description 16
- 102000003993 Phosphatidylinositol 3-kinases Human genes 0.000 description 16
- 239000003016 pheromone Substances 0.000 description 16
- 238000007894 restriction fragment length polymorphism technique Methods 0.000 description 16
- 238000010561 standard procedure Methods 0.000 description 16
- 238000011282 treatment Methods 0.000 description 16
- 238000003556 assay Methods 0.000 description 15
- -1 daf 2 Proteins 0.000 description 15
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 14
- 230000003993 interaction Effects 0.000 description 14
- 239000003446 ligand Substances 0.000 description 14
- 230000001629 suppression Effects 0.000 description 14
- 108020004635 Complementary DNA Proteins 0.000 description 13
- 210000000349 chromosome Anatomy 0.000 description 13
- 101150091060 daf-16 gene Proteins 0.000 description 13
- 238000004519 manufacturing process Methods 0.000 description 13
- 239000013612 plasmid Substances 0.000 description 13
- 238000013518 transcription Methods 0.000 description 13
- 230000035897 transcription Effects 0.000 description 13
- 101100008634 Caenorhabditis elegans daf-11 gene Proteins 0.000 description 12
- 230000032683 aging Effects 0.000 description 12
- 230000002103 transcriptional effect Effects 0.000 description 12
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 11
- 108010034219 Insulin Receptor Substrate Proteins Proteins 0.000 description 11
- 102100025087 Insulin receptor substrate 1 Human genes 0.000 description 11
- 230000003213 activating effect Effects 0.000 description 11
- 238000002474 experimental method Methods 0.000 description 11
- 230000004927 fusion Effects 0.000 description 11
- 239000008103 glucose Substances 0.000 description 11
- 238000000338 in vitro Methods 0.000 description 11
- 230000001939 inductive effect Effects 0.000 description 11
- 210000004962 mammalian cell Anatomy 0.000 description 11
- 230000000955 neuroendocrine Effects 0.000 description 11
- 239000000047 product Substances 0.000 description 11
- 230000009466 transformation Effects 0.000 description 11
- 108091026890 Coding region Proteins 0.000 description 10
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 10
- 102000004218 Insulin-Like Growth Factor I Human genes 0.000 description 10
- 241000699666 Mus <mouse, genus> Species 0.000 description 10
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 10
- 239000005557 antagonist Substances 0.000 description 10
- 210000004369 blood Anatomy 0.000 description 10
- 239000008280 blood Substances 0.000 description 10
- 210000004899 c-terminal region Anatomy 0.000 description 10
- 239000000523 sample Substances 0.000 description 10
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 10
- 108020004705 Codon Proteins 0.000 description 9
- 101000852815 Homo sapiens Insulin receptor Proteins 0.000 description 9
- 101710143123 Mothers against decapentaplegic homolog 2 Proteins 0.000 description 9
- 102100025751 Mothers against decapentaplegic homolog 2 Human genes 0.000 description 9
- 108010029485 Protein Isoforms Proteins 0.000 description 9
- 102000001708 Protein Isoforms Human genes 0.000 description 9
- 230000003178 anti-diabetic effect Effects 0.000 description 9
- 239000003472 antidiabetic agent Substances 0.000 description 9
- 230000033228 biological regulation Effects 0.000 description 9
- 238000001114 immunoprecipitation Methods 0.000 description 9
- 230000000968 intestinal effect Effects 0.000 description 9
- 210000000936 intestine Anatomy 0.000 description 9
- 108020001756 ligand binding domains Proteins 0.000 description 9
- 238000013507 mapping Methods 0.000 description 9
- 230000004044 response Effects 0.000 description 9
- 230000009758 senescence Effects 0.000 description 9
- 230000014616 translation Effects 0.000 description 9
- 238000013519 translation Methods 0.000 description 9
- 101100351314 Caenorhabditis elegans pdk-1 gene Proteins 0.000 description 8
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 8
- 241000282412 Homo Species 0.000 description 8
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 8
- 230000003579 anti-obesity Effects 0.000 description 8
- 238000012217 deletion Methods 0.000 description 8
- 230000037430 deletion Effects 0.000 description 8
- 108020001507 fusion proteins Proteins 0.000 description 8
- 102000037865 fusion proteins Human genes 0.000 description 8
- 102000047882 human INSR Human genes 0.000 description 8
- 230000005764 inhibitory process Effects 0.000 description 8
- 238000002347 injection Methods 0.000 description 8
- 239000007924 injection Substances 0.000 description 8
- 230000004155 insulin signaling pathway Effects 0.000 description 8
- 238000012163 sequencing technique Methods 0.000 description 8
- 239000000126 substance Substances 0.000 description 8
- 239000004471 Glycine Substances 0.000 description 7
- 229920002527 Glycogen Polymers 0.000 description 7
- 101000835893 Homo sapiens Mothers against decapentaplegic homolog 4 Proteins 0.000 description 7
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 7
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 7
- 108010022394 Threonine synthase Proteins 0.000 description 7
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 7
- 230000008859 change Effects 0.000 description 7
- 230000002950 deficient Effects 0.000 description 7
- 238000010586 diagram Methods 0.000 description 7
- 102000004419 dihydrofolate reductase Human genes 0.000 description 7
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 7
- 230000007613 environmental effect Effects 0.000 description 7
- 229940096919 glycogen Drugs 0.000 description 7
- 235000004400 serine Nutrition 0.000 description 7
- 101100043372 Caenorhabditis elegans sqt-1 gene Proteins 0.000 description 6
- 108010031794 IGF Type 1 Receptor Proteins 0.000 description 6
- 102000038455 IGF Type 1 Receptor Human genes 0.000 description 6
- 102100025725 Mothers against decapentaplegic homolog 4 Human genes 0.000 description 6
- 238000012228 RNA interference-mediated gene silencing Methods 0.000 description 6
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 6
- 230000001086 cytosolic effect Effects 0.000 description 6
- 201000010099 disease Diseases 0.000 description 6
- 235000013601 eggs Nutrition 0.000 description 6
- 230000009368 gene silencing by RNA Effects 0.000 description 6
- 230000006698 induction Effects 0.000 description 6
- 238000002955 isolation Methods 0.000 description 6
- 239000003550 marker Substances 0.000 description 6
- 210000005036 nerve Anatomy 0.000 description 6
- 210000003800 pharynx Anatomy 0.000 description 6
- 150000003905 phosphatidylinositols Chemical class 0.000 description 6
- 230000009467 reduction Effects 0.000 description 6
- 230000004960 subcellular localization Effects 0.000 description 6
- 238000003786 synthesis reaction Methods 0.000 description 6
- 238000001262 western blot Methods 0.000 description 6
- 108020005345 3' Untranslated Regions Proteins 0.000 description 5
- 241000244203 Caenorhabditis elegans Species 0.000 description 5
- 102000004190 Enzymes Human genes 0.000 description 5
- 108090000790 Enzymes Proteins 0.000 description 5
- 108010014905 Glycogen Synthase Kinase 3 Proteins 0.000 description 5
- 102000002254 Glycogen Synthase Kinase 3 Human genes 0.000 description 5
- 241000238631 Hexapoda Species 0.000 description 5
- 108091092195 Intron Proteins 0.000 description 5
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 5
- 108091005682 Receptor kinases Proteins 0.000 description 5
- 108020004511 Recombinant DNA Proteins 0.000 description 5
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 5
- 235000004279 alanine Nutrition 0.000 description 5
- 125000000539 amino acid group Chemical group 0.000 description 5
- 230000035578 autophosphorylation Effects 0.000 description 5
- 238000010367 cloning Methods 0.000 description 5
- 238000005194 fractionation Methods 0.000 description 5
- 238000012252 genetic analysis Methods 0.000 description 5
- 238000010172 mouse model Methods 0.000 description 5
- 230000030648 nucleus localization Effects 0.000 description 5
- 230000036961 partial effect Effects 0.000 description 5
- 230000007115 recruitment Effects 0.000 description 5
- 210000001044 sensory neuron Anatomy 0.000 description 5
- 101100008635 Caenorhabditis elegans daf-12 gene Proteins 0.000 description 4
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 4
- 102100035421 Forkhead box protein O3 Human genes 0.000 description 4
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 4
- 101000877681 Homo sapiens Forkhead box protein O3 Proteins 0.000 description 4
- 101001117146 Homo sapiens [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial Proteins 0.000 description 4
- 206010022489 Insulin Resistance Diseases 0.000 description 4
- 206010023379 Ketoacidosis Diseases 0.000 description 4
- 208000007976 Ketosis Diseases 0.000 description 4
- 241000699670 Mus sp. Species 0.000 description 4
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 4
- 102000010995 Pleckstrin homology domains Human genes 0.000 description 4
- 108050001185 Pleckstrin homology domains Proteins 0.000 description 4
- 241000700159 Rattus Species 0.000 description 4
- 108091005735 TGF-beta receptors Proteins 0.000 description 4
- 210000000577 adipose tissue Anatomy 0.000 description 4
- 239000000556 agonist Substances 0.000 description 4
- 238000013459 approach Methods 0.000 description 4
- 230000001580 bacterial effect Effects 0.000 description 4
- 210000000227 basophil cell of anterior lobe of hypophysis Anatomy 0.000 description 4
- 235000020934 caloric restriction Nutrition 0.000 description 4
- 238000004113 cell culture Methods 0.000 description 4
- 210000000805 cytoplasm Anatomy 0.000 description 4
- 239000012636 effector Substances 0.000 description 4
- 230000013020 embryo development Effects 0.000 description 4
- 210000002257 embryonic structure Anatomy 0.000 description 4
- 230000003054 hormonal effect Effects 0.000 description 4
- 230000002779 inactivation Effects 0.000 description 4
- 108010054372 insulin receptor-related receptor Proteins 0.000 description 4
- 230000010354 integration Effects 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 230000011278 mitosis Effects 0.000 description 4
- 238000012544 monitoring process Methods 0.000 description 4
- 229930014626 natural product Natural products 0.000 description 4
- 239000002751 oligonucleotide probe Substances 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 230000018406 regulation of metabolic process Effects 0.000 description 4
- 230000001932 seasonal effect Effects 0.000 description 4
- 238000002560 therapeutic procedure Methods 0.000 description 4
- 210000002262 tip cell Anatomy 0.000 description 4
- 230000001960 triggered effect Effects 0.000 description 4
- 235000002374 tyrosine Nutrition 0.000 description 4
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 3
- 102000005606 Activins Human genes 0.000 description 3
- 108010059616 Activins Proteins 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 3
- 101100205088 Caenorhabditis elegans iars-1 gene Proteins 0.000 description 3
- 108700024394 Exon Proteins 0.000 description 3
- 241000287227 Fringillidae Species 0.000 description 3
- 102000042092 Glucose transporter family Human genes 0.000 description 3
- 108091052347 Glucose transporter family Proteins 0.000 description 3
- 101001034652 Homo sapiens Insulin-like growth factor 1 receptor Proteins 0.000 description 3
- 101150030450 IRS1 gene Proteins 0.000 description 3
- 102000048143 Insulin-Like Growth Factor II Human genes 0.000 description 3
- 108090001117 Insulin-Like Growth Factor II Proteins 0.000 description 3
- 102000004375 Insulin-like growth factor-binding protein 1 Human genes 0.000 description 3
- 108090000957 Insulin-like growth factor-binding protein 1 Proteins 0.000 description 3
- 101710114386 Insulin-like protein Proteins 0.000 description 3
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 3
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 3
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 3
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- 102100025748 Mothers against decapentaplegic homolog 3 Human genes 0.000 description 3
- 101710143111 Mothers against decapentaplegic homolog 3 Proteins 0.000 description 3
- 102100033073 Polypyrimidine tract-binding protein 1 Human genes 0.000 description 3
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 3
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 3
- 102000016715 Transforming Growth Factor beta Receptors Human genes 0.000 description 3
- 102100033019 Tyrosine-protein phosphatase non-receptor type 11 Human genes 0.000 description 3
- 101710116241 Tyrosine-protein phosphatase non-receptor type 11 Proteins 0.000 description 3
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 3
- 238000009825 accumulation Methods 0.000 description 3
- 230000009471 action Effects 0.000 description 3
- 239000000488 activin Substances 0.000 description 3
- 230000006978 adaptation Effects 0.000 description 3
- 210000001789 adipocyte Anatomy 0.000 description 3
- 238000001042 affinity chromatography Methods 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- 235000003704 aspartic acid Nutrition 0.000 description 3
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 3
- 210000005056 cell body Anatomy 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- 230000008878 coupling Effects 0.000 description 3
- 238000010168 coupling process Methods 0.000 description 3
- 238000005859 coupling reaction Methods 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 101150042374 daf-2 gene Proteins 0.000 description 3
- 101150089830 daf-3 gene Proteins 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 238000013461 design Methods 0.000 description 3
- 238000009509 drug development Methods 0.000 description 3
- 230000002124 endocrine Effects 0.000 description 3
- 230000009395 genetic defect Effects 0.000 description 3
- 239000001963 growth medium Substances 0.000 description 3
- 238000004128 high performance liquid chromatography Methods 0.000 description 3
- 102000050328 human FOXO1 Human genes 0.000 description 3
- 102000048810 human PDK1 Human genes 0.000 description 3
- 230000001900 immune effect Effects 0.000 description 3
- 239000004026 insulin derivative Substances 0.000 description 3
- 238000012423 maintenance Methods 0.000 description 3
- 210000001161 mammalian embryo Anatomy 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 229930182817 methionine Natural products 0.000 description 3
- 210000000663 muscle cell Anatomy 0.000 description 3
- 230000001537 neural effect Effects 0.000 description 3
- 230000002018 overexpression Effects 0.000 description 3
- 210000000496 pancreas Anatomy 0.000 description 3
- DCWXELXMIBXGTH-QMMMGPOBSA-N phosphonotyrosine Chemical group OC(=O)[C@@H](N)CC1=CC=C(OP(O)(O)=O)C=C1 DCWXELXMIBXGTH-QMMMGPOBSA-N 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 238000011084 recovery Methods 0.000 description 3
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 3
- 238000012340 reverse transcriptase PCR Methods 0.000 description 3
- 238000005096 rolling process Methods 0.000 description 3
- 230000003248 secreting effect Effects 0.000 description 3
- 238000003860 storage Methods 0.000 description 3
- 230000002195 synergetic effect Effects 0.000 description 3
- 230000032258 transport Effects 0.000 description 3
- 101150118369 unc-64 gene Proteins 0.000 description 3
- 230000009750 upstream signaling Effects 0.000 description 3
- 239000004474 valine Substances 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 2
- 108020003589 5' Untranslated Regions Proteins 0.000 description 2
- 102100032123 AMP deaminase 1 Human genes 0.000 description 2
- 230000007730 Akt signaling Effects 0.000 description 2
- 210000002237 B-cell of pancreatic islet Anatomy 0.000 description 2
- 241000255789 Bombyx mori Species 0.000 description 2
- 101100127890 Caenorhabditis elegans let-23 gene Proteins 0.000 description 2
- 101100343342 Caenorhabditis elegans lin-11 gene Proteins 0.000 description 2
- 101100181921 Caenorhabditis elegans lin-31 gene Proteins 0.000 description 2
- 101100149252 Caenorhabditis elegans sem-5 gene Proteins 0.000 description 2
- 101100048436 Caenorhabditis elegans unc-1 gene Proteins 0.000 description 2
- 108010078791 Carrier Proteins Proteins 0.000 description 2
- 230000004544 DNA amplification Effects 0.000 description 2
- 230000004568 DNA-binding Effects 0.000 description 2
- 238000012286 ELISA Assay Methods 0.000 description 2
- 108010051696 Growth Hormone Proteins 0.000 description 2
- 101000976075 Homo sapiens Insulin Proteins 0.000 description 2
- 101000962483 Homo sapiens Max dimerization protein 1 Proteins 0.000 description 2
- 101001090919 Homo sapiens N-acylglucosamine 2-epimerase Proteins 0.000 description 2
- 102000003839 Human Proteins Human genes 0.000 description 2
- 108090000144 Human Proteins Proteins 0.000 description 2
- 102100039137 Insulin receptor-related protein Human genes 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- 108060001084 Luciferase Proteins 0.000 description 2
- 239000005089 Luciferase Substances 0.000 description 2
- 108091054455 MAP kinase family Proteins 0.000 description 2
- 102000043136 MAP kinase family Human genes 0.000 description 2
- 208000035180 MODY Diseases 0.000 description 2
- 108700026244 Open Reading Frames Proteins 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 238000012408 PCR amplification Methods 0.000 description 2
- 241000276498 Pollachius virens Species 0.000 description 2
- 102000001253 Protein Kinase Human genes 0.000 description 2
- 102000009516 Protein Serine-Threonine Kinases Human genes 0.000 description 2
- 108010009341 Protein Serine-Threonine Kinases Proteins 0.000 description 2
- 108010076504 Protein Sorting Signals Proteins 0.000 description 2
- 102000004278 Receptor Protein-Tyrosine Kinases Human genes 0.000 description 2
- 108090000873 Receptor Protein-Tyrosine Kinases Proteins 0.000 description 2
- 102000003743 Relaxin Human genes 0.000 description 2
- 108090000103 Relaxin Proteins 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- 102000004584 Somatomedin Receptors Human genes 0.000 description 2
- 108010017622 Somatomedin Receptors Proteins 0.000 description 2
- 102100038803 Somatotropin Human genes 0.000 description 2
- YCUVUDODLRLVIC-UHFFFAOYSA-N Sudan black B Chemical compound C1=CC(=C23)NC(C)(C)NC2=CC=CC3=C1N=NC(C1=CC=CC=C11)=CC=C1N=NC1=CC=CC=C1 YCUVUDODLRLVIC-UHFFFAOYSA-N 0.000 description 2
- 102000043168 TGF-beta family Human genes 0.000 description 2
- 108091085018 TGF-beta family Proteins 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- 241000269370 Xenopus <genus> Species 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 238000002306 biochemical method Methods 0.000 description 2
- 239000012472 biological sample Substances 0.000 description 2
- 210000003969 blast cell Anatomy 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 230000001684 chronic effect Effects 0.000 description 2
- 239000000470 constituent Substances 0.000 description 2
- 239000000287 crude extract Substances 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 101150052712 daf-36 gene Proteins 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- 235000014113 dietary fatty acids Nutrition 0.000 description 2
- 238000007876 drug discovery Methods 0.000 description 2
- 231100001129 embryonic lethality Toxicity 0.000 description 2
- 238000004146 energy storage Methods 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 238000011156 evaluation Methods 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 229930195729 fatty acid Natural products 0.000 description 2
- 239000000194 fatty acid Substances 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 239000000122 growth hormone Substances 0.000 description 2
- 238000009957 hemming Methods 0.000 description 2
- 235000003642 hunger Nutrition 0.000 description 2
- 210000004408 hybridoma Anatomy 0.000 description 2
- 201000001421 hyperglycemia Diseases 0.000 description 2
- 238000000099 in vitro assay Methods 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 238000005462 in vivo assay Methods 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- PBGKTOXHQIOBKM-FHFVDXKLSA-N insulin (human) Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@H]1CSSC[C@H]2C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@H](C(N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3C=CC(O)=CC=3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3NC=NC=3)NC(=O)[C@H](CO)NC(=O)CNC1=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O)=O)CSSC[C@@H](C(N2)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](NC(=O)CN)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC=1C=CC=CC=1)C(C)C)C1=CN=CN1 PBGKTOXHQIOBKM-FHFVDXKLSA-N 0.000 description 2
- 230000006362 insulin response pathway Effects 0.000 description 2
- 230000003914 insulin secretion Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 230000003902 lesion Effects 0.000 description 2
- 230000004130 lipolysis Effects 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- 230000004777 loss-of-function mutation Effects 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 201000006950 maturity-onset diabetes of the young Diseases 0.000 description 2
- 230000004066 metabolic change Effects 0.000 description 2
- 230000010120 metabolic dysregulation Effects 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 210000003205 muscle Anatomy 0.000 description 2
- 238000007857 nested PCR Methods 0.000 description 2
- 210000000633 nuclear envelope Anatomy 0.000 description 2
- 102000039446 nucleic acids Human genes 0.000 description 2
- 108020004707 nucleic acids Proteins 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 230000008488 polyadenylation Effects 0.000 description 2
- 230000029279 positive regulation of transcription, DNA-dependent Effects 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 239000002987 primer (paints) Substances 0.000 description 2
- 230000031877 prophase Effects 0.000 description 2
- 108020001580 protein domains Proteins 0.000 description 2
- 108060006633 protein kinase Proteins 0.000 description 2
- 230000017854 proteolysis Effects 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 238000007423 screening assay Methods 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 150000003355 serines Chemical class 0.000 description 2
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 2
- 230000035938 sexual maturation Effects 0.000 description 2
- 108091006024 signal transducing proteins Proteins 0.000 description 2
- 102000034285 signal transducing proteins Human genes 0.000 description 2
- 239000007790 solid phase Substances 0.000 description 2
- 230000037351 starvation Effects 0.000 description 2
- 230000000946 synaptic effect Effects 0.000 description 2
- 241000701447 unidentified baculovirus Species 0.000 description 2
- 210000003905 vulva Anatomy 0.000 description 2
- 230000004580 weight loss Effects 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- UBWXUGDQUBIEIZ-UHFFFAOYSA-N (13-methyl-3-oxo-2,6,7,8,9,10,11,12,14,15,16,17-dodecahydro-1h-cyclopenta[a]phenanthren-17-yl) 3-phenylpropanoate Chemical compound CC12CCC(C3CCC(=O)C=C3CC3)C3C1CCC2OC(=O)CCC1=CC=CC=C1 UBWXUGDQUBIEIZ-UHFFFAOYSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- YREOLPGEVLLKMB-UHFFFAOYSA-N 3-methylpyridin-1-ium-2-amine bromide hydrate Chemical group O.[Br-].Cc1ccc[nH+]c1N YREOLPGEVLLKMB-UHFFFAOYSA-N 0.000 description 1
- 102100037263 3-phosphoinositide-dependent protein kinase 1 Human genes 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 101150039504 6 gene Proteins 0.000 description 1
- 206010001497 Agitation Diseases 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 108050000790 Bombyxin Proteins 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 108700005471 C elegans AGE-1 Proteins 0.000 description 1
- 108700016493 C elegans DAF-7 Proteins 0.000 description 1
- 108700019341 C elegans akt-1 Proteins 0.000 description 1
- 108010075254 C-Peptide Proteins 0.000 description 1
- 101100182883 Caenorhabditis elegans aex-3 gene Proteins 0.000 description 1
- 101100328957 Caenorhabditis elegans clk-1 gene Proteins 0.000 description 1
- 101100528916 Caenorhabditis elegans rol-6 gene Proteins 0.000 description 1
- 101100257127 Caenorhabditis elegans sma-2 gene Proteins 0.000 description 1
- 101100257134 Caenorhabditis elegans sma-4 gene Proteins 0.000 description 1
- 101100048437 Caenorhabditis elegans unc-22 gene Proteins 0.000 description 1
- 101100347613 Caenorhabditis elegans unc-54 gene Proteins 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 241000819038 Chichester Species 0.000 description 1
- 238000000116 DAPI staining Methods 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 241000255925 Diptera Species 0.000 description 1
- 201000005948 Donohue syndrome Diseases 0.000 description 1
- 108700042019 Drosophila InR Proteins 0.000 description 1
- 108700008039 Drosophila MAD Proteins 0.000 description 1
- 102000001301 EGF receptor Human genes 0.000 description 1
- 108060006698 EGF receptor Proteins 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 102100023374 Forkhead box protein M1 Human genes 0.000 description 1
- 102000001267 GSK3 Human genes 0.000 description 1
- 108060006662 GSK3 Proteins 0.000 description 1
- 208000034826 Genetic Predisposition to Disease Diseases 0.000 description 1
- 102220599341 Glutamate receptor ionotropic, NMDA 3B_A845T_mutation Human genes 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 102000006771 Gonadotropins Human genes 0.000 description 1
- 108010086677 Gonadotropins Proteins 0.000 description 1
- 102000009465 Growth Factor Receptors Human genes 0.000 description 1
- 108010009202 Growth Factor Receptors Proteins 0.000 description 1
- 102000006754 Hepatocyte Nuclear Factor 1 Human genes 0.000 description 1
- 108010086512 Hepatocyte Nuclear Factor 1 Proteins 0.000 description 1
- 108010068250 Herpes Simplex Virus Protein Vmw65 Proteins 0.000 description 1
- 101150068639 Hnf4a gene Proteins 0.000 description 1
- 101000600756 Homo sapiens 3-phosphoinositide-dependent protein kinase 1 Proteins 0.000 description 1
- 101000907578 Homo sapiens Forkhead box protein M1 Proteins 0.000 description 1
- 101000599951 Homo sapiens Insulin-like growth factor I Proteins 0.000 description 1
- 101001059454 Homo sapiens Serine/threonine-protein kinase MARK2 Proteins 0.000 description 1
- 241000243251 Hydra Species 0.000 description 1
- 102100039688 Insulin-like growth factor 1 receptor Human genes 0.000 description 1
- 101710184277 Insulin-like growth factor 1 receptor Proteins 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- 125000002842 L-seryl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])O[H] 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- 208000035369 Leprechaunism Diseases 0.000 description 1
- 102000016267 Leptin Human genes 0.000 description 1
- 108010092277 Leptin Proteins 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- 241000239218 Limulus Species 0.000 description 1
- 102000004882 Lipase Human genes 0.000 description 1
- 108090001060 Lipase Proteins 0.000 description 1
- 239000004367 Lipase Substances 0.000 description 1
- 241001599018 Melanogaster Species 0.000 description 1
- 241000237852 Mollusca Species 0.000 description 1
- 102000003505 Myosin Human genes 0.000 description 1
- 108060008487 Myosin Proteins 0.000 description 1
- 102000005640 Myosin Type II Human genes 0.000 description 1
- 108010045128 Myosin Type II Proteins 0.000 description 1
- 108091008604 NGF receptors Proteins 0.000 description 1
- 102000007339 Nerve Growth Factor Receptors Human genes 0.000 description 1
- 101000706020 Nicotiana tabacum Pathogenesis-related protein R minor form Proteins 0.000 description 1
- 108091092724 Noncoding DNA Proteins 0.000 description 1
- 108020004485 Nonsense Codon Proteins 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 206010033307 Overweight Diseases 0.000 description 1
- 102000038030 PI3Ks Human genes 0.000 description 1
- 108091007960 PI3Ks Proteins 0.000 description 1
- 229930040373 Paraformaldehyde Natural products 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 108090000472 Phosphoenolpyruvate carboxykinase (ATP) Proteins 0.000 description 1
- 102100034792 Phosphoenolpyruvate carboxykinase [GTP], mitochondrial Human genes 0.000 description 1
- 102000004422 Phospholipase C gamma Human genes 0.000 description 1
- 108010056751 Phospholipase C gamma Proteins 0.000 description 1
- 241000255969 Pieris brassicae Species 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102000003923 Protein Kinase C Human genes 0.000 description 1
- 108090000315 Protein Kinase C Proteins 0.000 description 1
- 108700005075 Regulator Genes Proteins 0.000 description 1
- 108010034634 Repressor Proteins Proteins 0.000 description 1
- 102000009661 Repressor Proteins Human genes 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 102000014400 SH2 domains Human genes 0.000 description 1
- 108050003452 SH2 domains Proteins 0.000 description 1
- 102100028904 Serine/threonine-protein kinase MARK2 Human genes 0.000 description 1
- 102000013275 Somatomedins Human genes 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 229940100389 Sulfonylurea Drugs 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 102000014172 Transforming Growth Factor-beta Type I Receptor Human genes 0.000 description 1
- 108010011702 Transforming Growth Factor-beta Type I Receptor Proteins 0.000 description 1
- 102000004060 Transforming Growth Factor-beta Type II Receptor Human genes 0.000 description 1
- 108010082684 Transforming Growth Factor-beta Type II Receptor Proteins 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 210000001766 X chromosome Anatomy 0.000 description 1
- 241001376713 Xenops Species 0.000 description 1
- 238000002679 ablation Methods 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 210000003503 anal sac Anatomy 0.000 description 1
- 230000031016 anaphase Effects 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 230000009949 anti-apoptotic pathway Effects 0.000 description 1
- 239000000883 anti-obesity agent Substances 0.000 description 1
- 229940125708 antidiabetic agent Drugs 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 229940125710 antiobesity agent Drugs 0.000 description 1
- 238000003491 array Methods 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 230000002567 autonomic effect Effects 0.000 description 1
- 210000003403 autonomic nervous system Anatomy 0.000 description 1
- 230000003376 axonal effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 238000012742 biochemical analysis Methods 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 239000007844 bleaching agent Substances 0.000 description 1
- 238000009534 blood test Methods 0.000 description 1
- 230000008468 bone growth Effects 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 244000144987 brood Species 0.000 description 1
- 235000010633 broth Nutrition 0.000 description 1
- 125000000837 carbohydrate group Chemical group 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 238000000423 cell based assay Methods 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 150000005829 chemical entities Chemical class 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 230000000723 chemosensory effect Effects 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 238000004440 column chromatography Methods 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 230000009918 complex formation Effects 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 238000013480 data collection Methods 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 230000005016 dendritic process Effects 0.000 description 1
- 230000014155 detection of activity Effects 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 208000016097 disease of metabolism Diseases 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 230000007783 downstream signaling Effects 0.000 description 1
- 238000007878 drug screening assay Methods 0.000 description 1
- 230000008482 dysregulation Effects 0.000 description 1
- 210000003981 ectoderm Anatomy 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 210000001900 endoderm Anatomy 0.000 description 1
- 210000000105 enteric nervous system Anatomy 0.000 description 1
- 238000010195 expression analysis Methods 0.000 description 1
- 230000004438 eyesight Effects 0.000 description 1
- 238000000855 fermentation Methods 0.000 description 1
