USRE45137E1 - Adjuvanted meningococcus compositions - Google Patents

Adjuvanted meningococcus compositions Download PDF

Info

Publication number
USRE45137E1
USRE45137E1 US13/587,840 US201213587840A USRE45137E US RE45137 E1 USRE45137 E1 US RE45137E1 US 201213587840 A US201213587840 A US 201213587840A US RE45137 E USRE45137 E US RE45137E
Authority
US
United States
Prior art keywords
composition
microparticles
antigen
adsorbed
plg
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Expired - Fee Related, expires
Application number
US13/587,840
Inventor
Derek O'Hagan
Nicholas Valiante
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novartis Vaccines and Diagnostics Inc
Original Assignee
Novartis Vaccines and Diagnostics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from US10/264,802 external-priority patent/US7838015B2/en
Application filed by Novartis Vaccines and Diagnostics Inc filed Critical Novartis Vaccines and Diagnostics Inc
Priority to US13/587,840 priority Critical patent/USRE45137E1/en
Application granted granted Critical
Publication of USRE45137E1 publication Critical patent/USRE45137E1/en
Adjusted expiration legal-status Critical
Expired - Fee Related legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/39Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/095Neisseria
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/21Retroviridae, e.g. equine infectious anemia virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/29Hepatitis virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/18Antivirals for RNA viruses for HIV
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55522Cytokines; Lymphokines; Interferons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55555Liposomes; Vesicles, e.g. nanoparticles; Spheres, e.g. nanospheres; Polymers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55561CpG containing adjuvants; Oligonucleotide containing adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55566Emulsions, e.g. Freund's adjuvant, MF59
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16034Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011Details
    • C12N2770/24011Flaviviridae
    • C12N2770/24211Hepacivirus, e.g. hepatitis C virus, hepatitis G virus
    • C12N2770/24234Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

Definitions

  • the invention relates to vaccines, more particularly those against Neisseria meningitidis.
  • Antigens generally require the co-administration of adjuvants in order to enhance their immunogenicity in vaccines [13].
  • Freund's adjuvant has been used for serogroup B meningococcus [9], and the licensed vaccine MenjugateTM against serogroup C uses aluminium hydroxide [14].
  • Enhancement of the bactericidal activity of Neisseria antigens has also been reported by using oligonucleotide adjuvants containing CpG motifs [15].
  • the invention therefore provides a composition comprising: (a) a Neisserial antigen; (b) a CpG oligonucleotide; and (c) a biodegradable polymer microparticle.
  • the Neisserial antigen may be a protein antigen, nucleic acid encoding a protein antigen, or a saccharide antigen.
  • the antigen preferably elicits a bactericidal or protective immune response (e g antibody response) in a recipient mammal.
  • the antigen may be derived from any species of Neisseria including N. gonorrhoeae, N lactamica and N. meningitidis. It is preferably a N. meningitidis antigen and may be from any serogroup. Where the antigen is from serogroup B, it is preferred to use a protein antigen; where it is from serogroup A, C, W135 or Y then it is preferred to use a saccharide antigen. Where saccharide antigens are used, these will typically be derived from the bacterial capsular polysaccharide (e.g. oligosaccharides, such as those obtained by hydrolysis), and they will typically be conjugated to carrier proteins (e.g. to CRM 197 ).
  • carrier proteins e.g. to CRM 197
  • Preferred protein antigens derived from serogroup B N. meningitidis are:
  • a particularly preferred protein antigen from serogroup B N. meningitidis is protein ‘287’.
  • This protein may be used in a wild-type form [e.g. GenBank accession gi:7228690, i.e., MFKRSVIAMACIFALSACGGGGGGSPDVKSADTLSKPAAPVVSEKETEAKEDAPQAGSQ GQGAPSAQGGQDMAAVSEENTGNGGAAATDKPKNEDEGAQNDMPQNAADTDSLTPN HTPASNMPAGNMENQAPDAGESEQPANQPDMANTADGMQGDDPSAGGENAGNTAAQ GTNQAENNQTAGSQNPASSTNPSATNSGGDFGRTNVGNSVVIDGPSQNITLTHCKGDSC SGNNFLDEEVQLKSEFEKLSDADKISNYKKDGKNDGKNDKFVGLVADSVQMKGINQYII FYKPKPTSFARFRRSARSRRSLPAEMPLIPVNQADTLIVDGEAVSLTGHS
  • proteins having 50% or more sequence identity (e.g. 60%, 70%, 80%, 90%, 95%, 99% or more) to gi:7228690 may be used.
  • Proteins comprising truncation or deletion variants of the protein may be used, such as the N-terminal truncated forms disclosed in references 10 to 12 (‘ ⁇ G287’ in particular, in which the N-terminus of the protein up to and including the six repeated glycine residues is deleted). Fusion proteins comprising such 287 sequences may be used. All of these forms of 287, and more particularly those which retain the immunogenicity of wild-type 287 proteins, fall within the meaning of ‘287’ as used herein.
  • protein ‘961’ also known as ‘NadA’ [16].
  • This protein may be used in a wild-type form [e.g. GenBank accession gi:7227256; alleles of 961 are disclosed in ref. 17] but derivatives of the wild-type protein may be used. For instance, proteins having 50% or more sequence identity (e.g. 60%, 70%, 80%, 90%, 95%, 99% or more) to gi:7227256 may be used. Proteins comprising truncation or deletion variants of the protein may be used, such as those disclosed in references 10 to 12 (‘961c’ in particular, which lacks the C-terminal membrane anchor). Fusion proteins comprising such 961 sequences may be used. All of these forms of 961, and particularly those which retain the immunogenicity of wild-type 961 proteins, fall within the meaning of ‘961’ or ‘NadA’ as used herein.
  • proteins ‘741’ and protein ‘ORF46.1’ and proteins ‘ORF1’, ‘ORF4’, ‘ORF25’, ‘ORF40’, ‘ORF83’, ‘NMB1343’, ‘230’, ‘233’, ‘292’, ‘594’, ‘687’, ‘736’, ‘907’, ‘919’, ‘936’, ‘953’, and ‘983’.
  • Other preferred protein antigens are the hybrid proteins disclosed in references 10 to 12, particularly those comprising one or more of: a 287 protein, a 953 protein, a 936 protein and/or a 741 protein.
  • Protein antigens may be derived from any strain of N. meningitidis. It is preferred to use antigens from strains 2996, MC58, 95N477 and 394/98.
  • strain variants single or multiple conservative amino acid substitutions may be made with altering the immunogenicity of antigens used according to the present invention.
  • nucleic acid encoding a protein antigen may be included within compositions of the invention.
  • the nucleic acid will be expressed in vivo once administered to a mammalian recipient and the protein antigen will be produced: Such nucleic acid immunization is well known [e.g. refs. 18 to 23 etc.].
  • the nucleic acid will typically be a DNA plasmid.
  • a preferred saccharide antigen derived from serogroup A is an oligosaccharide in which one or more of the hydroxyl groups on the constituent monosaccharide units has been replaced by a blocking group [26].
  • oligosaccharide antigens from serogroups A, W135 and Y are disclosed in reference 27.
  • composition of the invention may comprise more than one Neisserial antigen. Where saccharides from both serogroups A and C of N. meningitidis are included, it is preferred that the ratio (w/w) of MenA saccharide:MenC saccharide is greater than 1 (e.g. 2:1, 3:1, 4:1, 5:1, 10:1 or higher).
  • composition of the invention is preferably an immunogenic composition or vaccine.
  • Such compositions comprise an immunologically effective amount of the antigen.
  • immunologically effective amount it is meant that the administration to an individual of a composition of the invention comprising that amount of antigen (either in a single dose or as part of a series) is effective for raising a therapeutic or prophylactic immune response. This amount varies depending upon the health and physical condition of the individual to be treated, age, the taxonomic group of individual to be treated (e.g. non-human primate, primate, etc.), the capacity of the individual's immune system to synthesise antibodies, the degree of protection desired, the formulation of the vaccine, the treating physician's assessment of the medical situation, and other relevant factors. The amount may fall in a relatively broad range that can be determined through routine trials. Antigens will typically be present at a concentration of at least 1 ⁇ g/ml each.
  • Dosage treatment may be a single dose or a multiple dose schedule (e.g. including booster doses).
  • CpG oligonucleotides are known for use as vaccine adjuvants [e.g. ref. 28] and they induce strong Thl immune responses. They are useful as parenteral and mucosal adjuvants [29].
  • the CpG oligonucleotide used according to the present invention is a nucleic acid which includes at least one CG dinucleotide i.e. a cytosine nucleotide followed by a guanosine nucleotide.
  • the oligonucleotide may contain multiple CG dinucleotides.
  • a CG sequence in the oligonucleotide may be flanked by two purines at the 5′ side and two pyrimidines at the 3′ side i.e. RRCGYY.
  • Cytosine nucleotides in the CpG oligonucleotide may be methylated, but it is preferred that they should be unmethylated.
  • the cytosine and guanosine nucleotides are preferably deoxynucleotides and the nucleic acid is preferably DNA.
  • the oligonucleotide may comprise a modified backbone, such as a phosphorothioate backbone.
  • PNA peptide nucleic acid
  • the oligonucleotides can comprise substitutions of the sugar moieties and nitrogenous base moieties.
  • the oligonucleotide preferably comprises between about 6 and about 100 nucleotides, more preferably between about 8 and about 50 nucleotides, most preferably between about 10 and about 40 nucleotides.
  • Oligonucleotides comprising at least one CG dinucleotide can conveniently be prepared using conventional oligonucleotide synthesis.
  • Biodegradable polymer microparticles are known for use as vaccine adjuvants [e.g. ref. 56]. They are useful as parenteral and mucosal adjuvants.
  • the polymer used to make the microparticles will generally be sterilizable and non-toxic (biocompatible).
  • Suitable biodegradable polymers are readily commercially available and include those derived from polyhydroxybutyric acid; polycaprolactone; polyorthoester; polyanhydride; poly(hydoxybutyrate); and a poly( ⁇ -hydroxy acid).
  • Preferred polymers are formed from one or more poly( ⁇ -hydroxy acid) e.g.
  • Microparticles formed from poly(D,L-lactide-co-glycolide) (‘PLG’) are preferred.
  • poly(L-lactide) a suitable molecular weight will be on the order of about 2000 to 250,000.
  • suitable molecular weights will generally range from about 10,000 to about 200,000, preferably about 15,000 to about 150,000, and most preferably about 50,000 to about 100,000.
  • lactide:glycolide ratios may be used and the ratio is largely a matter of choice, depending in part on the co-administered antigen and the rate of degradation desired.
  • a 50:50 PLG polymer, containing 50% D,L-lactide and 50% glycolide will provide a fast resorbing copolymer while 75:25 PLG degrades more slowly, and 85:15 and 90:10, even more slowly, due to the increased lactide component.
  • a suitable ratio of lactide:glycolide is easily determined based on the nature of the antigen and disorder in question.
  • microparticles with varying lactide:glycolide ratios will find use in the formulations in order to achieve the desired release kinetics for a given antigen and to provide for both a primary and secondary immune response.
  • Degradation rate of the microparticles of the present invention can also be controlled by such factors as polymer molecular weight and polymer crystallinity.
  • microparticle refers to a particle of about 100 nm to about 150 ⁇ m in diameter, more preferably about 200 nm to about 30 ⁇ m in diameter, and most preferably about 500 nm to about 10 ⁇ m in diameter.
  • the microparticle will be of a diameter that permits parenteral administration without occluding needles and capillaries.
  • Microparticle size is readily determined by techniques well known in the art, such as photon correlation spectroscopy, laser diffractometry and/or scanning electron microscopy.
  • the term ‘microparticle’ includes ‘nanoparticles’ [57] within its scope. Preferred microparticles are microspheres, although lamellar particles [58] may also be used.
  • Microparticles may be prepared using any of several methods well known in the art [e.g ref. 59]. For example, double emulsion/solvent evaporation techniques [e.g. refs. 60 & 61] can be used to form the microparticles. These techniques involve the formation of a primary emulsion consisting of droplets of polymer solution containing the antigen (if antigen is to be entrapped in the microparticle), which is subsequently mixed with a continuous aqueous phase containing a particle stabilizer/surfactant.
  • double emulsion/solvent evaporation techniques e.g. refs. 60 & 61
  • These techniques involve the formation of a primary emulsion consisting of droplets of polymer solution containing the antigen (if antigen is to be entrapped in the microparticle), which is subsequently mixed with a continuous aqueous phase containing a particle stabilizer/surfactant.
  • a water-in-oil-in-water (w/o/w) solvent evaporation system can be used to form the microparticles, as described in references 62, 63 and 64.
  • the particular polymer is combined with an organic solvent, such as ethyl acetate, dimethylchloride (also called methylene chloride and dichloromethane), acetonitrile, acetone, chloroform, and the like.
  • the polymer will be provided in about a 2-15% solution, in organic solvent.
  • An approximately equal amount of an antigen solution e.g. in water
  • the polymer/antigen solution emulsified using e.g. a homogenizer.
  • the emulsion is then combined with a larger volume of an aqueous solution of an emulsion stabilizer such as polyvinyl alcohol (PVA) or polyvinyl pyrrolidone.
  • PVA polyvinyl alcohol
  • the emulsion stabilizer is typically provided in about a 2-15% solution, more typically about a 4-10% solution.
  • the mixture is then homogenized to produce a stable w/o/w double emulsion. Organic solvents are then evaporated.
  • the formulation parameters can be manipulated to allow the preparation of small ( ⁇ 5 ⁇ m) and large (>30 ⁇ m) microparticles [e.g. 63, 65]. For example, reduced agitation results in larger microparticles, as does an increase in internal phase volume. Small particles are produced by low aqueous phase volumes with high concentrations of PVA.
  • Microparticles can also be formed using spray-drying and coacervation [e.g. refs. 66, 67 & 68]; air-suspension coating techniques, such as pan coating and Wurster coating [69, 70]; ionic gelation [71].
  • spray-drying and coacervation e.g. refs. 66, 67 & 68
  • air-suspension coating techniques such as pan coating and Wurster coating [69, 70]
  • ionic gelation ionic gelation
  • antigen content Prior to use of the microparticles, antigen content is generally determined so that an appropriate amount of the microparticles may be delivered to the subject in order to elicit an adequate immune response.
  • Antigen content of the microparticles can be determined according to methods known in the art, such as by disrupting the microparticles and extracting entrapped antigen.
  • microparticles can be dissolved in dimethylchloride and the protein extracted into distilled water [e.g. refs. 72, 73, 74].
  • microparticles can be dispersed in 0.1 M NaOH containing 5% (w/v) SDS. The sample is agitated, centrifuged and the supernatant assayed for antigen using an appropriate assay [75].
  • Antigen and/or CpG-oligonucleotides can be located within or on the microparticles. Entrapment will generally be achieved by having the antigen/oligonucleotide present during formation of the microparticles, whereas surface adsorption is achieved by adding antigen/oligonucleotide to preformed microparticles.
  • Microparticles are rehydrated and dispersed to an essentially monomeric suspension of microparticles using dialyzable anionic or cationic detergents.
  • Useful detergents include, but are not limited to, any of the various N-methylglucamides (known as MEGAs), such as heptanoyl-N-methylglucamide (MEGA-7), octanoyl-N-methylglucamide (MEGA-8), nonanoyl-N-methylglucamide (MEGA-9), and decanoyl-N-methyl-glucamide (MEGA-10); cholic acid; sodium cholate; deoxycholic acid; sodium deoxycholate; taurocholic acid; sodium taurocholate; taurodeoxycholic acid; sodium taurodeoxycholate; 3-[(3-cholamidopropyl)dimethylammonio]-1-propane-sulfonate (CHAPS); N-octylglucoside; 3-[(3-cholamidopropyl) dimethylammonio]-2-hydroxy-1-propane-sulfonate (CHAPSO); N-dodecyl-N,N-di
  • the microparticle/detergent mixture is then physically ground e.g. using a ceramic mortar and pestle, until a smooth slurry is formed.
  • An appropriate aqueous buffer such as phosphate buffered saline (PBS) or Tris buffered saline, is then added and the resulting mixture sonicated or homogenized until the microparticles are fully suspended.
  • PBS phosphate buffered saline
  • Tris buffered saline Tris buffered saline
  • the antigen/oligonucleotide is then added to the microparticle suspension and the system dialyzed to remove detergent.
  • the polymer microparticles and detergent system are preferably chosen such that the antigen/oligonucleotide will adsorb to the microparticle surface while still maintaining activity.
  • microparticles containing surface adsorbed antigen/oligonucleotide may be washed free of unbound antigen/oligonucleotide and stored as a suspension in an appropriate buffer formulation, or lyophilized with the appropriate excipients, as described further below.
  • compositions of the invention Various physical relationships are possible between the three basic components of the compositions of the invention. These arise because the microparticles have an internal volume and a surface, either of which may be used to locate the CpG-oligonucleotide and/or the antigen.
  • the antigen may be entrapped within microparticles, it may be adsorbed to microparticles, or it may be in simple admixture with the microparticles without entrapment or adsorption. Adsorption is preferred.
  • the CpG-oligonucleotide may be entrapped within microparticles, it may be adsorbed to microparticles, or it may be in simple admixture with the microparticles. Adsorption can be achieved using detergents such as CTAB.
  • the CpG-oligonucleotide and the antigen may both have the same physical relationship to the microparticles as each other, or they may be different. Likewise the CpG-oligonucleotide and the antigen may be adsorbed onto the same microparticle or the CpG-oligonucleotide and the antigen may be adsorbed onto different microparticles. All possible combinations are encompassed within the present invention:
  • compositions of the invention may include mixtures of the above e.g. some microparticles within the composition have entrapped antigen and some have adsorbed antigen.
  • compositions of the invention will generally comprise a pharmaceutically acceptable carrier. This gives a pharmaceutical composition of the invention.
  • a pharmaceutically acceptable carrier can be any substance that does not itself induce the production of antibodies harmful to the patient receiving the composition, and which can be administered without undue toxicity.
  • Suitable carriers can be large, slowly-metabolised macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, and inactive virus particles. Such carriers are well known to those of ordinary skill in the art.
  • Pharmaceutically acceptable carriers can include liquids such as water, saline, glycerol and ethanol. Auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, can also be present in such vehicles. Liposomes are suitable carriers. A thorough discussion of pharmaceutical carriers is available in ref. 78.
  • compositions of the invention may be prepared in various forms.
  • the compositions may be prepared as injectables, either as liquid solutions or suspensions. Solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection can also be prepared.
  • the composition may be prepared for topical administration e.g. as an ointment, cream or powder.
  • the composition be prepared for oral administration e.g. as a tablet or capsule, or as a syrup (optionally flavoured).
  • the composition may be prepared for pulmonary administration e.g. as an inhaler, using a fine powder or a spray.
  • the composition may be prepared as a suppository or pessary.
  • the composition may be prepared for nasal, aural or ocular administration e.g. as drops, as a spray, or as a powder [e.g. 79].
  • the pharmaceutical composition is preferably sterile. It is preferably pyrogen-free. It is preferably buffered e.g. at between pH 6 and pH 8, generally around pH 7.
  • the pharmaceutical composition may be lyophilised.
  • the invention also provides a delivery device containing a pharmaceutical composition of the invention.
  • the device may be, for example, a syringe.
  • compositions of the invention may be used therapeutically (i.e. to treat an existing Neisserial infection) or prophylactically (i.e. to prevent future Neisserial infection).
  • the invention provides a composition of the invention for use as a medicament.
  • the invention also provides a method for raising an antibody response in a mammal, comprising administering a pharmaceutical composition of the invention to the mammal.
  • the antibody response is preferably an IgA or IgG response and it is preferably bactericidal.
  • the invention also provides a method for treating a mammal suffering from a Neisserial infection and/or disease, comprising administering to the patient a pharmaceutical composition of the invention.
  • the invention also provides a method for protecting a mammal against a Neisserial infection and/or disease, comprising administering to the mammal a pharmaceutical composition of the invention.
  • the invention also provides the use of (a) a Neisserial antigen, (b) a CpG oligonucleotide, and (c) a biodegradable polymer microparticle, in the manufacture of a medicament for preventing or treating disease and/or infection in an mammal.
  • the mammal is preferably a human.
  • the human may be an adult or, preferably, a child.
  • compositions of the invention are particularly useful for immunising children and teenagers.
  • the uses and methods of the invention are particularly useful for treating/protecting against infections of N. meningitidis.
  • the uses and methods are particularly useful for preventing/treating diseases including bacterial meningitis.
  • Efficacy of therapeutic treatment can be tested by monitoring Neisserial infection after administration of the composition of the invention.
  • Efficacy of prophylactic treatment can be tested by monitoring anti-Neisseria immune responses after administration of the composition.
  • compositions of the invention will generally be administered directly to a patient.
  • Direct delivery may be accomplished by parenteral injection (e.g. subcutaneously, intraperitoneally, intravenously, intramuscularly, or to the interstitial space of a tissue), or by rectal, oral, vaginal, topical, transdermal, ocular, nasal, aural, or pulmonary administration. Injection or intranasal administration is preferred.
  • Dosage treatment can be a single dose schedule or a multiple dose schedule.
  • compositions of the invention may include adjuvants in addition to CpG-oligonucleotides and polymer microparticles.
  • Preferred further adjuvants include, but are not limited to: (A) aluminium compounds (e.g. aluminium hydroxide, aluminium phosphate, aluminium hydroxyphosphate, oxyhydroxide, orthophosphate, sulphate etc. [e.g. see chapters 8 & 9 of ref. 13]), or mixtures of different aluminium compounds, with the compounds taking any suitable form (e.g.
  • RibiTM adjuvant system Ribi Immunochem
  • Ribi Immunochem Ribi Immunochem
  • bacterial cell wall components from the group consisting of monophosphorylipid A (MPL), trehalose dimycolate (TDM), and cell wall skeleton (CWS), preferably MPL+ CWS (DetoxTM)
  • MPL monophosphorylipid A
  • TDM trehalose dimycolate
  • CWS cell wall skeleton
  • saponin adjuvants such as QuilA or QS21 [see Chapter 22 of ref. 13], also known as StimulonTM [82]
  • H chitosan [e.g.
  • MPL monophosphoryl lipid A
  • 3dMPL 3-O-deacylated MPL
  • Muramyl peptides include N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-normuramyl -L-alanyl-D-isoglutamine (nor-MDP), N-acetylmuramyl-L-alanyl-D-isogl utaminyl-L-alanine-2-(1′-2′-dipal mitoyl-sn-glycero-3-hydroxyphosphoryloxy)-ethylamine MTP-PE), etc.
  • composition may comprise further antigenic components.
  • Antigens which can be included in the composition of the invention include:
  • composition may comprise one or more of these further antigens.
  • Toxic protein antigens may be detoxified where necessary (e.g. detoxification of pertussis toxin by chemical and/or genetic means [114]).
  • diphtheria antigen is included in the composition it is preferred also to include tetanus antigen and pertussis antigens. Similarly, where a tetanus antigen is included it is preferred also to include diphtheria and pertussis antigens. Similarly, where a pertussis antigen is included it is preferred also to include diphtheria and tetanus antigens.
  • Antigens are preferably adsorbed to an aluminium salt.
  • Antigens in the composition will typically be present at a concentration of at least 1 ⁇ g/ml each.
  • the concentration of any given antigen will be sufficient to elicit an immune response against that antigen.
  • nucleic acid encoding the antigen may be used.
  • Protein components of the compositions of the invention may thus be replaced by nucleic acid (preferably DNA e.g. in the form of a plasmid) that encodes the protein.
  • composition “comprising” means “including” as well as “consisting” e.g. a composition “comprising” X may consist exclusively of X or may include something additional e.g. X+Y.
  • references to a percentage sequence identity between two amino acid sequences means that, when aligned, that percentage of amino acids are the same in comparing the two sequences.
  • This alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in section 7.7.18 of reference 145.
  • a preferred alignment is determined by the Smith-Waterman homology search algorithm using an affine gap search with a gap open penalty of 12 and a gap extension penalty of 2, BLOSUM matrix of 62.
  • the Smith-Waterman homology search algorithm is taught in reference 146.
  • Reference 6 discloses a protein from serogroup B N. meningitidis called ‘287’.
  • References 10 to 12 disclose ways of improving its expression. One way involves deleting the N-terminus of the protein up to and including the six repeated glycine residues. This protein is referred to as ‘ ⁇ G287’.
  • mice were primed and boosted with MenB ⁇ G287 antigen (20 ⁇ g/dose) from strain 2996, formulated for intramuscular (IM) administration by adsorption to PLG microparticles, with or without CpG oligonucleotide (also adsorbed to the microparticles).
  • An additional formulation for intranasal (IN) administration used LT-K63 adjuvant.
  • Mice received either 3 IM doses or 2 IM then 2 IN doses (doses at: day 0; day 28; day 84; and, optionally, day 98).
  • CpG-oligonucleotide enhanced antibody titers against intramuscularly administered MenB protein 287 (compare groups 1 & 2). Titers could be enhanced by replacing a third intramuscular dose with two intranasal doses (compare groups 1 & 3). The CpG enhancement was also seen in the intramuscular/intranasal regime (compare groups 3 & 4).
  • ⁇ G287 was formulated with various adjuvants and administered to mice. Sera from the mice were assessed using the bactericidal antibody (BCA) assay and titers were as follows:
  • Adjuvant BCA post-2 BCA post-3 Freund's adjuvant 2048 8192 Alum ⁇ 4 256 Alum + CpG oligonucleotide 256 4096 MF59 ⁇ 4 ⁇ 4 CpG oligonucleotide ⁇ 4 128 PLG microparticles (adsorbed) 8 1024 PLG microparticles (adsorbed) + CpG 2048 16384
  • CpG-oligonucleotide was thus only mildly effective as an adjuvant, almost comparable to alum.
  • the PLG microparticles were more effective than both alum and CpG, but not as effective as Freund's adjuvant.
  • the mixture of CpG and PLG matched the adjuvanticity of Freund's adjuvant at the post-second immunization stage and exceeded Freund's adjuvant post-third immunization.
  • Adjuvant GMT post-2 GMT post-3 MF59 6967 13417 PLG microparticles (adsorbed) 7070 11367 PLG microparticles (adsorbed) + CpG 15099 26833 Effect of Adsorption on Adjuvanticity
  • Protein ⁇ G287 was either adsorbed onto PLG microparticles using DSS surfactant or SDS or was simply mixed with the particles. Immunisations were performed on days 0, 21 and 35 and titers were assessed on days 35 and 49. Results were as follows:
  • the adjuvanticity of CpG and microparticle mixtures for ⁇ G287 is thus optimal when the antigen is adsorbed to microparticles.
  • Reference 6 discloses a protein from serogroup B N. meningitidis called ‘961’ (now known as ‘NadA’ [16,17]).
  • References 10 to 12 disclose ways of improving the expression of NadA. One way involves deleting the C-terminus of the protein to remove its membrane anchor (i.e. remove amino acids 351-405 for strain 2996), as well as natural removal of its leader peptide. This protein is referred to as ‘961 c’.
  • the effect of adsorption on PLG adjuvanticity when co-administered with CpG was studied for 961c, as described above for 287:
  • the adjuvanticity of CpG and microparticle mixtures for 961c is optimal when the antigen is adsorbed to microparticles. This is true for the antigen on its own and the antigen when combined with ⁇ G287.
  • Adjuvant Titer PLG (antigen adsorbed to PLG) 1024 PLG + CpG (antigen adsorbed to PLG) 16384 PLG + CpG (antigen and CpG both adsorbed to PLG) 16384 PLG + alum (antigen adsorbed to PLG) 1024 PLG + alum + CpG (antigen adsorbed to PLG) 16384 PLG + alum + CpG (antigen and CpG both 8192 adsorbed to PLG) PLG + MF59 (antigen adsorbed to PLG) 4096 PLG + MF59 + CpG (antigen adsorbed to PLG) 16384 Alum (antigen adsorbed to alum) 256 CpG 128 Alum + CpG 1024 Alum + CpG + PLG (antigen adsorbed to alum; 4096 CpG adsorbed to PLG) CpG + PLG (CpG adsorbed on PLG; antigen 64 not adsor
  • MF59 and alum can further enhance efficacy of CpG/PLG mixtures, adsorption of CpG to PLG microparticles is not necessary for adjuvanticity, but adsorption of antigen to microparticles is again seen to be optimal.
  • the adjuvanticity of CpG and microparticle mixtures for protein 961 c is optimal when the antigen is adsorbed to microparticles.
  • Reference 12 discloses a combination of three proteins which, between them, include five different N. meningitidis antigens: (1) 961c 2996 ; (2) ⁇ G287 NZ -953 2996 ; and (3) 936 2996 - ⁇ G741 MC58 .
  • the antigen mixture was tested in reference 12 using aluminum hydroxide adjuvant. According to the present invention, the antigen mixture is adjuvanted by adsorption to a biodegradable polymer microparticle plus a CpG oligonucleotide. Titers after the third dose were as follows:
  • the PLG+CpG mixture leads to lower overall antibody titers (except for protein 287) but, importantly, gives higher bactericidal titers against a wide range of strains. Although absolute titers are lower, therefore, the adjuvant of the invention therefore advantageously shifts antibody production towards bactericidal antibodies.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Immunology (AREA)
  • Virology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Communicable Diseases (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Oncology (AREA)
  • Genetics & Genomics (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • AIDS & HIV (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)