- 230000004151 fermentation Effects 0.000 description 1
- 102000034287 fluorescent proteins Human genes 0.000 description 1
- 108091006047 fluorescent proteins Proteins 0.000 description 1
- 230000004907 flux Effects 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 230000037433 frameshift Effects 0.000 description 1
- 238000010230 functional analysis Methods 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 210000000609 ganglia Anatomy 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000010359 gene isolation Methods 0.000 description 1
- 238000003209 gene knockout Methods 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 238000003167 genetic complementation Methods 0.000 description 1
- 230000007614 genetic variation Effects 0.000 description 1
- 238000012268 genome sequencing Methods 0.000 description 1
- 208000004104 gestational diabetes Diseases 0.000 description 1
- 230000006377 glucose transport Effects 0.000 description 1
- 230000004190 glucose uptake Effects 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 235000004554 glutamine Nutrition 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 230000034659 glycolysis Effects 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 210000002149 gonad Anatomy 0.000 description 1
- 230000026109 gonad development Effects 0.000 description 1
- 239000002622 gonadotropin Substances 0.000 description 1
- 208000035474 group of disease Diseases 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 239000000710 homodimer Substances 0.000 description 1
- 102000045603 human SMAD4 Human genes 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 238000010324 immunological assay Methods 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000126 in silico method Methods 0.000 description 1
- 230000000415 inactivating effect Effects 0.000 description 1
- 239000003999 initiator Substances 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 210000000011 invertebrate ventral nerve cord Anatomy 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- QRXWMOHMRWLFEY-UHFFFAOYSA-N isoniazide Chemical compound NNC(=O)C1=CC=NC=C1 QRXWMOHMRWLFEY-UHFFFAOYSA-N 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 239000005351 kimble Substances 0.000 description 1
- 238000011813 knockout mouse model Methods 0.000 description 1
- 238000011005 laboratory method Methods 0.000 description 1
- NRYBAZVQPHGZNS-ZSOCWYAHSA-N leptin Chemical compound O=C([C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC(C)C)CCSC)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CS)C(O)=O NRYBAZVQPHGZNS-ZSOCWYAHSA-N 0.000 description 1
- 229940039781 leptin Drugs 0.000 description 1
- 235000019421 lipase Nutrition 0.000 description 1
- 125000003473 lipid group Chemical group 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 210000005229 liver cell Anatomy 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 230000002101 lytic effect Effects 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 230000010198 maturation time Effects 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 230000034217 membrane fusion Effects 0.000 description 1
- 210000003716 mesoderm Anatomy 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 208000030159 metabolic disease Diseases 0.000 description 1
- 230000037323 metabolic rate Effects 0.000 description 1
- 230000029052 metamorphosis Effects 0.000 description 1
- 230000031864 metaphase Effects 0.000 description 1
- 230000000394 mitotic effect Effects 0.000 description 1
- 238000007479 molecular analysis Methods 0.000 description 1
- 210000002161 motor neuron Anatomy 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 230000000869 mutational effect Effects 0.000 description 1
- 210000004457 myocytus nodalis Anatomy 0.000 description 1
- NFVJNJQRWPQVOA-UHFFFAOYSA-N n-[2-chloro-5-(trifluoromethyl)phenyl]-2-[3-(4-ethyl-5-ethylsulfanyl-1,2,4-triazol-3-yl)piperidin-1-yl]acetamide Chemical compound CCN1C(SCC)=NN=C1C1CN(CC(=O)NC=2C(=CC=C(C=2)C(F)(F)F)Cl)CCC1 NFVJNJQRWPQVOA-UHFFFAOYSA-N 0.000 description 1
- 230000032393 negative regulation of gluconeogenesis Effects 0.000 description 1
- 230000010004 neural pathway Effects 0.000 description 1
- 230000037434 nonsense mutation Effects 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 238000003162 one-hybrid assay Methods 0.000 description 1
- 229940125395 oral insulin Drugs 0.000 description 1
- 229940126701 oral medication Drugs 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 229920002866 paraformaldehyde Polymers 0.000 description 1
- 230000007918 pathogenicity Effects 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 210000001184 pharyngeal muscle Anatomy 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 230000000865 phosphorylative effect Effects 0.000 description 1
- 238000000053 physical method Methods 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 230000021625 positive regulation of cell division Effects 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 238000001273 protein sequence alignment Methods 0.000 description 1
- 230000012743 protein tagging Effects 0.000 description 1
- 150000003254 radicals Chemical class 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 102000027426 receptor tyrosine kinases Human genes 0.000 description 1
- 108091008598 receptor tyrosine kinases Proteins 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 238000007634 remodeling Methods 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 230000000754 repressing effect Effects 0.000 description 1
- 230000004043 responsiveness Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000000979 retarding effect Effects 0.000 description 1
- 102220144866 rs753460994 Human genes 0.000 description 1
- 238000003345 scintillation counting Methods 0.000 description 1
- 210000004739 secretory vesicle Anatomy 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 230000000392 somatic effect Effects 0.000 description 1
- 230000002269 spontaneous effect Effects 0.000 description 1
- 238000003153 stable transfection Methods 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 230000003319 supportive effect Effects 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 230000008625 synaptic signaling Effects 0.000 description 1
- 230000001360 synchronised effect Effects 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 230000016853 telophase Effects 0.000 description 1
- 230000035922 thirst Effects 0.000 description 1
- 238000006257 total synthesis reaction Methods 0.000 description 1
- 108091006106 transcriptional activators Proteins 0.000 description 1
- 108091008023 transcriptional regulators Proteins 0.000 description 1
- 230000002463 transducing effect Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000003151 transfection method Methods 0.000 description 1
- 238000011426 transformation method Methods 0.000 description 1
- 101150088302 trim72 gene Proteins 0.000 description 1
- 108010064892 trkC Receptor Proteins 0.000 description 1
- 102000047459 trkC Receptor Human genes 0.000 description 1
- 238000010396 two-hybrid screening Methods 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 230000022211 vulval development Effects 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
- A01K67/033—Rearing or breeding invertebrates; New breeds of invertebrates
- A01K67/0333—Genetically modified invertebrates, e.g. transgenic, polyploid
- A01K67/0335—Genetically modified worms
- A01K67/0336—Genetically modified Nematodes, e.g. Caenorhabditis elegans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K49/00—Preparations for testing in vivo
- A61K49/0004—Screening or testing of compounds for diagnosis of disorders, assessment of conditions, e.g. renal clearance, gastric emptying, testing for diabetes, allergy, rheuma, pancreas functions
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70596—Molecules with a "CD"-designation not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/8509—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells for producing genetically modified animals, e.g. transgenic
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/5082—Supracellular entities, e.g. tissue, organisms
- G01N33/5085—Supracellular entities, e.g. tissue, organisms of invertebrates
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2207/00—Modified animals
- A01K2207/15—Humanized animals
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/05—Animals comprising random inserted nucleic acids (transgenic)
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/07—Animals genetically altered by homologous recombination
- A01K2217/075—Animals genetically altered by homologous recombination inducing loss of function, i.e. knock out
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2227/00—Animals characterised by species
- A01K2227/10—Mammal
- A01K2227/105—Murine
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2267/00—Animals characterised by purpose
- A01K2267/03—Animal model, e.g. for test or diseases
- A01K2267/0306—Animal model for genetic diseases
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2267/00—Animals characterised by purpose
- A01K2267/03—Animal model, e.g. for test or diseases
- A01K2267/035—Animal model for multifactorial diseases
- A01K2267/0362—Animal model for lipid/glucose metabolism, e.g. obesity, type-2 diabetes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/43504—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from invertebrates
- G01N2333/43526—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from invertebrates from worms
- G01N2333/4353—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from invertebrates from worms from nematodes
Definitions
- This invention relates to compositions and methods useful for delaying or ameliorating human diseases associated with glucose intolerance. Diabetes is a major disease affecting over 16 million individuals in the United States alone at an annual cost of over 92 billion dollars.
- Type I diabetes or insulin-dependent diabetes is an autoimmune disease.
- IDDM insulin-dependent diabetes
- the immune system attacks and destroys the insulin-producing beta cells in the pancreas.
- the central role of insulin in human metabolism is to aid in the transport of glucose into muscle cells and fat cells.
- the body's inability to produce insulin results in hyperglycemia, ketoacidosis, thirst, and weight loss.
- diabetics often suffer from chronic atherosclerosis and kidney and eyesight failure.
- a patient with IDDM requires daily injections of insulin to survive.
- Type II diabetes is a heterogenous group of disorders in which hyperglycemia results from both impaired insulin secretory response to glucose and decreased insulin effectiveness (i.e., insulin resistance). Older people who are overweight are at particular risk for Type II diabetes. Genetic studies have suggested that. Type II diabetes is found in families and that the disease may be due to multiple genetic defects. In addition, the link between obesity and Type II diabetes is strong. Approximately 80 percent of Type II diabetics are obese. Weight loss and exercise can be effective to keep blood glucose levels normal, reducing the long-term complications of the disease. At present there are few reliable methods for presymptomatic diagnosis of a genetic predisposition for diabetes or obesity.
- Treatments for diabetes emphasize control of blood glucose through blood glucose monitoring.
- the majority of patients take oral medications and/or insulin injections for appropriate control.
- Treatment of diabetes is generally chronic and lifelong, and treatments are generally not satisfactory over the long run.
- insulin treatment may become increasingly ineffective as the disease progresses. While insulin has been known for decades, and within the past decade, the receptors for insulin and aspects of its signaling pathway have been identified, the transcriptional output from these signaling pathways have not been characterized. In addition, the molecular basis of the obesity-induced insulin resistance is unknown.
- C. elegans metabolic regulatory genes daf-2 and age-1 encode homologues of the mammalian insulin receptor/PI 3-kinase signaling pathway proteins, respectively.
- DAF-16 forkhead protein represents the major transcriptional output of this insulin signaling pathway. For example, we have discovered that it is the dysregulation of the DAF-16 transcription factor in the absence of insulin signaling that leads to metabolic defects; inactivation of DAF-16 reverses the metabolic defects caused by lack of insulin signaling in C. elegans.
- C. elegans metabolic regulatory genes daf-2 and age-1 encode homologues of the mammalian insulin receptor/PI 3-kinase signaling pathway proteins, respectively.
- DAF-16 forkhead protein represents the major transcriptional output of this insulin signaling pathway. For example, we have discovered that it is the dysregulation of the DAF-16 transcription factor in the absence of insulin signaling that leads to metabolic defects; inactivation of DAF-16 reverses the metabolic defects caused by lack of insulin signaling in C. elegans.
- elegans daf-7, daf-1, daf-4, daf-8, daf-14, and daf-3 genes encode neuroendocrine/target tissue TGF- ⁇ type signal transduction molecules that genetically interact with the insulin signaling pathway.
- the metabolic defects caused by lack of neuroendocrine TGF- ⁇ signals can be reversed by inactivation of the DAF-3 transcription factor.
- D AF-7 and D AF-2 insulin-like signaling indicate that many cases of obesity-induced and genetically-induced diabetes (and obesity) may be treated by administration of a human DAF-7 polypeptide.
- the invention features a substantially pure preparation of a DAF-2 polypeptide, which can be derived from an animal (for example, a mammal, such as a human, or an invertebrate, such as C. elegans).
- the DAF-2 polypeptide has insulin receptor (InR) activity, insulin receptor related activity, insulin-like growth factor receptor (IGF-1) receptor activity, or a combination of these activities.
- InR insulin receptor
- IGF-1 insulin-like growth factor receptor
- the invention also features isolated DNA encoding a DAF-2 polypeptide.
- This isolated DNA can have a nucleotide sequence that includes, for example, the nucleotide sequence of the daf-2 gene shown in Fig. 2B.
- This isolated DNA can also, in preferred embodiments, complement a daf-2 mutation in C. elegans, an InR mutation in a mouse, or an IGF-1 receptor mutation in a mouse.
- the isolated DNA encoding a DAF-2 polypeptide can be included in a vector, such as a vector that is capable of directing the expression of the protein encoded by the DNA in a vector-containing cell.
- the isolated DNA in the vector can be operatively linked to a promoter, for example, a promoter selected from the group consisting of daf-2, age-1, daf- 16, daf-1, daf-4, daf-3, and akt promoters.
- the isolated DNA encoding a DAF-2 polypeptide, or a vector including this DNA can be contained in a cell, such as a bacterial, mammalian, or nematode cell. Also included in the invention is a method of producing a recombinant
- DAF-2 polypeptide and a DAF-2 polypeptide produced by this method.
- This method involves (a) providing a cell transformed with isolated DNA that (i) encodes a DAF-2 polypeptide, and (ii) is positioned for expression in the cell, under conditions for expressing the isolated DNA, and (b) isolating the recombinant DAF-2 polypeptide.
- a substantially pure antibody such as a monoclonal or polyclonal antibody, that specifically recognizes and binds a DAF-2 polypeptide is also included in the invention.
- the invention also features a method of detecting a gene, or a portion of a gene, that is found in a human cell and has sequence identity to the daf-2 sequence of Fig. 2B.
- isolated DNA encoding a DAF-2 polypeptide, a portion of such DNA greater than about 12 residues in length, or a degenerate oligonucleotide corresponding to SEQ ID NOS: 33, 34, 79, 80, 81,
- This method can also include a step of testing the gene, or portion thereof, for the ability to functionally complement a C. elegans daf- 2 mutant.
- Another method included in the invention is a method of isolating a gene, or a portion of a gene, that is found in a human cell and has at least 90% nucleic acid sequence identity to a sequence encoding SEQ ID NOS: 33, 34, 79, 80, 81, 82, 83, or 84.
- This method involves (a) amplifying by PCR the human gene, or portion thereof, using oligonucleotide primers that (i) are each greater than about 12 residues in length, and (ii) each have regions of complementarity to opposite DNA strands in a region of the nucleotide sequence of Fig. 2B, and (b) isolating the human gene, or portion thereof.
- This method can also include a step of testing the gene, or portion thereof, for the ability to functionally complement a C. elegans daf-2 mutant.
- the invention features a substantially pure preparation of a DAF-3 polypeptide, which can be derived from an animal (for example, a mammal, such as a human, or an invertebrate, such as C. elegans).
- the polypeptide is a SMAD protein.
- the polypeptide is capable of binding and interacting with a nematode DAF-1, DAF-4, DAF-8, DAF- 14, or DAF- 16 polypeptide.
- the invention also features isolated DNA encoding a DAF-3 polypeptide. This isolated DNA can have a sequence that includes, for example, the nucleotide sequence of a daf 3 gene shown in Figs.
- This isolated DNA can also, in preferred embodiments, complement a daf 3 mutation in C. elegans or complement a daf 3 knockout mouse.
- the isolated DNA encoding a DAF-3 polypeptide can be included in a vector, such as a vector that is capable of directing the expression of the protein encoded by the DNA in a vector-containing cell.
- the isolated DNA in the vector can be operatively linked to a promoter, for example, a promoter selected from the group consisting of daf 3, daf-4, daf 16, daf 2, age-1, and akt promoters.
- the isolated DNA encoding a DAF-3 polypeptide, or a vector including this DNA can be contained in a cell, such as a bacterial, mammalian, or nematode cell.
- Also included in the invention is a method of producing a recombinant DAF-3 polypeptide, and a DAF-3 polypeptide produced by this method.
- This method involves (a) providing a cell transformed with isolated DNA that (i) encodes a DAF-3 polypeptide, and (ii) is positioned for expression in the cell, under conditions for expressing the isolated DNA, and (b) isolating the recombinant DAF-3 polypeptide.
- a substantially pure antibody such as a monoclonal or polyclonal antibody, that specifically recognizes and binds a DAF-3 polypeptide is also included in the invention.
- the invention also features a method of detecting a gene, or a portion of a gene, that is found in a human cell and has sequence identity to any of the daf 3 sequences of Figs. 11 A, 1 IB, or 1 lC.
- isolated DNA encoding a DAF-3 polypeptide, a portion of such DNA that is greater than about 12 residues in length, or a degenerate oligonucleotide corresponding to SEQ ID NOS: 35, 36, or 85 is contacted with a preparation of DNA from the human cell under hybridization conditions that provide detection of DNA sequences having about 70% or greater nucleic acid sequence identity to any of the daf- 3 sequences of Figs. 11 A, 1 IB, or 1 IC.
- This method can also include a step of testing the gene, or portion thereof, for the ability to functionally complement a C. elegans daf 3 mutant.
- Another method included in the invention is a method of isolating a gene, or a portion thereof, that is found in a human cell and has at least 90% nucleic acid sequence identity to a sequence encoding SEQ ID NOS: 35, 36, or 85.
- This method includes (a) amplifying by PCR the human gene, or portion thereof, using oligonucleotide primers that (i) are each greater than about 12 residues in length, and (ii) each have regions of complementarity to opposite
- the invention features a substantially pure preparation of DAF- 16 polypeptide, which can be derived from an animal (for example, a mammal, such as a human, or an invertebrate, such as C. elegans).
- the polypeptide is a forkhead transcription factor that binds DNA.
- the polypeptide is capable of interacting with a polypeptide selected from the group consisting of DAF-3,
- the invention also features isolated DNA encoding a DAF- 16 polypeptide.
- This isolated DNA can have a sequence that includes, for example, the sequence of the daf 6 gene shown in Figs. 13A or 13B.
- This isolated DNA can also, in preferred embodiments, complement a daf 6 mutation in C. elegans, or complement an FKHR or AFX mutation in a mouse.
- the isolated DNA encoding a DAF- 16 polypeptide can be included in a vector, such as a vector that is capable of directing the expression of the protein encoded by the DNA in a vector-containing cell.
- the isolated DNA in the vector can be operatively linked to a promoter, for example, a promoter selected from the group consisting of daf 2, age-1, daf 16, daf 3, daf 4, and akt promoters.
- a promoter selected from the group consisting of daf 2, age-1, daf 16, daf 3, daf 4, and akt promoters.
- the isolated DNA encoding a DAF- 16 polypeptide, or a vector containing this DNA can be contained in a cell, such as a bacterial, mammalian, or nematode cell.
- Also included in the invention is a method for producing a recombinant DAF- 16 polypeptide, and a DAF- 16 polypeptide produced by this method.
- This method involves (a) providing a cell transformed with purified DNA that (i) encodes a DAF- 16 polypeptide, and (ii) is positioned for expression in the cell, under conditions for expressing the isolated DNA, and (b) isolating the recombinant DAF- 16 polypeptide.
- a substantially pure antibody such as a monoclonal or polyclonal antibody, that specifically recognizes and binds a DAF- 16 polypeptide is also included in the invention.
- the invention also features a method of detecting a gene, or a portion of a gene, that is found in a human cell and has sequence identity to the daf- 16 sequence of Figs. 13A or 13B.
- isolated DNA encoding a DAF- 16 polypeptide, a portion of such DNA that is greater than about 12 residues in length, or a degenerate oligonucleotide corresponding to SEQ ID NO: 54, 55,
- This method can also include a step of testing the gene, or portion of the gene, for the ability to functionally complement a C. elegans daf- 16 mutant.
- Another method included in the invention is a method of isolating a gene, or a portion of a gene, that is found in a human cell and has at least 90% nucleic acid sequence identity to a sequence encoding SEQ ID NO: 54, 55, 56, or 57.
- This method involves (a) amplifying by PCR the human gene, or portion thereof, using oligonucleotide primers that (i) are each greater than about 12 residues in length, and (ii) each have regions of complementarity to opposite DNA strands in a region of the nucleotide sequence of Figs. 13A or 13B, and
- This method can also include a step of testing the gene, or portion thereof, for the ability to functionally complement a C. elegans dafl 6 mutant.
- the invention features a method of determining whether a human gene is involved in an impaired glucose tolerance condition
- This method involves (a) providing a nematode having a mutation in a daf or age gene, and (b) expressing in the nematode the human gene, which is operatively linked to a nematode gene promoter. Complementation of the daf or age mutation in the nematode is indicative of a human gene that is involved in an impaired glucose tolerance condition or obesity.
- the nematode gene promoter is selected from the group consisting of dafl, daf 3, daf 4, daf 2, age-1, and akt gene promoters.
- the daf mutation is selected from the group consisting of daf- 2, daf 3, dafl, daf-4, daf 7, daf-8, daf 11, daf 12, daf 14, and dafl 6 mutations.
- the mutation can also be found in the age-1 gene.
- the invention features methods for diagnosing an impaired glucose tolerance condition (for example, Type II diabetes or a condition involving atherosclerosis), or a propensity for such a condition, in a patient.
- an impaired glucose tolerance condition for example, Type II diabetes or a condition involving atherosclerosis
- One such method includes analyzing the DNA of the patient to determine whether the DNA contains a mutation in a daf gene. Identification of such a mutation indicates that the patient has an impaired glucose tolerance condition or a propensity for such a condition.
- the analysis in this method can be carried out, for example, by nucleotide sequencing or RFLP analysis.
- the analysis can also include amplifying (for example, by PCR or reverse transcriptase PCR) the gene (for example, a human gene), or a fragment thereof, using primers, and analyzing the amplified gene, or a fragment thereof, for the presence of the mutation.
- the daf gene analyzed in this method is, for example, a dafl, daf 2, daf 3 daf 4, daf 7, daf 8, daf 11, dafl 2, daf- 14, or daf- 16 coding sequence, or the daf gene is FKHR or AFX.
- Another method for diagnosing an impaired glucose tolerance condition, such as Type II diabetes, or a propensity for such a condition, in a patient includes analyzing the DNA of the patient to determine whether the DNA contains a mutation in an age gene. Identification of such a mutation indicates that the patient has an impaired glucose tolerance condition or a propensity for such a condition.
- the analysis in this method can be carried out, for example, by nucleotide sequencing or RFLP analysis.
- the analysis can also include amplifying (for example, by PCR or reverse transcriptase PCR) the gene (for example, a human gene), or a fragment thereof, using primers and analyzing the amplified gene, or fragment thereof, for the presence of the mutation.
- the age gene is an age-1 coding sequence.
- Yet another method for diagnosing an impaired glucose tolerance condition such as Type II diabetes or a condition that involves atherosclerosis, or a propensity for such a condition, in a patient, includes analyzing the DNA of the patient to determine whether the DNA contains a mutation in an akt gene. Identification of such a mutation indicates that the patient has an impaired glucose tolerance condition (for example, Type II diabetes) or a propensity for such a condition (for example, a pre-diabetic condition).
- the analysis in this method can be carried out, for example, by nucleotide sequencing or RFLP analysis.
- the analysis can also include amplifying (for example, by PCR or reverse transcriptase PCR) the gene (for example, a human gene), or a fragment thereof, using primers and analyzing the amplified gene, or fragment thereof, for the presence of the mutation.
- amplifying for example, by PCR or reverse transcriptase PCR
- the gene for example, a human gene
- primers and analyzing the amplified gene, or fragment thereof, for the presence of the mutation.
- kits for use in the diagnosis of an impaired glucose tolerance condition, or a propensity for such a condition, in a patient includes a PCR primer complementary to a daf nucleic acid sequence and instructions for diagnosing an impaired glucose tolerance condition or a propensity for such a condition.
- Another kit includes a PCR primer complementary to an age nucleic acid sequence and instructions for diagnosing an impaired glucose tolerance condition or a propensity for such a condition.
- Yet another kit includes a PCR primer complementary to an akt nucleic acid sequence and instructions for diagnosing an impaired glucose tolerance condition or a propensity for such a condition.
- the invention features methods for ameliorating or delaying the onset of an impaired glucose tolerance condition (for example, Type II diabetes) in a patient.
- a therapeutically effective amount of a DAF polypeptide for example, the human or nematode DAF-7 polypeptide
- a therapeutically effective amount of a compound that is capable of inhibiting the activity of a DAF- 16 or DAF-3 polypeptide is administered to the patient.
- a therapeutically effective amount of a compound that activates a DAF-1, DAF-4, DAF-8, DAF-11, or DAF-14 polypeptide is administered to the patient.
- Another aspect of the invention provides methods for ameliorating or preventing obesity (for example, obesity associated with Type II diabetes) in a patient.
- One such method involves administering to the patient a therapeutically effective amount of a DAF polypeptide, such as a human or nematode DAF-7 polypeptide.
- Another such method involves administering to the patient a therapeutically effective amount of a compound that is capable of inhibiting the activity of a DAF- 16 or DAF-3 polypeptide.
- Yet another aspect of the invention features a transgenic, non-human animal, such as a mouse or a nematode, whose germ cells and somatic cells contain a transgene coding for a mutant DAF polypeptide, for example, a mutant DAF polypeptide that is derived from a human.
- the mutant DAF polypeptide is a DAF-1, DAF-2, DAF-3, DAF- 4, DAF-7, DAF-8, DAF-11, DAF-12, DAF-14, or DAF-16 polypeptide.
- the transgene includes a knockout mutation.
- the invention features a transgenic, non-human animal, such as a mouse or a nematode, whose germ cells and somatic cells contain a transgene coding for a mutant AGE polypeptide, for example, a mutant AGE polypeptide derived from a human.
- the mutant AGE polypeptide is an AGE-1 polypeptide.
- the transgene includes a knockout mutation.
- the invention features a transgenic, non-human animal, such as a mouse or a nematode, whose germ cells and somatic cells contain a transgene coding for a mutant AKT polypeptide, for example, a mutant AKT polypeptide derived from a human.
- the transgene includes a knockout mutation.
- the invention features cells (for example, cells isolated from a mammal, such as mouse, human, or nematode cells) isolated from the transgenic animals described above.
- the invention also includes methods for producing transgenic, non- human animals.
- the invention includes a method for producing a transgenic, non-human animal that lacks an endogenous daf gene and is capable of expressing a human DAF polypeptide. This method involves (a) providing a transgenic, non-human animal whose germ cells and somatic cells contain a mutation in a daf gene, and (b) introducing a transgene that (i) encodes a human DAF polypeptide, and (ii) is capable of expressing the human polypeptide, into an embryonal cell of the non-human animal.
- Another method included in the invention can be used for producing a transgenic, non-human animal that lacks an endogenous age gene and is capable of expressing a human AGE polypeptide.
- This method involves (a) providing a transgenic, non-human animal whose germ cells and somatic cells contain a mutation in an age gene, and (b) introducing a transgene that (i) encodes a human AGE polypeptide, and (ii) is capable of expressing the human polypeptide, into an embryonal cell of the non-human animal.
- the invention includes a method for producing a transgenic, non-human animal that lacks an endogenous akt gene and is capable of expressing of expressing a human AKT polypeptide.
- This method involves (a) providing a transgenic, non-human animal whose germ cells and somatic cells contain a mutation in an akt gene, and (b) introducing a transgene that (i) encodes a human AKT polypeptide, and (ii) is capable of expressing the human polypeptide, into an embryonal cell of the non-human animal.
- Another aspect of the invention features a method of screening for a compound that increases the activity of a DAF polypeptide.
- This method includes (a) exposing a non-human transgenic animal whose germ cells and somatic cells contain a transgene coding for a mutant DAF polypeptide to a candidate compound, and (b) determining the activity of the DAF polypeptide in the transgenic animal.
- An increase in DAF polypeptide activity, as compared to untreated controls, is indicative of a compound that is capable of increasing DAF polypeptide activity.
- the compound can be used to treat an impaired glucose tolerance condition or obesity.
- the invention features a method of screening for a compound that decreases the activity of a DAF polypeptide.
- This method includes (a) exposing a non-human transgenic animal whose germ cells and somatic cells contain a transgene coding for a mutant DAF polypeptide to a candidate compound, and (b) determining the activity of the DAF polypeptide in the transgenic animal.