Abstract

A combination of CpG oligonucleotides and polymer microparticles is an extremely effective adjuvant for Neisserial antigens. The invention therefore provides a composition comprising: (a) a Neisserial antigen; (b) a CpG oligonucleotide; and (c) a biodegradable polymer microparticle.

Description

CROSS-REFERENCE TO RELATED APPLICATIONS
This application claims priority under 35 U.S.C §119(e)(1) to U.S. Provisional Applications Ser. Nos. 60/326,929 filed Oct. 3, 2001, 60/373,547, filed Apr. 17, 2002, 60/380,677, filed May 13, 2002, U.S. patent application Ser. No. 10/254,438 entitled Adjuvant Compositions filed, Sep. 24, 2002, now abandoned, and. U.S. patent application Ser. No. 10/265,083 entitled Adjuvant Compositions, filed Oct. 3, 2002, now U.S. Pat. No. 7,550,145. This application also claims priority to PCT Application No. PCT/US02/10869, filed Apr. 5, 2002, PCT Application No. PCT/US02/30423 entitled Adjuvant Compositions, filed Sep. 24, 2002, and PCT Application No. PCT/US02/31486 entitled Adjuvant Compositions, filed Oct. 3, 2002. All documents cited herein are incorporated by reference in their entirety.
SUBMISSION OF SEQUENCE LISTING ON ASCII TEXT FILE
The content of the following submission on ASCII text file is incorporated herein by reference in its entirety: a computer readable form (CRF) of the Sequence Listing (file name: 223002126030SEQLIST.txt, date recorded: Aug. 16, 2012, size: 5 KB).
TECHNICAL FIELD
The invention relates to vaccines, more particularly those against Neisseria meningitidis.
BACKGROUND ART
Genome sequences for Neisseria meningitidis (meningococcus) serogroups A [1] and B [2,3] have been reported. The serogroup B sequence has been studied to identify vaccine antigens [e.g. refs. 4 to 9] and candidate antigens have been manipulated to improve heterologous expression [refs. 10 to 12].
Antigens generally require the co-administration of adjuvants in order to enhance their immunogenicity in vaccines [13]. Freund's adjuvant has been used for serogroup B meningococcus [9], and the licensed vaccine Menjugate™ against serogroup C uses aluminium hydroxide [14]. Enhancement of the bactericidal activity of Neisseria antigens has also been reported by using oligonucleotide adjuvants containing CpG motifs [15].
It is an object of the invention to provide further and improved adjuvants for Neisserial antigens.
DISCLOSURE OF THE INVENTION
It has been found that a combination of CpG oligonucleotides and polymer microparticles is an extremely effective adjuvant for Neisserial antigens, with the combination giving much better results than either of the individual components. The invention therefore provides a composition comprising: (a) a Neisserial antigen; (b) a CpG oligonucleotide; and (c) a biodegradable polymer microparticle.
The Neisserial Antigen
The Neisserial antigen may be a protein antigen, nucleic acid encoding a protein antigen, or a saccharide antigen. The antigen preferably elicits a bactericidal or protective immune response (e g antibody response) in a recipient mammal.
The antigen may be derived from any species of Neisseria including N. gonorrhoeae, N lactamica and N. meningitidis. It is preferably a N. meningitidis antigen and may be from any serogroup. Where the antigen is from serogroup B, it is preferred to use a protein antigen; where it is from serogroup A, C, W135 or Y then it is preferred to use a saccharide antigen. Where saccharide antigens are used, these will typically be derived from the bacterial capsular polysaccharide (e.g. oligosaccharides, such as those obtained by hydrolysis), and they will typically be conjugated to carrier proteins (e.g. to CRM197).
Preferred protein antigens derived from serogroup B N. meningitidis are:
    • a protein disclosed in any one of references 4, 5, 6, 7, 8 or 9 (in particular the 446 even SEQ IDs (i.e. 2, 4, 6, . . . , 890, 892) disclosed in reference 4, the 45 even SEQ IDs (i.e. 2, 4, 6, . . . , 88, 90) disclosed in reference 5 and the 1674 even SEQ IDs 2-3020, even SEQ IDs 3040-3114, and all SEQ IDs 3115-3241, disclosed in reference 6);
    • a protein comprising an immunogenic fragment of one or more of the proteins disclosed in any one of references 4, 5, 6, 7, 8 or 9.
    • a protein comprising a sequence having sequence identity (preferably greater than 50% e.g. 60%, 70%, 80%, 90%, 95%, 99% or more) to one or more of the proteins disclosed in any one of references 4, 5, 6, 7, 8 or 9.
    • a protein disclosed in any one of references 10, 11 or 12.
    • a protein comprising a sequence having sequence identity (preferably greater than 50% e.g. 60%, 70%, 80%, 90%, 95%, 99% or more) to one or more of the proteins disclosed in any one of references 10, 11 or 12.
A particularly preferred protein antigen from serogroup B N. meningitidis is protein ‘287’. This protein may be used in a wild-type form [e.g. GenBank accession gi:7228690, i.e., MFKRSVIAMACIFALSACGGGGGGSPDVKSADTLSKPAAPVVSEKETEAKEDAPQAGSQ GQGAPSAQGGQDMAAVSEENTGNGGAAATDKPKNEDEGAQNDMPQNAADTDSLTPN HTPASNMPAGNMENQAPDAGESEQPANQPDMANTADGMQGDDPSAGGENAGNTAAQ GTNQAENNQTAGSQNPASSTNPSATNSGGDFGRTNVGNSVVIDGPSQNITLTHCKGDSC SGNNFLDEEVQLKSEFEKLSDADKISNYKKDGKNDGKNDKFVGLVADSVQMKGINQYII FYKPKPTSFARFRRSARSRRSLPAEMPLIPVNQADTLIVDGEAVSLTGHSGNIFAPEGNYR YLTYGAEKLPGGSYALRVQGEPSKGEMLAGTAVYNGEVLHFHTENGRPSPSRGRFAAK VDFGSKSVDGIIDSGDGLHMGTQKFKAAIDGNGFKGTWTENGGGDVSGKFYGPAGEEV AGKYSYRPTDAEKGGFGVFAGKKEQD (SEQ ID NO 1); alignments of polymorphic forms of 287 are shown in FIGS. 5 & 15 of ref. 8] but derivatives of the wild-type protein may be used. For instance, proteins having 50% or more sequence identity (e.g. 60%, 70%, 80%, 90%, 95%, 99% or more) to gi:7228690 may be used. Proteins comprising truncation or deletion variants of the protein may be used, such as the N-terminal truncated forms disclosed in references 10 to 12 (‘ΔG287’ in particular, in which the N-terminus of the protein up to and including the six repeated glycine residues is deleted). Fusion proteins comprising such 287 sequences may be used. All of these forms of 287, and more particularly those which retain the immunogenicity of wild-type 287 proteins, fall within the meaning of ‘287’ as used herein.
Another particularly preferred protein antigen from serogroup B N. meningitidis is protein ‘961’, also known as ‘NadA’ [16]. This protein may be used in a wild-type form [e.g. GenBank accession gi:7227256; alleles of 961 are disclosed in ref. 17] but derivatives of the wild-type protein may be used. For instance, proteins having 50% or more sequence identity (e.g. 60%, 70%, 80%, 90%, 95%, 99% or more) to gi:7227256 may be used. Proteins comprising truncation or deletion variants of the protein may be used, such as those disclosed in references 10 to 12 (‘961c’ in particular, which lacks the C-terminal membrane anchor). Fusion proteins comprising such 961 sequences may be used. All of these forms of 961, and particularly those which retain the immunogenicity of wild-type 961 proteins, fall within the meaning of ‘961’ or ‘NadA’ as used herein.
Other preferred protein antigens are protein ‘741’ and protein ‘ORF46.1’, and proteins ‘ORF1’, ‘ORF4’, ‘ORF25’, ‘ORF40’, ‘ORF83’, ‘NMB1343’, ‘230’, ‘233’, ‘292’, ‘594’, ‘687’, ‘736’, ‘907’, ‘919’, ‘936’, ‘953’, and ‘983’. Other preferred protein antigens are the hybrid proteins disclosed in references 10 to 12, particularly those comprising one or more of: a 287 protein, a 953 protein, a 936 protein and/or a 741 protein.
Protein antigens may be derived from any strain of N. meningitidis. It is preferred to use antigens from strains 2996, MC58, 95N477 and 394/98.
As well as strain variants, single or multiple conservative amino acid substitutions may be made with altering the immunogenicity of antigens used according to the present invention.
In addition to or in place of protein antigens, nucleic acid encoding a protein antigen may be included within compositions of the invention. The nucleic acid will be expressed in vivo once administered to a mammalian recipient and the protein antigen will be produced: Such nucleic acid immunization is well known [e.g. refs. 18 to 23 etc.]. The nucleic acid will typically be a DNA plasmid.
A preferred saccharide antigen derived from serogroup C N. meningitidisis the oligosaccharide conjugate used in Menjugate™ [24, 25], which contains 12 to 22 monosaccharide units from the serogroup C capsular polysaccharide.
A preferred saccharide antigen derived from serogroup A is an oligosaccharide in which one or more of the hydroxyl groups on the constituent monosaccharide units has been replaced by a blocking group [26].
Further oligosaccharide antigens from serogroups A, W135 and Y are disclosed in reference 27.
The composition of the invention may comprise more than one Neisserial antigen. Where saccharides from both serogroups A and C of N. meningitidis are included, it is preferred that the ratio (w/w) of MenA saccharide:MenC saccharide is greater than 1 (e.g. 2:1, 3:1, 4:1, 5:1, 10:1 or higher).
The composition of the invention is preferably an immunogenic composition or vaccine. Such compositions comprise an immunologically effective amount of the antigen. By ‘immunologically effective amount’, it is meant that the administration to an individual of a composition of the invention comprising that amount of antigen (either in a single dose or as part of a series) is effective for raising a therapeutic or prophylactic immune response. This amount varies depending upon the health and physical condition of the individual to be treated, age, the taxonomic group of individual to be treated (e.g. non-human primate, primate, etc.), the capacity of the individual's immune system to synthesise antibodies, the degree of protection desired, the formulation of the vaccine, the treating physician's assessment of the medical situation, and other relevant factors. The amount may fall in a relatively broad range that can be determined through routine trials. Antigens will typically be present at a concentration of at least 1 μg/ml each.
Dosage treatment may be a single dose or a multiple dose schedule (e.g. including booster doses).
The CpG Oligonucleotide
CpG oligonucleotides are known for use as vaccine adjuvants [e.g. ref. 28] and they induce strong Thl immune responses. They are useful as parenteral and mucosal adjuvants [29].
The CpG oligonucleotide used according to the present invention is a nucleic acid which includes at least one CG dinucleotide i.e. a cytosine nucleotide followed by a guanosine nucleotide. The oligonucleotide may contain multiple CG dinucleotides.
A CG sequence in the oligonucleotide may be flanked by two purines at the 5′ side and two pyrimidines at the 3′ side i.e. RRCGYY.
Cytosine nucleotides in the CpG oligonucleotide may be methylated, but it is preferred that they should be unmethylated.
The cytosine and guanosine nucleotides are preferably deoxynucleotides and the nucleic acid is preferably DNA. In order to enhance nuclease resistance, the oligonucleotide may comprise a modified backbone, such as a phosphorothioate backbone. As an alternative to using DNA, it is possible to use PNA (peptide nucleic acid). In addition, the oligonucleotides can comprise substitutions of the sugar moieties and nitrogenous base moieties.
The oligonucleotide preferably comprises between about 6 and about 100 nucleotides, more preferably between about 8 and about 50 nucleotides, most preferably between about 10 and about 40 nucleotides.
Oligonucleotides comprising at least one CG dinucleotide can conveniently be prepared using conventional oligonucleotide synthesis.
Examples of CpG oligonucleotide adjuvants are found in references 30 to 55.
The Biodegralable Polymer Microparticle
Biodegradable polymer microparticles are known for use as vaccine adjuvants [e.g. ref. 56]. They are useful as parenteral and mucosal adjuvants.
As well as being biodegradable, the polymer used to make the microparticles will generally be sterilizable and non-toxic (biocompatible). Suitable biodegradable polymers are readily commercially available and include those derived from polyhydroxybutyric acid; polycaprolactone; polyorthoester; polyanhydride; poly(hydoxybutyrate); and a poly(α-hydroxy acid). Preferred polymers are formed from one or more poly(α-hydroxy acid) e.g. poly(L-lactide), poly(D,L-lactide), copolymers of D,L-lactide and glycolide (such as poly(D,L-lactide-co-glycolide), or a copolymer of D,L-lactide and caprolactone. Microparticles formed from poly(D,L-lactide-co-glycolide) (‘PLG’) are preferred.
These polymers are available in a variety of molecular weights, and the appropriate molecular weight for a given antigen can readily be determined. For poly(L-lactide), a suitable molecular weight will be on the order of about 2000 to 250,000. For PLG, suitable molecular weights will generally range from about 10,000 to about 200,000, preferably about 15,000 to about 150,000, and most preferably about 50,000 to about 100,000.
For PLG microparticles, a variety of lactide:glycolide ratios may be used and the ratio is largely a matter of choice, depending in part on the co-administered antigen and the rate of degradation desired. For example, a 50:50 PLG polymer, containing 50% D,L-lactide and 50% glycolide, will provide a fast resorbing copolymer while 75:25 PLG degrades more slowly, and 85:15 and 90:10, even more slowly, due to the increased lactide component. A suitable ratio of lactide:glycolide is easily determined based on the nature of the antigen and disorder in question. Moreover, mixtures of microparticles with varying lactide:glycolide ratios will find use in the formulations in order to achieve the desired release kinetics for a given antigen and to provide for both a primary and secondary immune response. Degradation rate of the microparticles of the present invention can also be controlled by such factors as polymer molecular weight and polymer crystallinity.
The term ‘microparticle’ as used herein, refers to a particle of about 100 nm to about 150 μm in diameter, more preferably about 200 nm to about 30 μm in diameter, and most preferably about 500 nm to about 10 μm in diameter. Preferably, the microparticle will be of a diameter that permits parenteral administration without occluding needles and capillaries. Microparticle size is readily determined by techniques well known in the art, such as photon correlation spectroscopy, laser diffractometry and/or scanning electron microscopy. The term ‘microparticle’ includes ‘nanoparticles’ [57] within its scope. Preferred microparticles are microspheres, although lamellar particles [58] may also be used.
Microparticles may be prepared using any of several methods well known in the art [e.g ref. 59]. For example, double emulsion/solvent evaporation techniques [e.g. refs. 60 & 61] can be used to form the microparticles. These techniques involve the formation of a primary emulsion consisting of droplets of polymer solution containing the antigen (if antigen is to be entrapped in the microparticle), which is subsequently mixed with a continuous aqueous phase containing a particle stabilizer/surfactant.
More particularly, a water-in-oil-in-water (w/o/w) solvent evaporation system can be used to form the microparticles, as described in references 62, 63 and 64. In this technique, the particular polymer is combined with an organic solvent, such as ethyl acetate, dimethylchloride (also called methylene chloride and dichloromethane), acetonitrile, acetone, chloroform, and the like. The polymer will be provided in about a 2-15% solution, in organic solvent. An approximately equal amount of an antigen solution (e.g. in water) is added and the polymer/antigen solution emulsified using e.g. a homogenizer. The emulsion is then combined with a larger volume of an aqueous solution of an emulsion stabilizer such as polyvinyl alcohol (PVA) or polyvinyl pyrrolidone. The emulsion stabilizer is typically provided in about a 2-15% solution, more typically about a 4-10% solution. The mixture is then homogenized to produce a stable w/o/w double emulsion. Organic solvents are then evaporated.
The formulation parameters can be manipulated to allow the preparation of small (<5 μm) and large (>30 μm) microparticles [e.g. 63, 65]. For example, reduced agitation results in larger microparticles, as does an increase in internal phase volume. Small particles are produced by low aqueous phase volumes with high concentrations of PVA.
Microparticles can also be formed using spray-drying and coacervation [e.g. refs. 66, 67 & 68]; air-suspension coating techniques, such as pan coating and Wurster coating [69, 70]; ionic gelation [71].
Prior to use of the microparticles, antigen content is generally determined so that an appropriate amount of the microparticles may be delivered to the subject in order to elicit an adequate immune response.
Antigen content of the microparticles can be determined according to methods known in the art, such as by disrupting the microparticles and extracting entrapped antigen. For example, microparticles can be dissolved in dimethylchloride and the protein extracted into distilled water [e.g. refs. 72, 73, 74]. Alternatively, microparticles can be dispersed in 0.1 M NaOH containing 5% (w/v) SDS. The sample is agitated, centrifuged and the supernatant assayed for antigen using an appropriate assay [75].
Antigen and/or CpG-oligonucleotides can be located within or on the microparticles. Entrapment will generally be achieved by having the antigen/oligonucleotide present during formation of the microparticles, whereas surface adsorption is achieved by adding antigen/oligonucleotide to preformed microparticles.
One method for adsorbing antigen/oligonucleotide onto prepared microparticles is as follows. Microparticles are rehydrated and dispersed to an essentially monomeric suspension of microparticles using dialyzable anionic or cationic detergents. Useful detergents include, but are not limited to, any of the various N-methylglucamides (known as MEGAs), such as heptanoyl-N-methylglucamide (MEGA-7), octanoyl-N-methylglucamide (MEGA-8), nonanoyl-N-methylglucamide (MEGA-9), and decanoyl-N-methyl-glucamide (MEGA-10); cholic acid; sodium cholate; deoxycholic acid; sodium deoxycholate; taurocholic acid; sodium taurocholate; taurodeoxycholic acid; sodium taurodeoxycholate; 3-[(3-cholamidopropyl)dimethylammonio]-1-propane-sulfonate (CHAPS); N-octylglucoside; 3-[(3-cholamidopropyl) dimethylammonio]-2-hydroxy-1-propane-sulfonate (CHAPSO); N-dodecyl-N,N-dimethyl-3-ammonio-1-propane-sulfonate (ZWITTERGENT 3-12); N,N-bis-(3-D-gluconeamidopropyl)-deoxycholamide (DEOXY-BIGCHAP); sucrose monolaurate; glycocholic acid/sodium glycocholate; laurosarcosine (sodium salt); glycodeoxycholic acid/sodium glycodeoxycholate; sodium dodceyl sulfate (SDS); and hexadecyltrimethylammonium bromide (CTAB); dodecyltrimethylammonium bromide; hexadecyltrimethyl-ammonium bromide; tetradecyltrimethylammonium bromide; benzyl dimethyidodecylammonium bromide; benzyl dimethylhexadecylammonium chloride; benzyl dimethyltetra-decylammonium bromide. The above detergents are commercially available. Various cationic lipids known in the art can also be used as detergents [76, 77].
The microparticle/detergent mixture is then physically ground e.g. using a ceramic mortar and pestle, until a smooth slurry is formed. An appropriate aqueous buffer, such as phosphate buffered saline (PBS) or Tris buffered saline, is then added and the resulting mixture sonicated or homogenized until the microparticles are fully suspended. The antigen/oligonucleotide is then added to the microparticle suspension and the system dialyzed to remove detergent. The polymer microparticles and detergent system are preferably chosen such that the antigen/oligonucleotide will adsorb to the microparticle surface while still maintaining activity. The resulting microparticles containing surface adsorbed antigen/oligonucleotide may be washed free of unbound antigen/oligonucleotide and stored as a suspension in an appropriate buffer formulation, or lyophilized with the appropriate excipients, as described further below.
The Antigen/CpG/Microparticle Combination
Various physical relationships are possible between the three basic components of the compositions of the invention. These arise because the microparticles have an internal volume and a surface, either of which may be used to locate the CpG-oligonucleotide and/or the antigen.
Thus, the antigen may be entrapped within microparticles, it may be adsorbed to microparticles, or it may be in simple admixture with the microparticles without entrapment or adsorption. Adsorption is preferred.
Similarly, the CpG-oligonucleotide may be entrapped within microparticles, it may be adsorbed to microparticles, or it may be in simple admixture with the microparticles. Adsorption can be achieved using detergents such as CTAB.
The CpG-oligonucleotide and the antigen may both have the same physical relationship to the microparticles as each other, or they may be different. Likewise the CpG-oligonucleotide and the antigen may be adsorbed onto the same microparticle or the CpG-oligonucleotide and the antigen may be adsorbed onto different microparticles. All possible combinations are encompassed within the present invention:
CpG-oligonucleotide
Entrapped Adsorbed Mixed
Antigen
Entrapped Yes Yes Yes
Adsorbed Yes Yes Yes
Mixed Yes Yes Yes
Compositions of the invention may include mixtures of the above e.g. some microparticles within the composition have entrapped antigen and some have adsorbed antigen.
Pharmaceutical Compositions
For pharmaceutical use, compositions of the invention will generally comprise a pharmaceutically acceptable carrier. This gives a pharmaceutical composition of the invention.
A pharmaceutically acceptable carrier can be any substance that does not itself induce the production of antibodies harmful to the patient receiving the composition, and which can be administered without undue toxicity. Suitable carriers can be large, slowly-metabolised macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, and inactive virus particles. Such carriers are well known to those of ordinary skill in the art. Pharmaceutically acceptable carriers can include liquids such as water, saline, glycerol and ethanol. Auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, can also be present in such vehicles. Liposomes are suitable carriers. A thorough discussion of pharmaceutical carriers is available in ref. 78.
Compositions of the invention may be prepared in various forms. For example, the compositions may be prepared as injectables, either as liquid solutions or suspensions. Solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection can also be prepared. The composition may be prepared for topical administration e.g. as an ointment, cream or powder. The composition be prepared for oral administration e.g. as a tablet or capsule, or as a syrup (optionally flavoured). The composition may be prepared for pulmonary administration e.g. as an inhaler, using a fine powder or a spray. The composition may be prepared as a suppository or pessary. The composition may be prepared for nasal, aural or ocular administration e.g. as drops, as a spray, or as a powder [e.g. 79].
The pharmaceutical composition is preferably sterile. It is preferably pyrogen-free. It is preferably buffered e.g. at between pH 6 and pH 8, generally around pH 7.
The pharmaceutical composition may be lyophilised.
The invention also provides a delivery device containing a pharmaceutical composition of the invention. The device may be, for example, a syringe.
Medical Treatments and Uses
Compositions of the invention may be used therapeutically (i.e. to treat an existing Neisserial infection) or prophylactically (i.e. to prevent future Neisserial infection).
The invention provides a composition of the invention for use as a medicament.
The invention also provides a method for raising an antibody response in a mammal, comprising administering a pharmaceutical composition of the invention to the mammal. The antibody response is preferably an IgA or IgG response and it is preferably bactericidal.
The invention also provides a method for treating a mammal suffering from a Neisserial infection and/or disease, comprising administering to the patient a pharmaceutical composition of the invention.
The invention also provides a method for protecting a mammal against a Neisserial infection and/or disease, comprising administering to the mammal a pharmaceutical composition of the invention.
The invention also provides the use of (a) a Neisserial antigen, (b) a CpG oligonucleotide, and (c) a biodegradable polymer microparticle, in the manufacture of a medicament for preventing or treating disease and/or infection in an mammal.
The mammal is preferably a human. The human may be an adult or, preferably, a child.
Compositions of the invention are particularly useful for immunising children and teenagers.
The uses and methods of the invention are particularly useful for treating/protecting against infections of N. meningitidis. The uses and methods are particularly useful for preventing/treating diseases including bacterial meningitis.
Efficacy of therapeutic treatment can be tested by monitoring Neisserial infection after administration of the composition of the invention. Efficacy of prophylactic treatment can be tested by monitoring anti-Neisseria immune responses after administration of the composition.
Compositions of the invention will generally be administered directly to a patient. Direct delivery may be accomplished by parenteral injection (e.g. subcutaneously, intraperitoneally, intravenously, intramuscularly, or to the interstitial space of a tissue), or by rectal, oral, vaginal, topical, transdermal, ocular, nasal, aural, or pulmonary administration. Injection or intranasal administration is preferred.
Dosage treatment can be a single dose schedule or a multiple dose schedule.
Further Components
Compositions of the invention may include adjuvants in addition to CpG-oligonucleotides and polymer microparticles. Preferred further adjuvants include, but are not limited to: (A) aluminium compounds (e.g. aluminium hydroxide, aluminium phosphate, aluminium hydroxyphosphate, oxyhydroxide, orthophosphate, sulphate etc. [e.g. see chapters 8 & 9 of ref. 13]), or mixtures of different aluminium compounds, with the compounds taking any suitable form (e.g. gel, crystalline, amorphous etc.), and with adsorption being preferred; (B) MF59 (5% Squalene, 0.5% Tween®80, and 0.5% Span ®85, formulated into submicron particles using a microfluidizer) [see Chapter 10 of 13; see also ref. 80]; (C) liposomes [see Chapters 13 and 14 of ref. 13]; (D) ISCOMs [see Chapter 23 of ref. 13], which may be devoid of additional detergent [81]; (E) SAF, containing 10% Squalane, 0.4% Tween®80, 5% pluronic-block polymer L121, and thr-MDP, either microfluidized into a submicron emulsion or vortexed to generate a larger particle size emulsion [see Chapter 12 of ref. 13]; (F) Ribi™ adjuvant system (RAS), (Ribi Immunochem) containing 2% Squalene, 0.2% Tween®80, and one or more bacterial cell wall components from the group consisting of monophosphorylipid A (MPL), trehalose dimycolate (TDM), and cell wall skeleton (CWS), preferably MPL+ CWS (Detox™); (G) saponin adjuvants, such as QuilA or QS21 [see Chapter 22 of ref. 13], also known as Stimulon™ [82]; (H) chitosan [e.g. 83]; (I) complete Freund's adjuvant (CFA) and incomplete Freund's adjuvant (IFA); (J) cytokines, such as interleukins (e.g. IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12, etc.), interferons (e.g. interferon-γ), macrophage colony stimulating factor, tumor necrosis factor, etc. [see Chapters 27 & 28 of ref. 13]; (K) monophosphoryl lipid A (MPL) or 3-O-deacylated MPL (3dMPL) [e.g. chapter 21 of ref. 13]; (L) combinations of 3dMPL with, for example, QS21 and/or oil-in-water emulsions [84]; (M) a polyoxyethylene ether or a polyoxyethylene ester [85]; (N) a polyoxyethylene sorbitan ester surfactant in combination with an octoxynol [86] or a polyoxyethylene alkyl ether or ester surfactant in combination with at least one additional non-ionic surfactant such as an octoxynol [87]; (N) a particle of metal salt [88]; (O) a saponin and an oil-in-water emulsion [89]; (P) a saponin (e.g. QS21)+3dMPL+IL-12 (optionally+a sterol) [90]; (Q) E. coli heat-labile enterotoxin (“LT”), or detoxified mutants thereof, such as the K63 or R72 mutants [e.g. Chapter 5 of ref. 91]; (R) cholera toxin (“CT”), or detoxified mutants thereof [e.g. Chapter 5 of ref. 91]; (S) double-stranded RNA and (T) other substances that act as immunostimulating agents to enhance the effectiveness of the composition [e.g. see Chapter 7 of ref. 13]. Alum (especially aluminium phosphate and/or hydroxide) and MF59 are preferred further adjuvants for parenteral immunisation. Mutant toxins are preferred mucosal adjuvants.
Muramyl peptides include N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-normuramyl -L-alanyl-D-isoglutamine (nor-MDP), N-acetylmuramyl-L-alanyl-D-isogl utaminyl-L-alanine-2-(1′-2′-dipal mitoyl-sn-glycero-3-hydroxyphosphoryloxy)-ethylamine MTP-PE), etc.
As well as Neisserial antigen(s), the composition may comprise further antigenic components. Antigens which can be included in the composition of the invention include:
    • antigens from Helicobacter pylori such as CagA [92 to 95], VacA [96, 97], NAP [98, 99, 100], HopX [e.g. 101], HopY [e.g. 101] and/or urease.
    • an outer-membrane vesicle (OMV) preparation from N. meningitidisserogroup B, such as those disclosed in refs. 102, 103, 104, 105 etc.
    • a saccharide antigen from Streptococcus pneumoniae [e.g. 106, 107, 108].
    • an antigen from hepatitis A virus, such as inactivated virus [e.g. 109, 110].
    • an antigen from hepatitis B virus, such as the surface and/or core antigens [e.g. 110, 11].
    • an antigen from hepatitis C virus [e.g. 112].
    • an antigen from Bordetella pertussis, such as pertussis holotoxin (PT) and filamentous haemagglutinin (FHA) from B. pertussis, optionally also in combination with pertactin and/or agglutinogens 2 and 3 [e.g. refs. 113 & 114].
    • a diphtheria antigen, such as a diphtheria toxoid [e.g. chapter 3 of ref. 115] e.g. the CRM197 mutant [e.g 116].
    • a tetanus antigen, such as a tetanus toxoid [e.g. chapter 4 of ref. 115].
    • a saccharide antigen from Haemophilus influenzae B [e.g. 23].
    • an antigen from Chlamydia pneumoniae [e.g 117, 118, 119, 120, 121, 122, 123].
    • an antigen from Chlamydia trachomatis [e.g. 124].
    • an antigen from Porphyromonas gingivalis [e.g. 125].
    • polio antigen(s) [e.g. 126, 127] such as IPV or OPV.
    • rabies antigen(s) [e.g. 128] such as lyophilised inactivated virus [e.g. 129, RabAvert™].
    • measles, mumps and/or rubella antigens [e.g chapters 9, 10 & 11 of ref. 115].
    • antigen(s) from influenza virus [e.g. chapter 19 of ref. 115], such as the haemagglutinin and/or neuraminidase surface proteins
    • antigen(s) from a paarmyxovirus such as respiratory syncytial virus (RSV [130, 131]) and/or parainfluenza virus (PIV3 [132]).
    • an antigen from Moraxella catarrhalis [e.g. 133].
    • an antigen from Streptococcus agalactiae (group B streptococcus) [e.g. 134, 135].
    • an antigen from Streptococcus pyogenes (group A streptococcus) [e.g. 135, 136, 137].
    • an antigen from Staphylococcus aureus [e.g. 138].
    • an antigen from Bacillus anthracis [e.g. 139, 140, 141].
    • an antigen from a virus in the flaviviridae family (genus flavivirus), such as from yellow fever virus, Japanese encephalitis virus, four serotypes of Dengue viruses, tick-borne encephalitis virus, West Nile virus.
    • a pestivirus antigen, such as from classical porcine fever virus, bovine viral diarrhoea virus, and/or border disease virus.
    • a parvovirus antigen e.g. from parvovirus B19.
    • a prion protein (e.g the CJD prion protein)
    • an amyloid protein, such as a beta peptide [142]
    • a cancer antigen, such as those listed in Table 1 of ref. 143 or in tables 3 & 4 of ref. 144.
The composition may comprise one or more of these further antigens.
Toxic protein antigens may be detoxified where necessary (e.g. detoxification of pertussis toxin by chemical and/or genetic means [114]).
Where a diphtheria antigen is included in the composition it is preferred also to include tetanus antigen and pertussis antigens. Similarly, where a tetanus antigen is included it is preferred also to include diphtheria and pertussis antigens. Similarly, where a pertussis antigen is included it is preferred also to include diphtheria and tetanus antigens.
Antigens are preferably adsorbed to an aluminium salt.
Antigens in the composition will typically be present at a concentration of at least 1 μg/ml each.
In general, the concentration of any given antigen will be sufficient to elicit an immune response against that antigen.
As an alternative to using proteins antigens in the composition of the invention, nucleic acid encoding the antigen may be used. Protein components of the compositions of the invention may thus be replaced by nucleic acid (preferably DNA e.g. in the form of a plasmid) that encodes the protein.
Definitions
The term “comprising” means “including” as well as “consisting” e.g. a composition “comprising” X may consist exclusively of X or may include something additional e.g. X+Y.
References to a percentage sequence identity between two amino acid sequences means that, when aligned, that percentage of amino acids are the same in comparing the two sequences. This alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in section 7.7.18 of reference 145. A preferred alignment is determined by the Smith-Waterman homology search algorithm using an affine gap search with a gap open penalty of 12 and a gap extension penalty of 2, BLOSUM matrix of 62. The Smith-Waterman homology search algorithm is taught in reference 146.
MODES FOR CARRYING OUT THE INVENTION
Parenteral Prime & Mucosal Boost with Neisseria meningitidis Serogroup B Antigen
Reference 6 discloses a protein from serogroup B N. meningitidis called ‘287’. References 10 to 12 disclose ways of improving its expression. One way involves deleting the N-terminus of the protein up to and including the six repeated glycine residues. This protein is referred to as ‘ΔG287’.
Mice were primed and boosted with MenB ΔG287 antigen (20 μg/dose) from strain 2996, formulated for intramuscular (IM) administration by adsorption to PLG microparticles, with or without CpG oligonucleotide (also adsorbed to the microparticles). An additional formulation for intranasal (IN) administration used LT-K63 adjuvant. Mice received either 3 IM doses or 2 IM then 2 IN doses (doses at: day 0; day 28; day 84; and, optionally, day 98).
Antibody GMT
2 weeks after
Group Formulation Route Dose dose 2 Dose 3 dose 4
1 PLG/287 IM 1, 2, 3 10,729 2,853
2 PLG/287 + IM 1, 2, 3 15,673 4,163
PLG/CpG
3 PLG/287 IM 1, 2 9,064 7,948 9,412
287 + LT-K63 IN 3, 4
4 PLG/287 + IM 1, 2 34,891 15,167 16,556
PLG/CpG
287 + LT-K63 IN 3, 4
Thus, the inclusion of CpG-oligonucleotide enhanced antibody titers against intramuscularly administered MenB protein 287 (compare groups 1 & 2). Titers could be enhanced by replacing a third intramuscular dose with two intranasal doses (compare groups 1 & 3). The CpG enhancement was also seen in the intramuscular/intranasal regime (compare groups 3 & 4).
Comparison of Adjuvants for MenB Protein 287
ΔG287 was formulated with various adjuvants and administered to mice. Sera from the mice were assessed using the bactericidal antibody (BCA) assay and titers were as follows:
Adjuvant BCA post-2 BCA post-3
Freund's adjuvant 2048 8192
Alum <4 256
Alum + CpG oligonucleotide 256 4096
MF59 <4 <4
CpG oligonucleotide <4 128
PLG microparticles (adsorbed) 8 1024
PLG microparticles (adsorbed) + CpG 2048 16384
CpG-oligonucleotide was thus only mildly effective as an adjuvant, almost comparable to alum. The PLG microparticles were more effective than both alum and CpG, but not as effective as Freund's adjuvant. In marked contrast, however, the mixture of CpG and PLG matched the adjuvanticity of Freund's adjuvant at the post-second immunization stage and exceeded Freund's adjuvant post-third immunization.
Enhancement of PLG adjuvanticity by using CpG was also seen in a separate study (02-0279):
Adjuvant GMT post-2 GMT post-3
MF59 6967 13417
PLG microparticles (adsorbed) 7070 11367
PLG microparticles (adsorbed) + CpG 15099 26833