- a decrease in DAF polypeptide activity, as compared to untreated controls, is indicative of a compound that is capable of decreasing DAF polypeptide activity.
- the compound can be used to treat an impaired glucose tolerance condition, obesity, or atherosclerosis.
- the compound decreases the activity of DAF-3 or DAF- 16.
- the invention features a method of screening for a compound that increases the activity of an AGE polypeptide.
- This method includes (a) exposing a non-human transgenic animal whose germ cells and somatic cells contain a transgene coding for a mutant AGE polypeptide to a candidate compound, and (b) determining the activity of the AGE polypeptide in the transgenic animal.
- An increase in AGE polypeptide activity, as compared to untreated controls, is indicative of a compound that is capable of increasing AGE polypeptide activity.
- the compound can be used to treat an impaired glucose tolerance condition, obesity, or atherosclerosis.
- the invention features a method of screening for a compound that decreases the activity of a AGE polypeptide.
- This method includes (a) exposing a non-human, transgenic animal whose germ cells and somatic cells contain a transgene coding for a mutant AGE polypeptide to a candidate compound, and (b) determining the activity of the AGE polypeptide in the transgenic animal.
- a decrease in AGE polypeptide activity, as compared to untreated controls, is indicative of a compound that is capable of decreasing AGE polypeptide activity.
- the compound can be used to treat an impaired glucose tolerance condition, obesity, or atherosclerosis.
- the AGE polypeptide is AGE-1.
- the invention features a method of screening for a compound that increases the activity of an AKT polypeptide.
- This method includes (a) exposing a transgenic, non-human animal whose germ cells and somatic cells contain a transgene coding for a mutant AKT polypeptide to a candidate compound, and (b) determining the activity of the AKT polypeptide in the transgenic animal.
- An increase in AKT polypeptide activity, as compared to untreated controls, is indicative of a compound that is capable of increasing AKT polypeptide activity.
- the compound can be used to treat an impaired glucose tolerance condition, obesity, or atherosclerosis.
- the invention features a method of screening for a compound that decreases the activity of a AKT polypeptide.
- This method includes (a) exposing a transgenic, non-human animal whose germ cells and somatic cells contain a transgene coding for a mutant AKT polypeptide to a candidate compound, and (b) determining the activity of the AKT polypeptide in the transgenic animal.
- a decrease in AKT polypeptide activity, as compared to untreated controls, is indicative of a compound that is capable of decreasing AKT polypeptide activity.
- the compound can be used to treat an impaired glucose tolerance condition or obesity.
- Also included in the invention is a method of screening for a compound that is capable of ameliorating or delaying an impaired glucose tolerance condition.
- This method involves (a) exposing a transgenic, non-human animal whose germ cells and somatic cells contain a transgene coding for a mutant DAF, AGE, or AKT polypeptide to a candidate compound, and (b) monitoring the blood glucose level of the animal.
- a compound that promotes maintenance of a physiologically acceptable level of blood glucose in the animal, as compared to untreated controls, is indicative of a compound that is capable of ameliorating or delaying an impaired glucose tolerance condition.
- the compound can be used to treat Type II diabetes.
- Another method of screening for a compound that is capable of ameliorating or delaying obesity is also included in the invention.
- This method involves (a) exposing a transgenic, non-human animal whose germ cells and somatic cells contain a transgene coding for a mutant DAF, AGE, or AKT polypeptide to a candidate compound, and (b) monitoring the adipose tissue of the animal.
- a compound that promotes maintenance of a physiologically acceptable level of adipose tissue in the animal, as compared to untreated controls, is indicative of a compound that is capable of ameliorating or delaying obesity.
- a related method of the invention can be used for screening for a compound that is capable of ameliorating or delaying atherosclerosis.
- This method involves (a) exposing a transgenic, non-human animal whose germ cells and somatic cells contain a transgene coding for a mutant DAF, AGE, or AKT polypeptide to a candidate compound, and (b) monitoring the adipose tissue of the animal.
- a compound that promotes maintenance of a physiologically acceptable level of adipose tissue in the animal, as compared to untreated controls, is indicative of a compound that is capable of ameliorating or delaying atherosclerosis.
- the invention includes a method for identifying a modulatory compound that is capable of decreasing the expression of a daf gene. This method involves (a) providing a cell expressing the daf gene, and (b) contacting the cell with a candidate compound. A decrease in daf expression following contact with the candidate compound identifies a modulatory compound.
- the compound can be used W wO 9 y 8o i /z .1m351 i PCT/US98/10080
- the compound is capable of decreasing the expression of DAF-3 or DAF- 16. This method can be carried out in an animal, such as a nematode.
- the invention includes a method for the identification of a modulatory compound that is capable of increasing the expression of a daf gene.
- This method involves (a) providing a cell expressing the daf gene, and (b) contacting the cell with a candidate compound. An increase in daf expression following contact with the candidate compound identifies a modulatory compound.
- the compound can be used to treat an impaired glucose tolerance condition or obesity.
- the compound is capable of increasing expression of DAF- 1 , DAF-2, DAF-4, DAF-7, DAF-8, DAF-11, or DAF- 14. This method can be carried out in an animal, such as a nematode.
- the invention includes a method for the identification of a modulatory compound that is capable of increasing the expression of an age-1 gene.
- This method involves (a) providing a cell expressing the age-1 gene, and (b) contacting the cell with a candidate compound. An increase in age-1 expression following contact with the candidate compound identifies a modulatory compound.
- the compound is capable of treating an impaired glucose tolerance condition or obesity. This method can be carried out in an animal, such as a nematode.
- the invention provides a method for identification of a compound that is capable of ameliorating or delaying an impaired glucose tolerance condition.
- This method involves (a) providing a dauer larvae including a mutation in a daf gene, and (b) contacting the dauer larvae with a compound. Release from the dauer larval state is an indication that the compound is capable of ameliorating or delaying an impaired glucose tolerance condition.
- the dauer larvae carries a daf 2 mutation.
- the dauer larvae is from C. elegans.
- the impaired glucose tolerance condition involves obesity or atherosclerosis.
- the invention provides a method for identification of a compound that is capable of ameliorating or delaying an impaired glucose tolerance condition.
- This method involves (a) providing a dauer larvae including a mutation in an age-1 gene, and (b) contacting the dauer larvae with a compound. Release from the dauer larval state is an indication that the compound is capable of ameliorating or delaying an impaired glucose tolerance condition.
- the dauer larvae carries an age-1 mutation.
- the dauer larvae is from C. elegans.
- the impaired glucose tolerance condition involves obesity or atherosclerosis.
- the invention provides a method for the identification of a compound that is capable of ameliorating or delaying an impaired glucose tolerance condition.
- This method involves (a) providing a dauer larvae including a mutation in an akt gene, and (b) contacting the dauer larvae with a compound. Release from the dauer larval state is an indication that the compound is capable of ameliorating or delaying an impaired glucose tolerance condition.
- the dauer larvae is from C. elegans.
- the impaired glucose tolerance condition involves obesity or atherosclerosis.
- the invention provides a method for the identification of a compound for ameliorating or delaying an impaired glucose tolerance condition.
- This method involves (a) combining PIP3 and an AKT polypeptide in the presence and absence of a compound under conditions that allow PIP3:AKT complex formation, (b) identifying a compound that is capable of decreasing the formation of the PIP3:AKT complex, and (c) determining whether the compound identified in step (b) is capable of increasing AKT activity.
- An increase in AKT kinase activity is taken as an indication of a compound useful for ameliorating or delaying an impaired glucose tolerance condition.
- the invention provides a method for the identification of a compound for ameliorating or delaying an impaired glucose tolerance condition.
- This method involves (a) providing a daf-7, daf 3 mutant nematode, (b) expressing in the cells of the nematode a mammalian DAF-3 polypeptide, whereby the nematode forms a dauer larva, and (c) contacting the dauer larva with a compound.
- a release from the dauer larval state is an indication that the compound is capable of ameliorating or delaying the glucose intolerance condition.
- the invention features a method for the identification of a compound for ameliorating or delaying an impaired glucose tolerance condition.
- This method involves (a) providing a daf 2, daf 16 mutant nematode, (b) expressing in the cells of the nematode a mammalian DAF- 16 polypeptide, whereby the nematode forms a dauer larva, and (c) contacting the dauer larva with a compound.
- a release from the dauer larval state is an indication that the compound is capable of ameliorating or delaying the glucose intolerance condition.
- the invention features insulin-like molecules and their use as diagnostic and therapeutic reagents.
- DAF polypeptide As used herein, by a “DAF” polypeptide is meant a polypeptide that functionally complements a C. elegans daf mutation and/or that has at least 60%, preferably 75%, and more preferably 90% amino acid sequence identity to a 100 amino acid region (and preferably a conserved domain) of a C. elegans DAF polypeptide. Complementation may be assayed in an organism (for example, in a nematode) or in a cell culture system. Complementation may be partial or complete, but must provide a detectable increase in function (as described herein). DAF polypeptides are encoded by "DAF" genes or nucleic acid sequences.
- an “AGE” polypeptide is meant a polypeptide that functionally complements a C. elegans age mutation and/or that has at least 60%, preferably 75%, and more preferably 90% amino acid sequence identity to a 100 amino acid region (and preferably a conserved domain) of a C. elegans AGE polypeptide.
- Complementation may be assayed in an organism (for example, in a nematode) or in a cell culture system. Complementation may be partial or complete, but must provide a detectable increase in a known AGE function.
- AGE polypeptides are encoded by "AGE" genes or nucleic acid sequences.
- an "AKT" polypeptide is meant a polypeptide that functionally complements a C. elegans akt mutation and/or that possess at least 64% amino acid sequence identity to SEQ ID NO: 60, at least 71% amino acid sequence identity to SEQ ID NO: 61, at least 79% amino acid sequence identity to SEQ ID NO: 62, at least 63% amino acid sequence identity to SEQ ID NO: 63, at least 48% amino acid sequence identity to SEQ ID NO: 64, at least 70% amino acid sequence identity to SEQ ID NO: 65, at least 64% amino acid sequence identity to SEQ ID NO: 66, at least 67% amino acid sequence identity to SEQ ID NO: 67, or a combination thereof.
- Complementation may be assayed in an organism (for example, in a nematode) or in a cell culture system. Complementation may be partial or complete, but must provide a detectable increase in a known AKT function.
- AKT polypeptides are encoded by "AKT" genes or nucleic acid sequences.
- DAF-2 polypeptide a polypeptide that complements (as defined above) a C. elegans daf 2 mutation and/or that possesses at least 61% amino acid sequence identity to SEQ ID NO: 33, at least 31% amino acid sequence identity to SEQ ID NO: 34, at least 43% amino acid sequence identity to SEQ ID NO: 79, at least 35% amino acid sequence identity to SEQ ID NO: 80, at least 35% amino acid sequence identity to SEQ ID NO: 81, at least 48% amino acid sequence identity to SEQ ID NO: 82, at least 43% amino acid sequence identity to SEQ ID NO: 83, at least 40% amino acid sequence identity to SEQ ID NO: 84, or a combination thereof.
- a DAF-2 polypeptide includes an aspartic acid, a proline, a proline, a serine, an alanine, an aspartic acid, a cysteine, or a proline at amino acid positions corresponding to C. elegans DAF-2 amino acids 1252, 1312, 1343, 347, 451, 458, 526, 279, and 348 respectively, or a combination thereof.
- a DAF-3 polypeptide is meant a polypeptide that complements (as defined above) a C. elegans daf 3 mutation and/or that possesses at least 60% amino acid sequence identity to SEQ ID NO: 35, at least 38% amino acid sequence identity to SEQ ID NO: 36, at least 47% amino acid sequence identity to SEQ ID NO: 85, or a combination thereof.
- a DAF-3 polypeptide includes a proline or a glycine at amino acid positions corresponding to C. elegans daf -3 amino acids at positions 200 (proline) and/or 620 (glycine) in Fig. 12 A, respectively, or a combination thereof.
- the polypeptide may include a proline in the motif GRKGFPHV or a glycine in the motif RXXIXXG (where X is any amino acid).
- DAF- 16 polypeptide a polypeptide that complements (as defined above) a C. elegans daf- 16 mutation and/or that possesses at least 71% amino acid sequence identity to SEQ ID NO: 54, at least 35% amino acid sequence identity to SEQ ID NO: 55, at least 65% amino acid sequence identity to SEQ ID NO: 56, at least 53% amino acid sequence identity to SEQ ID NO: 57, or a combination thereof.
- a DAF- 16 polypeptide preferably includes a serine residue in the conserved motif WKNSIRH (SEQ ID NO: 59).
- a DAF-7 polypeptide is meant a polypeptide that complements (as defined above) a C. elegans daf- 7 mutation and/or that possesses at least 29% amino acid sequence identity to SEQ ID NO: 26, at least 66% amino acid sequence identity to SEQ ID NO: 27, at least 45% amino acid sequence identity to SEQ ID NO: 28, at least 33% amino acid sequence identity to SEQ ID NO: 29, at least 56% amino acid sequence identity to SEQ ID NO: 30, at least 75% sequence identity to SEQ ID No: 51, or a combination thereof.
- a DAF-7 polypeptide includes a proline or a glycine at amino acid positions corresponding to C. elegans daf 7 amino acids 271 and 280, respectively, or a combination thereof.
- DAF- 8 polypeptide a polypeptide that complements (as defined above) a C. elegans daf 8 mutation and/or that possesses at least 46% amino acid sequence identity to SEQ ID NO: 23, at least 45% amino acid sequence identity to SEQ ID NO: 24, at least 36% amino acid sequence identity to SEQ ID NO: 25, or a combination thereof.
- an “AGE-1 polypeptide” is meant a polypeptide that complements (as defined above) a C. elegans age-1 mutation (previously known as a daf-23 mutation) and/or that possesses at least 40% amino acid sequence identity to SEQ ID NO: 17, at least 45% amino acid sequence identity to SEQ ID NO: 18, at least 30% amino acid sequence identity to SEQ ID NO: 19, at least 24% amino acid sequence identity to SEQ ID NO: 38, or a combination thereof.
- an AGE-1 polypeptide includes an alanine at amino acid positions corresponding to C. elegans age-1 amino acids 845.
- DAF-1 polypeptide a polypeptide that complements (as defined above) a C. elegans dafl mutation and/or that possesses at least 45% amino acid sequence identity to SEQ ID NO: 13, at least 35% amino acid sequence identity to SEQ ID NO: 14, at least 65% amino acid sequence identity to SEQ ID NO: 15, at least 25% amino acid sequence identity to SEQ ID NO: 16, or a combination thereof.
- a DAF-1 polypeptide includes a proline at the amino acid position corresponding to C. elegans DAF-1 amino acid 546.
- DAF-4 polypeptide a polypeptide that complements (as defined above) a C. elegans daf 4 mutation and/or that possesses at least 45% amino acid sequence identity to SEQ ID NO: 20, at least 40% amino acid sequence identity to SEQ ID NO: 21, at least 44% amino acid sequence identity to SEQ ID NO: 22, or a combination thereof.
- DAF-11 polypeptide a polypeptide that complements (as defined above) a C. elegans daf- 11 mutation and/or that possesses at least 40% amino acid sequence identity to SEQ ID NO: 75, at least 43% amino acid sequence identity to SEQ ID NO: 76, at least 36% amino acid sequence identity to SEQ ID NO: 77, at least 65% amino acid sequence identity to SEQ ID NO: 78, or a combination thereof.
- DAF- 12 polypeptide a polypeptide that complements (as defined above) a C. elegans daf 12 mutation and/or that possesses at least 42% amino acid sequence identity to SEQ ID NO: 72, at least 58% amino acid sequence identity to SEQ ID NO: 73, at least 34% amino acid sequence identity to SEQ ID NO: 74, or a combination thereof.
- DAF- 14 polypeptide a polypeptide that complements (as defined above) a C. elegans daf 14 mutation and/or that possesses at least 48% amino acid sequence identity to SEQ ID NO: 68, at least 37% amino acid sequence identity to SEQ ID NO: 69, at least 48% amino acid sequence identity to SEQ ID NO: 70, at least 37% amino acid sequence identity to SEQ ID NO: 71 , or a combination thereof.
- insulin receptor activity is meant any activity exhibited by an insulin receptor and measured by either (i) activation of insulin receptor substrate- 1 (IRS-1) phosphorylation and recruitment of PI-3 kinase, (ii) activation of glucose transporter (Glut 4) fusion with a cellular membrane and concomitant glucose uptake, or (iii) activation of glycogen and/or fat synthesis and concomitant inhibition of gluconeogenesis or lipolysis or both.
- IRS-1 insulin receptor substrate- 1
- Glut 4 activation of glucose transporter
- insulin receptor related activity is meant any activity not directly attributable to the insulin receptor but that is measured by an activation of IRS- 1 phosphorylation and recruitment of PI3-kinase.
- IGF-1 receptor activity is meant any activity exhibited by an insulin-like growth factor- 1 receptor and measured by (i) activation of IRS- 1 phosphorylation and recruitment of PI-3 kinase, (ii) activation of cell division in NIH3T3 cells (e.g., as described in Gronborg et al., J. Biol. Chem. 268: 23435-23440, 1993), or (iii) activation of bone growth in, for example, the mouse model.
- Smad protein is meant a protein that is capable of coupling to TGF- ⁇ type ser/thr receptors.
- Smad proteins typically contain a smad conserved motif as described by Derynk et al. ⁇ Cell 87: 173, 1996).
- Exemplary smad proteins include, without limitation, DAF-3, MADR-2, MAD, DPC-4, and Sma-2.
- AKT activity is meant any activity exhibited by an AKT polypeptide and measured by phosphatidylinositol-regulated increases in serine phosphorylation of GSK-3 or activation of non-dauer growth in C. elegans akt mutants.
- abnormal glucose tolerance condition any condition in which blood sugar levels are inappropriately elevated or lack normal metabolic regulation. Examples of such conditions include, without limitation, Type I diabetes, Type II diabetes, and gestational diabetes, and may be associated with obesity and atherosclerosis.
- protein or “polypeptide” is meant any chain of amino acids, regardless of length or post-translational modification (e.g., glycosylation or phosphorylation).
- substantially pure is meant a preparation which is at least 60% by weight (dry weight) the compound of interest, e.g., any of the polypeptides of the invention such as the DAF-2, DAF-3, or DAF-16 polypeptides or DAF-2, DAF-3, or DAF-16-specif ⁇ c antibodies.
- the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight the compound of interest. Purity can be measured by any appropriate method, e.g., column chromatography, polyacrylamide gel electrophoresis, or HPLC analysis.
- isolated DNA DNA that is not immediately contiguous with both of the coding sequences with which it is immediately contiguous (one on the 5' end and one on the 3' end) in the naturally-occurring genome of the organism from which it is derived.
- the term therefore includes, for example, a recombinant DNA which is incorporated into a vector; into an autonomously replicating plasmid or virus; or into the genomic DNA of a prokaryote or eukaryote, or which exists as a separate molecule (e.g., a cDNA or a genomic DNA fragment produced by PCR or restriction endonuclease treatment) independent of other sequences. It also includes a recombinant DNA which is part of a hybrid gene encoding additional polypeptide sequence.
- substantially identical polypeptide sequence an amino acid sequence which differs only by conservative amino acid substitutions, for example, substitution of one amino acid for another of the same class (e.g., valine for glycine, arginine for lysine, etc.) or by one or more non-conservative substitutions, deletions, or insertions located at positions of the amino acid sequence which do not destroy the function of the polypeptide (assayed, e.g., as described herein).
- conservative amino acid substitutions for example, substitution of one amino acid for another of the same class (e.g., valine for glycine, arginine for lysine, etc.) or by one or more non-conservative substitutions, deletions, or insertions located at positions of the amino acid sequence which do not destroy the function of the polypeptide (assayed, e.g., as described herein).
- such a sequence is at least 75%, more preferably 85%, and most preferably 95% identical at the amino acid level to the sequence used for comparison.
- sequence analysis software e.g., Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, WI 53705 or BLAST software available from the National Library of Medicine.
- useful software include the programs, Pileup and PrettyBox.
- Such software matches similar sequences by assigning degrees of homology to various substitutions, deletions, substitutions, and other modifications.
- Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine.
- nucleic acid By a “substantially identical" nucleic acid is meant a nucleic acid sequence which encodes a polypeptide differing only by conservative amino acid substitutions, for example, substitution of one amino acid for another of the same class (e.g., valine for glycine, arginine for lysine, etc.) or by one or more non-conservative substitutions, deletions, or insertions located at positions of the amino acid sequence which do not destroy the function of the polypeptide (assayed, e.g., as described herein).
- the encoded sequence is at least 75%, more preferably 85%, and most preferably 95% identical at the amino acid level to the sequence of comparison.
- nucleic acid sequences are compared a "substantially identical" nucleic acid sequence is one which is at least 85%, more preferably 90%, and most preferably 95% identical to the sequence of comparison.
- the length of nucleic acid sequence comparison will generally be at least 50 nucleotides, preferably at least 60 nucleotides, more preferably at least 75 nucleotides, and most preferably 110 nucleotides.
- homology is typically measured using sequence analysis software (e.g., Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, WI 53705).
- positioned for expression is meant that the DNA molecule is positioned adjacent to a DNA sequence which directs transcription and translation of the sequence (i.e., facilitates the production of any of the polypeptides disclosed herein including, but not limited to, DAF-2, DAF-3, and DAF- 16 and any human homolog thereof).
- purified antibody is meant antibody which is at least 60%, by weight, free from the proteins and naturally-occurring organic molecules with which it is naturally associated.
- the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight, antibody.
- telomere binding binds an antibody which recognizes and binds a polypeptide of the invention (e.g., DAF-2, DAF-3, and DAF- 16) but which does not substantially recognize and bind other molecules in a sample (e.g., a biological sample) which naturally includes a polypeptide of the invention.
- An antibody which "specifically binds" such a polypeptide is sufficient to detect protein product in such a biological sample using one or more of the standard immunological techniques available to those in the art (for example, Western blotting or immunoprecipitation).
- immunological methods any assay involving antibody- based detection techniques including, without limitation, Western blotting, immunoprecipitation, and direct and competitive ELISA and RIA techniques.
- means for detecting any one or a series of components that sufficiently indicate a detection event of interest. Such means involve at least one label that may be assayed or observed, including, without limitation, radioactive, fluorescent, and chemiluminescent labels.
- hybridization techniques any detection assay involving specific interactions (based on complementarity) between nucleic acid strands, including DNA-DNA, RNA-RNA, and DNA-RNA interactions. Such hybridization techniques may, if desired, include a PCR amplification step.
- a “modulatory compound” is meant any compound capable of either decreasing DAF-3 and DAF-16 expression (i.e., at the level of transcription, translation, or post-translation) or decreasing DAF-3 and DAF- 16 protein levels or activity. Also included are compounds capable of either increasing DAF-1, DAF-2, DAF-4, DAF-8, DAF-7, DAF-11, DAF-14, AGE-1, and AKT expression (i.e., at the level of transcription, translation, or post- translation) or increasing DAF-1 , DAF-2, DAF-4, DAF-8, DAF-7, DAF-11 , DAF-14, AGE-1, and AKT protein levels or their corresponding activities.
- complementation is meant an improvement of a genetic defect or mutation.
- complementation of a genetic defect in a daf, age, or akt gene can be carried out by providing the wild-type daf, age, or akt genes, respectively. Complementation is generally accomplished by expressing the wild-type version of the protein in a host cell or animal bearing a mutant or inactive version of the gene.
- Fig. 1 shows the genetic and physical map of C. elegans daf 2.
- the top panel shows the genetic map of daf 2. daf-2 maps on the left arm of chromosome III 11.4 map units to the right of dpy-1 and 1.6 map units to the left of ben-1 (ACeDB).
- the middle panel shows the physical map of daf 2. daf 2 maps between gP34 and mgP44 in a region not covered by cosmid clones but covered by YAC Y53G8. Cosmids from the approximate daf 2 genetic location detect RFLPs between C. elegans strains Bristol N2 and Bergerac RC301.
- mgP31 on cosmid T21A6 is a Hindlll RFLP: 5.3 kb in Bristol, 4.5 kb in RC301.
- mgP33 on cosmid T02B2 is a Hindlll RFLP: 9 kb in Bristol, 8 kb in RC301.
- mgP34 on cosmid R10F2 is an EcoRI RFLP: 4.1 and 2.8 kb in Bristol, 3.6 kb in RC301.
- mgP44 on cosmid R07G11 is a complex EcoRI RFLP: 2.9 kb, 2.4 kb, 1.9 kb and 1.7kb in Bristol; 3.6kb, 2.5kb and 1.6kb in RC301.
- mgP35 on cosmid T10D5 is a Styl RFLP: 5.4 kb in Bristol, 5.8 kb in RC301.
- mgP32 on cosmid C42B8 is a Styl RFLP: 2.8 kb in Bristol; 2.9kb in RC301.
- mgP48 detected with daf-2 probe is a Hindlll RFLP: 4.3kb and 7kb in Bristol and 4.1kb and 6.2kb in RC301.
- mapping daf-2 0.69 map units to the right of mgP34 and to the left of mgP44.
- mapping daf 2 0.66 map units to the left of mgP44.
- Y53G8 YAC DNA was isolated from CHEF gels as described in Ausubel et al. ⁇ Current Protocols in Molecular Biology, John Wiley & Sons, New York, N.Y., 1990), labeled , and shown to hybridize to multiple restriction fragments from cosmids bearing mgP34 and mgP44.
- a probe from the insulin receptor homolog on Y53G8 detects the mgP48 RFLP between N2 and RC301.
- the bottom panel shows the structure of daf 2 cDNA.
- the daf- 2 cDNA was amplified from a cDNA library constructed according to standard methods by PCR using internal primers derived from the genomic shotgun sequences, vector sequence primers (for 3' end) and an SLl transspliced leader PCR primer (M. Krause, In: Methods Cell Biol., vol. 48, pp. 483-512, H. F. Epstein and D. C. Shakes, eds., Academic Press, San Diego, CA, 1995).
- To isolate a cDNA pooled plasmid DNA from 106 clones of a 107 clone complexity cDNA library was used as a PCR template.
- daf- 2 internal primer CGCTACGGCAAAAAAGTGAA (SEQ ID NO: 1) in the kinase domain and a cloning vector primer CGATGATGAAGATACCCC (SEQ ID NO: 2) were used in a nested PCR reaction with adjacent internal primers.
- PCR was carried out with TGATGCGAACGGCGATCGAT (SEQ ID NO: 3) and ACGCTGGATCATCTACATTA (SEQ ID NO: 4) primers.
- SLl primer GGTTTAATTACCCAAGTTTGAG SEQ ID NO: 5
- one internal daf 2 primer GCTCACGGGTCACACAACGA SEQ ID NO: 6
- PCR primers TGATGCGAACGGCGATCGAT SEQ ID NO: 7 and TGAGGGCCAACTAAAGAAGAC (SEQ ID NO: 8) were used.
- CGCTACGGCAAAAAAGTGAA SEQ ID NO: 9
- GACGATCCCGAGGTGAGTAT SEQ ID NO: 10.
- the presence of an SLl spliced leader sequence indicates a full length daf 2 cDNA.
- the predicted ORF is shown as a box; 5' and 3' UTRs are shown as thick bars.
- the predicted DAF-2 initiator methionine at base 486 is preceded by an in frame stop codon 63 bases upstream.
- the predicted DAF-2 stop codon is found at base 5658. No consensus polyadenylation signal was found in the cDNA nor in genomic shotgun sequence #00678, which extends 302 bp further downstream. The initial insulin receptor homolog shotgun sequences are shown as thin bars above the box.
- Introns were detected by a combination of in silico genomic and cDNA sequence comparison, and by comparison of PCR products derived from cDNA and genomic DNA templates.
- the open triangles over a vertical bar indicate positions of the detected exon/intron boundaries. All the intron donor sites have GT consensus and the acceptor sites have AG consensus (Krause, 1995 supra).
- the triangles without a vertical bar indicate the approximate intron locations determined by comparison of PCR products using genomic DNA or cDNA as a template.
- Intron lengths were estimated by comparison of the PCR product size using cDNA or genomic DNA templates. Genomic regions corresponding to some of the introns could not be PCR amplified suggesting that these introns are long.
- the minimum daf 2 gene size based on this analysis is 33 kb.
- Fig. 2A shows the predicted C. elegans DAF-2 amino acid sequence.
- the predicted cysteine-rich region (amino acids 207-372) and tyrosine kinase domain (amino acids 1124-1398) are boxed.
- the signal peptide (amino acids 1-20), proteolysis site (amino acids 806-809), transmembrane domain (amino acids 1062-1085), and PTB binding motif in the juxtamembrane region (NPEY, amino acids 1103-1106) are underlined.