Effect of Adsorption on Adjuvanticity
The effect of adsorption on adjuvanticity was studied. Protein ΔG287 was either adsorbed onto PLG microparticles using DSS surfactant or SDS or was simply mixed with the particles. Immunisations were performed on days 0, 21 and 35 and titers were assessed on days 35 and 49. Results were as follows:
Antibody titer 2 weeks after
Formulation BCA dose 2 Dose 3
CpG + 287 adsorbed on PLG (DSS) 4096 45817 67921
CpG + 287 adsorbed on PLG (SDS) 4096 39730 29911
CpG + 287 + PLG (no adsorption) <16 62 1065
DSS + 287 adsorbed on alum <16 1209 1249
CpG + 287 adsorbed on Alum 1024 4054 12236
287 adsorbed on alum 128 646 2454
The adjuvanticity of CpG and microparticle mixtures for ΔG287 is thus optimal when the antigen is adsorbed to microparticles.
Reference 6 discloses a protein from serogroup B N. meningitidis called ‘961’ (now known as ‘NadA’ [16,17]). References 10 to 12 disclose ways of improving the expression of NadA. One way involves deleting the C-terminus of the protein to remove its membrane anchor (i.e. remove amino acids 351-405 for strain 2996), as well as natural removal of its leader peptide. This protein is referred to as ‘961 c’. The effect of adsorption on PLG adjuvanticity when co-administered with CpG was studied for 961c, as described above for 287:
Antibody titer 2
Formulation BCA weeks after dose 3
961 adsorbed on PLG (SDS) 2048 20661
961 + PLG (no adsorption) 256 1706
287 adsorbed on PLG 4096 63057
287 adsorbed on PLG + 4096 287: 86052; 961: 1924
961 soluble
287 adsorbed on PLG + 8192 287: 107142; 961: 11717
961 adsorbed on PLG
287 (not adsorbed) + 961 1024 287: 1266; 961: 145
(not adsorbed) + ‘blank’ PLG
287 (adsorbed) + 961 8192 287: 78176; 961: 20876
(adsorbed) + ‘blank’ PLG
As for ΔG287, therefore, the adjuvanticity of CpG and microparticle mixtures for 961c is optimal when the antigen is adsorbed to microparticles. This is true for the antigen on its own and the antigen when combined with ΔG287.
For both ΔG287 and 961c, therefore, singly and combined, the best adjuvanticity for CpG and PLG mixtures is seen when the antigens are adsorbed onto the PLG microparticles.
PLG, CpG, alum and MF59
Various combinations of PLG, CpG and alum were tested for protein ΔG287, expressed as a His-tagged product. Serum bactericidal titers after three immunisations were as follows:
Adjuvant Titer
Alum 2048
Alum + CpG 32768
MF59 8192
MF59 + CpG 32768
PLG (antigen adsorbed to PLG) 1024
PLG + CpG (antigen and CpG both adsorbed to PLG) 4096
PLG + MF59 (antigen adsorbed to PLG) 2048
PLG + MF59 + CpG (antigen adsorbed to PLG) 8192
Complete Freund's 32768
PLG + Complete Freund's (antigen adsorbed to PLG) 2048
Similar experiments were performed and results were as follows:
Adjuvant Titer
PLG (antigen adsorbed to PLG) 1024
PLG + CpG (antigen adsorbed to PLG) 16384
PLG + CpG (antigen and CpG both adsorbed to PLG) 16384
PLG + alum (antigen adsorbed to PLG) 1024
PLG + alum + CpG (antigen adsorbed to PLG) 16384
PLG + alum + CpG (antigen and CpG both 8192
adsorbed to PLG)
PLG + MF59 (antigen adsorbed to PLG) 4096
PLG + MF59 + CpG (antigen adsorbed to PLG) 16384
Alum (antigen adsorbed to alum) 256
CpG 128
Alum + CpG 1024
Alum + CpG + PLG (antigen adsorbed to alum; 4096
CpG adsorbed to PLG)
CpG + PLG (CpG adsorbed on PLG; antigen 64
not adsorbed)
Thus, MF59 and alum can further enhance efficacy of CpG/PLG mixtures, adsorption of CpG to PLG microparticles is not necessary for adjuvanticity, but adsorption of antigen to microparticles is again seen to be optimal.
Antigen Mixtures
The effect of adsorption on adjuvanticity was studied for proteins ΔG287 and 961 c, singly and in combination. Antibody titers after three doses were as follows:
Antibody GMT against
Formulation 287 961
CpG + 961 adsorbed on PLG 20661
CpG + 961 + PLG (no adsorption) 1706
CpG + 961 + 287 adsorbed on PLG 86052 1924
CpG + 961 adsorbed on PLG + 287 107142 11717
adsorbed on PLG
CpG + 287 adsorbed on PLG 63057
CpG + 287 & 961 co-adsorbed on PLG 57306 6251
CpG + 961 adsorbed on PLG + 287 78176 20876
adsorbed on PLG + PLG
287 + 961 + PLG (no adsorption 1266 145
of antigens)
As for ΔG287, therefore, the adjuvanticity of CpG and microparticle mixtures for protein 961 c is optimal when the antigen is adsorbed to microparticles.
Further combinations of adjuvants with PLG microparticles were tested for proteins ΔG287 and 961c. The CpG was either soluble or was adsorbed to PLG microparticles. Results were as follows:
GMT against
Formulation + PLG microparticles BCA 287 961
287 (adsorbed on PLG) + 961 256 5719 2412
(adsorbed on PLG)
287 (adsorbed on PLG) + 961 512 17553 8627
(adsorbed on PLG) + CpG
287 (adsorbed on PLG) + 961 1024 16906 6720
(adsorbed on PLG) + CpG (adsorbed on PLG)
287 (adsorbed on PLG) + 961 64 4636 3969
(adsorbed on PLG) + MF59
287 (adsorbed on PLG) + 961 2048 23642 48446
(adsorbed on PLG) + MF59 + CpG
Similar work was performed on groups of 10 CD-1 mice, using 20 μg per PLG-adsorbed antigen per IM dose (days 0, 21 and 35). Where CpG was present, it was given at 10 μg per dose. ELISA titers (GMT) were calculated as the reciprocal serum dilution giving OD450nm 0.5, and sera were tested for both antigens. Serum bactericidal activity titers (SBA) are calculated as the reciprocal serum dilution killing 50% of target bacteria, and sera were tested for activity against 2996 strain and against MC58, a heterologous strain. Titers at day 49 (2 weeks post-third dose) were as follows:
GMT SBA
287 961 Extra adjuvant 287 961 2996 MC58
X 8375 512 <4
X Soluble CpG 33736 1024 128
X PLG-adsorbed CpG 32058 1024 64
X 3818 nd nd
X Soluble CpG 14149 2048 <4
X PLG-adsorbed CpG 18526 2048 <4
X X 13557 2476 nd nd
X X Soluble CpG 21664 6557 8192 64
X X PLG-adsorbed CpG 27259 7510 2048 128
X X Soluble CpG + MF59 27981 26826 2048 256
Control: soluble 287 with CFA 37889 1024 <32
Control: soluble 961 with CFA 50453 4096 <4
Control: soluble 287 and 1678 27069 512 <32
961 with CFA
Reference 12 discloses a combination of three proteins which, between them, include five different N. meningitidis antigens: (1) 961c2996; (2) ΔG287NZ-9532996; and (3) 9362996-ΔG741MC58. The antigen mixture was tested in reference 12 using aluminum hydroxide adjuvant. According to the present invention, the antigen mixture is adjuvanted by adsorption to a biodegradable polymer microparticle plus a CpG oligonucleotide. Titers after the third dose were as follows:
ELISA GMT SBA (against seven strains)
Immunisation 961 287 741 953 2996 MC58 BZ133 394/98 NGH38 F6124 44/76
(1) 961 on alum 12346 4096 <4 <4 <4 <4 64 <4
(2) 287-953 on alum 6415 585 1024 1024 256 1024 4096 256 1024
(3) 936-741 on alum 10625 <4 32768 16384 1024 128 16384 32768
(1), (2) & (3) on alum 42302 18206 33881 4549 8192 32768 32768 2048 4096 32768 65536
(1) 961 on PLG 14185 2048 4 <4 <4 16 256 <4
(2) 287-953 on PLG 43515 478 2048 128 2048 2048 8192 4096 128
(3) 936-741 on PLG 16150 <4 32768 16384 1024 512 8192 262144
(1), (2) & (3) on PLG 6735 24304 13801 1214 4096 65536 32768 2048 4096 32768 65536
(1), (2) & (3) on 10896 40697 26966 2301 8192 262144 65536 4096 8192 32768 262144
PLG + CpG
Compared to the aluminum adjuvant used in reference 12, the PLG+CpG mixture leads to lower overall antibody titers (except for protein 287) but, importantly, gives higher bactericidal titers against a wide range of strains. Although absolute titers are lower, therefore, the adjuvant of the invention therefore advantageously shifts antibody production towards bactericidal antibodies.
It will be understood that the invention has been described by way of example only and modifications may be made whilst remaining within the scope and spirit of the invention.
REFERENCES (The Contents of which are hereby Incorporated by Reference)
  • [1] Parkhill et al. (2000) Nature 404:502-506.
  • [2] Tettelin et al. (2000) Science 287:1809-1815.
  • [3] WO00/66791.
  • [4] WO99/24578.
  • [5] WO99/36544.
  • [6] WO99/57280.
  • [7] WO00/22430.
  • [8] WO00/66741.
  • [9] Pizza et al. (2000) Science 287:1816-1820.
  • [10] WO01/64920.
  • [11] WO01/64922.
  • [12] International patent application PCT/IB02/03904.
  • [13] Vaccine design the subunit and adjuvant approach, eds. Powell & Newman, Plenum Press 1995 (ISBN 0-306-44867-X).
  • [14] Jones (2001) Curr Opin Investig Drugs 2:47-49.
  • [15] WO00/50075.
  • [16] Comanducci et al. (2002)J. Exp. Med. 195:1445-1454.
  • [17] International patent application PCT/IB02/03396.
  • [18] Strugnell et al. (1997) Immunol Cell Biol 75(4):364-369.
  • [19] Robinson & Torres (1997) Seminars in Immunol 9:271-283.
  • [20] Donnelly et al. (1997) Annu Rev Immunol 15:617-648.
  • [21] DNA Vaccination—Genetic Vaccination (eds. Koprowski et al; 1998) ISBN 3540633928.
  • [22] Brunham et al. (2000) J. Infect Dis 181 Suppl 3:S538-43.
  • [23] Svanholm et al. (2000) Scand J Immunol 51(4):345-53.
  • [24] Costantino et al. (1992) Vaccine 10:691-698.
  • [25] Costantino et al. (1999) Vaccine 17:1251-1263.
  • [26] UK patent applications 0207117.3 & 0220195.2
  • [27] International patent application PCT/IB02/03191.
  • [28] McCluskie et al. (2001) Curr. Opin. Investig. Drugs 2:35-39.
  • [29] McCluskie et al. (2001) Crit. Rev. Immunol. 21:103-120.
  • [30] Krieg et al. (1998) Proc. Natl. Acad. Sci. USA, 95, 12631-12636,
  • [31] Klinman et al. (1996), Proc. Natl. Acad. Sci USA, 93, 2879-2883
  • [32] Weiner et al. (1997) Proc. Natl. Acad. Sci. USA, 94, 10833-10837
  • [33] Chu et al. (1997) J. Exp. Med., 186, 1623-1631
  • [34] Brazolot-Millan et al. (1998) Proc. Natl. Acad. Sci. USA, 95, 15553-15558
  • [35] Ballas et al (1996) J. Immunol., 157, 1840-1845
  • [36] Cowdery et al. (1996) J. Immunol., 156, 4570-4575
  • [37] Halpern et al. (1996) Cell. Immunol., 167, 72-78
  • [38] Yamamoto et al. (1988) Jpn J. Cancer Res., 79, 866-873
  • [39] Stacey et al. (1996) J. Immunol., 157, 2116-2122
  • [40] Messina et al. (1991) J. Immunol., 147, 1759-1764
  • [41] Yi et al. (1996) J. Immunol., 157, 4918-4925
  • [42] Yi et al (1996) J. Immunol., 157, 5394-5402
  • [43] Yi et al. (1998) J. Immunol., 160, 4755-4761
  • [44] Roman et al. (1997) Nat. Med, 3, 849-854
  • [45] Davis et al. (1998) J. Immunol., 160, 870-876
  • [46] Lipford et al (1997) Eur. J. Immunol., 27, 2340-2344
  • [47] Moldoveanu et al. (1988) Vaccine, 16, 1216-1224
  • [48] Yi et al. (1998) J. Immunol., 160, 5898-5906
  • [49] WO96/02555
  • [50] WO98/16247
  • [51] WO98/18810
  • [52] WO98/40100
  • [53] WO98/55495
  • [54] WO98/37919a
  • [55] WO98/52581
  • [56] Gupta et al. (1998) Adv Drug Deliv Rev 32:225-246.
  • [57] Ravi Kumar (2000) J. Pharm Pharm Sci 3:234-258.
  • [58] Jabbal-GilI et al. (2001) Adv Drug Deliv Rev 51:97-111.
  • [59] Jain (2000) Biomaterials 21:2475-2490.
  • [60] U.S. Pat. No. 3,523,907
  • [61] Ogawa et al. (1988) Chem. Pharm. Bull. 36:1095-1103.
  • [62] O'Hagan et al. (1993) Vaccine 11:965-969.
  • [63] Jeffery et al. (1993) Pharm. Res. 10:362-368.
  • [64] WO 00/06133
  • [65] McGee et al. (1997) J. Microencapsul. 14:197-210.
  • [66] Thomasin et al. (1996) J. Controlled Release 41:13ff
  • [67] U.S. Pat. No. 2,800,457
  • [68] Masters, K. (1976) Spray Drying 2nd Ed. Wiley, New York
  • [69] Hall et al., (1980) The “Wurster Process” in Controlled Release Technologies. Methods, Theory, and Applications (A. F. Kydonieus, ed.), Vol. 2, pp. 133-154 CRC Press, Boca Raton, Fla.
  • [70] Deasy, P. B. (1988) Crit. Rev Ther. Drug Carrier Syst. S(2):99-139
  • [71] Lim et al. (1980) Science 210:908-910.
  • [72] Cohen et al (1991) Pharm. Res. 8:713ff
  • [73] Eldridge et al. (1991) Infect. Immun. 59:2978ff
  • [74] Eldridge et al. (1990) J. Controlled Release 1:205ff
  • [75] O'Hagan et al. (1994) Int. J Pharm. 103:37-45.
  • [76] Balasubramaniam et al. (1996) Gene Ther 3:163-172.
  • [77] Gao & Huang (1995) Gene Ther. 2:7110-7122.
  • [78] Gennaro (2000) Remington' The Science and Practice of Pharmacy. 20th edition, ISBN: 0683306472.
  • [79] Almeida & Alpar (1996) J. Drug Targeting 3:455-467.
  • [80] WO90/14837.
  • [81] WO00/07621.
  • [82] WO00/62800.
  • [83] WO99/27960.
  • [84] European patent applications 0835318, 0735898 and 0761231.
  • [85] WO99/52549.
  • [86] WO01/21207.
  • [87] WO01/21152.
  • [88] WO00/23105.
  • [89] WO99/11241.
  • [90] WO98/57659.
  • [91] Del Giudice et al. (1998) Molecular Aspects of Medicine, vol. 19, number 1.
  • [92] Covacci & Rappuoli (2000) J. Exp. Med. 19:587-592.
  • [93] WO93/18150.
  • [94] Covacci et al. (1993) Proc. Natl. Acad. Sci. USA 90: 5791-5795.
  • [95] Tummuru et al (1994) Infect. Immun. 61:1799-1809.
  • [96] Marchetti et al. (1998) Vaccine 16:33-37.
  • [97] Telford et al. (1994) J. Exp. Med. 179:1653-1658.
  • [98] Evans et al (1995) Gene 153:123-127.
  • [99] WO96/01272 & WO96/01273, especially SEQ ID NO:6.
  • [100] WO97/25429.
  • [101] WO98/04702.
  • [102] WO01/52885.
  • [103] Bjune et al. (1991) Lancet 338(8775): 1093-1096.
  • [104] Fukasawaetal. (1999) Vaccine 17:2951-2958.
  • [105] Rosenqvistetal. (1998) Dev. Biol. Stand. 92:323-333.
  • [106] Watson (2000) Pediatr Infect Dis J. 19:331-332.
  • [107] Rubin (2000) Pediatr Clin North Am 47:269-285, v.
  • [108] Jedrzejas (2001) Microbiol Mol Biol Rev 65:187-207.
  • [109] Bell (2000) Pediatr Infect Dis J 19:1187-1188.
  • [110] Iwarson (1995) APMIS 103:321-326.
  • [111] Gerlich et al (1990) Vaccine 8 Suppl:S63-68 & 79-80.
  • [112] Hsu et al. (1999) Clin Liver Dis 3:901-915.
  • [113] Gustafsson et al. (1996) N. Engl. J. Med 334:349-355.
  • [114] Rappuoli et al. (1991) TIBTECH9:232-238.
  • [115] Vaccines (1988) eds. Plotkin & Mortimer. ISBN 0-7216-1946-0.
  • [116] Del Guidice et al. (1998) Molecular Aspects of Medicine 19:1-70.
  • [117] WO02/02606.
  • [118] Kalman et al. (1999) Nature Genetics 21:385-389.
  • [119] Read et al. (2000) Nucleic Acids Res 28:1397-406.
  • [120] Shirai et al. (2000) J. Infect. Dis. 181(Suppl 3):S524-S527.
  • [121] WO99/27105.
  • [122] WO00/27994.
  • [123] WO00/37494.
  • [124] WO99/28475.
  • [125] Ross et al (2001) Vaccine 19:4135-4142.
  • [126] Sutter et al. (2000) Pediatr Clin North Am 47:287-308.
  • [127] Zimmerman & Spann (1999) Am Fam Physician 59:113-118, 125-126.
  • [128] Dreesen (1997) Vaccine 15 Suppl:S2-6.
  • [129] MMWR Morb Mortal Wkly Rep Jan. 16, 1998;47(1):12, 19.
  • [130] Anderson (2000) Vaccine 19 Suppl 1:S59-65.
  • [131] Kahn (2000) Curr Opin Pediatr 12:257-262.
  • [132] Crowe (1995) Vaccine 13:415-421.
  • [133] McMichael (2000) Vaccine 19 Suppl 1:S101-107.
  • [134] Schuchat (1999) Lancet 353(9146):51-6.
  • [135] WO02/34771.
  • [136] Dale (1999) Infect Dis Clin North Am 13:227-43, viii.
  • [137] Ferretti et al. (2001) PNAS USA 98: 4658-4663.
  • [138] Kuroda et al. (2001) Lancet 357(9264):1225-1240; see also pages 1218-1219.
  • [139] J. Toxicol Clin Toxicol (2001) 39:85-100.
  • [140] Demicheli et al. (1998) Vaccine 16:880-884.
  • [141] Stepanov et al (1996) J. Biotechnol 44:155-160.
  • [142] Ingram (2001) Trends Neurosci 24:305-307.
  • [143] Rosenberg (2001) Nature 411:380-384.
  • [144] Moingeon (2001) Vaccine 19:1305-1326.
  • [145] Current Protocols in Molecular Biology (F. M. Ausubel et al., eds., 1987) Supplement 30.
  • [146] Smith & Waterman (1981) Adv. Appl. Math. 2: 482-489.

Claims (46)

The invention claimed is:
1. An immunogenic composition comprising (a) an isolated neisserial antigen comprising a ΔG287 form of the wild-type 287protein of strain 394/98 of serogroup B Neisseria meningitidis that retains the immunogenicity of said wild-type 287 protein of said 394/98 of serogroup B Neisseria meningitidis; (b) a CpG oligonucleotide; and (c) biodegradable poly(α-hydroxy acid) microparticles.
2. The composition of claim 1, wherein the neisserial antigen elicits a bactericidal immune response in a recipient mammal against said serogroup B Neisseria meningitidis.
3. The composition of claim 1, wherein the CpG oligonucleotide comprises between about 6 and about 100 deoxyribonucleotides.
4. The composition of claim 1, wherein the microparticles comprise poly(D,L-lactide-co-glycolide).
5. The composition of claim 1, wherein the neisserial antigen is entrapped within the microparticles.
6. The composition of claim 1, wherein the neisserial antigen is adsorbed to the microparticles.
7. The composition of claim 1, wherein the CpG oligonucleotide is entrapped within the microparticles.
8. The composition of claim 1, wherein the CpG oligonucleotide is adsorbed to the microparticles.
9. The composition of claim 2, wherein the microparticles comprise poly(D,L-lactide-co-glycolide).
10. The composition of claim 3, wherein the microparticles comprise poly(D,L-lactide-co-glycolide).
11. The composition of claim 2, wherein the neisserial antigen is entrapped within the microparticles.
12. The composition of claim 3, wherein the neisserial antigen is entrapped within the microparticles.
13. The composition of claim 4, wherein the neisserial antigen is entrapped within the microparticles.
14. The composition of claim 2, wherein the neisserial antigen is adsorbed to the microparticles.
15. The composition of claim 3, wherein the neisserial antigen is adsorbed to the microparticles.
16. The composition of claim 4, wherein the neisserial antigen is adsorbed to the microparticles.
17. The composition of claim 2, wherein the CpG oligonucleotide is entrapped within the microparticles.
18. The composition of claim 3, wherein the CpG oligonucleotide is entrapped within the microparticles.
19. The composition of claim 4, wherein the CpG oligonucleotide is entrapped within the microparticles.
20. The composition of claim 2, wherein the CpG oligonucleotide is adsorbed to the microparticles.
21. The composition of claim 3, wherein the CpG oligonucleotide is adsorbed to the microparticles.
22. The composition of claim 4, wherein the CpG oligonucleotide is adsorbed to the microparticles.
23. The composition of any one of claims 1, 2, 3,4-8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 and 22, comprising a further adjuvant.
24. The composition of claim 23, wherein the further adjuvant is MF59 adjuvant.
25. The composition of claim 23, wherein the further adjuvant is an aluminum salt adjuvant.
26. The composition of any one of claims 1, 2, 3 and 4-8, comprising at least one further non-neisserial antigen.
27. The composition of claim 1, wherein said neisserial antigen is a fusion protein comprising said serogroup B Neisseria meningitidis ΔG287 protein.
28. The composition of any one of claims 1, 2, 3, 4-8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 and 22, further comprising a pharmaceutically acceptable carrier.
29. The immunogenic composition of claim 6, further comprising an isolated 961c form of the wild-type 961 protein of strain 2996 of serogroup B Neisseria meningitidis that retains the immunogenicity of said wild-type 961 protein of said 2996 of serogroup B Neisseria meningitidis, wherein the antigen is adsorbed to the microparticles.
30. The composition of claim 9, further comprising MF59.
31. The composition of claim 29, further comprising MF59.
32. A method of immunizing a mammal comprising administering to the mammal the composition of any one of claims 1, 2, 3 and 4-8.
33. The composition of claim 1, further comprising an isolated 919 protein of strain MC58 of serogroup B Neisseria meningitidis.
34. The composition of claim 33, further comprising an isolated 961c form of the wild-type 961 protein of strain 2996 of serogroup B Neisseria meningitidis that retains the immunogenicity of said wild-type 961 protein of said 2996 of serogroup B Neisseria meningitidis.
35. The composition of claim 34, wherein said composition further comprises an outer-membrane vesicle (OMV) preparation from Neisseria meningitidis.
36. The composition of claim 35, wherein the outer-membrane vesicle is obtained from Neisseria meningitidis strain H44/76 or 394/98.
37. The immunogenic composition of claim 35 or claim 36, further comprising one or more saccharide antigens from N. meningitidis.
38. The immunogenic composition of claim 37, wherein the one or more saccharide antigens are from N. meningitidis serogroup A, C, W135 and/or Y.
39. The immunogenic composition of claim 35 or claim 36, comprising a further adjuvant.
40. The immunogenic composition of claim 39, wherein the further adjuvant is aluminum salt.
41. The immunogenic composition of claim 40, wherein the isolated ΔG287, the isolated 961c, and the isolated 919 proteins are adsorbed to the aluminum salt.
42. The immunogenic composition of claim 39, wherein the further adjuvant is aluminum hydroxide gel.
43. The immunogenic composition of claim 42, wherein the isolated ΔG287, the isolated 961c, and the isolated 919 proteins are adsorbed to the aluminum hydroxide gel.
44. The immunogenic composition of claim 35 or claim 36, wherein the composition is sterile.
45. The immunogenic composition of claim 35 or claim 36, wherein the composition is injectable.
46. The immunogenic composition of claim 35 or claim 36, wherein the composition is buffered.
US13/587,840 2001-10-03 2012-08-16 Adjuvanted meningococcus compositions Expired - Fee Related USRE45137E1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US13/587,840 USRE45137E1 (en) 2001-10-03 2012-08-16 Adjuvanted meningococcus compositions

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
US32692901P 2001-10-03 2001-10-03
US37354702P 2002-04-17 2002-04-17
US38067702P 2002-05-13 2002-05-13
US10/264,802 US7838015B2 (en) 2001-10-03 2002-10-03 Adjuvanted meningococcus compositions
US13/587,840 USRE45137E1 (en) 2001-10-03 2012-08-16 Adjuvanted meningococcus compositions

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
US10/264,802 Reissue US7838015B2 (en) 2001-10-03 2002-10-03 Adjuvanted meningococcus compositions

Publications (1)

Publication Number Publication Date
USRE45137E1 true USRE45137E1 (en) 2014-09-16

Family

ID=26985632

Family Applications (5)

Application Number Title Priority Date Filing Date
US10/265,083 Expired - Fee Related US7550145B2 (en) 2001-10-03 2002-10-03 Adjuvant compositions
US12/456,851 Abandoned US20100003280A1 (en) 2001-10-03 2009-06-22 Adjuvant compositions
US13/587,840 Expired - Fee Related USRE45137E1 (en) 2001-10-03 2012-08-16 Adjuvanted meningococcus compositions
US14/081,986 Abandoned US20140161887A1 (en) 2001-10-03 2013-11-15 Adjuvant compositions
US15/201,766 Abandoned US20160310590A1 (en) 2001-10-03 2016-07-05 Adjuvant compositions

Family Applications Before (2)

Application Number Title Priority Date Filing Date
US10/265,083 Expired - Fee Related US7550145B2 (en) 2001-10-03 2002-10-03 Adjuvant compositions
US12/456,851 Abandoned US20100003280A1 (en) 2001-10-03 2009-06-22 Adjuvant compositions

Family Applications After (2)

Application Number Title Priority Date Filing Date
US14/081,986 Abandoned US20140161887A1 (en) 2001-10-03 2013-11-15 Adjuvant compositions
US15/201,766 Abandoned US20160310590A1 (en) 2001-10-03 2016-07-05 Adjuvant compositions

Country Status (8)

Country Link
US (5) US7550145B2 (en)
EP (1) EP1438074B1 (en)
JP (2) JP4286138B2 (en)
AR (1) AR045702A1 (en)
AU (1) AU2002332019A1 (en)
CA (1) CA2462602A1 (en)
ES (1) ES2588006T3 (en)
WO (1) WO2003028656A2 (en)

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090041802A1 (en) * 2005-06-27 2009-02-12 Ralph Leon Biemans Immunogenic composition
US20130236489A1 (en) * 2010-09-10 2013-09-12 Novartis Ag Developments in meningococcal outer membrane vesicles
US9610342B2 (en) 1999-05-19 2017-04-04 Glaxosmithkline Biologicals Sa Combination neisserial compositions
US9636393B2 (en) 1999-11-29 2017-05-02 Glaxosmithkline Biologicals Sa Compositions comprising Neisseria meningitidis antigens from serogroups B and C
US9687789B2 (en) 2003-07-15 2017-06-27 Glaxosmithkline Biologicals Sa Ultrafiltration for preparing outer membrane vesicles
US9764027B2 (en) 2012-09-18 2017-09-19 Glaxosmithkline Biologicals Sa Outer membrane vesicles
US9771399B2 (en) 2004-10-29 2017-09-26 Glaxosmithkline Biologicals Sa Immunogenic bacterial vesicles with outer membrane proteins
US10195264B2 (en) 2004-04-22 2019-02-05 Glaxosmithkline Biologicals S.A. Immunising against meningococcal serogroup Y using proteins
US10376573B2 (en) 2012-06-14 2019-08-13 Glaxosmithkline Biologicals Sa Vaccines for serogroup X meningococcus