- DAF-2 tyrosine residues Y1293, Y1296 and Y1297, in the region corresponding to the insulin receptor kinase Y1158 to Y1163 activation loop are likely to be autophosphorylated, based on the predicted similarity between the DAF-2 and insulin receptor phosphorylation targets (Fig. 2B).
- Another likely target for DAF-2 autophosphorylation is the Yl 106 NPEY motif located in the region corresponding to the insulin receptor juxtamembrane region NPEY motif (at Y972), that has been shown to mediate IRS-1 binding via its PTB domain to the insulin receptor (White and Kahn, J. Biol. Chem. 269: 1-4, 1994).
- two other tyrosine residues may be autophosphorylated and bound to particular SH2-containing proteins: Y1678 binding to a PLC-g or SHP-2 homolog, and Y1686, perhaps binding to SEM-5 (Fig. 2A) (Songyang et al, Cell 72: 767-778, 1993). While mutations in, for example, ras and MAP kinase have not been identified in screens for dauer constitutive or dauer defective mutations, these general signaling pathway proteins may couple to DAF-2 as they couple to insulin signaling in vertebrates (White and Kahn, J. Biol. Chem. 269: 1-4, 1994).
- predicted phosphotyrosine residues in juxtamembrane region and the kinase domain activation loop are circled.
- predicted phosphotyrosine residues in the extended C-terminal region are also circled and SH2-binding sites are underlined (see below).
- Fig. 2B shows the cDNA encoding the C. elegans DAF-2.
- Fig. 2C shows the amino acid comparison of C. elegans DAF-2 to the human insulin receptor and human IGF-I receptor (shown in parenthesis), and to the Drosophila insulin receptor homolog, with daf -2 and human insulin receptor mutations highlighted.
- Six daf 2 mutations map in the ligand-binding domain: sal 87 (C347S, TGT to AGT), el 368 (S451L, TCA to TTA), el 365 (A458T, GCT to ACT), sa229 (D526N, GAT to AAT), and two mutations in mg43 (C279Y, TGT to TAT and P348L, CCC to CTC).
- the corresponding BLAST probabilities of DAF-2 random match to each protein is: 6.4 x 10 "157 (human insulin receptor), 2.7 x 10 "156 (human IGF-I receptor), 2.1 x 10 "153 (molluscan InR homolog), 8.3 x 10 "153 (mosquito InR homolgoue), 1.6 x 10 "138 (human insulin receptor-related receptor), 1.7x 10 "122 ⁇ Drosophila InR homolog ), 2.0 x 10 '108 (Hydra InR homolog).
- DAF-2 is more distant from the next most closely related kinase families: 8.9 x 10 "58 (v-ros) and 3.0 x 10 "51 (trkC neurotrophin receptor).
- Fig. 3 is a photograph showing the metabolic control by C. elegans daf 2 and daf 7.
- the top panel shows low levels of fat accumulation in a wild type L3 animal grown at 25 °C that has been stained with Sudan black.
- Non- starved animals were fixed in 1% paraformaldehyde in PBS, frozen at -70°C, and freeze-thawed three times. Fixed animals were washed three times in PBS, and then incubated overnight in IX Sudan black according to standard methods.
- the next panel shows higher levels of fat accumulation in daf-2(el370) grown at the non-permissive temperature of 25°C. These animals accumulate fat in both intestinal and hypodermal cells.
- the next panel shows high fat levels in the intestine and hypodermis of daf 7 (el 372) animals grown at 25 °C.
- the bottom panel shows high levels of fat in daf 2 (el 370) animals grown at the permissive temperature until the L4 stage and then shifted to the non-permissive temperature. This shows that daf 2 regulates metabolism without entry into the dauer stage.
- Fig. 4 is a schematic diagram showing a model of insulin signaling in the C. elegans dauer formation pathway.
- an insulin-like ligand activates DAF-2
- DAF-7 TGF- ⁇ -like signal activates the DAF- 1 and DAF-4 receptors.
- Activated DAF-2 autophosphorylates particular tyrosine residues and recruits signaling molecules, including the PI 3-kinase homolog (a heterodimer of an as yet unidentified p85 homolog and the PI 3-kinase catalytic subunit AGE-1).
- the AGE-1 PI 3-kinase produces PIP3 second messenger.
- This second messenger may regulate glucose transport (White and Kahn, 1994 supra), metabolic kinase cascades that include AKT and GSK-3 (Hemmings, Science 226: 1344-1345, 1984; Jonas et al., Nature, 385:343-346, 1997), and transcription and translation of metabolic genes (White and Kahn, 1994, supra).
- DAF- 16 acts downstream of DAF-2 and AGE-1 in this pathway and is negatively regulated by them (Vowels and Thomas, Genetics, 130: 105-123, 1992; Gottling and Ruvkun, Genetics, 137: 107-110, 1994).
- DAF-7/TGF- ⁇ and DAF-2/insulin signaling pathways converge to control dauer formation, only the DAF-2 pathway controls reproductive phase longevity. This may be due to non-transcriptional outputs of DAF-2 suggested by precedents from insulin receptor signaling. DAF-7 signaling output is predicted to be only transcriptional as described herein.
- Fig. 5A shows that C. elegans daf 3 was genetically mapped to a region on the X chromosome between aex-3 and unc-1. Cosmid and plasmid clones from the region were assayed for transformation rescue (Mello et al., EMBO J 10: 3959-3970,1991). Plasmid pRF4 ⁇ rol-6 transformation marker, 100 ng/ml), and cosmids (5-6 ng/ml) were injected into the gonad of daf- 7 ⁇ el 372); daf 3 ⁇ el 376) animals.
- Transgenic animals were scored for dauer formation at 25°C; a dauer (i.e., a return to the daf 7 phenotype) indicates rescue of daf 3; clones that rescue daf 3 are boxed. B0217 rescues the daf 3 phenotype; eighteen of nineteen transgenic lines were rescued (-80% dauers). Examination of sequence provided by the C. elegans Sequencing Consortium revealed a Smad homologous gene on B0217. A 13 kb subclone of B0217 containing just the Smad also rescues daf 3 (see Fig. 3).
- Fig. 5B shows the structure of the C. elegans daf 3 coding region. The top is the exon/intron structure of daf 3; coding exons are filled boxes, non-coding regions are open boxes, and lines are introns.
- daf 3 cDNAs were isolated according to standard methods. Four cDNAs were sequenced completely; their N-termini are indicated by vertical lines. These three cDNAs contain -400 bp of 3' UTR, but no poly-A tail; a C.
- elegans consensus poly-adenylation sequence is found 12 bp from the 3' end of the cDNAs. The longest of this cDNA appears full-length, as it contains a methionine codon and the genomic sequence contains no other methionine codon and no putative splice sites upstream before in- frame stop codons.
- PCR products from libraries or individual daf 3 cDNAs were sequenced. From DNA isolated from a cDNA library, we amplified a product with a primer to SLl and to a region in conserved domain I (shown as primer 1). For the individual cDNAs, we amplified with a primer to the cDNA vector and primer 1.
- Fig. 5C shows the protein sequence alignment of C. elegans daf 3 and the closest homolog found to date, human DPC4, in the Smad conserved domains I and II. Dots indicate gaps introduced to maximize alignment.
- DAF- 3 is 55% identical to DPC4 in domain I and 30% identical in domain II.
- daf 3(mgl25) and daf-3(mgl32) mutations are indicated by boldface and underline.
- the Smad mutational hotspot is underlined.
- seven other daf 3 alleles were sequenced in the hotspot; none of them contains a mutation. Alleles sequenced were mg91, mg93, mg!05, mgl21, mgl26, mgl33 (isolated by A. Koweek and G. Patterson, unpublished) and sa205.
- Figs. 6A-6G is a panel of photographs showing C. elegans DAF-3 and DAF-4 expression. These photographs show GFP fluorescence, paired with DAPI fluorescence or Nomarski optics photographs, as marked. All DAF-3 photographs show animals with the second plasmid from Fig. 6A illustrates DAF-3/GFP head expression in an LI animal. Fig. 6B illustrates DAF-3/GFP expression in the ventral nerve cord of an adult animal. LI animals demonstrated similar expression patterns. Fig. 6C illustrates DAF-3/GFP expression in the intestine of an LI animal. Fig. 6D illustrates DAF-3/GFP expression in the distal tip cell of an L4 animal. Fig.
- FIG. 6E illustrates DAF-3/GFP expression in an embryo with approximately 200 nuclei.
- Fig. 6F illustrates DAF-4/GFP expression in the head of an LI animal.
- Fig. 6G illustrates DAF-4/GFP expression in the dorsal nerve cord and ventral nerve cord of an L4 animal.
- Fig. 7 is a table that shows the rescuing ability and suppression of C. elegans daf- 7 by daf- 3 plasmids.
- the solid boxes represent the Smad conserved domains I and II of daf- 3; the stippled boxes represent green fluorescent protein (GFP).
- GFP green fluorescent protein
- daf 3 plasmids were injected at a concentration of 10 ng/ml, and the pRF4 injection marker was injected at a concentration of 90 ng/ml.
- To score dauer formation transgenic adult animals were allowed to lay eggs on plates for several hours at room temperature and were then removed. The plates were scored after two days at 25 °C.
- the rescue experiment shows the rescue of daf-7 (m62); daf-3(el376) by each of the fusion proteins. Failure to rescue results in rolling nondauers, while rescue of daf 3 results in rolling dauers (the daf 7 phenotype).
- the controls are two array strains with the pRF4 marker and an unrelated GFP expressing transgene.
- Fig. 8A is a photographs showing that DAF-3/GFP is associated with metaphase chromosomes. Fixed LI animals were immunostained with anti- GFP antibody and anti- ⁇ -tublin antibody. DNA was visualized using DAPI staining.
- Fig. 8B is a photograph showing that a truncated C. elegans daf-3IG ⁇ V protein is predominantly nuclear. Wild- type animals were injected with the truncated construct shown in Fig. 7 at a concentration of 10 ng/ml. The pRF4 transformation marker was injected at 100 ng/ml. The photograph shows a late LI or early L2 animal, and daf- 3 is predominantly nuclear. The clear spot in the center of some of the nuclei is the nucleolus, which has no _f ⁇ /-5/GFP. All cells in these animals have predominantly nuclear daf-3/GF ' P, including the ventral cord neurons, intestinal cells, and distal tip cell (all shown), as well as head and tail neurons and hypodermal cells.
- Figs. 9A and 9B show models for the role of the C. elegans daf- 3/DAF-8/DAF-14 Smad proteins in dauer formation.
- Fig. 9 A shows dauer reproductive growth induction.
- Fig. 9B shows reproductive dauer growth induction.
- Fig. 10 is a schematic illustration showing the genetic pathway that regulates C. elegans dauer formation.
- Figs. 11A-11C show the cDNA sequences of the differentially spliced C. elegans daf 3 transcripts (SEQ ID NOS: 39, 52, and 53).
- Figs. 12A-12C show the amino acid sequences of the C. elegans DAF-3 polypeptide isoforms (SEQ ID NOS: 40-42).
- Figs. 13 A and 13B show the cDNA sequence of the differentially spliced C. elegans daf 16 transcripts (SEQ ID NOS: 43 and 44).
- Figs. 14A and 14B show the amino acid sequences of the C. elegans DAF- 16 polypeptide isoforms (SEQ ID NOS: 45 and 46).
- Fig. 15 shows the cDNA sequence of the C. elegans age-1 gene (SEQ ID NO: 47).
- Fig. 16 shows the amino acid sequence of the C elegans AGE-1 polypeptide (SEQ ID NO: 48).
- Fig. 17 is a schematic diagram illustrating that convergent TGF- ⁇ and insulin signaling activates glucose-based metabolic genes.
- Fig. 18 is a schematic diagram illustrating a switch to fat-based metabolism in the absence of DAF-7 and DAF-2 signals (in phermone).
- Fig. 19 is a schematic diagram illustrating inhibition of the DAF- 16 pathway by drugs to ameliorate lack of insulin signaling.
- Fig. 20 is a schematic diagram illustrating inhibition of DAF-3 by drugs to ameliorate a lack of DAF-7 signaling (for example in obesity-induced diabetes).
- Fig. 21 A is an illustration showing that human FKHR and AFX are the closest relatives to DAF- 16. Note that the differentially spliced DAF- 16 forkhead domain is less homologous.
- Fig. 21B is an illustration showing a forkhead family tree, illustrating that DAF- 16 is much more closely related to FKHR and AFX than any other forkhead protein.
- Fig. 22 is a photograph showing that daf 16 is expressed in target tissues, like daf 3. This supports the model that DAF-3 and DAF- 16 are capable of interacting.
- Fig. 23 is an illustration showing a model for treatment of obesity-induced diabetes with DAF-7 protein.
- Fig. 24 is an illustration showing the genetic mapping of sup ⁇ (mgl 44) to the AKT genetic region.
- Fig. 25 is an illustration showing the comparison of C. elegans AKT with mammalian AKT.
- Fig. 26A is a photograph showing the expression of AKT:GFP in daf 2 dauers.
- Fig. 26B is a photograph showing the expression of AKT:GFP in an N2 adult worm.
- Fig. 27 is a schematic illustration showing the molecular map of daf- 16.
- Fig. 28 is a graph illustrating the homology of C. elegans insulin-like molecules (SEQ ID NOS: 117-124) with human insulin (SEQ ID NO: 125) and a consensus motif.
- Fig. 29 is a graph illustrating a PRETTYBOX analysis of insulin superfamily members (SEQ ID NOS: 126-153).
- Fig. 30 is a graph illustrating a PILEUP analysis of insulin superfamily members.
- Fig. 31 is a diagram illustrating the akt-1 region. On the top is shown the genetic and physical map of akt-1. akt-1 is contained on cosmid C12D8. Shown on the bottom is the exon/intron structure of akt- 1. Coding regions are filled boxes, non-coding regions are open boxes, and introns are lines. The pleckstrin homology domain is indicated by hatched boxes (Musacchio et al., Trends Biochem. Sci. 18:343-348, 1993). The kinase domain is indicated in gray (Hanks and Hunter, in The Protein Kinase Facts Book Protein-Serine Kinases, eds. Hardie, G.
- akt-la gene structure was confirmed by sequencing of cDNAs. akt- lb gene structure was deduced based on partial cDNA sequence that confirmed the exon 5 to exon 7 splice and 3'UTR only.
- Fig. 32 is a diagram illustrating the akt-2 region. On the top is shown the genetic and physical maps of the akt-2 region, akt-2 is contained on cosmid R03E1. On the bottom is shown the exon/intron structure of akt-2. All symbols are as in Fig. 31. Gene structure was deduced by sequencing of a cDNA which confirmed exons 2-8 and the 3'UTR; Genef ⁇ nder (Univ. of WA) predicts exon 1.
- Fig. 33 is a graph illustrating a dendogram of Akt/PKB and PKC protein kinase families.
- Pileup GCG was used to align the entire coding sequences of the indicated proteins.
- C. elegans proteins are indicated by "Ce,” rat by “r,” human by “h,” mouse by “m,” bovine by “b,” and D.
- the accession numbers for the proteins used in the Pileup are contained in parentheses: CePKC2a(U82935), rPKC ⁇ l(M19007), hAkt/PKB ⁇ (M63167), mAkt/PKB(M94335), bAkt/PKB(X61036), hAkt/ PKB ⁇ 2(M95936), rAkt/PKB ⁇ (D49836), Daktl(Z26242).
- rPKC ⁇ l the closest non-Akt/PKB homolog to both akt-la and hAkt/PKB ⁇
- CePKC2a the closest C. elegans homolog to rPKC ⁇ l
- the Akt/PKB homologs described in this report are indicated by the gray box.
- Fig. 34 is a graph illustrating a PILEUP (GCG) analysis of AKT- la (SEQ ID NO: 154), AKT-lb (SEQ ID NO: 155), AKT-2 (SEQ ID NO: 156), and human Akt/PKB ⁇ (M63167) (SEQ ID NO: 157). Identical residues are indicated by dots, gaps introduced in order to align the sequence are indicated by dashes. The pleckstrin homology domain (Musacchio et al., Trends Biochem. Sci.
- Figs. 35A and 35B show the genomic sequence of pdk-1 (SEQ ID NO: 158).
- Fig. 36 shows the amino acid sequence of pdk-1 a (SEQ ID NO: 159).
- Fig. 37 shows the amino acid sequence of pdk- lb (SEQ ID NO: 160).
- the DAF-2 Insulin Receptor Family Member Regulates Longevity and Diapause in C. elegans
- Arrest at the C. elegans dauer stage is normally triggered by a dauer-inducing pheromone detected by sensory neurons which signal via a complex pathway to target tissues that are remodeled and metabolically shifted such as the germ line, intestine, and ectoderm (Riddle, In: Caenorhabditis elegans II, D. Riddle, T. Blumenthal, B. Meyer, J. Priess, eds., Cold Spring Harbor Laboratory, Cold Spring Harbor, NY, 1997, pp. 739-768. Kenyon, op cit., pp. 791-813.).
- Table I shows the percentage of dauer formation of daf 2 alleles and the associated mutations.
- Eggs from animals grown at 15 °C (day 0) were incubated at 15, 20, or 25 °C. Numbers in parenthesis are animals counted. Numbers of wild- type animals and dauers were counted on day 3 (20 °C and 25 °C) or day 5 (15 °C). Most of the dauers marked with stars recovered by day 4 ⁇ sa229 at 25 °C) or by day 8 ⁇ sa229) and sa219 at 15°C, el 368 and sg219 at 20°C, and el365 and el368 at 25 °C).
- mg43 was studied as follows: dpy- l(el)daf-2(mg43); SDP3 animals were grown at 20 °C until the young adult stage. Eggs from five adults were laid at 15 °C or 20 °C and grown at the same temperatures. Numbers of Dpy-Daf animal and Dpy-non-Daf animals were counted on day 3 (20°C) or day 5 (15 °C). Sgl87 and sg229 were also studied by Malone and Thomas ⁇ Genetics 136:879-886, 1994). Table I. Percentage of dauer formation of daf 2 alleles
- YAC Y53G8 carries the genomic region that includes mgP34 and mgP44, which flank daf 2 (Fig. 1).
- random Ml 3 subclones derived from Y53G8 were sequenced by the Genome Sequencing Center.
- Figs. 2 A and 2B The amino acid sequences and nucleotide sequences encoding DAF-2 are shown in Figs. 2 A and 2B, respectively.
- BLASTX to compare 570 translated Y53G8 Ml 3 subclone sequences against the Genbank protein database, we found that four sequences are homologous to the mammalian insulin receptor family.
- An insulin receptor was a good daf 2 candidate gene because insulin regulates vertebrate growth and metabolism (White and Kahn, J. Biol. Chem. 269: 1-4, 1994), and because a phosphatidylinositol (PI) 3 -kinase has been shown to act in both the insulin receptor and daf 2 pathways (White and Kahn, J. Biol. Chem.
- daf- 2 transcription unit and gene structure were determined using PCR primers derived from daf 2 genomic subclone sequences to amplify daf- 2 genomic and cDNA regions.
- a probable full length daf- 2 cDNA bears a 5172 base open reading frame, a 485 base 5' UTR and a 159 base 3' UTR (Figs. 1 , 2A).
- the predicted DAF-2 protein shows long regions of sequence identity to the insulin receptor family.
- DAF-2 is 35% identical to the human insulin receptor (Ebina et al., Cell 40: 747-58, 1985; Ullrich, et al., Nature 313: 756-61, 1985), 34% identical to the human IGF-I receptor (Ullrich, et al., EMBO J : 5, 2503-12, 1986), and 33% identical to the human insulin receptor-related receptor (Shier and Watt, J. Biol. Chem. 264: 14605-8, 1989). DAF-2 is the only member of the insulin receptor family in the 90 Mb C. elegans genome sequence (about 90% complete) or in the 10 Mb C. elegans EST sequence database.
- DAF-2 is probably the homolog of the ancestor of these duplicated and diverged receptors, and thus may subserve any or all of the functions of these mammalian receptors (see below).
- DAF-2 has a putative signal peptide, a cysteine-rich region in the putative ligand binding domain, a putative proteolysis site, a transmembrane domain, and a tyrosine kinase domain.
- DAF-2 has a C-terminal region that may serve a function similar to the mammalian insulin receptor substrate- 1 (IRS-1) ( Figure 2; White and Kahn, J. Biol. Chem. 269: 1-4, 1994).
- DAF-2 is 36% identical to insulin receptor and 35% identical to the IGF-I receptor. Twenty-one of twenty-three phylogenetically conserved cysteine residues in this domain are conserved in DAF-2 (Fig. 2C). The DAF-2 cys-rich region is 34% identical to human insulin receptor and 28% identical to the IGF-I receptor. Six daf 2 mutations map in this domain (Fig. 2C, Table I). The mg43 and sal 87 mutations substitute conserved residues in the cys-rich region (Fig. 2C).
- daf-2(mg43) carries two mutations which substitute conserved residues, which may explain the strength of this allele (non-conditional, Table I). Other substitutions at non-conserved residues cause less severe phenotypes (Table I). Insulin resistant and diabetic patients with mutations in the ligand binding domain of the human insulin receptor gene have been identified (Taylor, Diabetes 41 : 1473-1490, 1992) (see below). These mutations impair receptor transport to cell surface, or insulin binding affinity, or both. The DAF-2 mutations in this domain might similarly decrease receptor signaling to cause dauer arrest.
- Insulin receptors are ⁇ 2, ⁇ 2 tetramers proteolytically processed from a single precursor protein (White and Kahn, J. Biol. Chem. 269: 1-4, 1994).
- DAF-2 bears a probable protease recognition site at a position analogous to the insulin receptor processing site (RVRR 806-809) (Yoshimasa et al., J. Biol. Chem. 265: 17230-17237, 1990).
- the 275 amino acid DAF-2 tyrosine kinase domain is 70% similar and 50% identical to the human insulin receptor kinase domain.
- the intracellular tyrosine kinase domain of the insulin receptor phosphorylates particular tyrosine residues flanked by signature amino acid residues (upstream acidic and downstream hydrophobic amino acids (Songyang and Cantley, Trends Biochem. Sci. 20: 470-475, 1995)) in the intracellular domain as well as on IRS-1 (White and Kahn, J. Biol. Chem. 269: 1-4, 1994).
- DAF-2 tyrosine residues in these sequence contexts are likely autophosphorylation targets, including three tyrosines in a region similar to the insulin receptor activation loop and one in the juxtamembrane region as described above (Fig. 2C).
- Fig. 2C Based on the crystal structure of the insulin receptor kinase domain bound to its activation loop, eight kinase domain residues mediate target site specificity (Hubbard et al., Nature 372: 746-754, 1994).
- these residues are invariant (5/8) or replaced with similar amino acids (3/8: K to R, E to D) (Fig. 2C), suggesting that DAF-2 phosphorylates the same target tyrosine motifs as the insulin receptor kinase.
- Fig. 2C Three daf- 2 missense mutations substitute conserved amino acid residues in the kinase domain (Fig. 2C, Table I). All three mutations cause moderate to strong dauer constitutive phenotype, but none are as strong as the non-conditional alleles, for example, mg43 (Table I).
- Human insulin receptor mutations in the kinase domain exhibit decreased kinase activity and cause severe insulin resistance and associated defects (Fig. 2C; Taylor, Diabetes 41 : 1473-1490, 1992).
- a human diabetic insulin resistant patient bears the same amino acid substitution (PI 178L) as daf-2(el391) (Kim et al., Diabetologia 35: 261-266, 1992). This patient was reported to be heterozygous for this substitution. daf-2(el391) is not dominant whereas it is a highly penetrance recessive mutation (Table I ).
- the PI 178L mutation in humans is dominant, or that the patient carries a second insulin receptor mutation in trans, or carries mutations in other genes (for example, other complex type II diabetes loci) that enhance the dominance of PI 178L (Bruning et al., Cell 88: 561-572, 1997).
- DAF-2 has a long C-terminal extension that may function analogously to mammalian IRS- 1 (Fernandez et al., EMBO J. 14: 3373-3384, 1995).
- IRS-1 tyrosine residues are phosphorylated by the insulin receptor kinase, and these phosphotyrosines mediate binding to a variety of signaling proteins bearing SH2 domains (White and Kahn, J. Biol. Chem. 269: 1-4, 1994; Songyang et al., Cell 72: 767-778, 1993.).
- DAF-2 C-terminal extension tyrosines bear flanking sequence motifs suggestive that they are autophosphorylated (Fig. 2A; Songyang and Cantley, Trends Biochem. Sci. 20: 470-475, 1995).
- a YXXM motif at DAF-2 Y1504 is likely to mediate interaction with the AGE-1 PI 3-kinase, which acts in the same genetic pathway as daf- 2 (Fig. 4) (Morris et al., Nature 382: 536-539, 1996).
- DAF-2 tyrosine residues Y1293, Y1296 and Y1297, in the region corresponding to the insulin receptor kinase Y1158 to Y1163 activation loop are likely to be autophosphorylated, based on the predicted similarity between the DAF-2 and insulin receptor phosphorylation targets (Fig. 2C).
- Another likely target for DAF-2 autophosphorylation is the Yl 106 NPEY motif located in the region corresponding to the insulin receptor juxtamembrane region NPEY motif (at Y972), that has been shown to mediate IRS-1 binding via its PTB domain to the insulin receptor (White and Kahn, J. Biol. Chem. 269: 1-4, 1994).
- two other tyrosine residues may be autophosphorylated and bound to particular SH2-containing proteins: Y1678 binding to a PLC- ⁇ or SHP-2 homolog, and Y1686, perhaps binding to SEM-5 (Fig. 2 A) (Songyang et al., Cell 72: 767-778, 1993). While mutations in, for example, ras and MAP kinase have not been identified in screens for dauer constitutive or dauer defective mutations, these general signaling pathway proteins may couple to DAF-2 as they couple to insulin signaling in vertebrates (White and Kahn, J. Biol. Chem. 269: 1-4, 1994).
- the insulin receptor also couples to other signaling pathways (White and Kahn, J. Biol. Chem. 269: 1-4, 1994); analogous DAF-2 phosphotyrosine residues may mediate these interactions (as described above).
- DAF-2 phosphotyrosine residues may mediate these interactions (as described above).
- insulin release by increasing blood glucose and autonomic inputs—insulin receptor engagement directs a shift in the activities of key metabolic enzymes, as well as changes in the transcription and translation of metabolic regulators in fat, liver, and muscle cells, all of which lead to assimilation of glucose into glycogen and fat (White and Kahn, J. Biol. Chem. 269: 1-4, 1994).
- IGF-I is released from the liver in response to pituitary growth hormone, and mediates many of the growth and development responses to that endocrine signal (Mathews et al., Proc Natl Acad Sci. U.S.A. 83: 9343-7, 1986). Interestingly, lifespan is dramatically increased in dwarf mice with defects in growth hormone signaling, and presumably decreased IGF-I signaling as well (Brown-Borg et al., Nature 384: 33, 1996). No function for the insulin receptor-related receptor has yet been established, though it is expressed in conjunction with ⁇ NGF receptor (Reinhardt et al., J. Neurosci. 14: 4674-4683, 1994).
- Diapause arrest in general and dauer arrest in particular are associated with major metabolic changes (Tauber et al., Seasonal Adaptation of Insects, Oxford University Press, New York, N. Y., 1986), consistent with a model that daf 2 acts in a metabolic regulatory pathway related to insulin signaling.
- DAF-2 signaling allows non-dauer reproductive growth, which is associated with utilization of food for growth in cell number and size, and small stores of fat (Fig. 3).
- Fig. 3 In daf- 2 mutant animals, metabolism is shifted to the production of fat (Fig. 3) and glycogen (data not shown) in intestinal and hypodermal cells.
- insulin-like growth factors have been detected in metabolism-regulating ganglia in molluscs (Roovers et al., Gene 162: 181-188, 1995) and regulate molting in locust (Hetru et al., Eur. J. Biochem 201 : 495-499, 1991) and silkworm (Kawakami et al., Science 247: 1333-1335, 1990). Consistent with the daf- 2 regulation of diapause, injection of insulin into diapausing Pieris brassicae (an insect) pupae induces recovery (A ⁇ agaus, Roux's Arch. Dev. Biol. 196: 527-530, 1987).
- AGE-1 is likely to be a major signaling output of DAF-2 because of the similarity of the age-1 and daf 2 mutant phenotypes and because of their similar placement in the epistasis pathway (Vowels and Thomas, Genetics 130: 105-123, 1992; Gottling and Ruvkun, Genetics 137: 107-120, 1994).
- Precedents from insulin receptor signaling suggest the following candidate targets for DAF-2/AGE-1/PIP3 regulation of metabolism: (1) membrane fusion of vesicles bearing glucose transporters (Kahn and Weir, eds., Joslin's Diabetes Mellitus, Lea & Febiger, 1994) (or more probably trehalose transporters (Tauber et al., Seasonal Adaptation of Insects, Oxford University Press, New York, N.
- DAF-2/AGE-1 signaling negatively regulates daf- 16 gene activity (Vowels and Thomas, Genetics 130: 105-123, 1992; Gottling and Ruvkun, Genetics 137: 107-120, 1994). DAF- 16 could act at any point downstream of AGE- 1 in this signaling pathway. Evidence is presented herein that DAF- 16 represents the major transcriptional output to DAF-2/AGE-1 PIP3 signaling.
- the DAF-2 signaling cascade also controls the reproductive maturation of the germ line as well as mo ⁇ hogenetic aspects of the pharynx and hypodermis (Riddle, In: Caenorhabditis elegans II, D. Riddle, T. Blumenthal, B. Meyer, J. Priess, eds., Cold Spring Harbor Laboratory, Cold Spring Harbor, NY, 1997, pp. 739-768; Kenyon, op cit, pp. 791-813).
- the DAF-2 receptor may act, for example, in the hypodermal and intestinal target tissues where we note a change in metabolism triggered by the dauer regulatory cascade (Fig. 3).
- DAF-2 regulates the metabolism and remodeling of tissues indirectly, for example, by controlling the production of other hormones (Nagasawa et al., Science 226: 1344-1345, 1984; Jonas, et al., Nature 385: 343-346, 1997).
- Expression and genetic mosaic analysis of daf- 2 is essential to distinguish these models.
- daf-2 dauer-constitutive alleles are more analogous to non-null human insulin receptor mutations.
- Most daf 2 alleles are temperature sensitive, including alleles isolated in genetic screens that would allow the recovery of non-temperature sensitive mutations (Vowels and Thomas, Genetics 130: 105-123,1992; Gottling and Ruvkun, Genetics 137: 107-120, 1994).
- daf-2(el391) dauer constitutive daf- 2 mutant alleles are isolated from EMS mutagenesis at a very high rate (about 1/300 chromosomes), suggesting that the existing alleles are not rare viable alleles.
- the 14 year old patient with the same insulin receptor mutation as daf-2(el391) was morbidly obese (Kim et al., Diabetologia 35: 261-266, 1992), suggesting that metabolic effects of decreased insulin signaling may be similar to daf 2 mutants.
- dafl 6 It may be significant to human diabetes that animals carrying mutations in dafl 6 can grow reproductively even if they also carry daf 2 and age-1 mutations that disable insulin-like metabolic control signals (Vowels and Thomas, Genetics 130: 105-123, 1992; Gottling and Ruvkun, Genetics 137: 107-120, 1994). These data suggest that it is unregulated daf 16 gene activity that causes these metabolic shifts.
- the analogous metabolic defects associated with both type I and type II diabetes may be caused by similar unregulated activity of the human DAF- 16 homolog. Below we disclose the molecular identity of dafl 6. Inhibition of its activity is expected to ameliorate the metabolic dysregulation associated with insulin signaling defects.
- DAF-16 Encodes a Forkhead Transcription Factor Homolog
- daf 16 was mapped 1 map unit to the left of lin-11 and 3.3 map units right of unc- 75 on Chromosome I. This region of the genome contained a gap that was not covered by cosmids nor YACs.
- a fosmid library Genome Sciences, Inc.
- Sequence analysis of the ends of four fosmids revealed that the previously unmapped contig 133 lies in the lin-11 unc-75 gap.
- Cosmids from the approximate daf- 16 genetic location were used to detect RFLPs between C. elegans strains Bristol N2 and Bergerac RC301 : mgP45 on cosmid C39H11, mgP46 on cosmid F28D9, mgP49 on cosmid C35E7, mgP50 is on cosmid C43H8.
- Zero out of 30 daf non-Unc recombinants carry the RC301 alleles of mgP45 and mgP50.
- Two out of 30 Daf non-Unc recombinants carry the RC301 allele of mgP49.
- 10 out of 30 Daf non-Unc recombinants carry the RC301 allele of mgP46.
- daf 16 lies between cosmids C43H8 and C35E7.
- the daf 16 gene was identified by identifying deletions (mgDf50) and point mutations ⁇ mg53 and mg54) within the forkhead gene on the cosmid R13H8 (Fig. 27).
- Fig. 13A and Fig. 13B SEQ ID NOS: 43 and 44, respectively.
- the amino acid sequences coding for the DAF- 16 isoforms are shown in Figs. 14A- 14C (SEQ ID NOS: 44-46).
- daf- 16 mutations (1) a large deletion of conserved regions in daf-16 (mg ⁇ F50) that proves that the daf 16 null phenotype is a suppression of daf 2 mutations; (2) a S to L substitution in exon 6 in daf- 16 (mg 53) that alters a conserved WKNSIRH motif; and (3) a nonsense mutation in exon 3 in daf- 16 ⁇ mg 54) that is predicted to truncate one of the daf 16 differentially spliced isoforms.
- this spliced isoform has a distinct forkhead DNA binding domain and is therefore expected to bind to distinct promoters or combinatorial partners.
- This mutant is a weak suppressor of daf- 2, suggesting that both DAF- 16 isoforms are necessary for metabolic control.
- DAF- 16 is a member of the forkhead (FH) transcription factor family (Figs. 21A-21B). This strong amino acid homology indicates that DAF- 16 is a transcription factor.
- Our genetic analysis indicates that DAF- 16 activity is regulated by the DAF-2/AGE-1 insulin signaling pathway. Precedent from another receptor kinase signaling pathway endorses this model: the C. elegans LIN-31 forkhead protein has been shown to be regulated by a tyrosine kinase signaling cascade from the LET-23 EGF receptor homolog (Kim, Genes Dev. 7: 933-947, 1993).
- HNF-3 another FH family member
- HNF-4 an endoderm-specific transcription factor that acts at the same metabolic control protein promoters as HNF-1 and HNF-4, both of which are mutant in maturity onset diabetes of the young (MODY) (Yamagata et al., Nature 384: 455-458, 1996; Yamagata et al., Nature 384: 458-460, 1996).
- DAF- 16 is a FH protein and DAF-3 is a Smad protein:
- DAF- 16 acts as a repressor protein causing a metabolic shift to fat metabolism.
- Smad protein transcription factors e.g., DAF 3, DAF8, DAF14
- DAF- 16 act on a common set of promoters as combinatorial transcriptional regulators.
- sup(mgl44) suppresses the dauer arrest of age-1 (mg44), (m333), (mgl09) such that fertile adults are formed.
- sup(mgl44) does not suppress the lack of insulin signaling in the daf-2 mutant: daf-2(el370); sup(mgl44 ) form dauers at 25 degrees. This suggests that not all of the DAF-2 signaling output is via AGE-1.
- sup(mgl44) weakly suppresses, allowing some fertile adults to bypass arrest at the dauer stage.
- daf-2(el370); sqt-1 age-l(mg44); sup(mgl44 ) form 8% fertile adults, 12% sterile adults, and 80% dauers at 25 degrees.
- swp ⁇ mgl44 is a dominant suppressor of age-1 mutations. sqt-1 age-l(mg44); sup(mgl44)/+ form 100% fertile adults. The sup(mgl44) parental genotype does not affect this outcome. This data indicates that sup ⁇ mgl44) is a dominant activating or dominant inactivating mutation.
- swp ⁇ mgl44 may identify an activating mutation in the C. elegans AKT homologue (Fig. 25).
- sup(mgl44) in trans to a multiply marked chromosome (using PCR based RFLPs)
- sup(mgl44) maps to a 2 map unit genetic interval that includes C elegans AKT (Fig. 24).
- AKT represents a dauer regulated gene that may respond to DAF- 16 and DAF-3 transcriptional control. Multiple probable binding sites, related to the DAF-3 binding site in myoll have been identified.
- sup(mg!42) identifies another likely output of age-1 signaling mg!42 suppresses three different age-1 alleles ⁇ age-1 (mg44), age-1 (m333), and age-1 (mg!09) at 20 degrees, age-1 (mg44); sup(mgl42 ) form fertile adults at 15 and 20 degrees. At 25 degrees, they form 33% fertile adults and 67% sterile adults. sqt-1 age-l(mg44); mgl42/+ form 14% fertile adults and 86% sterile adults when the parent was homozygous for mgl42. sqt-1 age-l(mg44); mgl42/+ form 67% fertile adults and 33% sterile adults when the parent was heterozygous for mgl42.
- Novel C. elegans insulin-like hormones are probable DAF-2 ligands
- the insulin superfamily signature residues were assembled using a set of vertebrate insulins and IGF-I and II proteins as well as silk moth bombyxin (a distant insulin relative) and a Limulus insulin superfamily member.
- the use of superfamily signature amino acid positions to detect distant relatives in databases is a more definitive approach to ascertaining gene superfamily members than simple searches with single family members.
- F13B12 was most closely related to human insulin and IGF-I, II. This was especially obvious from a PILEUP analysis in which a phylogenetic tree of protein superfamily members was constructed (Figs. 29 and 30). The insulin product of F13B12 clustered more closely to the mammalian insulin and IGF-I,II proteins than to other distant relatives like relaxin. Relaxin defined the most distantly related insulin superfamily member in the analysis, and it appeared to engage a tyrosine kinase receptor distinct from the insulin receptor.
- insulin-like hormones are expected to subserve the longevity, dauer arrest, and/or metabolic effects of DAF-2 signaling.
- each of these insulin superfamily members are expected to engage the DAF-2 receptor, leading to a result in which a mutation in daf 2 "sums" the functions of these eight or more insulin-like signals.
- F13B12 insulin-like hormone signaling can suppress dauer arrest induced by daf 7 mutations or decreases in synaptic signaling, but can enhance dauer arrest caused by decreases in daf 2 signaling.
- the F13B12 insulin-like hormone may act synergistically with DAF-7 signals, like the DAF-2 receptor, but may interfere with the secretion or activity of another DAF-2 ligand.
- the expression pattern of a promoter fusion of the F13B12 insulin-like hormone to GFP is also consistent with the genetic results.
- GFP was expressed in several head neurons, including ASJ and ASH, a pair of pharyngeal neurons, with processes that looked most like NSM, and three tail neurons. The full-length GFP looked similar but very faint. Worms expressing the full-length GFP lived longer than wild type.
- the NSM neuron had dense core vesicles by EM analysis, which is also true of beta cells of the pancreas.
- Pancreatic beta cells are also neuronal in character; they use synaptic components for insulin vesicle release, are synaptically connected to the autonomic nervous system, and are electrically active.
- Sulfonyl ureas which are used to increase insulin release, act by regulating the activity of K channels in beta cells, much the way K channels regulate excitability in other neurons.
- the NSM neuron is a part of the C. elegans enteric nervous system, just like the pancreas in mammals. Accordingly, the expression and functional analysis of the F13B12 insulin-like hormone is highly supportive of its role in insulin-like control of worm metabolism and aging.
- the F13B12 insulin-like hormone is the closest C. elegans homologue to insulin, it is likely that many or all of these insulin superfamily members engage the DAF-2 receptor to regulate their activity. For example, they are more closely related to insulin than to the ligands of the other growth factor receptors present in the worm genome. These distinct insulin superfamily ligands could regulate DAF-2 at distinct times or places, or act antagonistically or synergistically to the F13B12 insulin-like hormone. Some of these insulin-like hormones may regulate metabolism, like insulin, whereas others may regulate dauer arrest or longevity. Thus, the daf 2 mutant phenotype that results from loss of the receptor for these many hormones may be a composite loss of many hormonal signals.
- DAF-2 receptor in a daf-2 null mutant has been found to complement the dauer arrest phenotype of a daf-2 mutant but not the metabolic or aging defects. Accordingly, one DAF-2 ligand may be expressed in or near the brain to control dauer arrest, but other ligands may impinge on DAF-2, for example, in non-neuronal cells, to control metabolism and aging.
- loss of only one of the insulin-like hormones may cause only a subset of the daf 2 mutant phenotype, for example, only increased longevity or only metabolic dysregulation.
- These C. elegans insulin superfamily members may, for example, subserve the longevity or senescence function of DAF-2 receptor signaling, and an increase in such a hormone activity late in life may actually mediate the increase in DAF-2 activity that causes senescence.
- any of these insulin-like proteins have antagonistic effects on DAF-2, any decline in their activity late in life could mediate senescence.
- Application of only one hormone by injection or germ line therapy could therefore be used to target, for example, aging without any effects on metabolism.
- the F13B12 insulin-like hormone is a detectable worm homologue of insulin
- the other 7 worm insulins also have human homologues that are more closely related to their nematode counte ⁇ arts than they are to each other.
- the divergence of the F13B12 insulin-like hormone from insulin and IGF-I and IGF-II gives a measure of how much divergence may be expected for the mammalian homologues of the other insulin superfamily members.
- the F13B12 insulin-like hormone is slightly more closely related to IGF-II than insulin or IGF-I, but these three genes are probably duplicated and diverged homologues of a F13B12 homologue in the common ancestor of C.
- the insulin-like hormones described herein, as well as their human homologues, provide valuable candidate regulators of senescence. For example, if human senescence is triggered by a decline in an insulin-like longevity hormone, in analogy to how puberty is triggered by a timed change in sexual maturation hormones, it may prove possible to regulate the aging process in the same way that sexual maturation can be regulated by hormone treatment. In addition, the C. elegans aging hormones may reveal which human genes have such a function. Because daf 2 mutations cause longevity increases in a manner analogous to caloric restriction in mammals, it is possible that caloric restriction in mammals regulates the level of an insulin-like hormone that in turn engages the insulin or IGF-I, II receptors.
- Such a hormone may not have been detected if its level is very low or if it signals over a short range.
- the detection of human homologues to the C. elegans superfamily members listed above will become a trivial matter of database searching. In this way, the determination of the function of the worm homologue function in longevity or growth arrest or metabolism control will supply valuable functional information about the activity of human homologues.
- the effect of the C. elegans insulin-like proteins on longevity, metabolism, or growth arrest may be readily determined by a combination of high copy studies, as shown above for the F13B12 insulin-like hormone, as well as by using RNA inhibition and knockout strategies to inhibit the activities of these genes.
- the C elegans strains are then tested for interactions with daf pathway mutants, for example, as shown for the F13B12 insulin-like hormone above, and for longevity effects by standard techniques.
- the human proteins that regulate longevity may be detected by a combination of database searches and genetic complementation of worm RNAi or gene knockout mutants (for example, as described herein), as well as by high copy effects of human genes on worm longevity and metabolic control.
- these human proteins are hormones, they may be used to directly regulate human longevity, for example, by injection into the bloodstream. Depending on the particular hormone and its effects, the hormones themselves may cause increased longevity, or they may be modified to generate dominant interfering hormones (for example, by engineering chimeras between the insulin superfamily members).
- the function of these proteins upon injection into the bloodstream may be predicted from their function in C. elegans, for example, as ascertained by transgenic analysis. Because of their effects on longevity, the human homologues of these C. elegans insulin-like endocrine signals have important applications in preventing or retarding the aging process.
- An activating mutation (mgl44) in akt-1 one of two C. elegans Akt/PKB homologs, was identified in a genetic screen for mutations that suppress the dauer arrest phenotype of the age-1 (mg44) null mutant (Morris et al., Nature 382:536-539, 1996). This screen was designed to isolate reduction of function mutations in molecules negatively regulated by PI3K signaling, or gain of function mutations in molecules positively regulated by PI3K signaling.
- the mgl44 mutation suppresses the three age-1 alleles tested, including two classes of nonsense alleles and one missense substitution (Ala845Thr) in a conserved region of PI3K (Morris et al, Nature 382:536-539, 1996).
- mgl44 does not have any obvious phentoypes; it moves normally, has a normal vulva and brood size, and makes dauers on starved plates and on plates treated with pheromone. Thus mg!44 does not activate the AGE-1 PI3K signaling pathway to the point that normal dauer arrest is affected but does activate the pathway sufficiently to alleviate the requirement for AGE-1 PI3K outputs.
- mgl44 was mapped to a region on chromosome V within 1.3mu of the polymo ⁇ hic STS marker bPl (Fig. 31). From the C. elegans genome sequence in this 1.3 mu region, we identified a C elegans Akt/PKB homolog which we named akt-1 (Fig. 31). Because an activating mutation in Akt/PKB is a good candidate to be a genetically dominant suppressor of an age-1 PI3K null mutant, we determined the akt-1 DNA sequence in the mgl44 strain by PCR amplification and direct sequencing.
- akt-1 is differentially spliced within the conserved kinase domain to generate the akt-la and akt- lb isoforms with distinct kinase domain subregions IV, V, and VI (13) (92% identical, 238/258 amino acids over the entire kinase domain; 69% identical, 44/64 amino acids in the differentially spliced region), akt-la is 58% identical to human Akt/PKBa (Fig. 33 and 34).
- akt-1 has a pleckstrin homology domain, kinase domain, and the two phosphorylation sites necessary for Akt/PKB activation (Alessi et al., EMBO J. 15:6541-6551, 1996) which are the hallmarks of the Akt/PKB family (Fig. 34).
- the next most closely related non- Akt/PKB mammalian kinase is rat PKCbl which is 38% identical to akt-la.
- the akt-l ⁇ mgl44) mutation is present in both splice forms of akt-1 and is located in a region of the protein that links the N-terminal pleckstrin homology domain to the C-terminal kinase domain. This mutation is in a region that is not conserved between C. elegans and mammalian Akt/PKB. This mutation may reveal a negative regulatory region on akt-1 because the mgl44 allele is an activating mutation (see below).
- RNA interference RNA interference
- Akt/PKB homolog in the nearly complete C. elegans genome sequence (Wilson et al., Nature 368:32-38, 1994) which we named akt- 2 (Fig. 32).
- akt-1 and akt-2 are more closely related to each other (66% identity between akt-la and akt-2 overall) than to any other Akt/PKB homolog (Fig. 33).
- akt-2 is 55% identical to human Akt/PKBa overall and 35% identical to rat PKCbl overall.
- akt-2 only has the Thr308 phosphorylation site that is necessary for Akt/PKB activation by PDK1 (Alessi et al., Current Biology 7:261-269, 1997; Stokoe et al., Science 277:567-570, 1997) but not the Ser473 phosphorlyation site (Alessi et al., EMBO J. 15:6541-6551, 1996) (Fig. 34) and yet clearly functions in the insulin-like signaling pathway (see below).
- DAF- 16 contains four consensus sites for phosphorylation by Akt/PKB (Alessi et al., FEBS Letters 399:333-338, 1996) and three of these sites are conserved in the human DAF- 16 homologs AFX, FKHR, and FKHRLl .
- AKT-1 and AKT-2 may exert their negative regulatory effect by directly phosphorylating DAF- 16. Shown below are comparisons of AFX, FKHR, and DAF- 16, indicating the conservation between the consensus phosphorylation sites.
- the AKT sites indicated are located downstream and upstream, respectively, of the Forkhead domain SEQ ID NOS: 161-169).
- Akt/PKB is the major output of PI3K signaling and implicate a transcription factor downstream target for the Akt/PKB kinase. Because mutations in dafl 6 suppress akt-1 and akt-2 reduction of function, it is likely that DAF- 16 represents a major signaling output of Akt/PKB in C. elegans insulin-like signaling. Akt/PKB has been implicated in mammalian insulin receptor signaling that localizes glucose transporters to the plasma membrane (Kohn et al., J. Biol. Chem.
- the DAF- 16 Fork head transcription factor represents the major output of D AF-2/ AGE-1 /AKT-1 /AKT-2 insulin receptor-like signaling (Ogg et al., Nature 389:994-999, 1997).
- Akt/PKB action in the insulin/IGF-I anti-apoptotic pathway may also converge on transcription factors related to DAF- 16.
- akt-1 ⁇ mgl 44 is an activating mutation, as opposed to a loss of function or dominant negative mutation in akt-1.
- a mutation in daf 2 is suppressed more poorly by akt-l(mgl44) than by a reduction of function mutation in daf 16.
- the age-1 alleles suppressed by akt-l ⁇ mgl44) are null (Morris et al., Nature 382:536-539, 1996) whereas daf-2(el370) is a temperature sensitive mutation in the kinase domain (Kimura et al., Science 277:942-946, 1997).
- akt-l ⁇ mgl44) bypasses the need for AGE-1 signaling in reproductive development but does not activate normal aging pathways. It is possible that akt-l ⁇ mgl44) does not subserve all the functions of the wild type akt-1 or akt-2. akt-2 or other as yet unidentified downstream effectors of age-1 may be the pertinent signaling molecules for lifespan regulation.
- akt-1 and akt-2 were examined in transgenic animals containing a translational fusion of each genomic locus to Green Fluorescent Protein (GFP) (Chalfie et al., Science 263:802-805, 1994).
- GFP Green Fluorescent Protein
- the GFP fusion proteins contain the entire genomic coding region from either akt-1 or akt-2, including 5' upstream regulatory sequence, fused in frame at the C-terminus to GFP.
- AKT-1 /GFP expression is first observed in late embryos and is maintained throughout the life of the animal. In post-embryonic animals, AKT-1 /GFP is expressed in the majority of head neurons including sensory neurons.
- AKT-1 /GFP expression was observed more variably in a variety of cell types including hypodermis, intestine, muscle, some of the P cell descendants that form the vulva, and in a structure we believe to be the excretory canal.
- an AKT-2/GFP full length protein fusion gene is expressed at the same times as AKT-1/GFP and in the same tissues that express AKT-1/GFP, although AKT-2/GFP seems to be less abundant.
- AKT-1/GFP and AKT-2/GFP expression does not differ dramatically from their expression during reproductive growth.
- AKT-1 and AKT-2 in regulating the metabolic shift and developmental arrest associated with dauer formation suggests the following model.
- an insulin-like molecule binds to the DAF-2 insulin receptor kinase inducing autophosphorylation and recruitment of AGE-1 PI3K.
- PI3K signals via Akt/PKB.
- Phosphorylated DAF- 16 could be inactive, function to activate genes required for reproductive growth and metabolism, or repress genes required for dauer arrest and energy storage.
- Other signaling molecules that are activated by DAF-2 must also converge downstream of AGE-1 (for example, on DAF- 16 or AKT-1/ AKT-2) for proper regulation of metabolism and lifespan: the dauer arrest induced by loss of AGE-1 PI3K or AKT-1 /AKT-1 activity implies that the loss of only one of these inputs to DAF- 16 is sufficient to cause dauer arrest.
- DAF-2, AGE-1, AKT-l/AKT-2, and other signaling pathways from DAF-2 are inactive and therefore DAF- 16 is active, presumably because it is under-phosphorylated. Active DAF- 16 either represses genes required for reproductive growth and metabolism or activates genes necessary for dauer arrest and energy storage.
- the DAF- 16 Fork head protein has been suggested to interact with the DAF-3, DAF-8, or DAF- 14 Smad proteins to integrate converging TGF- ⁇ like neuroendocrine signals with insulin-like signals (Ogg et al., Nature 389:994-999, 1997; Patterson et al., Genes & Development 1 1 :2679-2690, 1997).
- DAF- 16 may form a complex with the DAF-3 Smad protein under dauer inducing conditions to regulate these downstream genes (Ogg et al., Nature 389:994-999, 1997), while AKT-1 phosphorylation of DAF-16 may inhibit the formation of a Smad/Fork head complex during reproductive development.
- Akt/PKB mediates insulin dependent repression of the insulin-like growth factor binding protein- 1 (IGFBP-1) gene in HepG2 cells via a conserved insulin response sequence (CAAAAC/TAA) (Cichy et al., J. Biol. Chem. 273:6482-6487, 1998).
- DAF- 16 binds to this same insulin response sequence in vitro.
- Akt/PKB mediates its transcriptional effects on insulin responsive genes such as IGFBP-1 via the human homologs of DAF-16: AFX, FKHR, FKHRL1, or AF6q21.
- the pdk-1 (mgl 42) gain of function mutation is Ala303Val (splice 1). This protein is 58% identical to mammalian PDK in the plecstrin homology domain and 39% identical in the kinase domain as shown below SEQ ID NOS: 170-199).
- PDK is a mammalian kinase that phosphorylates an essential serine residue on AKT, contributing to its activation. This serine is conserved in akt-1 and akt-2. Thus, PDK is an excellent candidate gene for the mgl 42 mutation.
- the genetic region bearing pdk- 1 was amplified from the mgl 42 strain, and an amino acid substitution in a conserved region of the PDK kinase domain was detected.
- human PDK1 becomes a candidate gene for variation in diabetes. Mutations in human PDK1 may underlie the genetic variation that causes diabetes in some families. Similarly, drugs that activate PDK, like the mgl 42 mutation that activates C elegans pdk-1, may bypass the need for upstream signaling in some diabetics with such upstream defects.
- the region of human PDK1 that is homologous to the C. elegans pdk-1 at alanine 303 provides a good candidate for screening for drugs that bind and activate signaling.
- the region of human AKT between the kinase domain and the PH domain, where the C elegans akt-1 gain of function mutation maps is a good candidate for the design of drugs that activate AKT.
- Such activated AKT in C. elegans bypasses the need for upstream signaling from the AGE-1 PI3K and may similarly treat diabetics with defects in insulin signaling between insulin and AKT.
- Diapause arrest is an essential feature of many vertebrate and invertebrate life cycles, especially in regions with seasonal temperature and humidity extremes (Tauber et al., Seasonal Adaptation of Insects, Oxford University Press, New York, N. Y., 1986). Animals in diapause arrest slow their metabolism and their rates of aging, and can survive for periods for much longer than their reproductive lifespan (Tauber et al., supra, 1986).
- the mammalian insulin signaling pathway may also control longevity homologously.
- the increase in longevity associated with decreased DAF-2 signaling is analogous to mammalian longevity increases associated with caloric restriction (Finch, Longevity, Senescence and the Genome, The University of Chicago Press, Chicago, 1990).
- caloric restriction causes a decline in insulin signaling to induce a partial diapause state, like that induced in weak daf-2 and age-1 mutants.
- the induction of diapause-like states may affect post-reproductive longevity (Finch, supra), as in C. elegans.
- C. elegans mutant, clk-1 may also regulate lifespan via such metabolic effects (Ewbank et al., Science 275: 980-983, 1997). This association of metabolic rate with longevity is also consistent with the correlation of free radical generation to aging (Finch, supra).
- DAF-7 TGF- ⁇ neuroendocrine signal is also necessary for reproductive development of C. elegans (Ren et al., Science 274: 1389-1391, 1996; Schackwitz et al., Neuron 17: 719-728, 1996).
- the signals in these two pathways are not redundant: animals missing either daf-2 signaling or daf-7 signaling (Fig. 3) shift their metabolism and arrest at the dauer stage (Table VII).
- the phenotypes caused by mutations in either pathway are strongly synergistic, suggesting that the two pathways are integrated.
- Synchronised eggs were grown and counted as described above. dafl(m40) and daf-2(el370) form 100% dauer at 25 °C. Numbers shown in Table VII indicate percentage dauer formation and number of animals counted (in parenthesis). Data presented is the sum of three independent trials. Table VII. Synergy of dafl and daf-2
- DAF-7 TGF- ⁇ like and DAF-2 insulin-like signaling pathways converge to control diapause and metabolism
- DAF-2/ AGE-1 pathway has been implicated in reproductive adult stage longevity control in the absense of dauer formation (Larsen et al., Genetics 139: 1567-1583, 1995; Kenyon et al., Nature 366: 461-464, 1993; Dorman et al., Genetics 141 : 1399-1406, 1995; and Morris et al., Nature 382: 536-539, 1996). Both pathways control the longevity increase associated with dauer arrest, since dauer larvae live much longer than reproductive C.
- DAF-7 TGF- ⁇ pathway all of the known signaling output of the DAF-7 TGF- ⁇ pathway are via downstream Smad transcriptional regulation (infra). Insulin signaling, and by extension, DAF-2 signaling, is more ramified: outputs from this receptor regulate sugar transport, metabolic enzyme activities, translation of mRNAs encoding these and other enzymes, as well as transcription (White and Kahn, J. Biol. Chem. 269: 1-4, 1994). We suggest that it is the regulatory output distinct to the DAF-2 pathway that controls longevity. Alternatively, TGF- ⁇ and insulin-like signals may converge only during the LI stage, when diapause is regulated, and that after this stage, only DAF-2 signaling is necessary for normal metabolic control.
- C. elegans In response to environmental signals C. elegans arrests development at the anatomically and metabolically distinctive third-larval dauer stage (Riddle In: C. elegans N, D.L. Riddle, T. Blumenthal, B.J. Meyer, J.R. Priess, eds., Cold Spring Harbor Press, 1997, pp. 739-768).