Families Citing this family (71)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE69812941T2 (en) * 1997-01-30 2004-02-05 Chiron Corp. (N.D.Ges.D. Staates Delaware), Emeryville USE OF MICROPARTICLES WITH ADSORBED ANTIGEN TO STIMULATE IMMUNE DEFENSE
PT1104306E (en) * 1998-08-10 2006-05-31 Antigenics Inc CPG COMPOSITIONS AND SAPONIN ADJUVANTS AND THEIR METHODS
JP4812942B2 (en) * 1999-02-26 2011-11-09 ノバルティス ヴァクシンズ アンド ダイアグノスティクス エスアールエル Enhancement of Neisseria antigen bactericidal activity using oligonucleotides containing CG motif
US6977245B2 (en) 1999-04-12 2005-12-20 The United States Of America As Represented By The Department Of Health And Human Services Oligodeoxynucleotide and its use to induce an immune response
ATE378348T1 (en) 2000-01-14 2007-11-15 Us Health OLIGODEOXYNUCLEOTIDES AND THEIR USE FOR INDUCING AN IMMUNE RESPONSE
ES2240745T3 (en) 2001-06-05 2005-10-16 Curevac Gmbh PHARMACEUTICAL COMPOSITION CONTAINING A STABILIZED AND OPTIMIZED mRNA FOR TRANSLATION, APPROPRIATE AS A VACCINE AND AS A REGENERANT OF FABRICS.
US7666674B2 (en) 2001-07-27 2010-02-23 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Use of sterically stabilized cationic liposomes to efficiently deliver CPG oligonucleotides in vivo
AU2002361468A1 (en) 2001-08-14 2003-03-18 The Government Of The United States Of America As Represented By The Secretary Of Health And Human S Method for rapid generation of mature dendritic cells
AR045702A1 (en) * 2001-10-03 2005-11-09 Chiron Corp COMPOSITIONS OF ASSISTANTS.
GB0129007D0 (en) * 2001-12-04 2002-01-23 Chiron Spa Adjuvanted antigenic meningococcal compositions
DE10162480A1 (en) 2001-12-19 2003-08-07 Ingmar Hoerr The application of mRNA for use as a therapeutic agent against tumor diseases
US8466116B2 (en) 2001-12-20 2013-06-18 The Unites States Of America As Represented By The Secretary Of The Department Of Health And Human Services Use of CpG oligodeoxynucleotides to induce epithelial cell growth
AU2002366710A1 (en) 2001-12-20 2003-07-09 The Government Of The United States Of America As Represented By The Secretary Of The Department Of USE OF CpG OLIGODEOXYNUCLEOTIDES TO INDUCE ANGIOGENESIS
US8153141B2 (en) 2002-04-04 2012-04-10 Coley Pharmaceutical Gmbh Immunostimulatory G, U-containing oligoribonucleotides
DE10229872A1 (en) * 2002-07-03 2004-01-29 Curevac Gmbh Immune stimulation through chemically modified RNA
US8263091B2 (en) 2002-09-18 2012-09-11 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Method of treating and preventing infections in immunocompromised subjects with immunostimulatory CpG oligonucleotides
US20060147509A1 (en) * 2002-10-02 2006-07-06 Kirkby Nikolai S Composition for vaccination
CA2511512C (en) 2002-12-27 2013-10-29 Chiron Corporation Immunogenic compositions containing phospholipid
ES2615029T3 (en) * 2003-01-14 2017-06-05 Glaxosmithkline Biologicals Sa Microparticles comprising polynucleotides adsorbed on the surface of microparticles or trapped inside them
US7731967B2 (en) 2003-04-30 2010-06-08 Novartis Vaccines And Diagnostics, Inc. Compositions for inducing immune responses
EP2179729B1 (en) 2003-06-02 2016-07-20 GlaxoSmithKline Biologicals SA Immunogenic compositions based on microparticles comprising adsorbed toxoid and a polysaccharide-containing antigen
JP5183064B2 (en) * 2003-07-02 2013-04-17 エムユーエスシー ファウンデイション フォー リサーチ デべロップメント Specific and non-specific immunity induced by dsRNA in crustaceans and other invertebrates, and biological delivery vehicles used therein
TWI358301B (en) * 2003-07-11 2012-02-21 Intercell Ag Hcv vaccines
WO2005024059A2 (en) * 2003-09-09 2005-03-17 Karolinska Innovations Ab Methods for identifying compounds for inhibiting fever
US20050244505A1 (en) * 2003-12-11 2005-11-03 Higbee Russell G Immunotherapy compositions, method of making and method of use thereof
EP1550458A1 (en) * 2003-12-23 2005-07-06 Vectron Therapeutics AG Synergistic liposomal adjuvants
DE102004042546A1 (en) * 2004-09-02 2006-03-09 Curevac Gmbh Combination therapy for immune stimulation
US20060213010A1 (en) * 2005-03-22 2006-09-28 Davis David T Mattress sled
US20090074815A1 (en) * 2005-04-22 2009-03-19 Sciclone Pharmaceuticals, Inc. Immunomodulator Compounds as Vaccine Enhancers
JP4828189B2 (en) * 2005-09-14 2011-11-30 雅美 森山 Secretory IgA and IgG antibody inducer
AU2006311019B2 (en) * 2005-11-10 2012-01-19 Intervet International B.V. Novel bacterium and vaccine
CA2636257A1 (en) 2006-01-06 2007-07-12 Cell-Medicine, Inc. Immune adjuvant
US20100226932A1 (en) * 2006-02-22 2010-09-09 Novavax, Inc. Adjuvant and Vaccine Compositions
CA2655933C (en) * 2006-06-23 2014-09-09 Alethia Biotherapeutics Inc. Polynucleotides and polypeptide sequences involved in cancer
JP2010507361A (en) 2006-07-31 2010-03-11 キュアバック ゲーエムベーハー Specifically, a nucleic acid represented by the general formula (I): GlXmGn or the general formula (II): ClXmCn, as an immunostimulant/adjuvant.
WO2009030254A1 (en) 2007-09-04 2009-03-12 Curevac Gmbh Complexes of rna and cationic peptides for transfection and for immunostimulation
EP3067048B1 (en) 2007-12-07 2018-02-14 GlaxoSmithKline Biologicals SA Compositions for inducing immune responses
SG188104A1 (en) 2008-01-31 2013-03-28 Curevac Gmbh Nucleic acids comprising formula (nuglxmgnnv)a and derivatives thereof as an immunostimulating agents /adjuvants
WO2010037408A1 (en) 2008-09-30 2010-04-08 Curevac Gmbh Composition comprising a complexed (m)rna and a naked mrna for providing or enhancing an immunostimulatory response in a mammal and uses thereof
KR20110084280A (en) 2008-11-03 2011-07-21 알레시아 바이오쎄라퓨틱스 인코포레이티드 Antibodies that specifically block the biological activity of tumor antigens
US20110053829A1 (en) 2009-09-03 2011-03-03 Curevac Gmbh Disulfide-linked polyethyleneglycol/peptide conjugates for the transfection of nucleic acids
JPWO2011040535A1 (en) 2009-09-30 2013-02-28 東レ株式会社 Hepatitis C virus vaccine composition
RU2625546C2 (en) 2010-07-06 2017-07-14 Новартис Аг Cationic emulsions "oil-in-water"
GB201012410D0 (en) 2010-07-23 2010-09-08 Medical Res Council Intracellular immunity
WO2012013326A1 (en) 2010-07-30 2012-02-02 Curevac Gmbh Complexation of nucleic acids with disulfide-crosslinked cationic components for transfection and immunostimulation
CA2807552A1 (en) 2010-08-06 2012-02-09 Moderna Therapeutics, Inc. Engineered nucleic acids and methods of use thereof
SMT202200321T1 (en) 2010-10-01 2022-09-14 Modernatx Inc Ribonucleic acids containing n1-methyl-pseudouracils and uses thereof
CA2888908A1 (en) 2011-03-31 2012-10-04 Alethia Biotherapeutics Inc. Antibodies against kidney associated antigen 1 and antigen binding fragments thereof
DE12722942T1 (en) 2011-03-31 2021-09-30 Modernatx, Inc. RELEASE AND FORMULATION OF MANIPULATED NUCLEIC ACIDS
WO2013006834A1 (en) 2011-07-06 2013-01-10 Novartis Ag Oil-in-water emulsions that contain nucleic acids
BR112014000235A8 (en) * 2011-07-06 2018-03-06 Novartis Ag cationic oil-in-water emulsions
US9464124B2 (en) 2011-09-12 2016-10-11 Moderna Therapeutics, Inc. Engineered nucleic acids and methods of use thereof
JP6113737B2 (en) 2011-10-03 2017-04-12 モデルナティエックス インコーポレイテッドModernaTX,Inc. Modified nucleosides, nucleotides and nucleic acids and methods for their use
CA3018046A1 (en) 2011-12-16 2013-06-20 Moderna Therapeutics, Inc. Modified nucleoside, nucleotide, and nucleic acid compositions
HUE043888T2 (en) 2012-01-09 2019-09-30 Adc Therapeutics Sa Agents for treating triple negative breast cancer
WO2013113326A1 (en) 2012-01-31 2013-08-08 Curevac Gmbh Pharmaceutical composition comprising a polymeric carrier cargo complex and at least one protein or peptide antigen
US10501512B2 (en) 2012-04-02 2019-12-10 Modernatx, Inc. Modified polynucleotides
JP2015513913A (en) 2012-04-02 2015-05-18 モデルナ セラピューティクス インコーポレイテッドModerna Therapeutics,Inc. Modified polynucleotide
US9283287B2 (en) 2012-04-02 2016-03-15 Moderna Therapeutics, Inc. Modified polynucleotides for the production of nuclear proteins
US9572897B2 (en) 2012-04-02 2017-02-21 Modernatx, Inc. Modified polynucleotides for the production of cytoplasmic and cytoskeletal proteins
ES2921623T3 (en) 2012-11-26 2022-08-30 Modernatx Inc terminally modified RNA
US8980864B2 (en) 2013-03-15 2015-03-17 Moderna Therapeutics, Inc. Compositions and methods of altering cholesterol levels
BR112016003361A2 (en) 2013-08-21 2017-11-21 Curevac Ag respiratory syncytial virus vaccine (rsv)
US10023626B2 (en) 2013-09-30 2018-07-17 Modernatx, Inc. Polynucleotides encoding immune modulating polypeptides
MX2016004249A (en) 2013-10-03 2016-11-08 Moderna Therapeutics Inc Polynucleotides encoding low density lipoprotein receptor.
ES2806575T3 (en) 2013-11-01 2021-02-18 Curevac Ag Modified RNA with decreased immunostimulatory properties
CA2936286A1 (en) 2014-04-01 2015-10-08 Curevac Ag Polymeric carrier cargo complex for use as an immunostimulating agent or as an adjuvant
US11197928B2 (en) 2017-01-13 2021-12-14 Board Of Regents, The University Of Texas System Sustained production of high affinity antigen specific antibody by high dose BAFF receptor-targeting mAb-siRNA conjugate
US10702596B2 (en) * 2017-07-05 2020-07-07 Inventprise, Llc Polysaccharide purification for vaccine production using lytic enzymes, tangential flow filtration, and multimode chromatography
CN114761558B (en) 2019-07-02 2025-08-01 株式会社Na疫苗研究所 Novel ribonucleic acid and pharmaceutical composition based on same
US20220011298A1 (en) * 2020-07-10 2022-01-13 Acutis Diagnostics, Inc. Methods and compositions for isolation and rapid detection of micro-organisms from blood and bodily fluids

Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1999036544A2 (en) * 1998-01-14 1999-07-22 Chiron S.P.A. Neisseria meningitidis antigens
WO1999057280A2 (en) * 1998-05-01 1999-11-11 Chiron Corporation Neisseria meningitidis antigens and compositions
WO2000006123A1 (en) * 1998-07-29 2000-02-10 Chiron Corporation Microparticles with adsorbent surfaces, methods of making same, and uses thereof
WO2000050075A2 (en) * 1999-02-26 2000-08-31 Chiron S.P.A. Enhancement of bactericidal activity of neisseria antigens with oligonucleotides containing cg motifs
WO2001064922A2 (en) 2000-02-28 2001-09-07 Chiron Spa Heterologous expression of neisserial proteins
WO2003020756A2 (en) 2001-09-06 2003-03-13 Chiron Srl. Hybrid and tandem expression of neisserial proteins
US6884435B1 (en) * 1997-01-30 2005-04-26 Chiron Corporation Microparticles with adsorbent surfaces, methods of making same, and uses thereof