- Pheromone signal is transduced by chemosensory neurons (Bargmann and Horvitz, Science 251 : 1243, 1991) which couple to a TGF- ⁇ signaling pathway (Ren et al., Science 274: 1389, 1996; Schackwitz et al., Neuron 17:719, 1989), as well as an insulin-related signaling pathway (as discussed, infra) to trigger changes in the development of the many tissues remodeled in dauer larvae (Riddle, supra).
- daf-7 a TGF- ⁇ homolog (Estevez et al., Nature 365:644, 1993)
- daf 4 a type II TGF- ⁇ receptor (Estevez et al., Nature 365:644, 1993)
- daf-l a type I TGF- ⁇ receptor
- daf-8 a type I TGF- ⁇ receptor
- daf 14 Smad homolog
- daf- 7 and its receptors and Smad proteins are antagonists to daf- 3.
- the dauer constitute phenotypes of mutations in the daf-7 signal transduction pathway genes (including putative null mutations) are fully suppressed by mutations in daf-3. These genetic data indicate that in the absence of daf- 7 signaling, daf 3 acts to induce dauer arrest.
- C. elegans DAF-3 Smad protein is most closely related in sequence to DPC4, which is a putative cofactor for Smadl , Smad2, and Smad3 (Zhang et al., Nature, 383: 168, 1996; Lagna et al., Nature, 383:832, 1996; Savage et al., Proc.Natl.Acad.Sci., 93:790, 1996; Hahn et al., Science, 271 :350 (1996). Smads have two conserved domains (Wrana et al., Trends Genet., 12:493, 1996).
- DAF-3 has these two domains; compared to its closest known relative DPC-4, daf-3 has 55% amino acid identity in domain I and 30% in domain II (Fig. 5C).
- DPC-4 is not the mammalian DAF-3 homologue: C. elegans Sma-4, for example, is more closely related to DPC-4 than DAF-3.
- daf-3 ⁇ mgl25 and daf-3 ⁇ mgl32 are missense mutations that alter conserved residues in domains 1 and 2 respectively (Fig. 5C).
- Most of the mutations detected in other Smads localize to a 45 amino acid segment of domain II (Wrana et al., Trends in Genet. 12:493, 1996). Clustering of mutations is observed even in DPC4, for which homozygous null mutations have been identified (Hahn et al., Science 271 :350, 1996), so the clustering is unlikely to be due to selection for non-null mutations.
- This hotspot region was sequenced in nine daf- 3 alleles, and no mutations were detected. This difference in mutation location may be a simple statistical anomaly, or may indicate functional differences between DAF-3 and other Smad proteins, consistent with the fact that DAF-3 is antagonized, rather than activated, by an upstream TGF- ⁇ molecule.
- DAF-7 signaling from the ASI neuron begins during the LI stage, and neuron ablations and dauer- formation assays in various environmental conditions indicate that the signal for dauer formation is also received during the first two larval stages (Ren et al., Science 274:1389, 1996, Schackwitz et al., Neuron 17:719, 1996; Bargmann and Horvitz, Science 251 : 1243, 1991 ; Golden and Riddle, Developmental Biology 102:368, 1984; Swanson and Riddle, Developmental Biology 84:27, 1981). Therefore, we most extensively examined LI larvae.
- V blast cells About half of the transgenic animals have weak expression in V blast cells, P blast cells, hyp7 hypodermal cells, and the pharynx.
- the weak expression impedes cell identification, but the main body of the pharynx is filled, implying expression in pharyngeal muscle (Fig. 6A). Expression is rarely detected in dorsal body wall muscle. The expression pattern in older larvae and adults is similar to that of LI animals.
- DAF-3/GFP is expressed in the distal tip cells and in their precursors, Zl .a and Z4.p, throughout development (Fig. 6D, Fig. 8). DAF-3/GFP is also strongly expressed in unidentified vulval cells.
- DAF-3/GFP is expressed uniformly thoughout the embryo (Fig. 6E).
- the subcellular localization of the DAF-3/GFP protein is mainly cytoplasmic (Fig. 6B-E, and see below).
- DAF-3 activity may be regulated by the DAF-1 and DAF-4 TGF- ⁇ receptors
- Figs. 6A-6G This construct complements a daf-4 mutant.
- a 10 kb Sail fragment from cosmid C05D2 contains 3 kb of sequence upstream of the daf-4 transcriptional start, and all of the daf 4 coding region except codons for the last fourteen residues of daf 4. This fragment was subcloned into the Sail site of the GFP plasmid TU#61 (Chalfie et al., Science 263: 802-805, 1994).
- This plasmid was injected into the daf-4 ⁇ m72) strain to test the fusion for DAF-4 activity. More than 95% of the transgenic animals were rescued for the dauer- constitutive and small phenotypes of daf-4 ⁇ m72), indicating that the fusion has robust DAF-4 activity.
- the pattern of DAF-4/GFP expression is similar to that of daf-3/GF ' P, except that DAF-4/GFP is localized to membranes, consistent with its role as a receptor. DAF-4/GFP is expressed more strongly in the pharynx (Figs. 6F-G), and more weakly in the ventral nerve cord cell bodies and the body hypodermis.
- DAF-4/GFP is first detectable at late embryogenesis when the embryo resembles an LI larva.
- the DAF-4/GFP construct contains an older version of GFP than in DAF-3/GFP; in the older version, the chromophore takes longer to mature.
- anti-GFP antibodies to assay GFP. These antibodies should recognize the two forms of GFP equally well.
- DAF-3/GFP is expressed in early embryos; DAF-4/GFP is not. DAF-4/GFP is also not expressed in membrane surrounding the intestinal lumen, unlike DAF-3/GFP.
- DAF-3 and DAF-4 expression patterns suggest that these genes act in target tissues to transduce pheromone-regulated DAF-7 neuroendocrine signals.
- the early expression of DAF-3 in embryos is also consistent with a model that DAF-3 acts during embryonic development, for example, to mediate the development of neuronal pathways that emit neuroendocrine signals that antagonize DAF-7 TGF- ⁇ signaling during the LI stage.
- DAF-3 functions in transducing environmental signals during the LI and L2 stages. This is supported by the following observations. (1) DAF-7 TGF- ⁇ signal from ASI neurons occurs during the LI and L2 stages and is repressed by dauer- inducing environmental conditions. (2) Expression of the DAF-4 type II receptor begins in very late embryogenesis.
- DAF-4 TGF- ⁇ family receptor kinase and the DAF-3 Smad protein in these target tissues is consistent with a model that the DAF-7 neuroendocrine signal from the ASI neuron is received directly by these tissues during non dauer development.
- DAF-4 and DAF-3 are expressed in many of the same cells is consistent with a model that DAF-4 signaling to downstream Smads (DAF- 8 and DAF- 14 are likely candidates) directly regulates DAF-3 gene activity.
- DAF- 8 and DAF- 14 are likely candidates
- DAF-3/GFP is primarily, although not exclusively, cytoplasmic. DAF-3/GFP subcellular distribution was examined in head neurons in the vicinity of ASI (the cell that produces the DAF-7 signal), as well as in intestinal cells. DAF-3/GFP was predominantly cytoplasmic in all animals.
- DAF-3 is antagonized by the other members of the DAF-7 TGF- ⁇ pathway, we expect that DAF-3 is active (and perhaps localized to the nucleus) when these genes are inactive. We therefore observed the subcellular localization of the full-length DAF-3/GFP fusion protein in the head neurons, tail neurons, and intestine of dauer-constitutive mutant LI worms, when DAF-3 gene activity is predicted to be highest.
- DAF-l ⁇ m402), daf-4 ⁇ m72), daf-7 ⁇ m62), daf-8 ⁇ sa233), and daf-14 ⁇ m77) mutants DAF-3/GFP was predominantly cytoplasmic, although, as in wild-type, cells were seen with some GFP in the nucleus.
- DAF-3/GFP was localized to the nucleus more than in wild-type lines.
- the increased nuclear localization was seen in both the daf-4 and wild-type segregants.
- the increased nuclear GFP was a property of the array, rather than of daf-4.
- the DAF-3/GFP fusion protein is predominantly cytoplasmic in LI and L2 stages of larvae induced to form dauers by environmental conditions or by mutations in the insulin receptor pathway gene daf-2, rather than by mutations in the DAF-7 signaling pathway mutants (data not shown).
- the tissue-specific expression pattern of DAF- 3/GFP was unaltered in these mutant backgrounds (data not shown).
- DAF-3/GFP subcellular localization is not strongly responsive to DAF- 7 signaling defects or to dauer- inducing environmental conditions does not rule out a role for DAF-3 in the nucleus in dauer formation. Even though we detect no change in DAF-3/GFP subcellular localization, we do detect some DAF-3/GFP in nuclei, and a minor change in nuclear localization or a change in activity due to phosphorylation state may couple DAF-3 to DAF-7 signaling. In fact, the subcellular localization of Drosophila MAD protein is not detectably altered in wild-type when receptor signaling to MAD occurs; relocalization is seen only if the DPP ligand is drastically overexpressed. It is unlikely that a set of undiscovered TGF- ⁇ receptors regulates DAF- 3.
- the finding that DAF-3/GFP subcellular localization is not strongly responsive to DAF- 7 signaling defects or to dauer- inducing environmental conditions does not rule out a role for DAF-3 in the nucleus in dauer formation
- C. elegans genome sequence is 90% complete, and there is only one candidate TGF- ⁇ receptor gene other than dafl and daf-4. If this receptor were a positive regulator of DAF-3, mutants would be expected to, like daf-3 mutants, suppress daf- 7 mutants. This receptor acts in a signaling pathway distinct from DAF-3, and it is not a suppressor of daf- 7.
- DAF-3/GFP is associated with chromosomes in intestinal cells during mitosis. These cells divide at the end of the LI stage, and antibody staining with anti-GFP antibodies and anti- ⁇ -tubulin antibodies reveals that DAF-3/GFP is found associated with DNA between the spindles during mitosis (Fig. 8A).
- DAF-3 GFP co-localized with DAPI from prophase to late anaphase.
- DAF- 3/GFP was associated with nuclei in prophase by the following criteria. The spindles were present on either side of the nucleus, but the nucleus has not completely broken down.
- DAF-3/GFP continues to co-localize with DAPI until the chromosomes have separated to the normal distance by which nuclei are separated in the intestine, implying continued association until telophase. At this point in mitosis, DAF- 3/GFP fades and becomes undectectable before the nuclei reform the nuclear envelope and nucleolus.
- DAF-3 can, indirectly or directly, bind DNA, consistent with the hypothesis that it is a transcriptional activator that acts in the nucleus. DAF-3 is not predicted from its mutant phenotype to have a role in mitosis.
- the second indication of DAF-3 function in the nucleus is our examination of a truncated DAF-3/GFP fusion that is missing most of conserved domain II.
- the truncated construct pGP7 consists of 8 kb of daf-3 fused to GFP.
- An 8 kb EcoRI fragment from B0217 was cloned into the EcoRI site of pBluescript SK(-).
- a Pvul/Sall fragment of this subclone was ligated to a Pvul/Sall fragment from the GFP vector pPD95.81.
- the resulting plasmid contains ⁇ 2.5 kb of sequence upstream of the 5'-most exon of daf-3 and coding region through the first 58 amino acid residues of domain II. The remaining 175 amino acids of daf 3 and the 3' noncoding region are replaced with GFP and the unc-54 3' end.
- Three transgenic lines were isolated, and all had a similar phenotype. This fusion protein interferes with dauer induction; like a daf-3 loss-of- function mutant, it suppresses mutations in daf-7 (Fig. 7). This truncated protein is predominantly nuclear, suggesting that it represses dauer formation by acting in the nucleus (Fig. 8B).
- wild- type DAF-3 also has a function in the nucleus.
- the full-length DAF-3/GFP construct also suppresses mutations in daf-7, as does a full-length DAF-3 construct without GFP (Fig. 7). This suppression indicates that overexpression of DAF-3 in the cytoplasm has dominant-negative activity, perhaps due to interference with DAF-3 interactions with receptors or cofactors such as other Smads.
- a Smad2 construct containing only the conserved domain II of the protein is constitutively nuclear, leading to the suggestion that the C-terminus is an effector domain, and the N-terminus tethers the protein in the cytoplasm (Baker and Harland, Genes and Development 10: 1880, 1996; Hoodless et al., Cell 85:489, 1996; Liu et al., Nature 381 :620, 1996; and Macias-Silva et al, Cell 87: 1215, 1996).
- Our construct, in which the N-terminus is intact, is nuclear.
- Smad2 like Smadl and Smad3 has an SSXS motif at the C terminus (Zhang et al., Nature 383: 168, 1996; Lagna et al., Nature 383:832, 1996; Savage et al., PNAS 93:790; Baker and Harland, Genes and Development 10: 1880, 1996; Hoodless et al., Cell 85:489, 1996; Liu et al., Nature 381 :620, 1996; Macias-Silva et al., Cell 87: 1215, 1996; and Graf et al., Cell 85:479, 1996); this motif is a substrate for phosphorylation and required for nuclear localization of Smad2 (Baker and Harland, Genes and Development 10: 1880, 1996; Hoodless et al., Cell 85:
- the DAF-7 TGF- ⁇ ligand which is produced by the ASI sensory neuron in conditions that induce reproductive organ (Ren et al., Science 274: 1389, 1996; Schakwitz et al., Neuron 17:719, 1996), binds to the DAF-l/DAF-4 receptor kinases on target tissues.
- Smads DAF-8 and/or DAF- 14 phosphorylate the Smads DAF-8 and/or DAF- 14, analogous to the phosphorylation and activation of Smadl , Smad2, and Smad3 (Zhang et al., Nature 383: 168, 1996; Lagna et al., Nature 383:832, 1996; Savage et al., PNAS 93:790, 1996).
- DAF-3 functions like its closest homolog, DPC4, which dimerizes with phosphorylated Smadl and Smad2, even under conditions that do not lead to detectable DPC4 phosphorylation (Zhang et al., Nature 383: 168, 1996; Lagna et al., Nature 383:832, 1996; and Savage et al., PNAS 93:790).
- DAF-3 forms dauer-inducing homodimers in the absence of DAF-7 signaling (Figs. 9A-B) that are disrupted when DAF-3 heterodimerizes with a phosphorylated DAF-8 and/or DAF-14 (Fig. 9B).
- DAF-3/DAF-8 dimers are proposed to have different activity from DAF-3/DAF-14. Perhaps each activates a subset of genes required for dauer formation.
- the formation of DAF-8/DAF-3 and/or DAF- 14/DAF-3 heterodimers antagonizes dauer induction by the DAF-3/DAF-3 homodimer.
- a daf-8(sa233); daf-14 ⁇ m77); daf-3 ⁇ mgDf90) triple mutant can form some dauers in dauer-inducing conditions (data not shown); we suggest that activity of the Daf-2 pathway may induce dauer in this mutant background.
- the dauer genetic pathway represents a neuroendocrine pathway for control of a diapause arrest and its associated shifts in metabolism and rates of senescence (Ren et al., Science 274: 1389, 1996; Schackwitz et al, Neuron 17:719, 1996; and Georgi et al., Cell 61 :635, 1990).
- activins members of the TGF- ⁇ family, were originally identified based on their neuroendocrine regulatory activity, for example, in regulation of gonadotropin signaling (Vale et al., in Peptide Growth Factors and Their Receptors, Sporn and Roberts, Eds., Springer- Verlag, Heidelberg, 1990).
- the DAF-7 signal is not the only signal that is necessary for reproductive development. Because mutations in the DAF- 7 TGF- ⁇ pathway and in the DAF-2 insulin-like signaling pathway cause the same dauer arrest phenotypes, we propose that both the DAF-7 TGF- ⁇ signals and the DAF-2 insulin-like signals are necessary for reproductive development. The involvement of an insulin-like signaling pathway in diapause with its associated metabolic shifts is consistent with metabolic regulation by insulin in vertebrates. Genetic experiments indicate that these pathways act in parallel (Riddle et al., Nature 290:668, 1981 ; Vowels and Thomas, Genetics 130: 105, 1992; and Thomas et al., Genetics 134: 1105, 1993).
- daf-3 mutants efficiently suppress daf-7 mutants, but not daf-2 mutants
- dafl 6 mutants efficiently suppress daf-2 mutants, but poorly suppress daf 7 mutants. It is not yet clear whether these two signaling pathways coverage on target tissues or in other regulatory (e.g., hormone secreting) cells.
- the expression of the DAF-7 receptor pathway genes and the DAF- 16 gene in essentially all target tissues suggests that the TGF- ⁇ and insulin pathways act there, and therefore that integration must occur there.
- Figs. 9A and 9B that the DAF-2 pathway converges on DAF-3/DAF-8DAF-1 Smad signaling to regulate metabolic gene expression in target tissues.
- oligonucleotide probes including degenerate oligonucleotide probes (i.e., a mixture of all possible coding sequences for a given amino acid sequence). These oligonucleotides may be based upon the sequence of either strand of the DNA.
- Exemplary probes or primers for isolating mammalian DAF sequences preferably correspond to conserved blocks of amino acids, for example, conserved DAF motifs.
- Exemplary motifs are as follows:
- DAF-2 tyrosine kinase domain
- DAF-2 ligand binding domain (SEQ ID NO: 34)
- DAF-2 (67 amino acid motif) (SEQ ID NO: 79)
- DAF-2 54 amino acid motif (SEQ ID NO: 80)
- DAF-2 (69 amino acid motif) (SEQ ID NO: 81) 404 KQDSGMASELKDIFANIHTITGYLLVRQSSPFISLNMFRNLRRIEAKSL FRNLYAITVFENPNLKKLFD 472
- DAF-2 52 amino acid motif (SEQ ID NO: 82)
- DAF-2 46 amino acid motif (SEQ ID NO: 83)
- DAF-2 36 amino acid motif (SEQ ID NO: 84)
- DAF-3 (79 amino acid motif) (SEQ ID NO: 85) 819 DSLAKYCCVRVSFCKGFGEAYPER 842
- DAF- 16 (forkhead DNA binding domain) (SEQ ID NO: 37) 727 KKTTTRRNAWGNMSYAELITTAIMASPEKRLTLAQVYEWMVQNVPY FRDKGDSNSSAGW__NSII___NLSLHSRFMRIQNEGAGKSSWWVINPDAKPG MNPRRTRERS 1044
- DAF- 16 (103 amino acid motif) (SEQ ID NO: 54) 242 KKTTTRRNAWGNMSYAELITTAIMASPEKRLTLAQVYEWMVQNVPY FRDKGDSNSSAGWKNSIRHNLSLHSRFMRIQNEGAGKSSWWVINPDAKPG MNPRRTR 344
- DAF- 16 (41 amino acid motif) (SEQ ID NO: 55)
- DAF- 16 (109 amino acid motif) (SEQ ID NO: 56)
- DAF- 16 (98 amino acid motif) (SEQ ID NO: 58)
- mammalian DAF-2, DAF-3, and DAF-16 genes may be isolated from sequence databases (for example, by the use of standard programs such as Pileup).
- sequences may be used to design degenerate oligonucleotide probes to probe large genomic or cDNA libraries directly.
- General methods for designing and preparing such probes are provided, for example, in Ausubel et al., Current Protocols in Molecular Biology, 1996, Wiley & Sons, New York, NY; and Guide to Molecular Cloning Techniques, 1987, S. L. Berger and A. R. Kimmel, eds., Academic Press, New York.
- oligonucleotides are useful for DAF gene isolation, either through their use as probes for hybridizing to DAF complementary sequences or as primers for various polymerase chain reaction (PCR) cloning strategies. If a PCR approach is utilized, the primers are optionally designed to allow cloning of the amplified product into a suitable vector. PCR is particularly useful for screening cDNA libraries from rare tissue types. Hybridization techniques and procedures are well known to those skilled in the art and are described, for example, in Ausubel et al., supra, and Guide to Molecular Cloning Techniques, supra. If desired, a combination of different oligonucleotide probes may be used for the screening of the recombinant DNA library.
- the oligonucleotides are, for example, labelled with 32 P using methods known in the art, and the detectably-labelled oligonucleotides are used to probe filter replicas from a recombinant DNA library.
- Recombinant DNA libraries for example, human cDNA libraries, such as hypothalamus- or pancreas- derived cDNA libraries, particularly for DAF-2 and DAF-7 cDNAs
- high stringency hybridization conditions may be employed; such conditions include hybridization at about 42 °C and about 50% formamide; a first wash at about 65 °C, about 2X SSC, and 1% SDS; followed by a second wash at about 65 °C and about 0.1 % SDS, IX SSC.
- Lower stringency conditions for detecting DAF genes having less sequence identity to the nematode DAF genes described herein include, for example, hybridization at about 42 °C in the absence of formamide; a first wash at about 42°C, about 6X SSC, and about 1% SDS; and a second wash at about 50°C, about 6X SSC, and about 1% SDS.
- DAF-specific oligonucleotides may also be used as primers in PCR cloning strategies.
- PCR methods are well known in the art and are described, for example, in PCR Technology, H.A. Erlich, ed., Stockton Press, London, 1989; PCR Protocols: A Guide to Methods and Applications, M.A. Innis, D.H. Gelfand, J.J. Sninsky, and TJ. White, eds., Academic Press, Inc., New York, 1990; and Ausubel et al., supra.
- sequences corresponding to conserved regions in a DAF sequence are preferred for use in isolating mammalian DAF sequences.
- Such probes may be used to screen cDNA as well as genomic DNA libraries.
- Sequences obtained are then examined (for example, using the Pileup program) to identify those sequences having the highest amino acid sequence identity to the C. elegans sequence, particularly in or between conserved DAF domains (for example, those domains described above).
- the human FKHR and AFX genes are 10 33 more closely related to the DAF- 16 forkhead domain than the next most closely related forkhead domain protein, making FKHR and AFX candidates for mammalian DAF- 16 genes.
- the DAF, AGE, or AKT gene homologue identified as above, may also complement or alter the metabolic phenotypes of a mammalian cell line.
- TGF- ⁇ -like growth factor may accentuate insulin responsiveness.
- genetic transformation of such a cell line with wild type or dominantly activated versions of a DAF, AGE, or AKT gene may alter metabolism.
- Such perturbations of metabolic control are stringent tests of candidate genes as DAF, AGE, or AKT homologues.
- mammalian candidate homologue acts in a metabolic control pathway, and is expressed in similar metabolic control tissues (liver, adipose), it is likely to function homologously to DAF proteins from C. elegans.
- Addition of a wild type or activated DAF, AKT, or AGE protein can confer on cell lines altered metabolic phenotypes.
- VP16 activation of the DAF-3 or DAF- 16 transcription factors can confer on cell lines altered metabolic phenotypes.
- supplying daf, age, or akt gene activity to such a cell line can alter its metabolism. This is one explemplary test of homologous DAF function in metabolic control.
- DAF polypeptides according to the invention may be produced by transformation of a suitable host cell with all or part of DAF- encoding cDNA fragment (e.g., one of the cDNAs described herein or isolated as described above) in a suitable expression vehicle.
- DAF-encoding cDNA fragment e.g., one of the cDNAs described herein or isolated as described above
- the DAF polypeptide may be produced in a prokaryotic host (e.g., R coli) or in a eukaryotic host (e.g., Saccharomyces cerevisiae, insect cells, e.g., Sf9 or Sf21 cells, or mammalian cells, e.g., COS 1, NIH 3T3, or HeLa cells).
- a prokaryotic host e.g., R coli
- a eukaryotic host e.g., Saccharomyces cerevisiae, insect cells, e.g., Sf9 or Sf21 cells, or mammalian cells, e.g., COS 1, NIH 3T3, or HeLa cells.
- Such cells are available from a wide range of sources (e.g., the American Type Culture Collection, Rockland, MD; also, see, e.g., Ausubel et al., supra).
- the method of transformation or transfection and the choice of expression vehicle will depend on the host system selected. Transformation and transfection methods are described, e.g., in Ausubel et al. ⁇ supra); expression vehicles may be chosen from those provided, e.g., in Cloning Vectors: A Laboratory Manual (P.H. Pouwels et al, 1985, Supp. 1987).
- baculovirus system using, for example, Sf9 cells and the method of Ausubel et al, supra.
- Another baculovirus system makes use of the vector pBacPAK9 and is available from Clontech (Palo Alto, CA).
- an DAF polypeptide is produced in a mammalian system, for example, by a stably-transfected mammalian cell line.
- a mammalian cell line A number of vectors suitable for stable transfection of mammalian cells are available to the public, e.g, see Pouwels et al. ⁇ supra); methods for constructing such cell lines are also publicly available, e.g, in Ausubel et al. ⁇ supra).
- cDNA encoding the DAF protein is cloned into an expression vector which includes the dihydrofolate reductase (DHFR) gene.
- DHFR dihydrofolate reductase
- Integration of the plasmid and, therefore, the DAF protein-encoding gene into the host cell chromosome is selected for by inclusion of 0.01-300 ⁇ M methotrexate in the cell culture medium (as described in Ausubel et al, supra). This dominant selection may be accomplished in most cell types. Recombinant protein expression may be increased by DHFR-mediated amplification of the transfected gene. Methods for selecting cell lines bearing gene amplifications are described in Ausubel et al. ⁇ supra); such methods generally involve extended culture in medium containing gradually increasing levels of methotrexate.
- DHFR-containing expression vectors commonly used for this pu ⁇ ose include pCVSEII-DHFR and pAdD26SV(A) (described in Ausubel et al, supra).
- Any of the host cells described above or, preferably, a DHFR-deficient CHO cell line e.g, CHO DHFR " cells, ATCC Accession No. CRL 9096
- a DHFR-deficient CHO cell line e.g, CHO DHFR " cells, ATCC Accession No. CRL 9096
- a DHFR-deficient CHO cell line are among the host cells preferred for DHFR selection of a stably-transfected cell line or DHFR- mediated gene amplification.
- the DAF polypeptide is produced in vivo or, preferably, in vitro using a T7 system (see, for example, Ausubel et al, supra, or other standard techniques).
- DAF protein Once the recombinant DAF protein is expressed, it is isolated, e.g, using affinity chromatography.
- an anti-DAF protein antibody e.g. produced as described herein
- Lysis and fractionation of DAF protein-harboring cells prior to affinity chromatography may be performed by standard methods (see, e.g, Ausubel et al, supra).
- the recombinant protein can, if desired, be further purified, e.g, by high performance liquid chromatography (see, e.g. Fisher, Laboratory Techniques In Biochemistry And Molecular Biology, eds. Work and Burdon, Elsevier, 1980).
- Polypeptides of the invention may also be produced by chemical synthesis (e.g, by the methods described in Solid Phase Peptide Synthesis. 2nd ed, 1984 The Pierce Chemical Co, Rockford, IL).
- anti-DAF antibodies may be produced by any standard technique.
- a DAF cDNA or cDNA fragment encoding a conserved DAF domain is fused to GST, and the fusion protein produced in R coli by standard techniques.
- the fusion protein is then purified on a glutathione column, also by standard techniques, and is used to immunize rabbits.
- the antisera obtained is then itself purified on a GST-DAF affinity column, for example, by the method of Finney and Ruvkun ⁇ Cell 63:895-905, 1990), and is shown to specifically identify GST-DAF, for example, by Western blotting.
- Polypeptides for antibody production may be produced by recombinant or peptide synthetic techniques (see, e.g. Solid Phase Peptide Synthesis, supra; Ausubel et al, supra).
- the peptides may, if desired, be coupled to a carrier protein, such as KLH as described in Ausubel et al, supra.
- KLH- peptide is mixed with Freund's adjuvant and injected into guinea pigs, rats, or preferably rabbits.
- Antibodies may be purified by any method of peptide antigen affinity chromatography.
- monoclonal antibodies may be prepared using a DAF polypeptide (or immunogenic fragment or analog) and standard hybridoma technology (see, e.g, Kohler et al. Nature 256:495. 1975; Kohler et al, Eur. J. Immunol. 6:511 , 1976; Kohler et al, Eur. J. Immunol. 6:292, 1976; Hammerling et al. In Monoclonal Antibodies and T Cell Hybridomas , Elsevier, NY, 1981 ; Ausubel et al, supra).
- polyclonal or monoclonal antibodies are tested for specific DAF recognition by Western blot or immunoprecipitation analysis (by the methods described in Ausubel et al, supra).
- Antibodies which specifically recognize a DAF polypeptide described herein are considered to be useful in the invention.
- Anti-DAF antibodies, as isolated above, may be used, e.g, in an immunoassay to measure or monitor the level of DAF polypeptide produced by a mammal or to screen for compounds which modulate DAF polypeptide production (for example, in the screens described herein).
- antibodies to human DAF-7 polypeptide are useful for screening blood samples from patients to determine whether they possess decreased DAF-7 polypeptide levels.
- Such antibodies may be used in any immunological assay, for example, an ELISA assay, and a decrease in DAF-7 is taken as an indication of a diabetic condition, for example, obesity onset Type II diabetes.
- anti-DAF antibodies are useful for carrying out pedigree analysis. For example, blood samples from individuals may be screened with anti-DAF-7 antibodies to detect those members of a family with a predisposition to a diabetic condition. Anti-DAF antibodies may also be used to identify cells that express a DAF gene.
- DAF-7 represents an endocrine hormone for metabolic control that acts synergistically with insulin. Declines in DAF-7 may be induced by obesity, just as the dauer pheromone, a fatty acid, causes declines in C elegans DAF-7 production.
- diabetes onset Type II diabetes, glucose intolerance, and the associated atherosclerosis may be treated if DAF-7 hormone is injected intramuscularly or intravenously (Fig. 23).
- antibodies to human DAF-7 should detect declines in DAF-7 in pre-diabetic, glucose-intolerant, or obesity induced diabetes. Such antibodies will detect DAF-7 levels in blood, just as insulin levels are detected in metabolic disease.
- DAF-7 therapeutic potential and dosage can be developed in mouse models of obesity onset diabetes, for example, the db and ob mouse.
- DAF- 7 may be injected either intravenously or intramuscularly, in analogy to insulin therapy.
- the decision of which classes of diabetics to treat with DAF-7 will come from a combination of blood tests for DAF-7 levels and genetic testing to determine which daf, age, or akt mutations a particular diabetic or pre-diabetic patient carries.
- the screening methods of the invention involve screening any number of compounds for therapeutically active agents by employing any number of in vitro or in vivo experimental systems. Exemplary methods useful for the identification of such compounds are detailed below.
- the methods of the invention simplify the evaluation, identification, and development of active agents for the treatment and prevention of impaired glucose tolerance conditions, such as diabetes and obesity.
- the screening methods provide a facile means for selecting natural product extracts or compounds of interest from a large population which are further evaluated and condensed to a few active and selective materials. Constituents of this pool are then purified and evaluated in the methods of the invention to determine their anti-diabetic or anti-obesity activities or both.
- novel drugs for the treatment of impaired glucose tolerance conditions are identified from large libraries of both natural product or synthetic (or semi-synthetic) extracts or chemical libraries according to methods known in the art.
- test extracts or compounds are not critical to the screening procedure(s) of the invention. Accordingly, virtually any number of chemical extracts or compounds can be screened using the exemplary methods described herein. Examples of such extracts or compounds include, but are not limited to, plant-, fungal-, prokaryotic- or animal-based extracts, fermentation broths, and synthetic compounds, as well as modification of existing compounds.
- Synthetic compound libraries are commercially available from Brandon Associates (Merrimack, NH) and Aldrich Chemical (Milwaukee, WI).
- libraries of natural compounds in the form of bacterial, fungal, plant, and animal extracts are commercially available from a number of sources, including Biotics (Sussex, UK), Xenova (Slough, UK), Harbor Branch Oceangraphics Institute (Ft. Pierce, FL), and PharmaMar, U.S.A. (Cambridge, MA).
- natural and synthetically produced libraries are produced, if desired, according to methods known in the art, e.g, by standard extraction and fractionation methods.
- any library or compound is readily modified using standard chemical, physical, or biochemical methods.
- the goal of the extraction, fractionation, and purification process is the careful characterization and identification of a chemical entity within the crude extract having anti-diabetic or anti-obesity activities.
- the same in vivo and in vitro assays described herein for the detection of activities in mixtures of compounds can be used to purify the active component and to test derivatives thereof. Methods of fractionation and purification of such heterogenous extracts are known in the art. If desired, compounds shown to be useful agents for the treatment of pathogenicity are chemically modified according to methods known in the art. Compounds identified as being of therapeutic value are subsequently analyzed using any standard animal model of diabetes or obesity known in the art.
- C. elegans mutant dauer larvae e.g, C. elegans containing mutations described herein, such as C. elegans daf-2 mutant dauer larvae
- C. elegans daf-2 mutant dauer larvae are cultured in wells of a microtiter plate, facilitating the semiautomation of manipulations and full automation of data collection.
- compounds that down regulate DAF-3 or DAF- 16 activities or up regulate DAF-1, DAF-2, DAF-4, DAF-7, DAF-8, DAF-11 , DAF- 14, AGE-1, or AKT activities are considered useful in the invention.
- Such compounds are identified by their effect on dauer formation in C.
- elegans strains carrying mutations in these genes carrying mutations in these genes (as described above).
- nematodes bearing mutations in the DAF-2 polypeptide arrest as dauer larvae, never producing progeny. All of the metabolic and growth arrest phenotypes caused by lack of daf-2 are suppressed by mutations in dafl 6.
- Mutations in the PI 3-kinase, AGE-1 have the same phenotype as lack of daf-2, and such mutations are also suppressed by daf- 16 mutations.
- Biochemical analysis of insulin signaling in mammals supports the view that AGE-1 transduces signals from the DAF-2 receptor by generating a PIP3 signal.
- dafl 6 mutations suppress lack of daf- 2, or age-1 gene activity, it is believed that PIP3 down regulates or modifies daf 16 gene activity.
- the biochemical overlap between DAF-2/AGE-1 and insulin receptors/PI 3-kinase indicates that the human homolog of the C. elegans daf- 16 gene acts in the insulin pathway as well.
- the C. elegans insulin signaling pathway yields the su ⁇ rising result that the animals can live without insulin signaling, provided they are mutant in dafl 6.
- This analysis therefore indicates that a compound that inhibits DAF- 16 activity would reverse the effects of diabetic lesions, e.g, in the production or secretion of insulin or in the reception of insulin signals by target tissues.
- Such drugs would be expected to be efficacious in the treatment of insulin deficiencies due to pancreatic ⁇ cell destruction in Type I diabetes, as well as some Type II diabetes due to defects in insulin signaling.
- mutant daf-2 (el 370); dafl 6 (mgDf50) animals carrying an integrated human DAF- 16 gene are incubated in microtiter dishes in the presence of a test compound.
- This human DAF- 16 gene supplies all of the DAF- 16 activity in the C. elegans strain and thus allows daf 2-induce ⁇ dauer arrest unless its activity is decreased by the candidate test compound.
- various concentrations of the test compound or extract can be inoculated to assess the dosage effect. Control wells are incubated in the absence of a test compound or extract. Plates are then incubated at 25 °C.
- test compound or extract After an appropriate period of time, e.g, 2 to 5 days, wells are examined for progeny. The presence of progeny is taken as an indication that the test compound or extract is effective at inhibiting daf- 3 or daf- 16 activity, and therefore is considered useful in the invention. Any compound that inhibits DAF- 16 gene activity (or activates upstream signaling in the absence of receptor function) will allow reproduction. This is shown schematically in Fig. 19.
- a diabetic condition may arise from defects in the DAF-7 TGF- ⁇ signaling pathway.
- drugs that down regulate DAF-3 activity are useful for ameliorating the metabolic defects associated with diabetes.
- daf- 7 el 372
- daf-3 mg90
- nematodes expressing human DAF-3 are exposed to chemicals as described above.
- human DAF-3 supplies all DAF-3 activity, causing daf- 7 induced dauer arrest unless its activity is inhibited (Fig. 20).
- Compounds capable of inhibiting this activity are considered useful therapeutics in the invention.
- daf- 7 or daf-2 mutants are directly screened for compounds that decrease C. elegans daf- 3 or daf- 16 gene activity.
- C elegans worms carrying other ⁇ mutations may be utilized in an assay to obtain additional information on the mode of action of the test compound in the insulin or TGF- ⁇ signaling pathways.
- a drug having PIP3 agonist activity would be expected to allow age-1 and daf-2 mutants (but not akt or daf 7 mutants) to not arrest at the dauer stage.
- drugs that inhibit daf-3 are expected to suppress daf 7 mutants but not daf-2 or age-1 mutants.
- Other drug screening assays may also be performed using either C. elegans worms or mammalian cell cultures. If desired, such assays may include the use of reporter gene constructs.
- C. elegans strains expressing particular human homologs of the daf, age, or akt genes represent useful screening methods.
- Expression of the human homologs in C. elegans is accomplished according to standard methods and, if desired, such genes may be operatively linked to a gene promoter obtained from C. elegans.
- promoters include, without limitation, the C. elegans dafl 6, age-1, daf- 3, daf-4, and akt gene promoters.
- the 2.5 kb age-1 promoter can be generated and isolated by employing standard PCR methods using the following primers:
- mammalian tissue culture cells expressing C elegans daf, age-1, or akt homologs may be used to evaluate the ability of a test compound or extract to modulate the insulin or TGF- ⁇ signaling pathways. Because the signaling pathways from the ligands, receptors, kinase cascades, and downstream transcription factors are conserved from man to worm, test compounds or extracts that inhibit or activate the worm signaling proteins should also inhibit or activate their respective human homolog. For example, our identification that DAF- 16 is a transcription factor that acts downstream of insulin-like signaling in C. elegans indicates that human DAF- 16 transcription reporter genes also can be used to identify drugs that inhibit any of the kinases in the signaling pathway downstream of insulin signaling.
- DAF- 16 and DAF-3 protein binding sites may be used to monitor insulin signaling.
- Candidate compounds mimicking insulin signaling e.g, PIP3 agonists are expected to increase reporter gene expression and are considered useful in the invention.
- the invention involves the use of a reporter gene that is expressed under the control of a C. elegans gene promoter, e.g, a promoter that includes the TCTCGTTGTTTGCCGTCGGATGTCTGCC (SEQ ID NO: 51) enhancer element, such as the C. elegans pharyngeal myosin promoter (Okkema and Fire, Development 120: 2175-2186, 1994).
- a C. elegans gene promoter e.g, a promoter that includes the TCTCGTTGTTTGCCGTCGGATGTCTGCC (SEQ ID NO: 51) enhancer element, such as the C. elegans pharyngeal myosin promoter (Okkema and Fire, Development 120: 2175-2186, 1994).
- This enhancer element is known to respond to DAF-3 regulation (i.e., in daf- 7 mutants, where daf 3 is active, the element confers low level expression to reporter genes; whereas in a daf 7; daf- 3 mutant (for example, daf-7 (el 372); daf 3), the element confers low level expression to reporter genes).
- Other equivalent enhancer elements may also be used in the invention, e.g, the enhancer element which is bound by the Xenop us Smadl and Fasti forkhead proteins ⁇ Nature 383 600-608, 1996).
- the enhancer element is cloned upstream of any standard reporter gene, e.g, the luciferase or green fluorescent protein (GFP) reporter genes.
- the GFP reporter gene is used in C elegans.
- either the GFP or the luciferase reporter genes may used in a mammalian cell based assay.
- the reporter gene construct is subsequently introduced into an appropriate host (e.g, C. elegans or a mammalian cell) according to any standard method known in the art. Analysis of reporter gene activity in the host organism or cell is determined according to any standard method, e.g, those methods described herein. Such reporter gene (and host cell systems) are useful for screening for drugs that modulate insulin or DAF-7 metabolic control signaling.
- C. elegans C. elegans
- the above-described reporter gene construct is introduced into wild-type C. elegans according to standard methods known in the art. If the enhancer element is operational, then it is expected that reporter gene expression is turned on. Alternatively, in daf mutants (e.g, daf 7 or daf-2 mutants, where insulin signaling is defective) carrying the above-described reporter gene construct, reporter gene activity is turned off.
- daf mutants e.g, daf 7 or daf-2 mutants, where insulin signaling is defective
- test compounds or extracts are evaluated for the ability to disrupt the signaling pathways described herein.
- daf-2 mutant worms carrying the reporter gene construct are used to assay the expression of the reporter gene. The majority of worms expressing the reporter gene will arrest at the dauer stage because of the daf-2 phenotype. If however the test compound or extract inhibits DAF- 16 activity, then the worms will exhibit a daf-2; daf 16 phenotype (i.e., do not arrest), developing to produce eggs.
- Such eggs are selected using a bleach treatment and reporter gene expression in the test compound or extract is assayed according to standard methods, e.g, worms are examined with an automated fluorometer to reveal the presence of reporter gene expression, e.g, GFP.
- reporter gene expression e.g, GFP.
- Candidate compounds that suppress the daf-2 phenotype or turn on reporter gene expression, i.e., activate signals in the absence of DAF-2 receptor (e.g, PIP3 mimetics) or inactivate DAF- 16, are considered useful in the invention.
- Analogous screens may also be performed using daf- 7 mutants as a means to identify drugs that inactivate other dafgenes, such as DAF-3, or compounds that activate the DAF-l/DAF-4 receptors.
- daf- 7 mutants such as DAF-3, or compounds that activate the DAF-l/DAF-4 receptors.
- Such screens may be coupled to reporter screens, for example, using GFP reporter genes whose expression is under DAF-3 transcriptional control (e.g, the myoll element). Drugs identified in such screens are useful as DAF-7 mimetics. Because DAF-7 expression may be down regulated in obesity, such drugs are useful in the treatment of obesity induced Type II diabetes
- C. elegans DAF-3 and DAF- 16 genes can be replaced with a human homolog, (e.g, FKHR for DAF- 16), and screens similar to those described above performed in the nematode system. Because drugs may act upstream of the transcription factors, it is useful to replace DAF-1 , DAF-4, DAF-8,DAF-14, DAF-2, DAF-3, DAF- 16, or AGE-1 with the appropriate human homolog, and to screen the humanized C. elegans animals. Such screens are useful for identifying compounds having activities in humans.
- a human homolog e.g, FKHR for DAF- 16
- Mammalian insulin-responsive cell lines are also useful in the screening methods of the invention.
- reporter gene constructs (for example, those described above) are introduced into the cell line to evaluate the ability of a test compound or extract to modulate insulin and TGF- ⁇ signaling pathways using a second construct expressing a C elegans daf, age, or akt gene or their corresponding human homologs.
- Exemplary cell lines include, but are not limited to, mouse 3T3, L6 ,and LI cells (MacDougald et al, Ann. Rev. Biochem. 64: 345-373, 1995) Introduction of the constructs into such cell lines is carried out according to standard methods well known in the art.
- reporter gene expression is monitored.
- Compounds that induce reporter gene expression in the absense of insulin or DAF-7 signaling are considered useful in the invention. Such compounds may also turn the cells into adipocytes, as insulin does.
- test compounds identified in mammalian cells may be tested in other screening assays described herein, and, in general, test compounds may be assayed in multiple screens to confirm involvement in insulin or DAF-7 signaling.
- Metabolic control by DAF-7 protein may be tested using any known cell line, e.g, those described herein.
- test compounds are screened for the ability to activate the phosphorylation of Smad proteins, DAF- 8, DAF- 14, or
- DAF-3 by DAF-1 or DAF-4 in vitro.
- DAF-8, DAF- 14, or DAF-3 is preferably tagged with a heterologous protein domain, for example, the myc epitope tag domain(s) by the method of Ausubel et al, and are incubated with the C-terminal kinase domain of DAF- 1 or DAF-4.
- Phosphorylation of the Smad proteins is preferably detected by immunoprecipitation using antibodies specific to the tag, followed by scintillation counting.
- Test compounds may be screened in high throughout microtiter plate assays. A test compound that effectively stimulates the phosphorylation of DAF-8, DAF- 14, or DAF-3 is considered useful in the invention. Using these same general assays, compounds that activate the phosphorylation of DAF- 16 by AKT or GSK-3 may also be identified.
- test compounds are screened for the ability to inhibit the in vitro association of DAF- 16 and the Smad proteins DAF-3, or preferentially activates the association of DAF- 16 with DAF-8 and DAF- 14, DAF-8, or DAF- 14, or to inhibit the association of DAF-3 and DAF- 16 with DNA in vitro.
- assays are carried out by any standard biochemical methods that test protein-protein binding or protein-DNA binding.
- each protein is tagged with a different heterologous protein domain (as described above). Immunoprecipitations are carried out using an antibody to one tag, and an ELISA assay is carried out on the immunoprecipitation complex to test for the presence of the second tag.
- this protein is also preferably included in the reaction mixture.
- antibodies to the tag are utilized in immunoprecipitations, and the presence of the DNA detected by the presence of the DNA label in the immunoprecipitation complex.
- a test compound that effectively inhibits the association between these proteins or between DAF-3 and DAF- 16 with DNA or both is considered useful in the invention.
- test derivatives of PIP3 are screened for the ability to increase in vitro AKT activity. This is accomplished, in general, by combining a labeled PIP3 and an AKT polypeptide in the presence and absence of the test compound under conditions that allow PIP3:AKT to bind in vitro. Compounds are then identified that interfere with the formation of the PIP3:AKT complex. Test compounds that pass this first screen may then be tested for increased AKT activation in vitro using GSK3 targets, or may be tested in nematodes or mammalian cells (as described above). An increase in AKT kinase activity is taken as an indication of a compound useful for ameliorating or delaying an impaired glucose tolerance condition.
- DAF-3 or DAF- 16 may be expressed in a yeast one-hybrid assay for transcriptional activation. Methods for such assays are described in Brent and Ptashne ⁇ Cell 43:729-736, 1985). A test compound that blocks the ability of DAF-3 or DAF- 16 or both to activate (or repress) transcription in this system is considered useful in the invention.
- compounds may be screened for their ability to inhibit an interaction between any of DAF-3, DAF-8, and DAF-14, or between DAF-3 and DAF- 16.
- in vivo assays may be carried out by any "two-hybrid” or “interaction trap” method (for example, by using the methods described by Vijaychander et al ⁇ Biotechniques 20: 564-568)).
- useful therapeutic compounds include those which down regulate the expression or activity of DAF-3 or DAF- 16.
- DAF-3 or DAF- 16 expression is measured following the addition of candidate antagonist molecules to a culture medium of DAF-3 or DAF- 16- expressing cells.
- the candidate antagonists may be directly administered to animals (for example, nematodes or mice) and used to screen for their effects on DAF-3 or DAF- 16 expression.
- DAF-3 or DAF- 16 expression is measured, for example, by standard Northern blot analysis (Ausubel et al, supra) using a DAF-3 or DAF- 16 nucleic acid sequence (or fragment thereof) as a hybridization probe.
- the level of DAF-3 or DAF- 16 expression in the presence of the candidate molecule is compared to the level measured for the same cells, in the same culture medium, or in a parallel set of test animals, but in the absence of the candidate molecule.
- Preferred modulators for anti-diabetic or anti-obesity pu ⁇ oses are those which cause a decrease in DAF-3 or DAF- 16 expression.
- the effect of candidate modulators on expression or activity may be measured at the level of DAF-3 or DAF- 16 protein production using the same general approach in combination with standard immunological detection techniques, such as Western blotting or immunoprecipitation with a DAF-3 or DAF-16-specific antibody (for example, the DAF-3 or DAF- 16 antibodies described herein).
- useful anti-diabetic or anti-obesity therapeutic modulators are identified as those which produce a decrease in DAF-3 or DAF- 16 polypeptide production.
- Antagonists may also affect DAF- 3 or DAF- 16 activity without any effect on expression level.
- kinase cascades upstream of DAF-3 and DAF- 16 suggest that the phosphorylation state of these polypeptides is correlated with activity. Phosphorylation state may be monitored by standard Western blotting using antibodies specific for phosphorylated amino acids.
- reporter genes bearing operably linked DAF-3 or DAF- 16 binding sites may be used to directly monitor the effects of antagonists on DAF-3 or DAF- 16 gene activity.
- Candidate modulators may be purified (or substantially purified) molecules or may be one component of a mixture of compounds (e.g, an extract or supernatant obtained from cells).
- DAF- 3 or DAF- 16 expression is tested against progressively smaller subsets of the candidate compound pool (e.g, produced by standard purification techniques, e.g, HPLC or FPLC; Ausubel et al, supra) until a single compound or minimal compound mixture is demonstrated to modulate DAF-3 or DAF- 16 expression.
- Candidate DAF-3 or DAF- 16 antagonists include peptide as well as non- peptide molecules (e.g, peptide or non-peptide molecules found, e.g, in a cell extract, mammalian serum, or growth medium on which mammalian cells have been cultured).
- non- peptide molecules e.g, peptide or non-peptide molecules found, e.g, in a cell extract, mammalian serum, or growth medium on which mammalian cells have been cultured.
- Antagonists found to be effective at the level of cellular DAF-3 or DAF- 16 expression or activity may be confirmed as useful in animal models (for example, nematodes or mice).
- the compound may ameliorate the glucose intolerance and diabetic symptoms of mouse models for Type II diabetes (e.g, a db mouse model), mouse models for Type I diabetes, or models of streptozocin- induced ⁇ cell destruction.
- a molecule which promotes a decrease in DAF-3 or DAF- 16 expression or DAF-3 or DAF- 16 activity is considered particularly useful in the invention; such a molecule may be used, for example, as a therapeutic to decrease the level or activity of native, cellular DAF-3 or DAF-16 and thereby treat a glucose intolerance condition in an animal (for example, a human).
- treatment with an antagonist of the invention may be combined with any other anti-diabetic or anti-obesity therapies.
- useful therapeutic compounds are those which up regulate the expression or activity of DAF- 1, DAF-2, DAF-4, DAF-7, DAF- 8, DAF-11, DAF-14, AGE-1, or AKT.
- expression of these genes is measured following the addition of candidate agonist molecules to a culture medium of DAF- 1, DAF-2, DAF-4, DAF-7, DAF-8, DAF-11, DAF- 14, AGE-1, or AKT-expressing cells.
- the candidate agonists may be directly administered to animals (for example, nematodes or mice) and used to screen for effects on DAF-1, DAF-2, DAF-4, DAF-7, DAF-8, DAF-11, DAF- 14, AGE-1, or AKT expression.
- DAF-1, DAF-2, DAF-4, DAF-7, DAF-8, DAF-11, DAF-14, AGE-1, or AKT-expression is measured, for example, by standard Northern blot analysis (Ausubel et al, supra) using all or a portion of one of these genes as a hybridization probe.
- the level of DAF-1, DAF-2, DAF-4, DAF-7, DAF-8, DAF- 11 , DAF- 14, AGE- 1 , or AKT expression in the presence of the candidate molecule is compared to the level measured for the same cells, in the same culture medium, or in a parallel set of test animals, but in the absence of the candidate molecule.
- Preferred modulators for anti-diabetic or anti-obesity pu ⁇ oses are those which cause an increase in DAF-1, DAF-2, DAF-4, DAF-7, DAF-8, DAF-11, DAF- 14, AGE-1, or AKT expression.
- the effect of candidate modulators on expression may be measured at the level of DAF-1 , DAF-2, DAF-4, DAF-7, DAF-8, DAF-11, DAF- 14, AGE-1, or AKT protein production using the same general approach in combination with standard immunological detection techniques, such as Western blotting or immunoprecipitation with an appropriate antibody. Again, the phosphorylation state of these polypeptides is indicative of DAF activity and may be measured on Western blots.
- Useful anti-diabetic or anti-obesity modulators are identified as those which produce an increase in DAF-1, DAF- 2, DAF-4, DAF-7, DAF-8, DAF-11, DAF-14, AGE-1, or AKT polypeptide production.
- Candidate modulators may be purified (or substantially purified) molecules or may be one component of a mixture of compounds (e.g, an extract or supernatant obtained from cells).
- DAF- 1, DAF-2, DAF-4, DAF-7, DAF-8, DAF-11, DAF-14, AGE-1, or AKT expression is tested against progressively smaller subsets of the candidate compound pool (e.g, produced by standard purification techniques, e.g, HPLC or FPLC; Ausubel et al, supra) until a single compound or minimal compound mixture is demonstrated to modulate DAF-1, DAF-2, DAF-4, DAF-7, DAF-8, DAF-11, DAF- 14, AGE-1, or AKT expression.
- candidate compounds may be screened for those which agonize native or recombinant DAF-1, DAF-2, DAF-4, DAF-7, DAF-8, DAF-11, DAF-14, AGE-1, or AKT activities.
- DAF-1 and DAF-4 phosphorylation of DAF-8 and DAF-14, or AKT phosphorylation of DAF- 16 may be activated by agonists.
- Candidate DAF-1, DAF-2, DAF-4, DAF-7, DAF-8, DAF-11, DAF-14, AGE-1, or AKT agonists include peptide as well as non-peptide molecules (e.g, peptide or non-peptide molecules found, e.g, in a cell extract, mammalian serum, or growth medium on which mammalian cells have been cultured).
- non-peptide molecules e.g, peptide or non-peptide molecules found, e.g, in a cell extract, mammalian serum, or growth medium on which mammalian cells have been cultured.
- Agonists found to be effective at the level of cellular DAF-1, DAF-2, DAF-4, DAF-7, DAF-8, DAF-11, DAF-14, AGE-1, or AKT expression or activity may be confirmed as useful in animal models (for example, nematodes or mice).
- a molecule which promotes an increase in DAF-1, DAF-2, DAF-4, DAF-7, DAF-8, DAF-11, DAF- 14, AGE-1, or AKT expression or DAF-1, DAF-2, DAF-4, DAF-7, DAF-8, DAF-11, DAF- 14, AGE-1, or AKT activities is considered particularly useful in the invention; such a molecule may be used, for example, as a therapeutic to increase the level or activity of these native, cellular genes and thereby treat a glucose intolerance condition.
- treatment with an DAF-1, DAF-2, DAF-4, DAF-7, DAF-8, DAF-11, DAF- 14, AGE-1, or AKT agonist may be combined with any other anti-diabetic or anti-obesity therapies.
- Compounds identified as having activity in any of the above-described assays are subsequently screened in any number of available diabetic or obesity animal model systems, including, but not limited to ob (Coleman, Dibetologia 14: 141-148, 1978; Chua et al. Science 21 : 994-996, 1996; Vaisse et al. Nature Genet. 14:95-100, 1996), db (Chen et al. Cell 84: 491-495, 1996), agouti mice, or fatty rats (Takaga et al. Biochem. Biophys. Res. Comm. 225: 75-83, 1996). Test compounds are administered to these animals according to standard methods.
- test compounds may be tested in mice bearing knockout mutations in the insulin receptor, IGF-1 receptor (e.g, Liu et al. Cell 75:59-72, 1993), IR-related receptor, DAF-7 homolog, or any of the daf (FKHR, AFX) genes described herein.
- Compounds can also be tested using any standard mouse or rat model of Type I diabetes, e.g, a streptozin ablated pancreas model.
- the invention involves the administration of DAF-7 or its homolog as a method for treating diabetes or obesity. Evaluation of the effectiveness of such a compound is accomplished using any standard animal model, for example, the animal diabetic model systems described above. Because these mouse diabetic models are also associated with obesity, they provide preferred models for human obesity associated Type II diabetes as well. Such diabetic or obese mice are administered C. elegans or human DAF- 7 according to standard methods well known in the art. Treated and untreated controls are then monitored for the ability of the compound to ameliorate the symptoms of the disease, e.g, by monitoring blood glucose, ketoacidosis, and atherosclerosis. Normalization of blood glucose and insulin levels is taken as an indication that the compound is effective at treating a glucose intolerance condition.
- Compounds of the invention may be administered with a pharmaceutically - acceptable diluent, carrier, or excipient, in unit dosage form.
- a pharmaceutically - acceptable diluent, carrier, or excipient Conventional pharmaceutical practice may be employed to provide suitable formulations or compositions to administer such compositions to patients.
- intravenous administration is preferred, any appropriate route of administration may be employed, for example, parenteral, subcutaneous, intramuscular, intracranial, intraorbital, ophthalmic, intraventricular, intracapsular, intraspinal, intracisternal, intraperitoneal, intranasal, aerosol, or oral administration.
- Therapeutic formulations may be in the form of liquid solutions or suspensions; for oral administration, formulations may be in the form of tablets or capsules; and for intranasal formulations, in the form of powders, nasal drops, or aerosols.
- Formulations for parenteral administration may, for example, contain excipients, sterile water, or saline, polyalkylene glycols such as polyethylene glycol, oils of vegetable origin, or hydrogenated napthalenes.
- Biocompatible, biodegradable lactide polymer, lactide/glycolide copolymer, or polyoxyethylene-polyoxypropylene copolymers may be used to control the release of the compounds.
- Other potentially useful parenteral delivery systems for antagonists or agonists of the invention include ethylene-vinyl acetate copolymer particles, osmotic pumps, implantable infusion systems, and liposomes.
- Formulations for inhalation may contain excipients, for example, lactose, or may be aqueous solutions containing, for example, polyoxyethylene-9-lauryl ether, glycocholate and deoxycholate, or may be oily solutions for administration in the form of nasal drops, or as a gel.
- DAF polypeptides are administered at any appropriate concentration, for example, for DAF-7, at a concentration of around lOnM.
- DAF polypeptides are involved in glucose metabolism enables assays for genetic testing to identify those individuals with predispositions toward the development of glucose intolerance conditions, such as diabetes or obesity, by determining the presence of a mutation found in a human gene having identity to any of the C. elegans daf-1, daf-2, daf-3, daf-4, daf 7, daf-8, daf 11, daf-14, daf-16, age-1, or akt genes.
- the development of this testing method requires that the individual be a member of a family that has multiple affected and unaffected members carrying one mutation from the list of above-listed genes.
- a diabetic or obesity phenotype may be produced by daf, age, or akt mutations found on different chromosomes, and that low resolution genetic mapping of the diabetic condition in single family pedigrees will be sufficient to favor some daf, age, or akt genes over others as causing the glucose intolerance condition in a particular pedigree.
- mutations associated with glucose intolerance may be found in different genes in, for example, the DAF-7 signaling pathway in each pedigree.
- mutations in a common pathway can show complex genetic interactions, multiple DAF mutations may segregate in single pedigress. These mutations can behave recessively in some genetic backgrounds and dominantly in others.
- chromosomal marker it may be necessary to evaluate the association of inheritance patterns of several different chromosomal markers (for example, from the collection of highly polymo ⁇ hic mapped DNA allelic variants) in the genomic DNAs of family members and of the clinically affected individuals. Methods commonly used in determining segregation patterns of human genetic diseases are well known in the art. In addition, methods are known in the art for determining whether individuals in a family are useful for providing information to determine co-segregation of an allele with a glucose intolerance trait.
- fragments of genomic DNA are prepared from each of the available members of the family, and each distinctive DNA allelic variant of the polymo ⁇ hic chromosome marker within the family is evaluated to determine which polymo ⁇ hisms (i.e., chromosomal region) is linked with the glucose intolerance phenotype within a particular family.
- the parents of the marker be heterozyous for a DNA allelic variant so that the segregation pattern of the DNA allelic variant linked with the diabetic or obese phenotype in the marker can be recognized.
- the inheritance of the diabetic phenotype can be judged to be dominant or recessive, depending on the pattern of inheritance. Most diabetes is dominantly inherited, and therefore inbred pedigrees are generally not necessary in the etiology of the diabetic condition.
- Type II diabetes With respect to Type II diabetes, the highest rate of this kind of diabetes in the world is found in American Indians of the Pima tribe. Such families are useful for mapping one particular cause of diabetes, but, in general, diabetes is caused by mutations in a variety of genes, including daf ' genes. Thus, by testing for low resolution linkage to a candidate daf, age, or akt mutation, and then by sequencing the particular linked daf gene in affected and unaffected individuals, a particular daf mutation can be associated with a particular diabetic pedigree.
- Human DAF homologues are mapped to chromosome regions using standard methods.
- the probable DAF- 16 homologue FKHR is located on chromosome 13
- AFX is located on the X chromosome.
- Any daf, akt, or age genes mapping to the approximate chromosomal regions associated with diabetes or glucose intolerance are sequenced from affected and unaffected individuals.
- Preferably, at least two genes per pedigree of 5-20 affected (and unaffected controls) are sequenced.
- the daf genomic regions are PCR amplified and compared between affected and unaffected DNA samples. Mutations detected in affected individuals are expected to (but need not) map to conserved domains of the DAF genes.
- a risk factor may be calculated for an individual in an age, akt, or daf chromosome family in a manner similar to those described for assessing the risk of other commonly known genetic diseases that are known to run in families, e.g, Huntington's disease and cystic fibrosis.
- daf, akt, or age genes are associated with diabetes in a pedigree analysis
- diagnostic PCR sequencing of these daf genes can be used to diagnose glucose intolerant, prediabetic, diabetic, obesity, and atherosclerotic conditions.
- the daf, akt, or age gene regions are PCR amplified from patients and mutations detected in the daf ' genes using standard DNA sequencing or oligonucleotide hybridization techniques.
- the use of such gene sequences or specific antibody probes to the products of these sequences provide valuable diagnostics, particularly in view of the likelihood there exist two classes of type II diabetics: those with defects in the TGF- ⁇ signaling genes, and those with defects in insulin signaling genes.
- Such genetic tests will influence whether drugs that affect DAF-7 TGF- ⁇ or DAF-2 insulin like signals are prescribed.
- mammalian homologs corresponding to the C. elegans dafl, age-1, daf-4, daf-8, and daf- 7 genes are isolated as described above for daf-2, daf 3, and dafl 6.
- standard hybridization or PCR cloning strategies are employed, preferably utilizing conserved DAF, AGE, or AKT motifs for probe design followed by comparison of less conserved sequences flanking these motifs.
- Exemplary motifs for these genes are as follows:
- DAF-1 (139 amino acid motif) (SEQ ID NO: 13)
- DAF-1 (62 amino acid motif) (SEQ ID NO: 14)
- DAF-1 (31 amino acid motif) (SEQ ID NO: 15)
- DAF-1 72 amino acid motif (SEQ ID NO: 16) 520 IPYIEWTDRDPQDAQMFDVVCTRRLRPTENPLWKDHPEMKHIMEII KTCWNGNPSARFTS YICRKRMDERQQ 591
- AKT 121 amino acid motif (SEQ ID NO: 60)
- AKT 66 amino acid motif (SEQ ID NO: 61)
- AKT 45 amino acid motif (SEQ ID NO: 62)
- AKT 57 amino acid motif (SEQ ID NO: 63) 32667
- AKT (59 amino acid motif) (SEQ ID NO: 64) 31846
- AKT 33 amino acid motif (SEQ ID NO: 65)
- AKT 21 amino acid motif
- SEQ ID NO: 66 amino acid motif
- AKT 26 amino acid motif (SEQ ID NO: 67)
- DAF-4 (61 amino acid motif) (SEQ ID NO: 21)
- DAF-8 (163 amino acid motif) (SEQ ID NO: 23)
- DAF-8 44 amino acid motif (SEQ ID NO: 24)
- DAF- 8 (38 amino acid motif) (SEQ ID NO: 25)
- DAF- 14 (39 amino acid motif) (SEQ ID NO: 68)
- DAF- 14 (45 amino acid motif) (SEQ ID NO: 69) 9409 SRNSKSSQIRNTVGAGIQLAYENGELWLTVLTDQIVFVQCPFLNQ
- DAF- 14 (29 amino acid motif) (SEQ ID NO: 70)
- DAF- 14 (29 amino acid motif) (SEQ ID NO: 71)
- DAF- 12 (105 amino acid motif) (SEQ ID NO: 72)
- DAF- 12 (73 amino acid motif) (SEQ ID NO: 74)
- DAF- 11 (15 amino acid motif) (SEQ ID NO: 78) 618 DMYSFGVILHEIILK 632
- DAF-7 60 amino acid motif (SEQ ID NO: 26)
- DAF-7 43 amino acid motif (SEQ ID NO: 28) 240 VCNAEAQSKGCCLYDLEIEFEKIGWDWIVAPPRYNAYMCRGDC
- DAF-7 70 amino acid motif (SEQ ID NO: 29)
- DAF-7 35 amino acid motif
- SEQ ID NO: 30 250
- mammalian DAF-7 may be identified using the sub-domain amino acids 314-323.
- exemplary degenerate oligonucleotides designed to PCR amplify this domain or hybridize are as follows:
- aa 263 oligo GGNTGGGAYTRNRTNRTNGCNCC (23-mer, 16,000- fold degeneracy) (SEQ ID NO: 31)
- aa 314 oligo TGYTGYNNNCCNACNGAR (18-mer, 8000-fold degeneracy) (SEQ ID NO: 32).
- the DNA sequence between the oligonucleotide probes is determined, and those sequences having the highest degree of homology are selected. Once isolated, these sequences are then tested in a C. elegans daf- 7 mutant or mouse model as described above for the ability to functionally complement the mutation or ameliorate the glucose intolerance phenotype.
- the invention includes any protein which possesses the requisite level of amino acid sequence identity (as defined herein) to DAF-2, DAF-3, or a DAF- 16 sequence; such homologs include other substantially pure naturally-occurring mammalian DAF polypeptides (for example, human DAF polypeptides) as well as allelic variants; natural mutants; induced mutants; proteins encoded by DNA that hybridizes to the DAF DNA sequence or degenerate conserved domains of DAF proteins (e.g, those described herein) under high stringency conditions; and proteins specifically bound by antisera directed to a DAF-2, DAF-3, or DAF- 16 polypeptide.
- mammalian DAF polypeptides for example, human DAF polypeptides
- allelic variants for example, human DAF polypeptides
- natural mutants for example, induced mutants
- the invention further includes analogs of any naturally-occurring DAF- 2, DAF-3, or DAF-16 polypeptides.
- Analogs can differ from the naturally- occurring protein by amino acid sequence differences which do not destroy function, by post-translational modifications, or by both. Modifications include in vivo and in vitro chemical derivatization of polypeptides, e.g, acetylation, carboxylation, phosphorylation, or glycosylation; such modifications may occur during polypeptide synthesis or processing or following treatment with isolated modifying enzymes.
- Analogs can also differ from the naturally- occurring DAF polypeptide by alterations in primary sequence.
- the invention also includes DAF- 2, DAF-3, and DAF- 16 polypeptide fragments.
- fragment means at least 20 contiguous amino acids, preferably at least 30 contiguous amino acids, more preferably at least 50 contiguous amino acids, and most preferably at least 60 to 80 or more contiguous amino acids. Fragments of such DAF polypeptides can be generated by methods known to those skilled in the art or may result from normal protein processing (e.g, removal of amino acids from the nascent polypeptide that are not required for biological activity or removal of amino acids by alternative mRNA splicing or alternative protein processing events).
- DAF-2, DAF-3, or DAF- 16 polypeptide sequence may be fused to another protein (for example, by recombinant means).
- the DAF polypeptide may be fused to the green fluorescent protein, GFP (Chalfie et al. Science 263:802-805, 1994).
- GFP green fluorescent protein
- Such a fusion protein is useful, for example, for monitoring the expression level of the DAF polypeptide in vivo (for example, by fluorescence microscopy) following treatment with candidate or known DAF agonists or antagonists.
- the methods of the invention may be used to diagnose or treat any condition related to glucose intolerance or obesity in any mammal, for example, humans, domestic pets, or livestock. Where a non-human mammal is diagnosed or treated, the DAF polypeptide, nucleic acid, or antibody employed is preferably specific for that species.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Biomedical Technology (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Biotechnology (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Diabetes (AREA)
- Immunology (AREA)
- Biochemistry (AREA)
- Hematology (AREA)
- Animal Behavior & Ethology (AREA)
- Toxicology (AREA)
- Cell Biology (AREA)
- Veterinary Medicine (AREA)
- Wood Science & Technology (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Urology & Nephrology (AREA)
- Gastroenterology & Hepatology (AREA)
- Public Health (AREA)
- General Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pathology (AREA)
- General Chemical & Material Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Obesity (AREA)
- Endocrinology (AREA)
- Physics & Mathematics (AREA)
- Environmental Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Food Science & Technology (AREA)
- Biodiversity & Conservation Biology (AREA)
Abstract
Description
Claims
Priority Applications (7)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU74941/98A AU752962B2 (en) | 1997-05-15 | 1998-05-15 | Therapeutic and diagnostic tools for impaired glucose tolerance conditions |
EP98922382A EP1019092A4 (en) | 1997-05-15 | 1998-05-15 | Therapeutic and diagnostic tools for impaired glucose tolerance conditions |
CA002287839A CA2287839A1 (en) | 1997-05-15 | 1998-05-15 | Therapeutic and diagnostic tools for impaired glucose tolerance conditions |
JP54963998A JP2002511747A (en) | 1997-05-15 | 1998-05-15 | Treatment and diagnostic tools for impaired glucose tolerance |
HU0002199A HUP0002199A2 (en) | 1997-07-07 | 1998-05-15 | Therapeutic and diagnostic tools for impaired glucose tolerance conditions |
US09/205,658 US6861256B2 (en) | 1997-05-15 | 1998-12-03 | Therapeutic and diagnostic tools for impaired glucose tolerance conditions |
US09/963,693 US7041437B2 (en) | 1997-05-15 | 2001-09-25 | Therapeutic and diagnostic tools for impaired glucose tolerance conditions |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US08/857,076 US6225120B1 (en) | 1997-05-15 | 1997-05-15 | Therapeutic and diagnostic tools for impaired glucose tolerance conditions |
US08/857,076 | 1997-05-15 | ||
US88853497A | 1997-07-07 | 1997-07-07 | |
US08/888,534 | 1997-07-07 |
Related Parent Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US08/857,076 Continuation-In-Part US6225120B1 (en) | 1997-05-15 | 1997-05-15 | Therapeutic and diagnostic tools for impaired glucose tolerance conditions |
US88853497A Continuation-In-Part | 1997-05-15 | 1997-07-07 |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US09/205,658 Continuation-In-Part US6861256B2 (en) | 1997-05-15 | 1998-12-03 | Therapeutic and diagnostic tools for impaired glucose tolerance conditions |
Publications (1)
Publication Number | Publication Date |
---|---|
WO1998051351A1 true WO1998051351A1 (en) | 1998-11-19 |
Family
ID=27127391
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US1998/010080 WO1998051351A1 (en) | 1997-05-15 | 1998-05-15 | Therapeutic and diagnostic tools for impaired glucose tolerance conditions |
Country Status (6)
Country | Link |
---|---|
EP (1) | EP1019092A4 (en) |
JP (1) | JP2002511747A (en) |
AU (1) | AU752962B2 (en) |
CA (1) | CA2287839A1 (en) |
PL (1) | PL336858A1 (en) |
WO (1) | WO1998051351A1 (en) |
Cited By (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2000063427A2 (en) * | 1999-04-15 | 2000-10-26 | Devgen Nv | Compound screening method |
WO2000063424A2 (en) * | 1999-04-15 | 2000-10-26 | Devgen Nv | Method for screening compounds using nematode worms |
WO2000063426A2 (en) * | 1999-04-15 | 2000-10-26 | Devgen Nv | Compound screening methods |
WO2001018549A1 (en) * | 1999-09-07 | 2001-03-15 | Neurogenetics, Inc. | Method for identifying modulators of daf-16 |
WO2001094627A2 (en) * | 2000-06-08 | 2001-12-13 | Devgen Nv | Assay techniques based on growth stage dependent expression in c. elegans |
EP1163515A1 (en) * | 1998-12-03 | 2001-12-19 | The General Hospital Corporation | Therapeutic and diagnostic tools for impaired glucose tolerance conditions |
US6617122B1 (en) | 1999-03-15 | 2003-09-09 | Xenon Genetics, Inc. | Process for identifying modulators of ABC1 activity |
US6787125B1 (en) | 1999-04-15 | 2004-09-07 | Devgen Nv | Compound screening method |
US7083947B2 (en) | 2000-05-19 | 2006-08-01 | Devgen Nv | Assay techniques using nematode worms |
US7414169B2 (en) | 1997-05-15 | 2008-08-19 | The General Hospital Corporation | Therapeutic and diagnostic tools for impaired glucose tolerance conditions |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5196333A (en) * | 1990-05-30 | 1993-03-23 | The Trustees Of Columbia University | DNA sequences involved in neuronal degeneration, multicellular organisms containing same and uses thereof |
-
1998
- 1998-05-15 AU AU74941/98A patent/AU752962B2/en not_active Ceased
- 1998-05-15 JP JP54963998A patent/JP2002511747A/en not_active Ceased
- 1998-05-15 CA CA002287839A patent/CA2287839A1/en not_active Abandoned
- 1998-05-15 EP EP98922382A patent/EP1019092A4/en not_active Withdrawn
- 1998-05-15 PL PL98336858A patent/PL336858A1/en unknown
- 1998-05-15 WO PCT/US1998/010080 patent/WO1998051351A1/en not_active Application Discontinuation
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5196333A (en) * | 1990-05-30 | 1993-03-23 | The Trustees Of Columbia University | DNA sequences involved in neuronal degeneration, multicellular organisms containing same and uses thereof |
Non-Patent Citations (12)
Title |
---|
ESTEVEZ M., ET AL.: "THE DAF-4 GENE ENCODES A BONE MORPHOGENETIC PROTEIN RECEPTOR CONTROLLING C. ELEGANS DAUER LARVA DEVELOPMENT.", NATURE, NATURE PUBLISHING GROUP, UNITED KINGDOM, vol. 365., 14 October 1993 (1993-10-14), United Kingdom, pages 644 - 649., XP002910178, ISSN: 0028-0836, DOI: 10.1038/365644a0 * |
GALILI N., ET AL.: "FUSION OF A FORK HEAD DOMAIN GENE TO PAX3 IN THE SOLID TUMOUR ALVEOLAR RHABDOMYOSARCOMA.", NATURE GENETICS., NATURE PUBLISHING GROUP, NEW YORK, US, vol. 05., no. 03., 1 November 1993 (1993-11-01), NEW YORK, US, pages 230 - 235 + 214., XP002910179, ISSN: 1061-4036, DOI: 10.1038/ng1193-230 * |
KENYON C., ET AL.: "A C. ELEGANS MUTANT THAT LIVES TWICE AS LONG AS WILD TYPE.", NATURE, NATURE PUBLISHING GROUP, UNITED KINGDOM, vol. 366., 2 December 1993 (1993-12-02), United Kingdom, pages 461 - 464., XP002910186, ISSN: 0028-0836, DOI: 10.1038/366461a0 * |
KIMURA K. D., ET AL.: "DAF-2, AN INSULIN RECEPTOR-LIKE GENE THAT REGULATES LONGEVITY AND DIAPAUSE IN CAENORHABDITIS ELEGANS.", SCIENCE, AMERICAN ASSOCIATION FOR THE ADVANCEMENT OF SCIENCE, US, vol. 277., 15 August 1997 (1997-08-15), US, pages 942 - 946., XP002910188, ISSN: 0036-8075, DOI: 10.1126/science.277.5328.942 * |
LIN K., ET AL.: "DAF-16: AN HNF-3/FORKHEAD FAMILY MEMBER THAT CAN FUNCTION TO DOUBLE THE LIFE-SPAN OF CAENORHABDITIS ELEGANS.", SCIENCE, AMERICAN ASSOCIATION FOR THE ADVANCEMENT OF SCIENCE, US, vol. 278., 14 November 1997 (1997-11-14), US, pages 1319 - 1322., XP002910182, ISSN: 0036-8075, DOI: 10.1126/science.278.5341.1319 * |
MCCOMBIE W. R., ET AL.: "CAENORHABDITIS ELEGANS EXPRESSED SEQUENCE TAGS IDENTIFY GENE FAMILIES AND POTENTIAL DISEASE GENE HOMOLOGUES.", NATURE GENETICS., NATURE PUBLISHING GROUP, NEW YORK, US, vol. 01., 1 May 1992 (1992-05-01), NEW YORK, US, pages 124 - 131., XP002910184, ISSN: 1061-4036, DOI: 10.1038/ng0592-124 * |
MURAKAMI S., JOHNSON T. E.: "A GENETIC PATHWAY CONFERRING LIFE EXTENSION AND RESISTANCE TO UV STRESS IN CAENORHABDITIS ELEGANS.", GENETICS, GENETICS SOCIETY OF AMERICA, AUSTIN, TX, US, vol. 143., 1 July 1996 (1996-07-01), US, pages 1207 - 1218., XP002910181, ISSN: 0016-6731 * |
OGG S., ET AL.: "THE FORK HEAD TRANSCRIPTION FACTOR DAF-16 TRANSDUCES INSULIN-LIKE METABOLIC AND LONGEVITY SIGNALS IN C. ELEGANS.", NATURE, NATURE PUBLISHING GROUP, UNITED KINGDOM, vol. 389., 30 October 1997 (1997-10-30), United Kingdom, pages 994 - 999., XP002910183, ISSN: 0028-0836, DOI: 10.1038/40194 * |
REN P., ET AL.: "CONTROL OF C. ELEGANS LARVAL DEVELOPMENT BY NEURONAL EXPRESSION OF A TGF-BETA HOMOLOG.", SCIENCE, AMERICAN ASSOCIATION FOR THE ADVANCEMENT OF SCIENCE, US, vol. 274., 22 November 1996 (1996-11-22), US, pages 1389 - 1391., XP002910187, ISSN: 0036-8075, DOI: 10.1126/science.274.5291.1389 * |
See also references of EP1019092A4 * |
WATERSTON R., ET AL.: "A SURVEY OF EXPRESSED GENES IN CAENORHABDITIS ELEGANS.", NATURE GENETICS., NATURE PUBLISHING GROUP, NEW YORK, US, vol. 01., 1 May 1992 (1992-05-01), NEW YORK, US, pages 114 - 123., XP002910185, ISSN: 1061-4036, DOI: 10.1038/ng0592-114 * |
ZWAAL R.R., ET AL.: "TARGET-SELECTED GENE INACTIVATION IN CAENORHABDITIS ELEGANS BY USING A FROZEN TRANSPOSON INSERTION MUTANT BANK.", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, NATIONAL ACADEMY OF SCIENCES, US, vol. 90., 1 August 1993 (1993-08-01), US, pages 7431 - 7435., XP002910180, ISSN: 0027-8424, DOI: 10.1073/pnas.90.16.7431 * |
Cited By (23)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7041437B2 (en) | 1997-05-15 | 2006-05-09 | The General Hospital Corporation | Therapeutic and diagnostic tools for impaired glucose tolerance conditions |
US6861256B2 (en) | 1997-05-15 | 2005-03-01 | The General Hospital Corporation | Therapeutic and diagnostic tools for impaired glucose tolerance conditions |
US7414169B2 (en) | 1997-05-15 | 2008-08-19 | The General Hospital Corporation | Therapeutic and diagnostic tools for impaired glucose tolerance conditions |
EP1163515A4 (en) * | 1998-12-03 | 2003-01-22 | Gen Hospital Corp | Therapeutic and diagnostic tools for impaired glucose tolerance conditions |
EP1163515A1 (en) * | 1998-12-03 | 2001-12-19 | The General Hospital Corporation | Therapeutic and diagnostic tools for impaired glucose tolerance conditions |
US8067219B2 (en) | 1999-03-15 | 2011-11-29 | Xenon Pharmaceuticals Inc. | Polynucleotide encoding an ATP binding cassette transporter 1 (ABC1) polypeptide |
US8715968B2 (en) | 1999-03-15 | 2014-05-06 | Xenon Pharmaceuticals Inc. | Methods and reagents for modulating cholesterol levels |
US7785886B2 (en) | 1999-03-15 | 2010-08-31 | Xenon Pharmaceuticals, Inc. | Methods and reagents for modulating cholesterol levels |
US6617122B1 (en) | 1999-03-15 | 2003-09-09 | Xenon Genetics, Inc. | Process for identifying modulators of ABC1 activity |
WO2000063427A3 (en) * | 1999-04-15 | 2001-12-06 | Devgen Nv | Compound screening method |
WO2000063427A2 (en) * | 1999-04-15 | 2000-10-26 | Devgen Nv | Compound screening method |
WO2000063426A3 (en) * | 1999-04-15 | 2001-02-08 | Devgen Nv | Compound screening methods |
WO2000063424A3 (en) * | 1999-04-15 | 2001-02-08 | Devgen Nv | Method for screening compounds using nematode worms |
WO2000063426A2 (en) * | 1999-04-15 | 2000-10-26 | Devgen Nv | Compound screening methods |
US6787125B1 (en) | 1999-04-15 | 2004-09-07 | Devgen Nv | Compound screening method |
WO2000063424A2 (en) * | 1999-04-15 | 2000-10-26 | Devgen Nv | Method for screening compounds using nematode worms |
AU780574B2 (en) * | 1999-04-15 | 2005-04-07 | Devgen N.V. | Compound screening method |
WO2001018549A1 (en) * | 1999-09-07 | 2001-03-15 | Neurogenetics, Inc. | Method for identifying modulators of daf-16 |
US7083947B2 (en) | 2000-05-19 | 2006-08-01 | Devgen Nv | Assay techniques using nematode worms |
WO2001094627A3 (en) * | 2000-06-08 | 2002-10-03 | Devgen Nv | Assay techniques based on growth stage dependent expression in c. elegans |
WO2001093669A3 (en) * | 2000-06-08 | 2002-05-10 | Devgen Nv | Compound screens relating to insulin deficiency or insulin resistance |
WO2001093669A2 (en) * | 2000-06-08 | 2001-12-13 | Devgen Nv | Compound screens relating to insulin deficiency or insulin resistance |
WO2001094627A2 (en) * | 2000-06-08 | 2001-12-13 | Devgen Nv | Assay techniques based on growth stage dependent expression in c. elegans |
Also Published As
Publication number | Publication date |
---|---|
EP1019092A4 (en) | 2004-12-15 |
CA2287839A1 (en) | 1998-11-19 |
AU7494198A (en) | 1998-12-08 |
JP2002511747A (en) | 2002-04-16 |
EP1019092A1 (en) | 2000-07-19 |
PL336858A1 (en) | 2000-07-17 |
AU752962B2 (en) | 2002-10-03 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Kiyokawa et al. | Enhanced growth of mice lacking the cyclin-dependent kinase inhibitor function of p27Kip1 | |
Hopper et al. | ARK-1 inhibits EGFR signaling in C. elegans | |
Patterson et al. | The DAF-3 Smad protein antagonizes TGF-β-related receptor signaling in the Caenorhabditis elegansdauer pathway | |
Miller et al. | Goα and diacylglycerol kinase negatively regulate the Gqα pathway in C. elegans | |
US6861256B2 (en) | Therapeutic and diagnostic tools for impaired glucose tolerance conditions | |
Miller et al. | RIC-8 (synembryn): A novel conserved protein that is required for Gqα signaling in the C. elegans nervous system | |
AU748334B2 (en) | Models and treatments for cardiac hypertrophy in relation with NF-AT3 function | |
US7414169B2 (en) | Therapeutic and diagnostic tools for impaired glucose tolerance conditions | |
Geisbrecht et al. | Drosophila ELMO/CED-12 interacts with Myoblast city to direct myoblast fusion and ommatidial organization | |
US6720175B1 (en) | Nucleic acid molecule encoding homer 1B protein | |
JP2005503809A (en) | Isolated DNA molecule encoding a humanized calcitonin gene-related peptide receptor, related non-human transgenic animals and assay methods | |
AU752962B2 (en) | Therapeutic and diagnostic tools for impaired glucose tolerance conditions | |
EP1324652A2 (en) | Transgenic drosophila melanogaster expressing beta amyloid | |
WO2001018549A1 (en) | Method for identifying modulators of daf-16 | |
Sakamaki et al. | Multiple functions of FADD in apoptosis, NF‐κB‐related signaling, and heart development in Xenopus embryos | |
US20030074682A1 (en) | Isolation, characterization, and use of a novel teleost potassium channel | |
US20060265769A1 (en) | Gab2 (p97) gene and methods of use thereof | |
JP2007511474A (en) | Genes involved in neurodegenerative disorders | |
US20060179497A1 (en) | Methods to treat conditions associated with insulin signaling dysregulation | |
CA2297946A1 (en) | Sel-10 and uses thereof | |
US20060282909A1 (en) | Methods and compositions for therapeutic intervention in cardiac hypertrophy | |
US20020009751A1 (en) | Drosophila homologues of genes and proteins implicated in metabolism and methods of use | |
Birnby | Analysis ofdaf-11, a transmembrane guanylyl cyclase that mediates chemosensory transduction in Caenorhabditis elegans | |
Li | Insights into the control of growth and axon guidance by the Drosophila insulin receptor | |
EP1571903A1 (en) | Method to treat conditions associated with insulin signaling dysregulation |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A1 Designated state(s): AL AM AT AU AZ BA BB BG BR BY CA CH CN CU CZ DE DK EE ES FI GB GE GH GM GW HU ID IL IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT UA UG UZ VN YU ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): GH GM KE LS MW SD SZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN ML MR NE SN TD TG |
|
WWE | Wipo information: entry into national phase |
Ref document number: 09205658 Country of ref document: US |
|
DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
ENP | Entry into the national phase |
Ref document number: 2287839 Country of ref document: CA Ref country code: CA Ref document number: 2287839 Kind code of ref document: A Format of ref document f/p: F |
|
ENP | Entry into the national phase |
Ref country code: JP Ref document number: 1998 549639 Kind code of ref document: A Format of ref document f/p: F |
|
WWE | Wipo information: entry into national phase |
Ref document number: 74941/98 Country of ref document: AU |
|
WWE | Wipo information: entry into national phase |
Ref document number: 1998922382 Country of ref document: EP |
|
REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
WWP | Wipo information: published in national office |
Ref document number: 1998922382 Country of ref document: EP |
|
WWG | Wipo information: grant in national office |
Ref document number: 74941/98 Country of ref document: AU |
|
WWW | Wipo information: withdrawn in national office |
Ref document number: 1998922382 Country of ref document: EP |