Family Cites Families (80)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US2800457A (en) 1953-06-30 1957-07-23 Ncr Co Oil-containing microscopic capsules and method of making them
NL280826A (en) 1962-07-11
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US3906092A (en) * 1971-11-26 1975-09-16 Merck & Co Inc Stimulation of antibody response
US4425437A (en) 1979-11-05 1984-01-10 Genentech, Inc. Microbial polypeptide expression vehicle
US4431739A (en) 1979-11-05 1984-02-14 Genentech, Inc. Transformant bacterial culture capable of expressing heterologous protein
US4338397A (en) 1980-04-11 1982-07-06 President And Fellows Of Harvard College Mature protein synthesis
IE52535B1 (en) 1981-02-16 1987-12-09 Ici Plc Continuous release pharmaceutical compositions
US4708871A (en) 1983-03-08 1987-11-24 Commonwealth Serum Laboratories Commission Antigenically active amino acid sequences
US5324513A (en) 1984-03-07 1994-06-28 Institut Pasteur Composition useful for the fabrication of vaccines
US5171568A (en) 1984-04-06 1992-12-15 Chiron Corporation Recombinant herpes simplex gb-gd vaccine
US5098704A (en) 1984-06-18 1992-03-24 Chiron Corporation Hepatitis surface antigen particle vaccine
US4722840A (en) 1984-09-12 1988-02-02 Chiron Corporation Hybrid particle immunogens
CA1341423C (en) 1984-10-31 2003-03-04 Paul A. Luciw Recombinant proteins of viruses associated with lymphadenopathy syndrome and/or acquired immune deficiency syndrome
US4727136A (en) 1985-10-01 1988-02-23 Canadian Patents And Development Ltd. Modified meningococcal group B polysaccharide for conjugate vaccine
DE3788902T3 (en) 1986-06-17 2004-11-25 Chiron Corp. (N.D.Ges.D. Staates Delaware), Emeryville Hepatitis delta diagnostics and vaccines, their manufacture and use.
NZ221411A (en) * 1986-08-11 1989-10-27 Innovata Biomed Ltd Pharmaceutical compositions containing microcapsules and a surfactant
US5906980A (en) 1987-07-17 1999-05-25 Hem Research Inc. Treatment of hepatitis with mismatched dsRNA
US5712257A (en) * 1987-08-12 1998-01-27 Hem Research, Inc. Topically active compositions of mismatched dsRNAs
BR8807310A (en) 1987-11-18 1990-03-13 Chiron Corp POLINUCLEOTIDIO, POLINUCLEOTIDIO RECOMBINANT, RECOMBINANT VECTOR, CELL HOSTESS, EXPRESSION SYSTEM RECOMBINANT, CELL TRANSFORMED, polypeptide, HCV, DE polypeptide PREPARATION, polypeptide OF HCV polypeptide PURIFIED, polypeptide RECOMBINANT, DE FUSION polypeptide, MONOCLONAL ANTIBODY, PREPARATION PURIFIED ANTIBODY POLYCLONAL, PARTICLE, POLYNUCLEOTID PROBE, ANTIBODY KIT FOR HCV EPETOPE, METHOD FOR POLYPEPTIDY PRODUCTION, METHOD FOR DETECTING HCV NUCLEIC ACIDS, IMMUNOENSAIO TO DETECT HCV ANTIGENE, IMMUNOENSAIO DETECTORIGIO ANTIGENE OF HCV, CELL, CELL INFECTED WITH HCV, METHOD FOR THE PRODUCTION OF ANTIBODIES FOR HCV AND METHOD FOR ISOLATING CDNA DERIVED FROM THE GENOME FROM AN UNIDENTIFIED INFECTIOUS AGENT
US5350671A (en) 1987-11-18 1994-09-27 Chiron Corporation HCV immunoassays employing C domain antigens
GB8815795D0 (en) 1988-07-02 1988-08-10 Bkl Extrusions Ltd Glazing bead
US5258369A (en) 1988-08-29 1993-11-02 Hem Pharmaceuticals Corporation Treatment of chronic cerebral dysfunction by dsRNA methodology
KR0185373B1 (en) 1989-03-17 1999-05-01 로버트 피. 블랙버언 Polypeptides comprising HCV amino acid sequence portions derived from HCV polyproteins and use thereof
DK0398748T3 (en) 1989-05-18 2002-03-18 Chiron Corp NANBV diagnostics: polynucleotides useful for screening for hepatitis C virus
WO1990014837A1 (en) 1989-05-25 1990-12-13 Chiron Corporation Adjuvant formulation comprising a submicron oil droplet emulsion
US5399346A (en) 1989-06-14 1995-03-21 The United States Of America As Represented By The Department Of Health And Human Services Gene therapy
DE69019727T2 (en) 1989-09-21 1995-10-19 Idemitsu Kosan Co ARYLSTYROL POLYMER AND COPOLYMER AND METHOD FOR THE PRODUCTION THEREOF.
JP2637845B2 (en) 1989-12-14 1997-08-06 ナシヨナル・リサーチ・カウンシル・カナダ Modified Meningococcus polysaccharide conjugate vaccine
US5614612A (en) 1990-03-09 1997-03-25 Haigwood; Nancy L. Purified gp120 compositions retaining natural conformation
US6274148B1 (en) 1990-11-08 2001-08-14 Chiron Corporation Hepatitis C virus asialoglycoproteins
IL101715A (en) 1991-05-02 2005-06-19 Amgen Inc Recombinant dna-derived cholera toxin subunit analogs
UA40572C2 (en) 1991-06-24 2001-08-15 Чірон Корпорейшн POLYPEPTIDE CONTAINING A SHORTEN SEQUENCE OF THE HEPATITIS C VIRUS, ISOLATED EPITOPE, REAGENT FOR IMMUNOANALIZATION FOR THE HEPATITIS VIRUS (VARIA)
RO116199B1 (en) * 1991-09-13 2000-11-30 Chiron Corp POLIPEPTIDIC HCV IMUNOGENE COMPOSITION
IT1253009B (en) 1991-12-31 1995-07-10 Sclavo Ricerca S R L DETOXIFIED IMMUNOGENIC MUTANTS OF COLERIC TOXIN AND TOXIN LT, THEIR PREPARATION AND USE FOR THE PREPARATION OF VACCINES
CZ282235B6 (en) 1992-06-25 1997-06-11 Smithkline Beecham Biologicals (S.A.) Inoculation substance, process of its preparation and use
UA39944C2 (en) 1992-07-07 2001-07-16 Чірон Корпорейшн METHOD FOR DETERMINATION OF EARLY SEROCONVERSION IN MAMMAL-TO-MACHINE TO HEPATITIS C VIRUS AND KIT FOR USE IN THE METHOD
US5776468A (en) 1993-03-23 1998-07-07 Smithkline Beecham Biologicals (S.A.) Vaccine compositions containing 3-0 deacylated monophosphoryl lipid A
GB9326253D0 (en) 1993-12-23 1994-02-23 Smithkline Beecham Biolog Vaccines
US5739118A (en) * 1994-04-01 1998-04-14 Apollon, Inc. Compositions and methods for delivery of genetic material
US6207646B1 (en) 1994-07-15 2001-03-27 University Of Iowa Research Foundation Immunostimulatory nucleic acid molecules
US6239116B1 (en) * 1994-07-15 2001-05-29 University Of Iowa Research Foundation Immunostimulatory nucleic acid molecules
EP1167378B1 (en) 1994-07-15 2011-05-11 University of Iowa Research Foundation Immunomodulatory oligonucleotides
WO1996004301A2 (en) 1994-07-29 1996-02-15 Chiron Corporation Novel hepatitis c e1 and e2 truncated polypeptides and methods of obtaining the same
GB9422096D0 (en) 1994-11-02 1994-12-21 Biocine Spa Combined meningitis vaccine
IL117483A (en) 1995-03-17 2008-03-20 Bernard Brodeur Proteinase k resistant surface protein of neisseria meningitidis
US5843752A (en) 1995-05-12 1998-12-01 Schering Corporation Soluble active hepatitis C virus protease
GB9513261D0 (en) 1995-06-29 1995-09-06 Smithkline Beecham Biolog Vaccines
US5990276A (en) 1996-05-10 1999-11-23 Schering Corporation Synthetic inhibitors of hepatitis C virus NS3 protease
ES2251028T3 (en) 1996-05-24 2006-04-16 Chiron Corporation MULTIPLE EPITHOPE FUSION PROTEIN.
CA2268825C (en) 1996-10-11 2006-04-18 The Regents Of The University Of California Immunostimulatory polynucleotide/immunomodulatory molecule conjugates
DE69812941T2 (en) 1997-01-30 2004-02-05 Chiron Corp. (N.D.Ges.D. Staates Delaware), Emeryville USE OF MICROPARTICLES WITH ADSORBED ANTIGEN TO STIMULATE IMMUNE DEFENSE
JP2001512308A (en) 1997-02-07 2001-08-21 メルク エンド カンパニー インコーポレーテッド Synthetic HIV GAG gene
WO1998037919A1 (en) 1997-02-28 1998-09-03 University Of Iowa Research Foundation USE OF NUCLEIC ACIDS CONTAINING UNMETHYLATED CpG DINUCLEOTIDE IN THE TREATMENT OF LPS-ASSOCIATED DISORDERS
ATE441432T1 (en) 1997-03-10 2009-09-15 Ottawa Hospital Res Inst USE OF NON-METHYLATED CPG DINUCLEOTIDE IN COMBINATION WITH ALUMINUM AS ADJUVANTS
AU7471698A (en) 1997-05-06 1998-11-27 Chiron Corporation Intracellular production of hepatitis c e1 and e2 truncated polypeptides
DE69838294T2 (en) 1997-05-20 2009-08-13 Ottawa Health Research Institute, Ottawa Process for the preparation of nucleic acid constructs
DE69840850D1 (en) 1997-06-06 2009-07-09 Dynavax Tech Corp INHIBITORS OF IMMUNSTIMULATORY DNA SEQUENCE ACTIVITY
JP2002509545A (en) * 1997-07-08 2002-03-26 カイロン コーポレイション Use of submicron oil-in-water emulsion with DNA vaccine
PT1007546E (en) 1997-08-27 2009-04-24 Childrens Hosp & Res Ct Oak Molecular mimetics of meningococcal b epitopes
AU9363798A (en) 1997-11-06 1999-05-31 Chiron S.P.A. Neisserial antigens
WO1999030737A1 (en) 1997-12-16 1999-06-24 Chiron Corporation Use of microparticles combined with submicron oil-in-water emulsions
US6303114B1 (en) 1998-03-05 2001-10-16 The Medical College Of Ohio IL-12 enhancement of immune responses to T-independent antigens
AU760549B2 (en) * 1998-04-03 2003-05-15 University Of Iowa Research Foundation, The Methods and products for stimulating the immune system using immunotherapeutic oligonucleotides and cytokines
EP1069910A1 (en) 1998-04-09 2001-01-24 GlaxoSmithKline Biologicals S.A. Adjuvant compositions
GB9817052D0 (en) 1998-08-05 1998-09-30 Smithkline Beecham Biolog Vaccine
US20020142974A1 (en) 1998-09-11 2002-10-03 Leonard D. Kohn Immune activation by double-stranded polynucleotides
WO2000022430A2 (en) 1998-10-09 2000-04-20 Chiron Corporation Neisseria genomic sequences and methods of their use
CN100558401C (en) 1998-10-16 2009-11-11 史密丝克莱恩比彻姆生物有限公司 Adjuvant systems and vaccines
CA2358385C (en) 1998-12-31 2013-08-06 Chiron Corporation Polynucleotides encoding antigenic hiv type c polypeptides, polypeptides and uses thereof
JP2002533124A (en) 1998-12-31 2002-10-08 カイロン コーポレイション Improved expression of HIV polypeptide and generation of virus-like particles
ES2242604T3 (en) 1999-02-26 2005-11-16 Chiron Corporation MICROEMULSIONS WITH MACROPARTICLES AND ADSORBID MICROPARTICLES.
ES2339737T3 (en) 1999-03-19 2010-05-25 Glaxosmithkline Biologicals Sa VACCINE AGAINST STREPTOCOCCUS PNEUMONIAE CAPSULAR POLYSACARIDS
KR100922031B1 (en) 1999-04-19 2009-10-19 글락소스미스클라인 바이오로지칼즈 에스.에이. Vaccines
EP1176978A2 (en) 1999-05-06 2002-02-06 The Immune Response Corporation Hiv immunogenic compositions and methods
WO2001021207A2 (en) 1999-09-24 2001-03-29 Smithkline Beecham Biologicals S.A. Use of combination of polyoxyethylene sorbitan ester and octoxynol as adjuvant and its use in vaccines
PL355232A1 (en) 1999-09-24 2004-04-05 Smithkline Beecham Biologicals S.A. Adjuvant comprising a polyxyethylene alkyl ether or ester and at least one nonionic surfactant
AU1623501A (en) 1999-11-19 2001-05-30 Chiron Corporation Microparticle-based transfection and activation of dendritic cells
AR045702A1 (en) * 2001-10-03 2005-11-09 Chiron Corp COMPOSITIONS OF ASSISTANTS.
US6861410B1 (en) 2002-03-21 2005-03-01 Chiron Corporation Immunological adjuvant compositions

Patent Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6884435B1 (en) * 1997-01-30 2005-04-26 Chiron Corporation Microparticles with adsorbent surfaces, methods of making same, and uses thereof
WO1999036544A2 (en) * 1998-01-14 1999-07-22 Chiron S.P.A. Neisseria meningitidis antigens
WO1999057280A2 (en) * 1998-05-01 1999-11-11 Chiron Corporation Neisseria meningitidis antigens and compositions
WO2000006123A1 (en) * 1998-07-29 2000-02-10 Chiron Corporation Microparticles with adsorbent surfaces, methods of making same, and uses thereof
WO2000050075A2 (en) * 1999-02-26 2000-08-31 Chiron S.P.A. Enhancement of bactericidal activity of neisseria antigens with oligonucleotides containing cg motifs
WO2001064922A2 (en) 2000-02-28 2001-09-07 Chiron Spa Heterologous expression of neisserial proteins
WO2001064920A2 (en) 2000-02-28 2001-09-07 Chiron Spa Hybrid expression of neisserial proteins
WO2003020756A2 (en) 2001-09-06 2003-03-13 Chiron Srl. Hybrid and tandem expression of neisserial proteins

Non-Patent Citations (11)

* Cited by examiner, † Cited by third party
Title
A. Spickler et al., "Adjuvants in Veterinary Vaccines: Modes of Action and Adverse Effects", J Vet Intern Med 2003; 17:273-281.
Colman PM. Research Immunol. 145: 33-36, 1994. *
Cruse et al. Illustrated Dictionary of Immunology. 2nd Edition, CRC Press, p. 46, 2003. *
J. Cox et al., "Adjuvants-A Classification and Review of Their Modes of Action", Vaccine, vol. 15, No. 3, pp. 248-256, 1997.
J. Cox et al., "Adjuvants—A Classification and Review of Their Modes of Action", Vaccine, vol. 15, No. 3, pp. 248-256, 1997.
McGuinnes et al. Lancet 337: 514-517, 1991. *
McGuinnes et al. Mol. Microbiol. 7: 505-514, 1993. *
N. Burdin et al., "Immunological Foundations to the Quest for New Vaccine Adjuvants", Biodrugs 2004; 18 (2):79-93.
O'Hagan D T et al: "poly(lactide-co-glycolide) Microparticles for the development of single-dose controlled-release vaccines" Advanced drug delivery reviews, Amsterdam, NL., vol. 32, 1998, pp. 225-246, XP000944990 Issn: 0169-409X * abstract *. *
Singh M, et al: "Advances in Vaccine Adjuvants" Nature Biotechnology, Nature Publishing Group, New York, NY, US, vol. 17, No. 11, Nov. 1999, pp. 1075-1081, XP000941305 Issn: 1087-0156 * the whole document *. *
Singh M, et al: "Cationic Microparticles are an effective delivery system for immunie stimulatory CpG DNA" Pharmaceutical Research, New York, NY, US, vol. 18, No. 10, Oct. 2001, pp. 1476-1479, XP002976979 Issn: 0724-8741 * whole document*. *

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9610342B2 (en) 1999-05-19 2017-04-04 Glaxosmithkline Biologicals Sa Combination neisserial compositions
US9636393B2 (en) 1999-11-29 2017-05-02 Glaxosmithkline Biologicals Sa Compositions comprising Neisseria meningitidis antigens from serogroups B and C
US9687789B2 (en) 2003-07-15 2017-06-27 Glaxosmithkline Biologicals Sa Ultrafiltration for preparing outer membrane vesicles
US10195264B2 (en) 2004-04-22 2019-02-05 Glaxosmithkline Biologicals S.A. Immunising against meningococcal serogroup Y using proteins
US10336794B2 (en) 2004-10-29 2019-07-02 Glaxosmithkline Biologicals S.A. Immunogenic bacterial vesicles with outer membrane proteins
US9771399B2 (en) 2004-10-29 2017-09-26 Glaxosmithkline Biologicals Sa Immunogenic bacterial vesicles with outer membrane proteins
US20090041802A1 (en) * 2005-06-27 2009-02-12 Ralph Leon Biemans Immunogenic composition
US11241495B2 (en) 2005-06-27 2022-02-08 Glaxosmithkline Biologicals S.A. Immunogenic composition
US10166287B2 (en) 2005-06-27 2019-01-01 Glaxosmithkline Biologicals S.A. Immunogenic composition
US10179167B2 (en) 2010-09-10 2019-01-15 Glaxosmithkline Biologicals S.A. Developments in meningococcal outer membrane vesicles
US9259462B2 (en) * 2010-09-10 2016-02-16 Glaxosmithkline Biologicals Sa Developments in meningococcal outer membrane vesicles
US20130236489A1 (en) * 2010-09-10 2013-09-12 Novartis Ag Developments in meningococcal outer membrane vesicles
US10376573B2 (en) 2012-06-14 2019-08-13 Glaxosmithkline Biologicals Sa Vaccines for serogroup X meningococcus
US9764027B2 (en) 2012-09-18 2017-09-19 Glaxosmithkline Biologicals Sa Outer membrane vesicles

Also Published As

Publication number Publication date
EP1438074A2 (en) 2004-07-21
CA2462602A1 (en) 2003-04-10
US20160310590A1 (en) 2016-10-27
US20030170273A1 (en) 2003-09-11
EP1438074B1 (en) 2016-06-01
EP1438074A4 (en) 2007-08-01
ES2588006T3 (en) 2016-10-28
JP2009143914A (en) 2009-07-02
JP4286138B2 (en) 2009-06-24
AR045702A1 (en) 2005-11-09
US20140161887A1 (en) 2014-06-12
AU2002332019A1 (en) 2003-04-14
WO2003028656A3 (en) 2003-11-27
US20100003280A1 (en) 2010-01-07
WO2003028656A2 (en) 2003-04-10
JP2005504816A (en) 2005-02-17
US7550145B2 (en) 2009-06-23

Similar Documents

Publication Publication Date Title
USRE45137E1 (en) Adjuvanted meningococcus compositions
EP1409013B1 (en) Vaccines comprising aluminium adjuvants and histidine
US7754218B2 (en) Vaccines comprising aluminum adjuvants and histidine
EP1587538B1 (en) Mucosal meningococcal vaccines
US20110150923A1 (en) Mucosal meningococcal vaccines
AU2002330681A1 (en) Vaccines comprising aluminium adjuvants and histidine
CA2462646C (en) Adjuvanted meningococcus compositions
JP2003514868A (en) Composition comprising Neisseria meningitidis antigens from serotypes B and C, and additional antigens
AU2002334844A1 (en) Adjuvanted meningococcus compositions
US7838015B2 (en) Adjuvanted meningococcus compositions
AU2007231677A1 (en) Adjuvanted meningococcus compositions
RU2360699C2 (en) Compositions of meningococcal vaccines with adjuvants
MXPA04003186A (en) Adjuvanted meningococcus compositions.

Legal Events

Date Code Title Description
FPAY Fee payment

Year of fee payment: 4

SULP Surcharge for late payment
FEPP Fee payment procedure

Free format text: MAINTENANCE FEE REMINDER MAILED (ORIGINAL EVENT CODE: REM.)

LAPS Lapse for failure to pay maintenance fees

Free format text: PATENT EXPIRED FOR FAILURE TO PAY MAINTENANCE FEES (ORIGINAL EVENT CODE: EXP.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY