USRE43309E1 - Immunoregulatory compositions - Google Patents
Immunoregulatory compositions Download PDFInfo
- Publication number
- USRE43309E1 USRE43309E1 US13/065,317 US201113065317A USRE43309E US RE43309 E1 USRE43309 E1 US RE43309E1 US 201113065317 A US201113065317 A US 201113065317A US RE43309 E USRE43309 E US RE43309E
- Authority
- US
- United States
- Prior art keywords
- seq
- nmpf
- amino acid
- acid
- peptides
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Lifetime, expires
Links
- 239000000203 mixture Substances 0.000 title claims abstract description 40
- 230000004957 immunoregulator effect Effects 0.000 title abstract description 8
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 77
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 49
- DXRXYJYFADHAPA-AUTRQRHGSA-N (2s)-2-[[2-[[(2s)-5-amino-2-[[(2s)-2-aminopropanoyl]amino]-5-oxopentanoyl]amino]acetyl]amino]-3-methylbutanoic acid Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)N DXRXYJYFADHAPA-AUTRQRHGSA-N 0.000 claims description 16
- 150000001413 amino acids Chemical class 0.000 abstract description 44
- 150000001875 compounds Chemical class 0.000 abstract description 25
- 238000004519 manufacturing process Methods 0.000 abstract description 14
- 241000024188 Andala Species 0.000 abstract description 4
- 230000001747 exhibiting effect Effects 0.000 abstract description 2
- 241000588724 Escherichia coli Species 0.000 description 42
- 238000001802 infusion Methods 0.000 description 40
- 108010038807 Oligopeptides Proteins 0.000 description 34
- 102000015636 Oligopeptides Human genes 0.000 description 34
- 241000282693 Cercopithecidae Species 0.000 description 32
- 241001465754 Metazoa Species 0.000 description 31
- 241000699670 Mus sp. Species 0.000 description 31
- 235000001014 amino acid Nutrition 0.000 description 31
- 238000002474 experimental method Methods 0.000 description 31
- 238000011282 treatment Methods 0.000 description 29
- 230000000694 effects Effects 0.000 description 28
- 238000000034 method Methods 0.000 description 21
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 19
- 206010040047 Sepsis Diseases 0.000 description 18
- 239000002158 endotoxin Substances 0.000 description 18
- 239000002953 phosphate buffered saline Substances 0.000 description 18
- 210000004027 cell Anatomy 0.000 description 16
- 206010025482 malaise Diseases 0.000 description 16
- 230000035939 shock Effects 0.000 description 16
- 206010040070 Septic Shock Diseases 0.000 description 14
- 238000002347 injection Methods 0.000 description 14
- 239000007924 injection Substances 0.000 description 14
- 150000003839 salts Chemical class 0.000 description 13
- 230000036303 septic shock Effects 0.000 description 13
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 12
- -1 ethylbenzyl Chemical group 0.000 description 12
- 238000006467 substitution reaction Methods 0.000 description 12
- 102000011022 Chorionic Gonadotropin Human genes 0.000 description 11
- 108010062540 Chorionic Gonadotropin Proteins 0.000 description 11
- 125000000217 alkyl group Chemical group 0.000 description 11
- 230000015572 biosynthetic process Effects 0.000 description 11
- 238000002360 preparation method Methods 0.000 description 11
- 238000007912 intraperitoneal administration Methods 0.000 description 10
- 238000003786 synthesis reaction Methods 0.000 description 10
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 9
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 9
- 231100000518 lethal Toxicity 0.000 description 9
- 230000001665 lethal effect Effects 0.000 description 9
- 206010002091 Anaesthesia Diseases 0.000 description 8
- 230000037005 anaesthesia Effects 0.000 description 8
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 8
- 239000008103 glucose Substances 0.000 description 8
- 229940084986 human chorionic gonadotropin Drugs 0.000 description 8
- 239000008194 pharmaceutical composition Substances 0.000 description 8
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 7
- 238000011725 BALB/c mouse Methods 0.000 description 7
- 239000002253 acid Substances 0.000 description 7
- 230000003115 biocidal effect Effects 0.000 description 7
- 210000004369 blood Anatomy 0.000 description 7
- 239000008280 blood Substances 0.000 description 7
- 230000000875 corresponding effect Effects 0.000 description 7
- 238000005259 measurement Methods 0.000 description 7
- 238000011084 recovery Methods 0.000 description 7
- 230000004083 survival effect Effects 0.000 description 7
- KSIPKXNIQOWMIC-UHFFFAOYSA-N 2-[[2-[(2-amino-4-methylsulfanylbutanoyl)amino]-3-hydroxybutanoyl]amino]-5-(diaminomethylideneamino)pentanoic acid Chemical compound CSCCC(N)C(=O)NC(C(C)O)C(=O)NC(C(O)=O)CCCN=C(N)N KSIPKXNIQOWMIC-UHFFFAOYSA-N 0.000 description 6
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 6
- 241000894006 Bacteria Species 0.000 description 6
- SPFYMRJSYKOXGV-UHFFFAOYSA-N Baytril Chemical compound C1CN(CC)CCN1C(C(=C1)F)=CC2=C1C(=O)C(C(O)=O)=CN2C1CC1 SPFYMRJSYKOXGV-UHFFFAOYSA-N 0.000 description 6
- 241000282560 Macaca mulatta Species 0.000 description 6
- 241000288906 Primates Species 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- 239000003242 anti bacterial agent Substances 0.000 description 6
- 230000000703 anti-shock Effects 0.000 description 6
- 229940105596 baytril Drugs 0.000 description 6
- 206010012601 diabetes mellitus Diseases 0.000 description 6
- 201000010099 disease Diseases 0.000 description 6
- 239000003814 drug Substances 0.000 description 6
- 230000006870 function Effects 0.000 description 6
- 239000003094 microcapsule Substances 0.000 description 6
- 239000004005 microsphere Substances 0.000 description 6
- 125000006239 protecting group Chemical group 0.000 description 6
- 238000012360 testing method Methods 0.000 description 6
- 102000004127 Cytokines Human genes 0.000 description 5
- 108090000695 Cytokines Proteins 0.000 description 5
- 241000588722 Escherichia Species 0.000 description 5
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 5
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 5
- 229940088710 antibiotic agent Drugs 0.000 description 5
- 125000003118 aryl group Chemical group 0.000 description 5
- 230000001580 bacterial effect Effects 0.000 description 5
- 238000010241 blood sampling Methods 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 230000006698 induction Effects 0.000 description 5
- 230000005764 inhibitory process Effects 0.000 description 5
- 210000002540 macrophage Anatomy 0.000 description 5
- 239000000902 placebo Substances 0.000 description 5
- 229940068196 placebo Drugs 0.000 description 5
- 108090000623 proteins and genes Proteins 0.000 description 5
- 239000007787 solid Substances 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- 238000004448 titration Methods 0.000 description 5
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 4
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 4
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 4
- IOVCWXUNBOPUCH-UHFFFAOYSA-M Nitrite anion Chemical compound [O-]N=O IOVCWXUNBOPUCH-UHFFFAOYSA-M 0.000 description 4
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 4
- OFOBLEOULBTSOW-UHFFFAOYSA-N Propanedioic acid Natural products OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 4
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 4
- 125000000539 amino acid group Chemical group 0.000 description 4
- 210000000612 antigen-presenting cell Anatomy 0.000 description 4
- 125000004432 carbon atom Chemical group C* 0.000 description 4
- 230000015556 catabolic process Effects 0.000 description 4
- 150000002148 esters Chemical class 0.000 description 4
- 230000014509 gene expression Effects 0.000 description 4
- 239000001963 growth medium Substances 0.000 description 4
- 230000002519 immonomodulatory effect Effects 0.000 description 4
- 230000028993 immune response Effects 0.000 description 4
- 238000001727 in vivo Methods 0.000 description 4
- 238000011065 in-situ storage Methods 0.000 description 4
- 238000010253 intravenous injection Methods 0.000 description 4
- 239000002502 liposome Substances 0.000 description 4
- 210000000056 organ Anatomy 0.000 description 4
- 210000001519 tissue Anatomy 0.000 description 4
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 4
- 239000003981 vehicle Substances 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 3
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 3
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 3
- 101150037123 APOE gene Proteins 0.000 description 3
- WFDIJRYMOXRFFG-UHFFFAOYSA-N Acetic anhydride Chemical compound CC(=O)OC(C)=O WFDIJRYMOXRFFG-UHFFFAOYSA-N 0.000 description 3
- 150000008574 D-amino acids Chemical group 0.000 description 3
- 101100216294 Danio rerio apoeb gene Proteins 0.000 description 3
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 3
- AEMRFAOFKBGASW-UHFFFAOYSA-N Glycolic acid Chemical compound OCC(O)=O AEMRFAOFKBGASW-UHFFFAOYSA-N 0.000 description 3
- PIWKPBJCKXDKJR-UHFFFAOYSA-N Isoflurane Chemical compound FC(F)OC(Cl)C(F)(F)F PIWKPBJCKXDKJR-UHFFFAOYSA-N 0.000 description 3
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical class NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 3
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 3
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 3
- KWYUFKZDYYNOTN-UHFFFAOYSA-M Potassium hydroxide Chemical compound [OH-].[K+] KWYUFKZDYYNOTN-UHFFFAOYSA-M 0.000 description 3
- 101000897961 Rattus norvegicus Endothelial cell-specific molecule 1 Proteins 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 230000003178 anti-diabetic effect Effects 0.000 description 3
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 3
- 230000004888 barrier function Effects 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 230000036772 blood pressure Effects 0.000 description 3
- 230000036760 body temperature Effects 0.000 description 3
- 230000037396 body weight Effects 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 239000000969 carrier Substances 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 238000013461 design Methods 0.000 description 3
- 238000012377 drug delivery Methods 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 230000001976 improved effect Effects 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 229960002725 isoflurane Drugs 0.000 description 3
- 210000004072 lung Anatomy 0.000 description 3
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 3
- 229910052760 oxygen Inorganic materials 0.000 description 3
- 239000001301 oxygen Substances 0.000 description 3
- 230000001575 pathological effect Effects 0.000 description 3
- 229940064298 pregnyl Drugs 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 235000018102 proteins Nutrition 0.000 description 3
- 102000004169 proteins and genes Human genes 0.000 description 3
- ZGYICYBLPGRURT-UHFFFAOYSA-N tri(propan-2-yl)silicon Chemical compound CC(C)[Si](C(C)C)C(C)C ZGYICYBLPGRURT-UHFFFAOYSA-N 0.000 description 3
- 210000001835 viscera Anatomy 0.000 description 3
- BDNKZNFMNDZQMI-UHFFFAOYSA-N 1,3-diisopropylcarbodiimide Chemical compound CC(C)N=C=NC(C)C BDNKZNFMNDZQMI-UHFFFAOYSA-N 0.000 description 2
- BMYNFMYTOJXKLE-UHFFFAOYSA-N 3-azaniumyl-2-hydroxypropanoate Chemical compound NCC(O)C(O)=O BMYNFMYTOJXKLE-UHFFFAOYSA-N 0.000 description 2
- UPXRTVAIJMUAQR-UHFFFAOYSA-N 4-(9h-fluoren-9-ylmethoxycarbonylamino)-1-[(2-methylpropan-2-yl)oxycarbonyl]pyrrolidine-2-carboxylic acid Chemical compound C1C(C(O)=O)N(C(=O)OC(C)(C)C)CC1NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C21 UPXRTVAIJMUAQR-UHFFFAOYSA-N 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 102100026679 Carboxypeptidase Q Human genes 0.000 description 2
- RGHNJXZEOKUKBD-SQOUGZDYSA-N D-gluconic acid Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)=O RGHNJXZEOKUKBD-SQOUGZDYSA-N 0.000 description 2
- 206010018473 Glycosuria Diseases 0.000 description 2
- 208000031886 HIV Infections Diseases 0.000 description 2
- 208000037357 HIV infectious disease Diseases 0.000 description 2
- 208000032843 Hemorrhage Diseases 0.000 description 2
- 101000910846 Homo sapiens Carboxypeptidase Q Proteins 0.000 description 2
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 2
- 208000001953 Hypotension Diseases 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- 102000015696 Interleukins Human genes 0.000 description 2
- 108010063738 Interleukins Proteins 0.000 description 2
- DPWGZWUMUUJQDT-IUCAKERBSA-N Leu-Gln-Gly Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(O)=O DPWGZWUMUUJQDT-IUCAKERBSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- ATHHXGZTWNVVOU-UHFFFAOYSA-N N-methylformamide Chemical compound CNC=O ATHHXGZTWNVVOU-UHFFFAOYSA-N 0.000 description 2
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 2
- GRYLNZFGIOXLOG-UHFFFAOYSA-N Nitric acid Chemical compound O[N+]([O-])=O GRYLNZFGIOXLOG-UHFFFAOYSA-N 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- LCTONWCANYUPML-UHFFFAOYSA-N Pyruvic acid Chemical compound CC(=O)C(O)=O LCTONWCANYUPML-UHFFFAOYSA-N 0.000 description 2
- KDYFGRWQOYBRFD-UHFFFAOYSA-N Succinic acid Natural products OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 2
- 210000001744 T-lymphocyte Anatomy 0.000 description 2
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 2
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 2
- 235000011054 acetic acid Nutrition 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 125000003545 alkoxy group Chemical group 0.000 description 2
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 2
- 150000008064 anhydrides Chemical class 0.000 description 2
- 230000003110 anti-inflammatory effect Effects 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 2
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 2
- 229920002988 biodegradable polymer Polymers 0.000 description 2
- 239000004621 biodegradable polymer Substances 0.000 description 2
- 208000034158 bleeding Diseases 0.000 description 2
- 231100000319 bleeding Toxicity 0.000 description 2
- 230000000740 bleeding effect Effects 0.000 description 2
- 210000000601 blood cell Anatomy 0.000 description 2
- KDYFGRWQOYBRFD-NUQCWPJISA-N butanedioic acid Chemical compound O[14C](=O)CC[14C](O)=O KDYFGRWQOYBRFD-NUQCWPJISA-N 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 210000000038 chest Anatomy 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 230000002596 correlated effect Effects 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- 210000004443 dendritic cell Anatomy 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- BGRWYRAHAFMIBJ-UHFFFAOYSA-N diisopropylcarbodiimide Natural products CC(C)NC(=O)NC(C)C BGRWYRAHAFMIBJ-UHFFFAOYSA-N 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- XBDQKXXYIPTUBI-UHFFFAOYSA-N dimethylselenoniopropionate Natural products CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 2
- 208000035475 disorder Diseases 0.000 description 2
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 2
- 238000013401 experimental design Methods 0.000 description 2
- 239000012894 fetal calf serum Substances 0.000 description 2
- 235000013305 food Nutrition 0.000 description 2
- 239000001530 fumaric acid Substances 0.000 description 2
- 238000007446 glucose tolerance test Methods 0.000 description 2
- 230000035780 glucosuria Effects 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 229910052736 halogen Inorganic materials 0.000 description 2
- 150000002367 halogens Chemical class 0.000 description 2
- 238000010438 heat treatment Methods 0.000 description 2
- 208000033519 human immunodeficiency virus infectious disease Diseases 0.000 description 2
- 239000000017 hydrogel Substances 0.000 description 2
- 229910052739 hydrogen Inorganic materials 0.000 description 2
- 239000001257 hydrogen Substances 0.000 description 2
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 2
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 description 2
- 230000036543 hypotension Effects 0.000 description 2
- 230000002757 inflammatory effect Effects 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 230000028709 inflammatory response Effects 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 229960004184 ketamine hydrochloride Drugs 0.000 description 2
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 235000018977 lysine Nutrition 0.000 description 2
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 2
- 239000011976 maleic acid Substances 0.000 description 2
- 238000013507 mapping Methods 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 2
- 150000007522 mineralic acids Chemical class 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 229910017604 nitric acid Inorganic materials 0.000 description 2
- 150000007524 organic acids Chemical class 0.000 description 2
- 230000001717 pathogenic effect Effects 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- VLTRZXGMWDSKGL-UHFFFAOYSA-N perchloric acid Chemical compound OCl(=O)(=O)=O VLTRZXGMWDSKGL-UHFFFAOYSA-N 0.000 description 2
- 230000010412 perfusion Effects 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 229920000728 polyester Polymers 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 238000011886 postmortem examination Methods 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 238000011809 primate model Methods 0.000 description 2
- 230000002035 prolonged effect Effects 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 238000004007 reversed phase HPLC Methods 0.000 description 2
- 239000012266 salt solution Substances 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- LPXPTNMVRIOKMN-UHFFFAOYSA-M sodium nitrite Chemical compound [Na+].[O-]N=O LPXPTNMVRIOKMN-UHFFFAOYSA-M 0.000 description 2
- 238000010532 solid phase synthesis reaction Methods 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 230000001629 suppression Effects 0.000 description 2
- 238000013268 sustained release Methods 0.000 description 2
- 239000012730 sustained-release form Substances 0.000 description 2
- 210000002435 tendon Anatomy 0.000 description 2
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 2
- ZMZDMBWJUHKJPS-UHFFFAOYSA-N thiocyanic acid Chemical compound SC#N ZMZDMBWJUHKJPS-UHFFFAOYSA-N 0.000 description 2
- 230000008673 vomiting Effects 0.000 description 2
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 2
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 1
- VWWKKDNCCLAGRM-GVXVVHGQSA-N (2s)-2-[[2-[[(2s)-2-[[(2s)-2-amino-4-methylpentanoyl]amino]propanoyl]amino]acetyl]amino]-3-methylbutanoic acid Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O VWWKKDNCCLAGRM-GVXVVHGQSA-N 0.000 description 1
- BJEPYKJPYRNKOW-REOHCLBHSA-N (S)-malic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O BJEPYKJPYRNKOW-REOHCLBHSA-N 0.000 description 1
- RKDVKSZUMVYZHH-UHFFFAOYSA-N 1,4-dioxane-2,5-dione Chemical compound O=C1COC(=O)CO1 RKDVKSZUMVYZHH-UHFFFAOYSA-N 0.000 description 1
- ASOKPJOREAFHNY-UHFFFAOYSA-N 1-Hydroxybenzotriazole Chemical compound C1=CC=C2N(O)N=NC2=C1 ASOKPJOREAFHNY-UHFFFAOYSA-N 0.000 description 1
- TUSDEZXZIZRFGC-UHFFFAOYSA-N 1-O-galloyl-3,6-(R)-HHDP-beta-D-glucose Natural products OC1C(O2)COC(=O)C3=CC(O)=C(O)C(O)=C3C3=C(O)C(O)=C(O)C=C3C(=O)OC1C(O)C2OC(=O)C1=CC(O)=C(O)C(O)=C1 TUSDEZXZIZRFGC-UHFFFAOYSA-N 0.000 description 1
- JFLSOKIMYBSASW-UHFFFAOYSA-N 1-chloro-2-[chloro(diphenyl)methyl]benzene Chemical compound ClC1=CC=CC=C1C(Cl)(C=1C=CC=CC=1)C1=CC=CC=C1 JFLSOKIMYBSASW-UHFFFAOYSA-N 0.000 description 1
- OZDAOHVKBFBBMZ-UHFFFAOYSA-N 2-aminopentanedioic acid;hydrate Chemical compound O.OC(=O)C(N)CCC(O)=O OZDAOHVKBFBBMZ-UHFFFAOYSA-N 0.000 description 1
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 1
- SQDAZGGFXASXDW-UHFFFAOYSA-N 5-bromo-2-(trifluoromethoxy)pyridine Chemical compound FC(F)(F)OC1=CC=C(Br)C=N1 SQDAZGGFXASXDW-UHFFFAOYSA-N 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 241000607528 Aeromonas hydrophila Species 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- VHUUQVKOLVNVRT-UHFFFAOYSA-N Ammonium hydroxide Chemical compound [NH4+].[OH-] VHUUQVKOLVNVRT-UHFFFAOYSA-N 0.000 description 1
- 102000007592 Apolipoproteins Human genes 0.000 description 1
- 108010071619 Apolipoproteins Proteins 0.000 description 1
- 101001007348 Arachis hypogaea Galactose-binding lectin Proteins 0.000 description 1
- 239000005711 Benzoic acid Substances 0.000 description 1
- 208000020084 Bone disease Diseases 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 241000589876 Campylobacter Species 0.000 description 1
- 239000004215 Carbon black (E152) Substances 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- ZAMOUSCENKQFHK-UHFFFAOYSA-N Chlorine atom Chemical compound [Cl] ZAMOUSCENKQFHK-UHFFFAOYSA-N 0.000 description 1
- 229920001287 Chondroitin sulfate Polymers 0.000 description 1
- 206010010904 Convulsion Diseases 0.000 description 1
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 1
- RGHNJXZEOKUKBD-UHFFFAOYSA-N D-gluconic acid Natural products OCC(O)C(O)C(O)C(O)C(O)=O RGHNJXZEOKUKBD-UHFFFAOYSA-N 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 206010013975 Dyspnoeas Diseases 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 1
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 1
- 206010015856 Extrasystoles Diseases 0.000 description 1
- 239000001263 FEMA 3042 Substances 0.000 description 1
- 206010053172 Fatal outcomes Diseases 0.000 description 1
- PXGOKWXKJXAPGV-UHFFFAOYSA-N Fluorine Chemical compound FF PXGOKWXKJXAPGV-UHFFFAOYSA-N 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- 206010018429 Glucose tolerance impaired Diseases 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 206010019280 Heart failures Diseases 0.000 description 1
- 206010019909 Hernia Diseases 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- RKUNBYITZUJHSG-UHFFFAOYSA-N Hyosciamin-hydrochlorid Natural products CN1C(C2)CCC1CC2OC(=O)C(CO)C1=CC=CC=C1 RKUNBYITZUJHSG-UHFFFAOYSA-N 0.000 description 1
- 229930194542 Keto Natural products 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- 150000008575 L-amino acids Chemical group 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- 102000000853 LDL receptors Human genes 0.000 description 1
- 108010001831 LDL receptors Proteins 0.000 description 1
- UCBPDSYUVAAHCD-UWVGGRQHSA-N Leu-Pro-Gly Chemical compound CC(C)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O UCBPDSYUVAAHCD-UWVGGRQHSA-N 0.000 description 1
- 108010048043 Macrophage Migration-Inhibitory Factors Proteins 0.000 description 1
- 102100037791 Macrophage migration inhibitory factor Human genes 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- KSIPKXNIQOWMIC-RCWTZXSCSA-N Met-Thr-Arg Chemical compound CSCC[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CCCNC(N)=N KSIPKXNIQOWMIC-RCWTZXSCSA-N 0.000 description 1
- 208000034486 Multi-organ failure Diseases 0.000 description 1
- 208000010718 Multiple Organ Failure Diseases 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- WFBHRSAKANVBKH-UHFFFAOYSA-N N-hydroxyguanidine Chemical compound NC(=N)NO WFBHRSAKANVBKH-UHFFFAOYSA-N 0.000 description 1
- 238000011887 Necropsy Methods 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 206010030113 Oedema Diseases 0.000 description 1
- 208000001132 Osteoporosis Diseases 0.000 description 1
- 208000034038 Pathologic Neovascularization Diseases 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- LRBQNJMCXXYXIU-PPKXGCFTSA-N Penta-digallate-beta-D-glucose Natural products OC1=C(O)C(O)=CC(C(=O)OC=2C(=C(O)C=C(C=2)C(=O)OC[C@@H]2[C@H]([C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)O2)OC(=O)C=2C=C(OC(=O)C=3C=C(O)C(O)=C(O)C=3)C(O)=C(O)C=2)O)=C1 LRBQNJMCXXYXIU-PPKXGCFTSA-N 0.000 description 1
- 108010067902 Peptide Library Proteins 0.000 description 1
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 1
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 1
- 229920001244 Poly(D,L-lactide) Polymers 0.000 description 1
- 239000004952 Polyamide Substances 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 108010020346 Polyglutamic Acid Proteins 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 208000000418 Premature Cardiac Complexes Diseases 0.000 description 1
- HMNSRTLZAJHSIK-YUMQZZPRSA-N Pro-Arg Chemical compound NC(=N)NCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1 HMNSRTLZAJHSIK-YUMQZZPRSA-N 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 241000607768 Shigella Species 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 1
- 235000001468 Triticum dicoccon Nutrition 0.000 description 1
- 240000000359 Triticum dicoccon Species 0.000 description 1
- 206010047700 Vomiting Diseases 0.000 description 1
- 208000010399 Wasting Syndrome Diseases 0.000 description 1
- 241000607447 Yersinia enterocolitica Species 0.000 description 1
- 241000607479 Yersinia pestis Species 0.000 description 1
- 241000607477 Yersinia pseudotuberculosis Species 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- 230000003187 abdominal effect Effects 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 125000002252 acyl group Chemical group 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 108010047506 alanyl-glutaminyl-glycyl-valine Proteins 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- BJEPYKJPYRNKOW-UHFFFAOYSA-N alpha-hydroxysuccinic acid Natural products OC(=O)C(O)CC(O)=O BJEPYKJPYRNKOW-UHFFFAOYSA-N 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 150000003862 amino acid derivatives Chemical class 0.000 description 1
- 239000000908 ammonium hydroxide Substances 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 239000003957 anion exchange resin Substances 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 150000004982 aromatic amines Chemical class 0.000 description 1
- 125000002029 aromatic hydrocarbon group Chemical group 0.000 description 1
- 150000004945 aromatic hydrocarbons Chemical group 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- RKUNBYITZUJHSG-SPUOUPEWSA-N atropine Chemical compound O([C@H]1C[C@H]2CC[C@@H](C1)N2C)C(=O)C(CO)C1=CC=CC=C1 RKUNBYITZUJHSG-SPUOUPEWSA-N 0.000 description 1
- 229960000396 atropine Drugs 0.000 description 1
- 150000001540 azides Chemical class 0.000 description 1
- 230000000721 bacterilogical effect Effects 0.000 description 1
- 229910052788 barium Inorganic materials 0.000 description 1
- DSAJWYNOEDNPEQ-UHFFFAOYSA-N barium atom Chemical compound [Ba] DSAJWYNOEDNPEQ-UHFFFAOYSA-N 0.000 description 1
- 210000000227 basophil cell of anterior lobe of hypophysis Anatomy 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- JUHORIMYRDESRB-UHFFFAOYSA-N benzathine Chemical compound C=1C=CC=CC=1CNCCNCC1=CC=CC=C1 JUHORIMYRDESRB-UHFFFAOYSA-N 0.000 description 1
- 235000010233 benzoic acid Nutrition 0.000 description 1
- 238000005574 benzylation reaction Methods 0.000 description 1
- 125000001584 benzyloxycarbonyl group Chemical group C(=O)(OCC1=CC=CC=C1)* 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 230000027455 binding Effects 0.000 description 1
- 229910052797 bismuth Inorganic materials 0.000 description 1
- JCXGWMGPZLAOME-UHFFFAOYSA-N bismuth atom Chemical compound [Bi] JCXGWMGPZLAOME-UHFFFAOYSA-N 0.000 description 1
- 229920001400 block copolymer Polymers 0.000 description 1
- 230000023555 blood coagulation Effects 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 150000001718 carbodiimides Chemical class 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 238000009903 catalytic hydrogenation reaction Methods 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 150000005829 chemical entities Chemical class 0.000 description 1
- 239000000460 chlorine Substances 0.000 description 1
- 229910052801 chlorine Inorganic materials 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 229940059329 chondroitin sulfate Drugs 0.000 description 1
- 235000015165 citric acid Nutrition 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 229910017052 cobalt Inorganic materials 0.000 description 1
- 239000010941 cobalt Substances 0.000 description 1
- GUTLYIVDDKVIGB-UHFFFAOYSA-N cobalt atom Chemical compound [Co] GUTLYIVDDKVIGB-UHFFFAOYSA-N 0.000 description 1
- 230000001332 colony forming effect Effects 0.000 description 1
- 230000036461 convulsion Effects 0.000 description 1
- 229910052802 copper Inorganic materials 0.000 description 1
- 239000010949 copper Substances 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 150000001945 cysteines Chemical class 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 238000004042 decolorization Methods 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 238000010511 deprotection reaction Methods 0.000 description 1
- 230000035487 diastolic blood pressure Effects 0.000 description 1
- 229960004132 diethyl ether Drugs 0.000 description 1
- 230000008034 disappearance Effects 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 238000009510 drug design Methods 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 238000005538 encapsulation Methods 0.000 description 1
- 244000079386 endoparasite Species 0.000 description 1
- 150000002169 ethanolamines Chemical class 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 230000008020 evaporation Effects 0.000 description 1
- 210000003608 fece Anatomy 0.000 description 1
- 239000000835 fiber Substances 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 229910052731 fluorine Inorganic materials 0.000 description 1
- 239000011737 fluorine Substances 0.000 description 1
- 235000019253 formic acid Nutrition 0.000 description 1
- 235000011087 fumaric acid Nutrition 0.000 description 1
- LRBQNJMCXXYXIU-QWKBTXIPSA-N gallotannic acid Chemical compound OC1=C(O)C(O)=CC(C(=O)OC=2C(=C(O)C=C(C=2)C(=O)OC[C@H]2[C@@H]([C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)O2)OC(=O)C=2C=C(OC(=O)C=3C=C(O)C(O)=C(O)C=3)C(O)=C(O)C=2)O)=C1 LRBQNJMCXXYXIU-QWKBTXIPSA-N 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 210000004392 genitalia Anatomy 0.000 description 1
- 239000000174 gluconic acid Substances 0.000 description 1
- 235000012208 gluconic acid Nutrition 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 1
- 230000036449 good health Effects 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 230000003394 haemopoietic effect Effects 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 230000002489 hematologic effect Effects 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 229920002674 hyaluronan Polymers 0.000 description 1
- 229960003160 hyaluronic acid Drugs 0.000 description 1
- 229930195733 hydrocarbon Natural products 0.000 description 1
- 150000002430 hydrocarbons Chemical class 0.000 description 1
- 125000002883 imidazolyl group Chemical group 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 239000005414 inactive ingredient Substances 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 150000007529 inorganic bases Chemical class 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 125000001972 isopentyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000000468 ketone group Chemical group 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 239000004310 lactic acid Substances 0.000 description 1
- 235000014655 lactic acid Nutrition 0.000 description 1
- JJTUDXZGHPGLLC-UHFFFAOYSA-N lactide Chemical compound CC1OC(=O)C(C)OC1=O JJTUDXZGHPGLLC-UHFFFAOYSA-N 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 231100000636 lethal dose Toxicity 0.000 description 1
- 108010009932 leucyl-alanyl-glycyl-valine Proteins 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 210000005210 lymphoid organ Anatomy 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 239000001630 malic acid Substances 0.000 description 1
- 235000011090 malic acid Nutrition 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000000897 modulatory effect Effects 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 208000029744 multiple organ dysfunction syndrome Diseases 0.000 description 1
- 125000001624 naphthyl group Chemical group 0.000 description 1
- 210000005036 nerve Anatomy 0.000 description 1
- 229910052759 nickel Inorganic materials 0.000 description 1
- 125000000449 nitro group Chemical group [O-][N+](*)=O 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 150000002892 organic cations Chemical class 0.000 description 1
- 235000006408 oxalic acid Nutrition 0.000 description 1
- WLJNZVDCPSBLRP-UHFFFAOYSA-N pamoic acid Chemical compound C1=CC=C2C(CC=3C4=CC=CC=C4C=C(C=3O)C(=O)O)=C(O)C(C(O)=O)=CC2=C1 WLJNZVDCPSBLRP-UHFFFAOYSA-N 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 239000000816 peptidomimetic Substances 0.000 description 1
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- UYWQUFXKFGHYNT-UHFFFAOYSA-N phenylmethyl ester of formic acid Natural products O=COCC1=CC=CC=C1 UYWQUFXKFGHYNT-UHFFFAOYSA-N 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 239000011574 phosphorus Substances 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920002647 polyamide Polymers 0.000 description 1
- 229920001610 polycaprolactone Polymers 0.000 description 1
- 239000004632 polycaprolactone Substances 0.000 description 1
- 229920002643 polyglutamic acid Polymers 0.000 description 1
- 229920000193 polymethacrylate Polymers 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 229920006324 polyoxymethylene Polymers 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 229920001451 polypropylene glycol Polymers 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 235000019422 polyvinyl alcohol Nutrition 0.000 description 1
- 238000009101 premedication Methods 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 108010004914 prolylarginine Proteins 0.000 description 1
- 235000019260 propionic acid Nutrition 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 229940076788 pyruvate Drugs 0.000 description 1
- 229940107700 pyruvic acid Drugs 0.000 description 1
- 238000000718 qrs complex Methods 0.000 description 1
- IUVKMZGDUIUOCP-BTNSXGMBSA-N quinbolone Chemical compound O([C@H]1CC[C@H]2[C@H]3[C@@H]([C@]4(C=CC(=O)C=C4CC3)C)CC[C@@]21C)C1=CCCC1 IUVKMZGDUIUOCP-BTNSXGMBSA-N 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000011514 reflex Effects 0.000 description 1
- 239000004627 regenerated cellulose Substances 0.000 description 1
- 230000001172 regenerating effect Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 230000029058 respiratory gaseous exchange Effects 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 229920006395 saturated elastomer Polymers 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 235000010288 sodium nitrite Nutrition 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 210000000278 spinal cord Anatomy 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 239000012086 standard solution Substances 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 230000035488 systolic blood pressure Effects 0.000 description 1
- 229920002258 tannic acid Polymers 0.000 description 1
- 235000015523 tannic acid Nutrition 0.000 description 1
- 229940033123 tannic acid Drugs 0.000 description 1
- 239000011975 tartaric acid Substances 0.000 description 1
- 235000002906 tartaric acid Nutrition 0.000 description 1
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- 230000000451 tissue damage Effects 0.000 description 1
- 231100000827 tissue damage Toxicity 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 125000005270 trialkylamine group Chemical group 0.000 description 1
- 125000002221 trityl group Chemical group [H]C1=C([H])C([H])=C([H])C([H])=C1C([*])(C1=C(C(=C(C(=C1[H])[H])[H])[H])[H])C1=C([H])C([H])=C([H])C([H])=C1[H] 0.000 description 1
- JOYRKODLDBILNP-UHFFFAOYSA-N urethane group Chemical group NC(=O)OCC JOYRKODLDBILNP-UHFFFAOYSA-N 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 230000004865 vascular response Effects 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 239000011345 viscous material Substances 0.000 description 1
- 229940098232 yersinia enterocolitica Drugs 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
- 239000011701 zinc Substances 0.000 description 1
- PAPBSGBWRJIAAV-UHFFFAOYSA-N ε-Caprolactone Chemical compound O=C1CCCCCO1 PAPBSGBWRJIAAV-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K4/00—Peptides having up to 20 amino acids in an undefined or only partially defined sequence; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/07—Tetrapeptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/06—Tripeptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/08—Peptides having 5 to 11 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/10—Peptides having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/59—Follicle-stimulating hormone [FSH]; Chorionic gonadotropins, e.g.hCG [human chorionic gonadotropin]; Luteinising hormone [LH]; Thyroid-stimulating hormone [TSH]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
- C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
- C07K5/06—Dipeptides
- C07K5/06008—Dipeptides with the first amino acid being neutral
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
- C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
- C07K5/06—Dipeptides
- C07K5/06008—Dipeptides with the first amino acid being neutral
- C07K5/06017—Dipeptides with the first amino acid being neutral and aliphatic
- C07K5/06026—Dipeptides with the first amino acid being neutral and aliphatic the side chain containing 0 or 1 carbon atom, i.e. Gly or Ala
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
- C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
- C07K5/08—Tripeptides
- C07K5/0802—Tripeptides with the first amino acid being neutral
- C07K5/0804—Tripeptides with the first amino acid being neutral and aliphatic
- C07K5/0806—Tripeptides with the first amino acid being neutral and aliphatic the side chain containing 0 or 1 carbon atoms, i.e. Gly, Ala
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
- C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
- C07K5/08—Tripeptides
- C07K5/0802—Tripeptides with the first amino acid being neutral
- C07K5/0804—Tripeptides with the first amino acid being neutral and aliphatic
- C07K5/0808—Tripeptides with the first amino acid being neutral and aliphatic the side chain containing 2 to 4 carbon atoms, e.g. Val, Ile, Leu
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
- C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
- C07K5/08—Tripeptides
- C07K5/0802—Tripeptides with the first amino acid being neutral
- C07K5/0804—Tripeptides with the first amino acid being neutral and aliphatic
- C07K5/081—Tripeptides with the first amino acid being neutral and aliphatic the side chain containing O or S as heteroatoms, e.g. Cys, Ser
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
- C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
- C07K5/10—Tetrapeptides
- C07K5/1002—Tetrapeptides with the first amino acid being neutral
- C07K5/1005—Tetrapeptides with the first amino acid being neutral and aliphatic
- C07K5/1008—Tetrapeptides with the first amino acid being neutral and aliphatic the side chain containing 0 or 1 carbon atoms, i.e. Gly, Ala
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
- C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
- C07K5/10—Tetrapeptides
- C07K5/1002—Tetrapeptides with the first amino acid being neutral
- C07K5/1005—Tetrapeptides with the first amino acid being neutral and aliphatic
- C07K5/101—Tetrapeptides with the first amino acid being neutral and aliphatic the side chain containing 2 to 4 carbon atoms, e.g. Val, Ile, Leu
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
- C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
- C07K5/10—Tetrapeptides
- C07K5/1002—Tetrapeptides with the first amino acid being neutral
- C07K5/1005—Tetrapeptides with the first amino acid being neutral and aliphatic
- C07K5/1013—Tetrapeptides with the first amino acid being neutral and aliphatic the side chain containing O or S as heteroatoms, e.g. Cys, Ser
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
- C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
- C07K5/10—Tetrapeptides
- C07K5/1021—Tetrapeptides with the first amino acid being acidic
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
- C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
- C07K5/10—Tetrapeptides
- C07K5/1024—Tetrapeptides with the first amino acid being heterocyclic
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the invention relates generally to biotechnology, and more specifically to compositions having immunoregulatory activity, which compounds include particular oligopeptides derived from human chorionic gonadotropin (hCG).
- hCG human chorionic gonadotropin
- compositions containing purified or isolated oligopeptides described herein have immunoregulatory activity useful in, for example, the treatment of sepsis and other disease states and conditions. They also have gene regulatory activities.
- the invention thus includes a composition
- a composition comprising a purified or isolated peptide consisting of particular four to eight amino acid segments of the sequence MTRVLQGV-LPALPQVVC (SEQ ID NO:44 of the incorporated herein SEQUENCE LISTING); and derivatives thereof having one or more conservative substitutions relative to the sequence of SEQ ID NO:44.
- the particular compositions exhibit immunoregulatory activity as determined by measuring the segment's ability to modulate production of NO by a cell.
- the compositions have the ability to decrease shock in a subject (e.g., a mammal) undergoing sepsis.
- the amino acid segment includes a tetrameric sequence (corresponding to the LQVG (SEQ ID NO: 1) portion of SEQ ID NO:44, i.e.,
- AAL is a substituted or unsubstituted non-polar amino acid selected from the group consisting of Ala and Leu
- AAQ is a substituted or unsubstituted amino acid selected from the group consisting of Gin, Pro, and Ala
- AAG is a substituted or unsubstituted Gly
- AAV is a substituted or unsubstituted non-polar amino acid selected from the group consisting of Val and Ala.
- the peptide could be selected from the group consisting of LQGV (SEQ ID NO:1), the derivative AQGV (SEQ ID NO:2), the derivative LQGA (SEQ ID NO:19), the derivative LAGV (SEQ ID NO:26), and the derivativeLPGC (SEQ ID NO:41).
- the segment is the tetramer MTRV (SEQ ID NO:42) or QVVC (SEQ ID NO:43).
- the segment is six or seven amino acids long, and comprises the sequence
- AAV is substituted or unsubstituted Val or Ala
- AAL and AAL2 are independently selected from substituted or unsubstituted Lys or Ala
- AAP is a substituted or unsubstituted Pro or Ala.
- the purified or isolated peptide can have a formula selected from the group consisting of VLPALP (SEQ ID NO:3), the derivative ALPALP (SEQ ID NO:21), the derivative VAPALP (SEQ ID NO:22), the derivative ALPALPQ (SEQ ID NO:23), the derivative VLPAAPQ (SEQ ID NO:24), the derivative VLPALAQ (SEQ ID NO:25), the derivative VLPALA (SEQ ID NO:28), VLPALPQ (SEQ ID NO:29), the derivative VLPALPA (SEQ ID NO:31), the derivative GVLPALP (SEQ ID NO:32), and the derivative VLAALP (SEQ ID NO:117).
- VLPALP SEQ ID NO:3
- the derivative ALPALP SEQ ID NO:21
- the derivative VAPALP SEQ ID NO:22
- the derivative ALPALPQ SEQ ID NO:23
- the derivative VLPAAPQ SEQ ID NO:24
- the derivative VLPALAQ SEQ ID NO:25
- the composition has no more than eight amino acids, and includes an amino acid sequence consisting of:
- AAL is a substituted or unsubstituted amino acid selected from the group of amino acids consisting of Ala, Leu, and Met
- AAQ is a substituted or unsubstituted amino acid selected from the group of amino acids consisting of Gln, Thr, Ala, and Pro
- AAG is substituted or unsubstituted Gly or Arg
- AAV is a substituted or unsubstituted amino acid selected from the group of amino acids consisting of Cys, Ala, and Val.
- the sequence is preferably selected from the group consisting of Leu Gln Gly Val (SEQ ID NO:1), Ala Gln Gly Val (SEQ ID NO:2), Leu Gln Gly Ala (SEQ ID NO:19), Leu Ala Gly Val (SEQ ID NO:26), Leu Pro Gly Cys (SEQ ID NO:41), and Met Thr Arg Val (SEQ ID NO:42).
- the composition is the sequence of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:19, SEQ ID NO:26, SEQ ID NO:41, SEQ ID NO:42, or a salt of any thereof.
- the invention further includes a pharmaceutical composition
- a pharmaceutical composition comprising a purified or isolated peptide, or acid addition salt thereof, the purified or isolated peptide (a) consisting of an amino acid sequence selected from the group consisting of: (i) a four to seven amino acid segment of the sequence of MTRVLQGVLPALPQVVC (SEQ ID NO:44); and (ii) a derivative of the segment of (a) having one or more conservative substitutions relative to the sequence of SEQ ID NO:44; and (b) exhibiting an immunoregulatory activity as determined by measuring its capability of modulating production of NO by a cell.
- a pharmaceutical composition comprising a purified or isolated peptide, or acid addition salt thereof, the purified or isolated peptide (a) consisting of an amino acid sequence selected from the group consisting of: (i) a four to seven amino acid segment of the sequence of MTRVLQGVLPALPQVVC (SEQ ID NO:44); and (ii) a derivative of the segment of (
- Such a pharmaceutical composition preferably includes a sequence selected from the group selected from the group consisting of LQGV (SEQ ID NO:1), AQGV (SEQ ID NO:2), VLPALP (SEQ ID NO:3), LQGA (SEQ ID NO:19), ALPALP (SEQ ID NO:21), VAPALP (SEQ ID NO:22), ALPALPQ (SEQ ID NO:23), VLPAAPQ (SEQ ID NO:24), VLPALAQ (SEQ ID NO:25), LAGV (SEQ ID NO:26), VLPALA (SEQ ID NO:28), VLPALPQ (SEQ ID NO:29), VLPALPA (SEQ ID NO:31), and GVLPALP (SEQ ID NO:32), LPGC (SEQ ID NO:41), MTRV (SEQ ID NO:42), QVVC (SEQ ID NO:43), VLAALP (SEQ ID NO:117), and combinations of any thereof, with or without other active or inactive ingredients, presented in a pharmaceutically acceptable
- the inventin is a purified or isolated peptide consisting of GVLPALPQ (SEQ ID NO:33), or an acid addition salt thereof.
- the invention would thus also include a pharmaceutical composition comprising the peptide of SEQ ID NO:33 or an addition salt thereof, together with a pharmaceutically acceptable excipient.
- the invention comprises a purified or isolated peptide (or, for example, acid addition salt thereof), selected from the group consisting of AQG, MTR, and VVC.
- the invention includes a composition comprising one or more of the following amino acid segments: LQGV (SEQ ID NO:1), AQGV (SEQ ID NO:2), VLPALP (SEQ ID NO:3), LQGA (SEQ ID NO:19), ALPALP (SEQ ID NO:21), VAPALP (SEQ ID NO:22), ALPALPQ (SEQ ID NO:23), VLPAAPQ (SEQ ID NO:24), VLPALAQ (SEQ ID NO:25), LAGV (SEQ ID NO:26), VLPALA (SEQ ID NO:28), VLPALPQ (SEQ ID NO:29), VLPALPA (SEQ ID NO:31), and GVLPALP (SEQ ID NO:32), LPGC (SEQ ID NO:41), MTRV (SEQ ID NO:42), QVVC (SEQ ID NO:43), VLAALP (SEQ ID NO:117), AQG, MTR, or VVC.
- LQGV SEQ ID NO:1
- AQGV
- the invention includes a composition comprising a purified or isolated peptide consisting of sequence LQG in an amount sufficient to exhibit an immunoregulatory activity as determined by measuring the sequence LQG's ability to modulate production of NO by a cell.
- the invention provides a method for the treatment of bone disease such as osteoporosis comprising administering to a subject believed to be in need of such treatment a composition comprising an oligopeptide, derivative or functional analogue thereof, the particular molecule capable of modulating production of NO and/or TNF-alpha by a cell.
- Such a method of treatment is particularly useful in post-menopausal women that no longer experience the benefits of being provided with a natural source of hCG and its breakdown products.
- Such a treatment can be achieved by systemic administration of a composition of the invention according to the invention, but local administration in joints, bursae or tendon sheaths is provided as well.
- the molecule can be selected from Table 6 or identified in a method described herein.
- the treatment comprises administering to the subject a pharmaceutical composition comprising an oligopeptide or functional analogue thereof capable of reducing production of NO by a cell, for example, wherein the composition comprises at least two oligopeptides or functional analogues thereof, each capable of reducing production of NO and/or TNF-alpha by a cell, in particular wherein the at least two oligopeptides are selected from the group LQGV (SEQ ID NO:1), AQGV (SEQ ID NO:2), and VLPALP (SEQ ID NO:3).
- LQGV SEQ ID NO:1
- AQGV SEQ ID NO:2
- VLPALP VLPALP
- oligopeptides according to the invention have been tested, both ex vivo and in vivo, and in small animals.
- Immunomodulatory effects with these oligopeptides have been observed in vitro and in ex vivo such as in T-cell assays showing the inhibition of pathological Thl immune responses, suppression of inflammatory cytokines (MIF), increase in production of anti-inflammatory cytokines (IL-10, TGF-beta) and immunomodulatory effects on antigen-presenting cells (APC) like dendritic cells, monocytes and macrophages.
- MIF inflammatory cytokines
- APC antigen-presenting cells
- oligopeptides as provided herein allows for rational design of signal molecule mixtures that better alleviate the symptoms seen with sepsis.
- One such mixture a 1:1:1 mixture of LQGV (SEQ ID NO:1), AQGV (SEQ ID NO:2) and VLPALP (SEQ ID NO:3) was administered to primates in a gram-negative induced rhesus monkey sepsis model for prevention of septic shock and found to be effective in this primate model.
- the invention provides a pharmaceutical composition for the treatment of sepsis in a primate and a method for the treatment of sepsis in a primate comprising subjecting the primate to a composition of the invention according to the invention, preferably to a mixture of such composition of the inventions.
- Administration of such a composition of the invention or mixture preferably occurs systematically, for example, by intravenous or intraperitoneal administration.
- such treatment also comprises the use of for example an antibiotic, however, only when such use is not contra indicated because of the risk of generating further toxin loads because of lysis of the bacteria subject to the action of those antibiotics in an individual thus treated.
- the invention also provides use of a composition according to the invention for the preparation of a pharmaceutical composition or medicament and methods of treating various medical conditions that are other than use in the preparation of a pharmaceutical composition for the treatment of an immune-mediated disorder or a method of treatment of an immune-mediated disorder or treatment of a wasting syndrome.
- a “purified or isolated” peptide is one that has been purified from a natural or biotechnological source, or, more preferably, is synthesized as described herein.
- composition refers to chemical compounds which contain or consist of the oligopeptide.
- the oligopeptide is preferably isolated before inclusion within the composition.
- the oligopeptide most preferably consists of three (3) to six (6) amino acids.
- the previously described preferred compound could, in one embodiment be:
- NT at the N-terminus is selected from the group of H—, CH3—, an acyl group, or a general protective group; and CT at the C-terminus is selected from the group of small (e.g. 1 to 5 amino acids) peptides, —OH, —OR 1 , —NH 2 , —NHR 1 , —NR 1 R 2 , or —N(CH 2 ) 1-6 NR 1 R 2 , wherein R 1 and R 2 , when present, are independently selected from H, alkyl, aryl, (ar)alkyl, and wherein R 1 and R 2 can be cyclically bonded to one another.
- small (e.g. 1 to 5 amino acids) peptides —OH, —OR 1 , —NH 2 , —NHR 1 , —NR 1 R 2 , or —N(CH 2 ) 1-6 NR 1 R 2 , wherein R 1 and R 2 , when present, are independently selected from H, alkyl
- Alkyl as used herein, is preferably a saturated branched or unbranched hydrocarbon having one to six carbon atoms, e.g. methyl, ethyl, and isopentyl.
- Aryl as used herein, is an aromatic hydrocarbon group, preferably having 6 to 10 carbon atoms, such as phenyl or naphthyl.
- (Ar)alkyl is an arene group (having both aliphatic and aromatic portions), preferably having 7 to 13 carbon atoms such as benzyl, ethylbenzyl, n-propylbenzyl, and isobutylbenzyl.
- Oletypeptide as used herein are peptides having from 3 to 8 amino acids joined together by peptide bonds. Equivalent to oligopeptides are compounds having the same or equivalent sidechains as the particular amino acids used in an oligopeptide, and arranged sequentially in the same order as the peptides, but joined together by non-peptide bonds, e.g., by isosteric linkages such as the keto isostere, hydroxy isostere, diketo isostere, or the keto-difluoromethylene isostere.
- composition also includes, for example, an acceptable salt of the oligopeptide or a labeled oligopeptide.
- acceptable salt refers to salts that retain the desired activity of the oligopeptide or equivalent compound, but preferably do not detrimentally affect the activity of the oligopeptide or other component of a system in which uses the oligopeptide.
- examples of such salts are acid addition salts formed with inorganic acids, for example, hydrochloric acid, hydrobromic acid, sulfuric acid, phosphoric acid, nitric acid, and the like.
- Salts may also be formed with organic acids such as, for example, acetic acid, oxalic acid, tartaric acid, succinic acid, maleic acid, fumaric acid, gluconic acid, citric acid, malic acid, ascorbic acid, benzoic acid, tannic acid, pamoic acid, alginic acid, polyglutamic acid, and the like.
- Salts may be formed with polyvalent metal cations such as zinc, calcium, bismuth, barium, magnesium, aluminum, copper, cobalt, nickel and the like or with an organic cation formed from N,N′-dibenzylethylenediamine or ethylenediamine, or combinations thereof (e.g., a zinc tannate salt).
- the thus developed chemical entity can be administered and introduced in-vivo systemically, topically, or locally.
- the peptide, or is modification or derivative can be administered as the entity as such or as a pharmaceutically acceptable acid- or baseaddition salt, formed by reaction with an inorganic acid (such as hydrochloric acid, hydrobromic acid, perchloric acid, nitric acid, thiocyanic acid, sulfuric acid, and phosphoric acid); or with an organic acid (such as formic acid, acetic acid, propionic acid, glycolic acid, lactic acid, pyruvic acid, oxahc acid, malonic acid, succinic acid, maleic acid, and fumaric acid); or by reaction with an inorganic base (such as sodium hydroxide, ammonium hydroxide, potassium hydroxide); or with an organic base (such as mono-, di-, trialkyl and aryl amines and substituted ethanolamines).
- an inorganic acid such as hydrochloric acid, hydrobromic acid
- a selected peptide and any of the derived entities may also be conjugated to sugars, lipids, other polypeptides, nucleic acids and PNA; and function in-situ as a conjugate or be released locally after reaching a targeted tissue or organ.
- substitutions with regard to the various amino acids generally relate to substituting a group such as alkoxy, halogen, hydroxy, nitro, or lower alkyl onto an aromatic ring for a hydrogen that would usually be present. Substitutions can also be made on the alkyl chain connecting the aromatic portion to the peptide backbone, with, for instance lower alkyl groups substituting for a hydrogen. Still further substitutions can be made at the alpha position of an amino acid, also using an alkyl group.
- Substitutions with regard to the amino acid phenylalanine include compounds such as L/D-homophenylalanyl, N methyl phenylalanyl, .alpha.-methylphenylalanyl, and alpha.-methyl-tyrosyl.
- substitutions involve the use of fluorine or chlorine as a halogen, and methoxy as an alkoxy group.
- alkyl and lower alkyl generally alkyl groups having fewer (1 to 3) carbon atoms are preferred.
- the compounds according to the general formula may be prepared in a manner conventional for such compounds.
- suitably N alpha. protected (and side-chain protected if reactive side-chains are present) amino acid derivatives or peptides are activated and coupled to suitably carboxyl protected amino acid or peptide derivatives either in solution or on a solid support. Protection of the .alpha.-amino functions generally takes place by urethane functions such as the acid-labile tertiary-butyloxycarbonyl group (“Boc”), benzyloxycarbonyl (“Z”) group and substituted analogs or the base-labile 9-fluoremyl-methyloxycarbonyl (“Fmoc”) group.
- Boc acid-labile tertiary-butyloxycarbonyl group
- Z benzyloxycarbonyl
- Fmoc base-labile 9-fluoremyl-methyloxycarbonyl
- the Z group can also be removed by catalytic hydrogenation,
- suitable protecting groups include the Nps, Bmv, Bpoc, Aloc, MSC, etc.
- a good overview of amino protecting groups is given in The peptides, Analysis, Synthesis, Biology, Vol. 3 E. Gross and J. Meienhofer, eds., (Academic Press, New York, 1981). Protection of carboxyl groups can take place by ester formation, for example, base-labile esters like methyl or ethyl, acid labile esters like tert. butyl or, substituted, benzyl esters or hydrogenolytically. Protection of side-chain functions like those of lysine and glutamic or aspartic acid can take place using the aforementioned groups.
- Activation of the carboxyl group of the suitably protected amino acids or peptides can take place by the azide, mixed anhydride, active ester, or carbodiimide method especially with the addition of catalytic and racemization-suppressing compounds like 1-N—N-hydroxybenzotriazole, N-hydroxysuccin-imide, 3-hydroxy-4-oxo-3,4-dihydro-1,2,3,-benzotriazine, N-hydroxy-5 norbornene-2,3-dicarboxyimide.
- the anhydrides of phosphorus based acids can be used. See, e.g., The Peptides, Analysis, Synthesis, Biology, supra and Pure and Applied Chemistry, 59(3), 331-344 (1987).
- Removal of the protecting groups, and, in the case of solid phase peptide synthesis, the cleavage from the solid support, can take place in different ways, depending on the nature of those protecting groups and the type of linker to the solid support.
- deprotection takes place under acidic conditions and in the presence of scavengers. See, e.g. volumes 3, 5 and 9 of the series on The Peptides Analysis, Synthesis, Biology, supra.
- oligopeptides according to the invention could also be made according to recombinant DNA methods. Such methods involve the preparation of the desired oligopeptide thereof by means of expressing recombinant polynucleotide sequence which codes for one or more of the oligopeptides in question in a suitable microorganism as host.
- the process involves introducing into a cloning vehicle (e.g., a plasmid, phage DNA, or other DNA sequence able to replicate in a host cell) a DNA sequence coding for the particular oligopeptide or oligopeptides, introducing the cloning vehicle into a suitable eucaryotic or procaryotic host cell, and culturing the host cell thus transformed.
- a cloning vehicle e.g., a plasmid, phage DNA, or other DNA sequence able to replicate in a host cell
- a DNA sequence coding for the particular oligopeptide or oligopeptides e.g., a plasmid, phage DNA, or other DNA sequence able to replicate in a host cell
- a eucaryotic or procaryotic host cell e.g., a eucaryotic host cell
- the compound may include a glycoprotein portion.
- a “functional analogue” or “derivative” of a peptide includes an amino acid sequence, or other sequence monomers, which has been altered such that the functional properties of the sequence are essentially the same in kind, not necessarily in amount.
- An analogue or derivative can be provided in many ways, for instance, through “conservative amino acid substitution”.
- peptidomimetic compounds can be designed that functionally or structurally resemble the original peptide taken as the starting point but that are for example composed of non-naturally occurring amino acids or polyamides. With “conservative amino acid substitution”, one amino acid residue is substituted with another residue with generally similar properties (size, hydrophobicity), such that the overall functioning is likely not to be seriously affected.
- a derivative can also be provided by systematically improving at least one desired property of an amino acid sequence. This can, for instance, be done by an Ala-scan and/or replacement net mapping method. With these methods, many different peptides are generated, based on an original amino acid sequence but each containing a substitution of at least one amino acid residue. The amino acid residue may either be replaced by alanine (Ala-scan) or by any other amino acid residue (replacement net mapping). This way, many positional variants of the original amino acid sequence are synthesized. Every positional variant is screened for a specific activity. The generated data are used to design improved peptide derivatives of a certain amino acid sequence.
- a derivative or analogue can also be, for instance, generated by substitution of an L-amino acid residue with a D-amino acid residue.
- This substitution leading to a peptide which does not naturally occur in nature, can improve a property of an amino acid sequence. It is, for example, useful to provide a peptide sequence of known activity of all D-amino acids in retro inversion format, thereby allowing for retained activity and increased half-life values.
- improved peptide derivatives comprising such D-amino acids can be designed with further improved characteristics.
- peptides or analogues can be circularized, for example, by providing them with (terminal) cysteines, dimerized or multimerized, for example, by linkage to lysine or cysteine or other compounds with side-chains that allow linkage or multimerization, brought in tandem- or repeat-configuration, conjugated or otherwise linked to carriers known in the art, if only by a labile link that allows dissociation.
- Synthetic versions of these oligopeptides as described above, and functional analogues or derivatives of these breakdown products, are herein provided to modulate gene expression in a cell and be used in methods to rectify errors in gene expression or the treatment of disease.
- composition as used herein is intended to cover both the active composition of the invention alone or a composition containing the composition of the invention together with a pharmaceutically acceptable carrier, diluent or excipient.
- Acceptable diluents of an oligopeptide as described herein in the detailed description are for example physiological salt solutions or phosphate buffered salt solutions.
- a signal molecule is administered in an effective concentration to an animal or human systemically, e.g., by intravenous, intramuscular or intraperitoneal administration.
- Another way of administration comprises perfusion of organs or tissue, be it in vivo or ex vivo, with a perfusion fluid comprising a signal molecule according to the invention.
- Topical administration may also apply, e.g., in inflammations of the skin or mucosal surfaces of for example mouth, nose and/or genitals.
- Local administration can occur in joints, bursae, tendon sheaths, in or around the spinal cord at locations where nerve bundles branch off, at the location of hernias, in or around infarcted areas in brain or heart, etc.
- the administration may be done as a single dose, as a discontinuous sequence of various doses, or continuously for a period of time sufficient to permit substantial modulation of gene expression. In the case of a continuous administration, the duration of the administration may vary depending upon a number of factors which would readily be appreciated by those skilled in the art.
- the administration dose of the active molecule may be varied over a fairly broad range.
- concentrations of an active molecule which can be administered would be limited by efficacy at the lower end and the solubility of the compound at the upper end.
- the optimal dose or doses for a particular patient should and can be determined by the physician or medical specialist involved, taking into consideration well-known relevant factors such as the condition, weight and age of the patient, etc.
- the active molecule may be administered directly in a suitable vehicle, such as, for example, phosphate-buffered saline (PBS) or solutions in alcohol or DMSO.
- a suitable vehicle such as, for example, phosphate-buffered saline (PBS) or solutions in alcohol or DMSO.
- PBS phosphate-buffered saline
- the active molecule is administered through a single dose delivery using a drug-delivery system, such as a sustained-release delivery system, which enables the maintenance of the required concentrations of the active molecule for a period of time sufficient for adequate modulation of gene expression.
- a suitable drug-delivery system would be pharmacologically inactive or at least tolerable. It should preferably not be immunogenic nor cause inflammatory reactions, and should permit release of the active molecule so as to maintain effective levels thereof over the desired time period.
- Suitable delivery vehicles include, but are not limited to, the following: microcapsules or microspheres; liposomes and other lipid-based release systems; viscous instillates; absorbable and/or biodegradable mechanical barriers and implants; and polymeric delivery materials, such as polyethylene oxide/polypropylene oxide block copolymers, polyesters, cross-linked polyvinylalcohols, polyanhydrides, polymethacrylate and polymethacrylamide hydrogels, anionic carbohydrate polymers, etc.
- Useful delivery systems are well known in the art.
- a highly suitable formulation to achieve the active molecule release comprises injectable microcapsules or microspheres made from a biodegradable polymer, such as poly (dl-lactide), poly(dl-lactide-co-glycolide), polycaprolactone, polyglycolide, polylactic acid-co-glycolide, poly(hydroxybutyric acid), polyesters or polyacetals.
- injectable systems comprising microcapsules or microspheres having a diameter of about 50 to about 500 micrometers offer advantages over other delivery systems. For example, they generally use less active molecules and may be administered by paramedical personnel. Moreover, such systems are inherently flexible in the design of the duration and rate of separate drug release by selection of microcapsule or microsphere size, drug loading and dosage administered. Further, they can be successfully sterilized by gamma irradiation.
- microcapsules and microspheres are well within the reach of persons skilled in the art and detailed information concerning these points is available in the literature.
- Biodegradable polymers such as lactide, glycolide and caprolactone polymers
- Fibers or filaments comprising the active molecule are also contemplated as within the scope of the present invention.
- Another highly suitable formulation for a single-dose delivery of the active molecule in accordance with the present invention involves liposomes.
- the encapsulation of an active molecule in liposomes or multilamellar vesicles is a well-known technique for targeted drug delivery and prolonged drug residence.
- the preparation and use of drug-loaded liposomes is well within the reach of persons skilled in the art and well documented in the literature.
- Suitable approach for single-dose delivery of an active molecule in accordance with the present invention involves the use of viscous installates.
- high molecular weight carriers are used in admixture with the active molecule, giving rise to a structure which produces a solution with high viscosity.
- Suitable high molecular weight carriers include, but are not limited to, the following: dextrans and cyclodextrans; hydrogels; (cross-linked) viscous materials, including (cross-linked) viscoelastics; carboxymethylcellulose; hyaluronic acid; and chondroitin sulfate.
- dextrans and cyclodextrans include, but are not limited to, the following: dextrans and cyclodextrans; hydrogels; (cross-linked) viscous materials, including (cross-linked) viscoelastics; carboxymethylcellulose; hyaluronic acid; and chondroitin sulfate.
- the preparation and use of drug-loaded viscous instillates is
- the active molecule may be administered in combination with absorbable mechanical barriers such as oxidized regenerated cellulose.
- the active molecule may be covalently or non-covalently (e.g., ionically) bound to such a barrier, or it may simply be dispersed therein.
- PEPTIDE SYNTHESIS The peptides as mentioned herein such as LQG, AQG, LQGV (SEQ ID NO:1), AQGV (SEQ ID NO:2), LQGA (SEQ ID NO:19), VLPALP (SEQ ID NO:13), ALPALP (SEQ ID NO:21), VAPALP (SEQ ID NO:22), ALPALPQ (SEQ ID NO:23), VLPAAPQ (SEQ ID NO:24), VLPALAQ (SEQ ID NO:25), LAGV (SEQ ID NO:26), VLAALP (SEQ ID NO:27), VLPALA (SEQ ID NO:28), VLPALPQ (SEQ ID NO:29), VLAALPQ (SEQ ID NO:30), VLPALPA (SEQ ID NO:31), GVLPALP (SEQ ID NO:32), VVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCAL (SEQ ID NO:35), RPRCRPINATLAVEKEGCPVC
- the side-chain of glutamine was protected with a trityl function.
- the peptides were synthesized manually. Each coupling consisted of the following steps: (i) removal of the alpha-amino Fmoc-protection by piperidine in dimethylformamide (DMF), (ii) coupling of the Fmoc amino acid (3 eq) with diisopropylcarbodiimide (DIC)/1-hydroxybenzotriazole (HOBt) in DMF/N-methylformamide (NMP) and (iii) capping of the remaining amino functions with acetic anhydride/diisopropylethylamine (DIEA) in DMF/NMP.
- DMF dimethylformamide
- DIEA acetic anhydride/diisopropylethylamine
- the peptide resin was treated with a mixture of trifluoroacetic acid (TFA)/H 2 O/triisopropylsilane (TIS) 95:2.5:2.5. After 30 minutes, TIS was added until decolorization. The solution was evaporated in vacuo and the peptide precipitated with diethylether.
- TFA trifluoroacetic acid
- TIS triisopropylsilane
- VLPALP SEQ ID NO:3
- VLPALPQ SEQ ID NO:29
- the collected fractions were concentrated to about 5 ml by rotation film evaporation under reduced pressure at 40° C.
- the remaining TFA was exchanged against acetate by eluting two times over a column with anion exchange resin (Merck II) in acetate form.
- the eluate was concentrated and lyphilized in 28 hours. Peptides later were prepared for use by dissolving them in PBS.
- mice 255957 from NV Organon of Oss, NL) and with synthetic peptides (5 mg/kg) after two hours of LPS injection.
- BALB/c mice were injected i.p. either with 10 mg/kg or with 11 mg/kg LPS (E. coli 026:B6; Difco Lab., Detroit, Mich., USA). Subsequently, mice were treated after 2 hours and 24 hours of LPS treatment with NMPF peptides.
- Derivatives of these peptides for example (but not limited to) by addition of classical and non-classical amino acids or derivatives that are differentially modified during or after synthesis, for example benzylation, amidation, glycosylation, proteolytic cleavage, linkage to an antibody molecule or other cellular ligand, etc. could also lead to a better effectiveness of the activity.
- NMPF synthetic peptides
- mice treated with PBS after the shock induction reached a sickness score of 5 at 14 and 24 hours, and remained so after the second injection with PBS.
- the survival rate in control group mice was 0% at 48 hours.
- mice treated with NMPF 9, 11, 12, 43, 46, 50 and 60 reached a maximum sickness score of 2-3 at 24 hours after the induction of septic shock and further reached a maximum sickness score of 1-2 at 48 hours after the second injection of NMPF.
- mice treated with NMPF 5, 7, 8, 45, 53 and 58 reached a sickness score of 5 and after the second injection with NMPF all mice returned to a sickness score of 1-2 and survival rates in NMPF groups were 100%.
- NMPF peptides have anti-shock activity at different stages of the disease and NMPF have anti-shock activity even at the disease stage when otherwise irreversible damage had been done. This indicates that NMPF have effects on different cellular levels and also have repairing and regenerating capacity.
- the RAW 264.7 murine macrophage cell line obtained from American Type Culture Collection (Manassas, Va., USA), were cultured at 37° C. in 5% CO 2 using DMEM containing 10% fetal calf serum (FCS), 50 U/ml penicillin, 50 ⁇ g/ml streptomycin, 0.2 M Na-pyruvate, 2 mM glutamine and 50 ⁇ M 2-mercaptoethanol (Bio Whittaker, Europe). The medium was changed every 2 days.
- FCS fetal calf serum
- penicillin 50 ⁇ g/ml streptomycin
- 0.2 M Na-pyruvate 2 mM glutamine
- 2-mercaptoethanol Bio Whittaker, Europe
- Nitrite measurements Nitrite production was measured in the RAW 264.7 macrophage supernatants.
- the cells (7.5 ⁇ 10 5 /ml) were cultured in 48-well plates in 500 ⁇ l of culture medium. The cells were stimulated with LPS (10 microg/ml) and/or NMPF (1 pg/ml, 1 ng/ml, 1 ⁇ g/ml) for 24 hours, then the culture media were collected.
- Nitrite was measured by adding 100 microl of Griess reagent (Sigma) to 100 microl samples of culture medium. The OD 540 was measured using a microplate reader, and the nitrite concentration was calculated by comparison with the OD 540 produced using standard solutions of sodium nitrite in the culture medium.
- NMPF neuropeptide
- NOD mice treated three times a week for two weeks with NMPF showed profound inhibition of diabetes development.
- the strongest anti-diabetic effects were seen with NMPF-1, -4, -5, -6, -7, -65, -66 and commercial hCG preparation (PREGNYL, batch no. 235863).
- NMPF-71 showed no effect on the incidence of diabetes, while NMPF-64 and NMPF-11 had a moderate anti-diabetic effect.
- NO production is a central mediator of the vascular and inflammatory response.
- macrophages RAW 264.7
- LPS LPS-induced NMPF peptides
- these cells co-stimulated with most of the NMPF peptides (NMPF peptides 1 to 14, 43 to 66 and 69) even in a very low dose (1 pg/ml) inhibited the production of NO.
- the invention provides a method and a composition of the invention for the treatment of conditions that are associated with dysfunctional LDL receptors such as apoE and other members of the apolipoprotein family.
- a composition of the invention comprising GVLPALPQ (SEQ ID NO:33) (NMPF-5) and/or VLPALP (SEQ ID NO:3) (NMPF-6) or a functional analogue or derivative thereof is preferred.
- VLPALPQVVC (SEQ ID NO: 20) 100 100 50 17 2 LQGVLPALPQ (SEQ ID NO: 49) 100 67 0 0 3 LQG 100 83 20 17 4 LQGV (SEQ ID NO: 1) 100 100 100 100 5 GVLPALPQ (SEQ ID NO: 33) 100 100 80 17 6 VLPALP (SEQ ID NO: 3) 100 100 100 100 7 VLPALPQ (SEQ ID NO: 168) 100 83 0 0 8 GVLPALP (SEQ ID NO: 32) 100 100 83 67 9 VVC 100 100 50 50 11 MTRV (SEQ ID NO: 42) 100 100 67 50 12 MTR 100 100 67 50 13 LQGVLPALPQVVC 100 100 100 100 100 100 100 100 100 100 100 100 100 100
- TNF- ⁇ TNF-A ID SEQUENCE TNF-A NO and NO NMPF-1 VLPALPQVVC ++ ++++++ ++++ (SEQ ID NO: 20) NMPF-2 LQGVLPALPQ ⁇ + ++++ ++++ (SEQ ID NO: 49) NMPF-3 LQG + ++++ ++++ NMPF-4 LQGV ++++ ++++ +++++++ (SEQ ID NO: 1) NMPF-5 GVLPALPQ ++++++ +++++++++ (SEQ ID NO: 33) NMPF-6 VLPALP ++++++++ +++++++++ (SEQ ID NO: 3) NMPF-7 VLPALPQ ++++++++ +++++++ (SEQ ID NO: 29) NMPF-8 GVLPALP ++++++++ +++++++++ (SEQ ID NO: 32) NMPF-9 VVC ++++++++ +++++++++ NMPF-10 QVVC
- NMPF a mixture 1:1:1 of LQGV (SEQ ID NO:1), AQGV (SEQ ID NO:2) and VLPALP (SEQ ID NO:3), administered in a gram-negative induced rhesus monkey sepsis model for prevention of septic shock.
- Two rhesus monkeys were infused with a 10 10 CFU per kg of the Gram negative bacterium E. coli to induce a fatal septic shock.
- One monkey received placebo-treatment and was sacrificed within 7 hours after infusion of the bacteria without recovery from the anesthesia.
- the second monkey received treatment with test compound and was sacrificed at the same time point.
- the monkeys were kept anesthetized throughout the observation period and sacrificed 7 hours after the start of the bacterium infusion for pathological examination.
- the animals underwent a gross necropsy in which the abdominal and thorax cavities were opened and internal organs examined in situ.
- the Escherichia coli strain was purchased from ATCC (E. coli; 086a: K61 serotype, ATCC 33985). In a control experiment, the strain proved equally susceptible to bactericidal factors in human and rhesus monkey serum. Prior to the experiment, a fresh culture was set-up; the E. coli strain was cultured for one day, harvested and washed thoroughly to remove free endotoxine. Prior to infusion into the animal, the number and viability of the bacteria were assessed. Serial dilutions of the E. coli stock were plated on BHI agar and cultured overnight at 37° C. The colonies on each plate were counted and the number of colony-forming units per ml was calculated.
- the body weight measurement of the day of the experiment was used to calculate the E. coli dose and E. coli stock was suspended in isotonic saline (N.P.B.I., Emmer-Compascuum, NL) at the concentration needed for infusion (total dose volume for infusion approximately 10 ml/kg.
- the E. coli suspension was kept on ice until infusion.
- Antibiotic was used to synchronize the shock induction in the monkeys.
- Baytril (Baytril 2.5%, Bayer, Del.) was used instead of gentamycin, as the strain proved only marginally susceptible to the latter antibiotic.
- Individual animals were identified by a number or letter combination tattooed on the chest.
- EXPERIMENTAL GROUP TREATMENT (number/ (independent variable, letter or other e.g., placebo treated NUM- identification control group)
- the femoral or the cephalic vein was cannulated and used for infusing isotonic saline, live E. coli and antibiotic administration. Insensible fluid loss was compensated for by infusing isotonic saline containing 2.5% glucose (Fresenius, 's Hertogenbosch, NL) at a rate of 3.3 ml/kg/hr.
- Preparative actions During anesthesia the animals were instrumented for measurement of blood pressure (with an automatic cuff), heart rate and body temperature. Isotonic saline was infused at 3.3 ml/kg/hr to compensate for fluid loss. Femoral vessels were cannulated for infusion of E. coli and antibiotics. Temperature-controlled heating pads were used to support body temperature. The monkeys were continuously monitored during the E. coli challenge and for the 6 hr period following E. coli administration. After 7 hrs, 2 animals (the control animal and one treated with NMPF) were sacrificed to compare the direct effect of the compound at the level of histology. The 3 rd animal, treated with NMPF, was allowed to recover from anesthesia and was intensively observed during the first 12 hours after recovery followed by frequent daily observation. The decision to allow the 3 rd animal to recover was made after consulting with the veterinarian.
- Baytril was administered intravenously immediately after completion of the 2 h.E. coli infusion (i.v.; dose 9 mg/kg).
- NMPF NMPF oligopeptides
- LQGV LQGV
- AQGV SEQ ID NO:2
- VLPALP SEQ ID NO:3
- kidneys The following organs were weighed and a bacterial count was performed: kidneys, liver, lungs, lymph nodes, and gross lesions.
- Tissues of all organs were preserved in neutral aqueous phosphate buffered 4% solution of formaldehyde. Lymphoid organs were cryopreserved. All tissues will be processed for histopathological examination.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Public Health (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Endocrinology (AREA)
- Zoology (AREA)
- Reproductive Health (AREA)
- Toxicology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention relates to compounds exhibiting immuno-regulatory activity as determined by measuring the compound's ability to modulate production of NO by a cell. Preferred compounds include or consist of a sequence
AAL AAQ AAG AAV
wherein AAL is a substituted or unsubstituted non-polar amino acid selected from the group consisting of Ala and Leu; wherein AAQ is a substituted or unsubstituted amino acid selected from the group consisting of Gln, Pro, and Ala; wherein AAG is a substituted or unsubstituted amino acid Gly, and wherein AAV is a substituted or unsubstituted non-polar amino acid selected from the group consisting of Val and Ala. In one embodiment, the compound consists of a tripeptide selected from the group AQG, MTR, VVC, and mixtures thereof.
AAL AAQ AAG AAV
wherein AAL is a substituted or unsubstituted non-polar amino acid selected from the group consisting of Ala and Leu; wherein AAQ is a substituted or unsubstituted amino acid selected from the group consisting of Gln, Pro, and Ala; wherein AAG is a substituted or unsubstituted amino acid Gly, and wherein AAV is a substituted or unsubstituted non-polar amino acid selected from the group consisting of Val and Ala. In one embodiment, the compound consists of a tripeptide selected from the group AQG, MTR, VVC, and mixtures thereof.
Description
This application is a reissue of U.S. Pat. No. 7,358,330, which issued Apr. 15, 2008, from U.S. Ser. No. 10/753,510 (filed Jan. 7, 2004). U.S. Ser. No. 10/753,510 is a continuation in part of U.S. Ser. No. 10/028,075, filed Dec. 21, 2001, now abandoned a continuation of U.S. Ser. No. 10/262,522, filed Sep. 30, 2002, now U.S. Pat. No. 7,365,155, which is a continuation of International Application No. PCT/NL01/00259, filed Mar. 29, 2001, designating the United States of America and published on Oct. 4, 2001, in English as PCT International Publication No. WO 01/72831 A2 filed Mar. 3, 2001, which international application claims priority under Article 8 of the Patent Cooperation Treaty from European Patent Application No. 00201139.3, filed Mar. 29, 2000, and a continuation-in-part of International Application No. PCT/NL02/00639, filed Oct. 4, 2002 designating the United States of America and published on Apr. 10, 2002 2003 in English as PCT Internatinal International Publication No. WO 03/029292 A2, the which international application claims priority under Article 8 of the Patent Cooperation Treaty from European Patent Application No. 01203748.7, filed Oct. 4, 2001. The contents of all of each of which U.S. Ser. Nos. 10/028,075 and 10/262,522; and PCT International Publication Nos. WO 01/72831 A2 and WO 03/029292 A2 are incorporated by this reference.
The invention relates generally to biotechnology, and more specifically to compositions having immunoregulatory activity, which compounds include particular oligopeptides derived from human chorionic gonadotropin (hCG).
U.S. Pat. No. 5,380,668 to Herron (Jan. 10, 1995), the contents of the entirety of which are incorporated by this reference, discloses, among other things, various compounds having the antigenic binding activity of hCG. The oligopeptides disclosed therein are disclosed generally for use in diagnostice methods.
Various patents and patent applications to Gallo et al. (e.g., U.S. Pat. No. 5,677,275 (corresponding to WO 96/04008 A1), U.S. Pat. No. 5,877,148 (also corresponding to WO 96/04008 A1), WO 97/49721 A1, U.S. Pat. No. 6,319,504 (corresponding to WO 97/49373), U.S. Patent Application 2003/0049273 A1 (also corresponding to WO 97/49373), U.S. Pat. No. 5,968,513 (corresponding to WO 97/49418), U.S. Pat. No. 5,997,871 (corresponding to WO 97/49432), U.S. Pat. No. 6,620,416, U.S. Pat. No. 6,596,688, WO 01/11048 A2, WO 01/10907 A2., and U.S. Pat. No. 6,583,109) relate to various oligopeptides and their use in, among other things, “inhibiting HIV infection”, “treating or preventing HIV infection”, “treating or preventing cancer”, “treating or preventing a condition characterized by loss of body cell mass”, “treating or preventing a condition associated with pathological angiogenesis”, “treating or preventing hematopoietic deficiency”, “ex vivo gene therapy”, “expanding blood cells in vitro”, and/or “providing blood cells to a subject”.
As we described in PCT International Publication No. WO 03/029292 A2 (published Apr. 10, 2003), PCT International Publication No. WO 01/72831 A2 (published Oct. 4, 2001), and U.S. Patent Application Publications 20020064501 A1 (published May 30, 2002), 20030119720 A1 (published Jun. 26, 2003), 20030113733 A1 (published Jun. 19, 2003), and 20030166556 A1 (published Sep. 4, 2003), the contents of all of which are incorporated by this reference, compositions containing purified or isolated oligopeptides described herein have immunoregulatory activity useful in, for example, the treatment of sepsis and other disease states and conditions. They also have gene regulatory activities.
The invention thus includes a composition comprising a purified or isolated peptide consisting of particular four to eight amino acid segments of the sequence MTRVLQGV-LPALPQVVC (SEQ ID NO:44 of the incorporated herein SEQUENCE LISTING); and derivatives thereof having one or more conservative substitutions relative to the sequence of SEQ ID NO:44. The particular compositions exhibit immunoregulatory activity as determined by measuring the segment's ability to modulate production of NO by a cell. Preferably, the compositions have the ability to decrease shock in a subject (e.g., a mammal) undergoing sepsis.
In one embodiment, the amino acid segment includes a tetrameric sequence (corresponding to the LQVG (SEQ ID NO: 1) portion of SEQ ID NO:44, i.e.,
AAL AAQ AAG AAV
wherein AAL is a substituted or unsubstituted non-polar amino acid selected from the group consisting of Ala and Leu; AAQ is a substituted or unsubstituted amino acid selected from the group consisting of Gin, Pro, and Ala; AAG is a substituted or unsubstituted Gly; and AAV is a substituted or unsubstituted non-polar amino acid selected from the group consisting of Val and Ala. For instance, the peptide could be selected from the group consisting of LQGV (SEQ ID NO:1), the derivative AQGV (SEQ ID NO:2), the derivative LQGA (SEQ ID NO:19), the derivative LAGV (SEQ ID NO:26), and the derivativeLPGC (SEQ ID NO:41).
In a different embodiment, the segment is the tetramer MTRV (SEQ ID NO:42) or QVVC (SEQ ID NO:43).
In another embodiment, the segment is six or seven amino acids long, and comprises the sequence
AAV AAL Pro Arg AAL2 AAP
wherein AAV is substituted or unsubstituted Val or Ala, wherein AAL and AAL2 are independently selected from substituted or unsubstituted Lys or Ala, and wherein AAP is a substituted or unsubstituted Pro or Ala.
In such an embodiment, the purified or isolated peptide can have a formula selected from the group consisting of VLPALP (SEQ ID NO:3), the derivative ALPALP (SEQ ID NO:21), the derivative VAPALP (SEQ ID NO:22), the derivative ALPALPQ (SEQ ID NO:23), the derivative VLPAAPQ (SEQ ID NO:24), the derivative VLPALAQ (SEQ ID NO:25), the derivative VLPALA (SEQ ID NO:28), VLPALPQ (SEQ ID NO:29), the derivative VLPALPA (SEQ ID NO:31), the derivative GVLPALP (SEQ ID NO:32), and the derivative VLAALP (SEQ ID NO:117).
In another embodiment, the composition has no more than eight amino acids, and includes an amino acid sequence consisting of:
AAL AAQ AAG AAV
wherein AAL is a substituted or unsubstituted amino acid selected from the group of amino acids consisting of Ala, Leu, and Met, wherein AAQ is a substituted or unsubstituted amino acid selected from the group of amino acids consisting of Gln, Thr, Ala, and Pro, wherein AAG is substituted or unsubstituted Gly or Arg, and wherein AAV is a substituted or unsubstituted amino acid selected from the group of amino acids consisting of Cys, Ala, and Val. Again such a composition is characterized in having immunoregulatory activity as determined by: measuring its capability of modulating production of NO by a cell.
In such an embodiment, the sequence is preferably selected from the group consisting of Leu Gln Gly Val (SEQ ID NO:1), Ala Gln Gly Val (SEQ ID NO:2), Leu Gln Gly Ala (SEQ ID NO:19), Leu Ala Gly Val (SEQ ID NO:26), Leu Pro Gly Cys (SEQ ID NO:41), and Met Thr Arg Val (SEQ ID NO:42). Preferably, the composition is the sequence of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:19, SEQ ID NO:26, SEQ ID NO:41, SEQ ID NO:42, or a salt of any thereof.
The invention further includes a pharmaceutical composition comprising a purified or isolated peptide, or acid addition salt thereof, the purified or isolated peptide (a) consisting of an amino acid sequence selected from the group consisting of: (i) a four to seven amino acid segment of the sequence of MTRVLQGVLPALPQVVC (SEQ ID NO:44); and (ii) a derivative of the segment of (a) having one or more conservative substitutions relative to the sequence of SEQ ID NO:44; and (b) exhibiting an immunoregulatory activity as determined by measuring its capability of modulating production of NO by a cell.
Such a pharmaceutical composition preferably includes a sequence selected from the group selected from the group consisting of LQGV (SEQ ID NO:1), AQGV (SEQ ID NO:2), VLPALP (SEQ ID NO:3), LQGA (SEQ ID NO:19), ALPALP (SEQ ID NO:21), VAPALP (SEQ ID NO:22), ALPALPQ (SEQ ID NO:23), VLPAAPQ (SEQ ID NO:24), VLPALAQ (SEQ ID NO:25), LAGV (SEQ ID NO:26), VLPALA (SEQ ID NO:28), VLPALPQ (SEQ ID NO:29), VLPALPA (SEQ ID NO:31), and GVLPALP (SEQ ID NO:32), LPGC (SEQ ID NO:41), MTRV (SEQ ID NO:42), QVVC (SEQ ID NO:43), VLAALP (SEQ ID NO:117), and combinations of any thereof, with or without other active or inactive ingredients, presented in a pharmaceutically acceptable form for administration to a human.
In one preferred embodiment, the inventin is a purified or isolated peptide consisting of GVLPALPQ (SEQ ID NO:33), or an acid addition salt thereof. The invention would thus also include a pharmaceutical composition comprising the peptide of SEQ ID NO:33 or an addition salt thereof, together with a pharmaceutically acceptable excipient.
In another embodiment the invention comprises a purified or isolated peptide (or, for example, acid addition salt thereof), selected from the group consisting of AQG, MTR, and VVC.
Finally the invention includes a composition comprising one or more of the following amino acid segments: LQGV (SEQ ID NO:1), AQGV (SEQ ID NO:2), VLPALP (SEQ ID NO:3), LQGA (SEQ ID NO:19), ALPALP (SEQ ID NO:21), VAPALP (SEQ ID NO:22), ALPALPQ (SEQ ID NO:23), VLPAAPQ (SEQ ID NO:24), VLPALAQ (SEQ ID NO:25), LAGV (SEQ ID NO:26), VLPALA (SEQ ID NO:28), VLPALPQ (SEQ ID NO:29), VLPALPA (SEQ ID NO:31), and GVLPALP (SEQ ID NO:32), LPGC (SEQ ID NO:41), MTRV (SEQ ID NO:42), QVVC (SEQ ID NO:43), VLAALP (SEQ ID NO:117), AQG, MTR, or VVC.
In another embodiment, the invention includes a composition comprising a purified or isolated peptide consisting of sequence LQG in an amount sufficient to exhibit an immunoregulatory activity as determined by measuring the sequence LQG's ability to modulate production of NO by a cell.
The invention provides a method for the treatment of bone disease such as osteoporosis comprising administering to a subject believed to be in need of such treatment a composition comprising an oligopeptide, derivative or functional analogue thereof, the particular molecule capable of modulating production of NO and/or TNF-alpha by a cell.
Such a method of treatment is particularly useful in post-menopausal women that no longer experience the benefits of being provided with a natural source of hCG and its breakdown products. Such a treatment can be achieved by systemic administration of a composition of the invention according to the invention, but local administration in joints, bursae or tendon sheaths is provided as well. The molecule can be selected from Table 6 or identified in a method described herein. The treatment comprises administering to the subject a pharmaceutical composition comprising an oligopeptide or functional analogue thereof capable of reducing production of NO by a cell, for example, wherein the composition comprises at least two oligopeptides or functional analogues thereof, each capable of reducing production of NO and/or TNF-alpha by a cell, in particular wherein the at least two oligopeptides are selected from the group LQGV (SEQ ID NO:1), AQGV (SEQ ID NO:2), and VLPALP (SEQ ID NO:3).
Several oligopeptides according to the invention have been tested, both ex vivo and in vivo, and in small animals. A beneficial effect of these oligopeptides on LPS-induced sepsis in mice, namely the inhibition of the effect of the sepsis, was observed. Immunomodulatory effects with these oligopeptides have been observed in vitro and in ex vivo such as in T-cell assays showing the inhibition of pathological Thl immune responses, suppression of inflammatory cytokines (MIF), increase in production of anti-inflammatory cytokines (IL-10, TGF-beta) and immunomodulatory effects on antigen-presenting cells (APC) like dendritic cells, monocytes and macrophages.
Now knowing the gene modulatory effect of the composition of the inventions such as oligopeptides as provided herein allows for rational design of signal molecule mixtures that better alleviate the symptoms seen with sepsis. One such mixture, a 1:1:1 mixture of LQGV (SEQ ID NO:1), AQGV (SEQ ID NO:2) and VLPALP (SEQ ID NO:3) was administered to primates in a gram-negative induced rhesus monkey sepsis model for prevention of septic shock and found to be effective in this primate model. Accordingly, the invention provides a pharmaceutical composition for the treatment of sepsis in a primate and a method for the treatment of sepsis in a primate comprising subjecting the primate to a composition of the invention according to the invention, preferably to a mixture of such composition of the inventions. Administration of such a composition of the invention or mixture preferably occurs systematically, for example, by intravenous or intraperitoneal administration. In a further embodiment, such treatment also comprises the use of for example an antibiotic, however, only when such use is not contra indicated because of the risk of generating further toxin loads because of lysis of the bacteria subject to the action of those antibiotics in an individual thus treated.
The invention also provides use of a composition according to the invention for the preparation of a pharmaceutical composition or medicament and methods of treating various medical conditions that are other than use in the preparation of a pharmaceutical composition for the treatment of an immune-mediated disorder or a method of treatment of an immune-mediated disorder or treatment of a wasting syndrome.
As used herein, a “purified or isolated” peptide is one that has been purified from a natural or biotechnological source, or, more preferably, is synthesized as described herein.
“Composition”, as used herein, refers to chemical compounds which contain or consist of the oligopeptide. The oligopeptide is preferably isolated before inclusion within the composition. The oligopeptide most preferably consists of three (3) to six (6) amino acids.
For instance, the previously described preferred compound could, in one embodiment be:
NT AA1 AA2 AA3 AA4 CT
wherein NT at the N-terminus is selected from the group of H—, CH3—, an acyl group, or a general protective group; and CT at the C-terminus is selected from the group of small (e.g. 1 to 5 amino acids) peptides, —OH, —OR1, —NH2, —NHR1, —NR1 R2, or —N(CH2)1-6 NR1 R2, wherein R1 and R2, when present, are independently selected from H, alkyl, aryl, (ar)alkyl, and wherein R1 and R2 can be cyclically bonded to one another.
“Alkyl” as used herein, is preferably a saturated branched or unbranched hydrocarbon having one to six carbon atoms, e.g. methyl, ethyl, and isopentyl.
“Aryl” as used herein, is an aromatic hydrocarbon group, preferably having 6 to 10 carbon atoms, such as phenyl or naphthyl.
“(Ar)alkyl”, as used herein, is an arene group (having both aliphatic and aromatic portions), preferably having 7 to 13 carbon atoms such as benzyl, ethylbenzyl, n-propylbenzyl, and isobutylbenzyl.
“Oligopeptide”, as used herein are peptides having from 3 to 8 amino acids joined together by peptide bonds. Equivalent to oligopeptides are compounds having the same or equivalent sidechains as the particular amino acids used in an oligopeptide, and arranged sequentially in the same order as the peptides, but joined together by non-peptide bonds, e.g., by isosteric linkages such as the keto isostere, hydroxy isostere, diketo isostere, or the keto-difluoromethylene isostere.
“Composition” also includes, for example, an acceptable salt of the oligopeptide or a labeled oligopeptide. As used herein, “acceptable salt” refers to salts that retain the desired activity of the oligopeptide or equivalent compound, but preferably do not detrimentally affect the activity of the oligopeptide or other component of a system in which uses the oligopeptide. Examples of such salts are acid addition salts formed with inorganic acids, for example, hydrochloric acid, hydrobromic acid, sulfuric acid, phosphoric acid, nitric acid, and the like. Salts may also be formed with organic acids such as, for example, acetic acid, oxalic acid, tartaric acid, succinic acid, maleic acid, fumaric acid, gluconic acid, citric acid, malic acid, ascorbic acid, benzoic acid, tannic acid, pamoic acid, alginic acid, polyglutamic acid, and the like. Salts may be formed with polyvalent metal cations such as zinc, calcium, bismuth, barium, magnesium, aluminum, copper, cobalt, nickel and the like or with an organic cation formed from N,N′-dibenzylethylenediamine or ethylenediamine, or combinations thereof (e.g., a zinc tannate salt).
The thus developed chemical entity can be administered and introduced in-vivo systemically, topically, or locally. The peptide, or is modification or derivative, can be administered as the entity as such or as a pharmaceutically acceptable acid- or baseaddition salt, formed by reaction with an inorganic acid (such as hydrochloric acid, hydrobromic acid, perchloric acid, nitric acid, thiocyanic acid, sulfuric acid, and phosphoric acid); or with an organic acid (such as formic acid, acetic acid, propionic acid, glycolic acid, lactic acid, pyruvic acid, oxahc acid, malonic acid, succinic acid, maleic acid, and fumaric acid); or by reaction with an inorganic base (such as sodium hydroxide, ammonium hydroxide, potassium hydroxide); or with an organic base (such as mono-, di-, trialkyl and aryl amines and substituted ethanolamines). A selected peptide and any of the derived entities may also be conjugated to sugars, lipids, other polypeptides, nucleic acids and PNA; and function in-situ as a conjugate or be released locally after reaching a targeted tissue or organ.
A “substitution” with regard to the various amino acids generally relate to substituting a group such as alkoxy, halogen, hydroxy, nitro, or lower alkyl onto an aromatic ring for a hydrogen that would usually be present. Substitutions can also be made on the alkyl chain connecting the aromatic portion to the peptide backbone, with, for instance lower alkyl groups substituting for a hydrogen. Still further substitutions can be made at the alpha position of an amino acid, also using an alkyl group.
Substitutions with regard to the amino acid phenylalanine include compounds such as L/D-homophenylalanyl, N methyl phenylalanyl, .alpha.-methylphenylalanyl, and alpha.-methyl-tyrosyl.
Preferred substitutions involve the use of fluorine or chlorine as a halogen, and methoxy as an alkoxy group. With regard to alkyl and lower alkyl, generally alkyl groups having fewer (1 to 3) carbon atoms are preferred.
The compounds according to the general formula may be prepared in a manner conventional for such compounds. To that end, suitably N alpha. protected (and side-chain protected if reactive side-chains are present) amino acid derivatives or peptides are activated and coupled to suitably carboxyl protected amino acid or peptide derivatives either in solution or on a solid support. Protection of the .alpha.-amino functions generally takes place by urethane functions such as the acid-labile tertiary-butyloxycarbonyl group (“Boc”), benzyloxycarbonyl (“Z”) group and substituted analogs or the base-labile 9-fluoremyl-methyloxycarbonyl (“Fmoc”) group. The Z group can also be removed by catalytic hydrogenation, Other suitable protecting groups include the Nps, Bmv, Bpoc, Aloc, MSC, etc. A good overview of amino protecting groups is given in The peptides, Analysis, Synthesis, Biology, Vol. 3 E. Gross and J. Meienhofer, eds., (Academic Press, New York, 1981). Protection of carboxyl groups can take place by ester formation, for example, base-labile esters like methyl or ethyl, acid labile esters like tert. butyl or, substituted, benzyl esters or hydrogenolytically. Protection of side-chain functions like those of lysine and glutamic or aspartic acid can take place using the aforementioned groups. Protection of thiol, and although not always required, of guanidino, alcohol and imidazole groups can take place using a variety of reagents such as those described in The Peptides, Analysis, Synthesis, Biology, id. or in Pure and Applied Chemistry, 59(3), 331-344 (1987). Activation of the carboxyl group of the suitably protected amino acids or peptides can take place by the azide, mixed anhydride, active ester, or carbodiimide method especially with the addition of catalytic and racemization-suppressing compounds like 1-N—N-hydroxybenzotriazole, N-hydroxysuccin-imide, 3-hydroxy-4-oxo-3,4-dihydro-1,2,3,-benzotriazine, N-hydroxy-5 norbornene-2,3-dicarboxyimide. Also the anhydrides of phosphorus based acids can be used. See, e.g., The Peptides, Analysis, Synthesis, Biology, supra and Pure and Applied Chemistry, 59(3), 331-344 (1987).
It is also possible to prepare the compounds by the solid phase method of Merrifield. Different solid supports and different strategies are known see, e.g. Barany and Merrifield in The Peptides, Analysis, Synthesis, Biology, Vol. 2, E. Gross and J. Meienhofer, eds., (Acad. Press, New York, 1980), Kneib-Cordonier and Mullen Int. J. Peptide Protein Res., 30, 705-739 (1987) and Fields and Noble Int. J. Peptide Protein Res., 35, 161-214 (1990). The synthesis of compounds in which a peptide bond is replaced by an isostere, can, in general, be performed using the previously described protecting groups and activation procedures. Procedures to synthesize the modified isosteres are described in the literature e.g. for the—CH2—NH—isostere and for the—CO—CH2—isostere.
Removal of the protecting groups, and, in the case of solid phase peptide synthesis, the cleavage from the solid support, can take place in different ways, depending on the nature of those protecting groups and the type of linker to the solid support. Usually deprotection takes place under acidic conditions and in the presence of scavengers. See, e.g. volumes 3, 5 and 9 of the series on The Peptides Analysis, Synthesis, Biology, supra.
Another possibility is the application of enzymes in synthesis of such compounds; for reviews see, e.g., H. D. Jakubke in The Peptides, Analysis, Synthesis, Biology, Vol. 9, S. Udenfriend and J. Meienhofer, eds., (Acad. Press, New York, 1987).
Although possibly not desirable from an economic point of view, oligopeptides according to the invention could also be made according to recombinant DNA methods. Such methods involve the preparation of the desired oligopeptide thereof by means of expressing recombinant polynucleotide sequence which codes for one or more of the oligopeptides in question in a suitable microorganism as host. Generally the process involves introducing into a cloning vehicle (e.g., a plasmid, phage DNA, or other DNA sequence able to replicate in a host cell) a DNA sequence coding for the particular oligopeptide or oligopeptides, introducing the cloning vehicle into a suitable eucaryotic or procaryotic host cell, and culturing the host cell thus transformed. When a eucaryotic host cell is used, the compound may include a glycoprotein portion.
As used herein, a “functional analogue” or “derivative” of a peptide includes an amino acid sequence, or other sequence monomers, which has been altered such that the functional properties of the sequence are essentially the same in kind, not necessarily in amount. An analogue or derivative can be provided in many ways, for instance, through “conservative amino acid substitution”. Also peptidomimetic compounds can be designed that functionally or structurally resemble the original peptide taken as the starting point but that are for example composed of non-naturally occurring amino acids or polyamides. With “conservative amino acid substitution”, one amino acid residue is substituted with another residue with generally similar properties (size, hydrophobicity), such that the overall functioning is likely not to be seriously affected. However, it is often much more desirable to improve a specific function. A derivative can also be provided by systematically improving at least one desired property of an amino acid sequence. This can, for instance, be done by an Ala-scan and/or replacement net mapping method. With these methods, many different peptides are generated, based on an original amino acid sequence but each containing a substitution of at least one amino acid residue. The amino acid residue may either be replaced by alanine (Ala-scan) or by any other amino acid residue (replacement net mapping). This way, many positional variants of the original amino acid sequence are synthesized. Every positional variant is screened for a specific activity. The generated data are used to design improved peptide derivatives of a certain amino acid sequence.
A derivative or analogue can also be, for instance, generated by substitution of an L-amino acid residue with a D-amino acid residue. This substitution, leading to a peptide which does not naturally occur in nature, can improve a property of an amino acid sequence. It is, for example, useful to provide a peptide sequence of known activity of all D-amino acids in retro inversion format, thereby allowing for retained activity and increased half-life values. By generating many positional variants of an original amino acid sequence and screening for a specific activity, improved peptide derivatives comprising such D-amino acids can be designed with further improved characteristics.
A person skilled in the art is well able to generate analogous compounds of an amino acid sequence. This can, for instance, be done through screening of a peptide library. Such an analogue has essentially the same functional properties of the sequence in kind, not necessarily in amount. Also, peptides or analogues can be circularized, for example, by providing them with (terminal) cysteines, dimerized or multimerized, for example, by linkage to lysine or cysteine or other compounds with side-chains that allow linkage or multimerization, brought in tandem- or repeat-configuration, conjugated or otherwise linked to carriers known in the art, if only by a labile link that allows dissociation.
Synthetic versions of these oligopeptides as described above, and functional analogues or derivatives of these breakdown products, are herein provided to modulate gene expression in a cell and be used in methods to rectify errors in gene expression or the treatment of disease.
The term “pharmaceutical composition” as used herein is intended to cover both the active composition of the invention alone or a composition containing the composition of the invention together with a pharmaceutically acceptable carrier, diluent or excipient. Acceptable diluents of an oligopeptide as described herein in the detailed description are for example physiological salt solutions or phosphate buffered salt solutions. In one embodiment, a signal molecule is administered in an effective concentration to an animal or human systemically, e.g., by intravenous, intramuscular or intraperitoneal administration. Another way of administration comprises perfusion of organs or tissue, be it in vivo or ex vivo, with a perfusion fluid comprising a signal molecule according to the invention. Topical administration, e.g., in ointments or sprays, may also apply, e.g., in inflammations of the skin or mucosal surfaces of for example mouth, nose and/or genitals. Local administration can occur in joints, bursae, tendon sheaths, in or around the spinal cord at locations where nerve bundles branch off, at the location of hernias, in or around infarcted areas in brain or heart, etc. The administration may be done as a single dose, as a discontinuous sequence of various doses, or continuously for a period of time sufficient to permit substantial modulation of gene expression. In the case of a continuous administration, the duration of the administration may vary depending upon a number of factors which would readily be appreciated by those skilled in the art.
The administration dose of the active molecule may be varied over a fairly broad range. The concentrations of an active molecule which can be administered would be limited by efficacy at the lower end and the solubility of the compound at the upper end. The optimal dose or doses for a particular patient should and can be determined by the physician or medical specialist involved, taking into consideration well-known relevant factors such as the condition, weight and age of the patient, etc.
The active molecule may be administered directly in a suitable vehicle, such as, for example, phosphate-buffered saline (PBS) or solutions in alcohol or DMSO. Pursuant to preferred embodiments of the present invention, however, the active molecule is administered through a single dose delivery using a drug-delivery system, such as a sustained-release delivery system, which enables the maintenance of the required concentrations of the active molecule for a period of time sufficient for adequate modulation of gene expression. A suitable drug-delivery system would be pharmacologically inactive or at least tolerable. It should preferably not be immunogenic nor cause inflammatory reactions, and should permit release of the active molecule so as to maintain effective levels thereof over the desired time period. Alternatives are known in the art as suitable for purposes of sustained release and are contemplated as within the scope of the present invention. Suitable delivery vehicles include, but are not limited to, the following: microcapsules or microspheres; liposomes and other lipid-based release systems; viscous instillates; absorbable and/or biodegradable mechanical barriers and implants; and polymeric delivery materials, such as polyethylene oxide/polypropylene oxide block copolymers, polyesters, cross-linked polyvinylalcohols, polyanhydrides, polymethacrylate and polymethacrylamide hydrogels, anionic carbohydrate polymers, etc. Useful delivery systems are well known in the art.
A highly suitable formulation to achieve the active molecule release comprises injectable microcapsules or microspheres made from a biodegradable polymer, such as poly (dl-lactide), poly(dl-lactide-co-glycolide), polycaprolactone, polyglycolide, polylactic acid-co-glycolide, poly(hydroxybutyric acid), polyesters or polyacetals. Injectable systems comprising microcapsules or microspheres having a diameter of about 50 to about 500 micrometers offer advantages over other delivery systems. For example, they generally use less active molecules and may be administered by paramedical personnel. Moreover, such systems are inherently flexible in the design of the duration and rate of separate drug release by selection of microcapsule or microsphere size, drug loading and dosage administered. Further, they can be successfully sterilized by gamma irradiation.
The design, preparation, and use of microcapsules and microspheres are well within the reach of persons skilled in the art and detailed information concerning these points is available in the literature. Biodegradable polymers (such as lactide, glycolide and caprolactone polymers) may also be used in formulations other than microcapsules and microspheres; e.g., premade films and spray-on films of these polymers containing the active molecule would be suitable for use in accordance with the present invention. Fibers or filaments comprising the active molecule are also contemplated as within the scope of the present invention.
Another highly suitable formulation for a single-dose delivery of the active molecule in accordance with the present invention involves liposomes. The encapsulation of an active molecule in liposomes or multilamellar vesicles is a well-known technique for targeted drug delivery and prolonged drug residence. The preparation and use of drug-loaded liposomes is well within the reach of persons skilled in the art and well documented in the literature.
Yet another suitable approach for single-dose delivery of an active molecule in accordance with the present invention involves the use of viscous installates. In this technique, high molecular weight carriers are used in admixture with the active molecule, giving rise to a structure which produces a solution with high viscosity. Suitable high molecular weight carriers include, but are not limited to, the following: dextrans and cyclodextrans; hydrogels; (cross-linked) viscous materials, including (cross-linked) viscoelastics; carboxymethylcellulose; hyaluronic acid; and chondroitin sulfate. The preparation and use of drug-loaded viscous instillates is well known to persons skilled in the art.
Pursuant to yet another approach, the active molecule may be administered in combination with absorbable mechanical barriers such as oxidized regenerated cellulose. The active molecule may be covalently or non-covalently (e.g., ionically) bound to such a barrier, or it may simply be dispersed therein.
The invention is further explained with the aid of the following illustrative examples.
Material and Methods
PEPTIDE SYNTHESIS: The peptides as mentioned herein such as LQG, AQG, LQGV (SEQ ID NO:1), AQGV (SEQ ID NO:2), LQGA (SEQ ID NO:19), VLPALP (SEQ ID NO:13), ALPALP (SEQ ID NO:21), VAPALP (SEQ ID NO:22), ALPALPQ (SEQ ID NO:23), VLPAAPQ (SEQ ID NO:24), VLPALAQ (SEQ ID NO:25), LAGV (SEQ ID NO:26), VLAALP (SEQ ID NO:27), VLPALA (SEQ ID NO:28), VLPALPQ (SEQ ID NO:29), VLAALPQ (SEQ ID NO:30), VLPALPA (SEQ ID NO:31), GVLPALP (SEQ ID NO:32), VVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCAL (SEQ ID NO:35), RPRCRPINATLAVEKEGCPVCITVNTTICAGYCPT (SEQ ID NO:45), SKAPPPSLPSPSRLPGPS (SEQ ID NO:38), LQGVLPALPQVVC (SEQ ID NO:34), SIRLPGCPRGVNPVVS (SEQ ID NO:39), LPGCPRGVNPVVS (SEQ ID NO:40), LPGC (SEQ ID NO:41), MTRV (SEQ ID NO:42), MTR, and VVC were prepared by solid-phase synthesis (R. B. Merrifield, J. Am. Chem. Soc., 85:2149-2165 (1963)) using the fluorenylmethoxycarbonyl (Fmoc)/tert-butyl-based methodology (Atherton, 1985) with 2-chlorotrityl chloride resin (Barlos et al., Int. J. Peptide Protein res., 37:513-520 (1991)) as the solid support.
The side-chain of glutamine was protected with a trityl function. The peptides were synthesized manually. Each coupling consisted of the following steps: (i) removal of the alpha-amino Fmoc-protection by piperidine in dimethylformamide (DMF), (ii) coupling of the Fmoc amino acid (3 eq) with diisopropylcarbodiimide (DIC)/1-hydroxybenzotriazole (HOBt) in DMF/N-methylformamide (NMP) and (iii) capping of the remaining amino functions with acetic anhydride/diisopropylethylamine (DIEA) in DMF/NMP. Upon completion of the synthesis, the peptide resin was treated with a mixture of trifluoroacetic acid (TFA)/H2O/triisopropylsilane (TIS) 95:2.5:2.5. After 30 minutes, TIS was added until decolorization. The solution was evaporated in vacuo and the peptide precipitated with diethylether.
The crude peptides were dissolved in water (50-100 mg/ml) and purified by reverse-phase high-performance liquid chromatography (RP-HPLC). HPLC conditions were: column: Vydac TP21810C18 (10×250 mm); elution system: gradient system of 0.1% TFA in water v/v (A) and 0.1% TFA in acetonitrile (ACN) v/v (B); flow rate 6 ml/min; absorbance was detected from 190-370 nm. There were different gradient systems used. For example, for peptides LQG and LQGV (SEQ ID NO:1): 10 minutes 100% A followed by linear gradient 0-10% B in 50 minutes. For example for peptides VLPALP (SEQ ID NO:3) and VLPALPQ (SEQ ID NO:29): 5 minutes 5% B followed by linear gradient 1% B/minute. The collected fractions were concentrated to about 5 ml by rotation film evaporation under reduced pressure at 40° C. The remaining TFA was exchanged against acetate by eluting two times over a column with anion exchange resin (Merck II) in acetate form. The eluate was concentrated and lyphilized in 28 hours. Peptides later were prepared for use by dissolving them in PBS.
Endotxin Shock Model (Sepsis)
Sepsis. For the endotoxin model, BALB/c mice were injected i.p. with 8-9 mg/kg LPS (E. coli 026:B6; Difco Lab., Detroit, Mich., USA). Control groups (PBS) were treated with PBS i.p. only. To test the effect of NMPF from different sources (synthetic, commercial hCG preparation [c-hCG]), we treated BALB/c mice with a dose of 300-700 IU of different hCG preparations (PG23; PREGNYL™ batch no. 235863, PG25; PREGNYL™ batch no. 255957 from NV Organon of Oss, NL) and with synthetic peptides (5 mg/kg) after two hours of LPS injection. In other experiments, BALB/c mice were injected i.p. either with 10 mg/kg or with 11 mg/kg LPS (E. coli 026:B6; Difco Lab., Detroit, Mich., USA). Subsequently, mice were treated after 2 hours and 24 hours of LPS treatment with NMPF peptides.
Semi-quantitative sickness measurements. Mice were scored for sickness severity using the following measurement scheme:
-
- 1 Percolated fur, but no detectable behaviour differences compared to normal mice.
- 2 Percolated fur, huddle reflex, responds to stimuli (such as tap on cage), just as active during handling as healthy mouse.
- 3 Slower response to tap on cage, passive or docile when handled, but still curious when alone in a new setting.
- 4 Lack of curiosity, little or no response to stimuli, quite immobile.
- 5 Labored breathing, inability or slow to self-right after being rolled onto back (moribund)
- 6 Sacrificed
Results
Endotoxin Shock Model (Sepsis)
Sepsis experiments. To determine the effect of synthetic peptides (NMPF) in high-dose LPS shock model, BALB/c mice were injected intraperitoneally with different doses of LPS and survival was assessed daily for 5 days. In this experiment (for the LPS endotoxin model), BALB/c mice were injected i.p. with 8-9 mg/kg LPS (E. coli 026:B6; Difco Lab., Detroit, MI, USA). Control groups (PBS) were treated with PBS i.p. only. We treated BALB/c mice with a dose of 300-700 IU of different hCG preparations (PG23; PREGNYL batch no. 235863, PG25; PREGNYL batch no. 255957) or with peptides (5 mg/kg) after two hours of LPS injection.
These experiments showed (Table 1) that NMPF peptides 4, 6, 66 and PG23 inhibited shock completely (all mice had in first 24 hours sickness scores not higher than 2; shortly thereafter they recovered completely and had sickness scores of 0), while peptides 2, 3 and 7 accelerated shock (all mice had in first 24 hours sickness scores of 5 and most of them died, while the control mice treated with LPS+PBS had sickness scores of 3-4 in first 24 hours and most of them died after 48 hours with sickness scores of 5; 17% survival rate at 72 hours). In addition, peptides 1, 5, 8, 9, 11, 12, 13, 14 and 64 showed in a number of different experiments variability in effectiveness as well as in the kind (inhibitory vs accelerating) of activity. This variability is likely attributable to the rate of breakdown of the various peptides and the different effects the various peptides and their breakdown products have in vivo. In addition, these experiments also showed the variability in anti-shock activity in c-hCG preparations that is likely attributable to the variation in the presence of anti-shock and shock-accelerating NMPF. Visible signs of sickness were apparent in all of the experimental animals, but the kinetics and obviously the severity of this sickness were significantly different. These data are representative of at least 10 separate experiments.
In Table 2, we see the effect of ALA-replacement (PEP-SCAN) in peptide LQG, LQGV (SEQ ID NO:1), VLPALP (SEQ ID NO:3), VLPALPQ (SEQ ID NO:29) in septic shock experiments. We conclude that the change in even one amino acid by a neutral amino acid can lead to different activity. So, genomic differences as well as polymorphism in these peptides can regulate the immune response very precisely. Derivatives of these peptides, for example (but not limited to) by addition of classical and non-classical amino acids or derivatives that are differentially modified during or after synthesis, for example benzylation, amidation, glycosylation, proteolytic cleavage, linkage to an antibody molecule or other cellular ligand, etc. could also lead to a better effectiveness of the activity.
To determine whether treatment of BALB/c mice with NMPF inhibits septic shock at different stages of disease, synthetic peptides (NMPF) were injected i.p. at 2 and 24 hours after the induction of septic shock with high dose LPS (10 mg/kg).
As shown in Tables 3 and 4, control mice treated with PBS after the shock induction reached a sickness score of 5 at 14 and 24 hours, and remained so after the second injection with PBS. The survival rate in control group mice was 0% at 48 hours. In contrast to control mice, mice treated with NMPF 9, 11, 12, 43, 46, 50 and 60 reached a maximum sickness score of 2-3 at 24 hours after the induction of septic shock and further reached a maximum sickness score of 1-2 at 48 hours after the second injection of NMPF. In addition, mice treated with NMPF 5, 7, 8, 45, 53 and 58 reached a sickness score of 5 and after the second injection with NMPF all mice returned to a sickness score of 1-2 and survival rates in NMPF groups were 100%. Mice treated with NMPF 3 reached sickness scores of 3-4 and the second NMPF injection did save these mice. These experiments show that NMPF peptides have anti-shock activity at different stages of the disease and NMPF have anti-shock activity even at the disease stage when otherwise irreversible damage had been done. This indicates that NMPF have effects on different cellular levels and also have repairing and regenerating capacity.
NOD Experiment
Mice. Female NOD mice at the age of 13-14 weeks were treated i.p. with PBS (n=6) or NMPF peptides (VLPALPQVVC (SEQ ID NO:20), LQGV (SEQ ID NO:1), GVLPALPQ (SEQ ID NO:33), VLPALP (SEQ ID NO:3), VLPALPQ (SEQ ID NO:29), MTRV (SEQ ID NO:42), LPGCPRGVNPVVS (SEQ ID NO:40), CPRGVNPVVS (SEQ ID NO:50), LPGC (SEQ ID NO:41), MTRVLQGVLPALPQVVC (SEQ ID NO:44), VVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCAL (SEQ ID NO:35)) (5 mg/kg, n=6) three times a week for 2 weeks. Every four days urine was checked for the presence of glucose (Gluketur Test; Boehringer Mannheim, Mannheim, Del.). All mice used in these studies were maintained in a pathogen-free facility. They were given free access to food and water. The experiments were approved by the Animal Experiments Committee of the Erasmus University Rotterdam. Diabetes was assessed by measurement of the venous blood glucose level using an Abbott Medisense Precision glucometer. Mice were considered diabetic after two consecutive glucose measurements≧11 mmol/l (200 mg/dl). Onset of diabetes was dated from the first consecutive reading.
Glucose tolerance test (GTT) was performed at 28 weeks of age in fasted mice (n=5) by injecting 1 g/kg D-glucose intraperitoneally (i.p.). At 0 (fasting), 5, 30 and 60 minutes, blood samples were collected from the tail and tested for glucose content.
NO Experiment
Cell culture. The RAW 264.7 murine macrophage cell line, obtained from American Type Culture Collection (Manassas, Va., USA), were cultured at 37° C. in 5% CO2 using DMEM containing 10% fetal calf serum (FCS), 50 U/ml penicillin, 50 μg/ml streptomycin, 0.2 M Na-pyruvate, 2 mM glutamine and 50 μM 2-mercaptoethanol (Bio Whittaker, Europe). The medium was changed every 2 days.
Nitrite measurements. Nitrite production was measured in the RAW 264.7 macrophage supernatants. The cells (7.5×105/ml) were cultured in 48-well plates in 500 μl of culture medium. The cells were stimulated with LPS (10 microg/ml) and/or NMPF (1 pg/ml, 1 ng/ml, 1 μg/ml) for 24 hours, then the culture media were collected. Nitrite was measured by adding 100 microl of Griess reagent (Sigma) to 100 microl samples of culture medium. The OD540 was measured using a microplate reader, and the nitrite concentration was calculated by comparison with the OD540 produced using standard solutions of sodium nitrite in the culture medium.
Results
NOD Experiment
In order to determine whether NMPF has effect on the disease development in NOD mice, we tested NMPF on pre-diabetic female NOD mice at the age of 13-14 weeks. After only two weeks of treatment (injection of NMPF (5 mg/kg) every other day), glucosuria data of all NOD mice was analyzed at the of 17 weeks. Profound anti-diabetic effect (mice negative for glucosuria) was observed in different NMPF groups as compared to the PBS group, especially in NMPF groups treated with peptide VLPALPQVVC (SEQ ID NO:20), VLPALP (SEQ ID NO:3), MTRV (SEQ ID NO:42), LPGCPRGVNPVVS (SEQ ID NO:40) and LPGC. In addition, impairment of the glucose tolerance test was positively correlated to insulitis, but negatively correlated to the number of functional beta cells; also this test showed that NOD mice successfully treated with NMPF were tolerant for glucose as compared to the PBS group. Our results show that PBS treated NOD mice were all diabetic at the age of 23 weeks. Whereas, NOD mice treated three times a week for two weeks with NMPF showed profound inhibition of diabetes development. The strongest anti-diabetic effects were seen with NMPF-1, -4, -5, -6, -7, -65, -66 and commercial hCG preparation (PREGNYL, batch no. 235863). These mice had a low fasting blood glucose level and were tolerant for glucose (data partially shown). However, NMPF-71 showed no effect on the incidence of diabetes, while NMPF-64 and NMPF-11 had a moderate anti-diabetic effect.
NO Experiment
NO production is a central mediator of the vascular and inflammatory response. Our results show that macrophages (RAW 264.7) stimulated with LPS produce large amounts of NO. However, these cells co-stimulated with most of the NMPF peptides (NMPF peptides 1 to 14, 43 to 66 and 69) even in a very low dose (1 pg/ml) inhibited the production of NO.
Results
apoE Experiment
The invention provides a method and a composition of the invention for the treatment of conditions that are associated with dysfunctional LDL receptors such as apoE and other members of the apolipoprotein family. In particular, use of a composition of the invention comprising GVLPALPQ (SEQ ID NO:33) (NMPF-5) and/or VLPALP (SEQ ID NO:3) (NMPF-6) or a functional analogue or derivative thereof is preferred. Groups of apoE deficient mice (n=6 per group) were fed a high cholesterol food and given PBS or NMPF every other day intraperitoneally. After 2.5 weeks, body weight was determined as shown in the Table below.
| Average Weight (g) | SD (g) | p-value | |||
| ApoE-/-PBS | 31.667 | 1.007 | |||
| ApoE-/-NMPF-4 | 31.256 | 1.496 | 0.536 | ||
| ApoE-/-NMPF-5 | 29.743 | 1.160 | 0.019 | ||
| Background/PBS | 26.760 | 1.582 | 10−6 | ||
| ApoE-/-NMPF-6 | 29.614 | 1.064 | 0.004 | ||
| TABLE 1 |
| Results of shock experiments in mice |
| % SURVIVAL | ||
| IN TIME (HRS) |
| 0 | 16 | 40 | 72 | ||
| TEST | |||||
| SUBSTANCE | |||||
| PBS | 100 | 100 | 67 | 17 | |
| PG23 | 100 | 100 | 100 | 100 | |
| PG25 | 100 | 83 | 83 | 83 | |
| PEPTIDE | |||||
| NMPF | SEQUENCE | ||||
| 1 | VLPALPQVVC (SEQ ID NO: 20) | 100 | 100 | 50 | 17 |
| 2 | LQGVLPALPQ (SEQ ID NO: 49) | 100 | 67 | 0 | 0 |
| 3 | LQG | 100 | 83 | 20 | 17 |
| 4 | LQGV (SEQ ID NO: 1) | 100 | 100 | 100 | 100 |
| 5 | GVLPALPQ (SEQ ID NO: 33) | 100 | 100 | 80 | 17 |
| 6 | VLPALP (SEQ ID NO: 3) | 100 | 100 | 100 | 100 |
| 7 | VLPALPQ (SEQ ID NO: 168) | 100 | 83 | 0 | 0 |
| 8 | GVLPALP (SEQ ID NO: 32) | 100 | 100 | 83 | 67 |
| 9 | VVC | 100 | 100 | 50 | 50 |
| 11 | MTRV (SEQ ID NO: 42) | 100 | 100 | 67 | 50 |
| 12 | MTR | 100 | 100 | 67 | 50 |
| 13 | LQGVLPALPQVVC | 100 | 100 | 100 | 100 |
| (SEQ ID NO: 34) | |||||
| 14 | (CYCLIC) LQGVLPALPQVVC | 100 | 83 | 83 | 83 |
| (SEQ ID NO: 34) | |||||
| 64 | LPGCPRGVNPVVS | 100 | 100 | 100 | 100 |
| (SEQ ID NO: 40) | |||||
| 66 | LPGC (SEQ ID NO: 41) | 100 | 100 | 100 | 100 |
| TABLE 2 |
| Additional results of shock experiments |
| NMPF SEQUENCE ID: | |
| ANTI-SHOCK EFFECT | |
| LQGV (SEQ ID NO: 1) | +++ |
| AQGV (SEQ ID NO: 2) | +++ |
| LQGA (SEQ ID NO: 19) | +++ |
| VLPALP (SEQ ID NO: 3) | +++ |
| ALPALP (SEQ ID NO: 21) | ++ |
| VAPALP (SEQ ID NO: 22) | ++ |
| ALPALPQ (SEQ ID NO: 23) | ++ |
| VLPAAPQ (SEQ ID NO: 24) | ++ |
| VLPALAQ (SEQ ID NO: 25) | +++ |
| SHOCK ACCELERATING EFFECT | |
| LAGV (SEQ ID NO: 26) | +++ |
| LQAV (SEQ ID NO: 52) | +++ |
| VLAALP (SEQ ID NO: 27) | +++ |
| VLPAAP (SEQ ID NO: 117) | +++ |
| VLPALA (SEQ ID NO: 28) | +++ |
| VLPALPQ (SEQ ID NO: 29) | +++ |
| VLAALPQ (SEQ ID NO: 30) | +++ |
| VLPALPA (SEQ ID NO: 31) | +++ |
| TABLE 3 |
| Further additional results of shock experiments |
| % SURVIVAL IN TIME (HRS) |
| NMPF | Tx | Tx | ||||
| PEPTIDES | 0 | 14 | 24 | 48 | ||
| PBS | 100 | 100 | 100 | 0 | ||
| NMPF-3 | 100 | 100 | 100 | 0 | ||
| NMPF-5 | 100 | 100 | 100 | 100 | ||
| NMPF-7 | 100 | 100 | 100 | 67 | ||
| NMPF-8 | 100 | 100 | 100 | 100 | ||
| NMPF-9 | 100 | 100 | 100 | 100 | ||
| NMPF-11 | 100 | 100 | 100 | 100 | ||
| NMPF-12 | 100 | 100 | 100 | 100 | ||
| NMPF-43 | 100 | 100 | 100 | 100 | ||
| NMPF-45 | 100 | 100 | 100 | 100 | ||
| NMPF-46 | 100 | 100 | 100 | 100 | ||
| NMPF-50 | 100 | 100 | 100 | 100 | ||
| NMPF-53 | 100 | 100 | 100 | 100 | ||
| NMPF-58 | 100 | 100 | 100 | 100 | ||
| NMPF-60 | 100 | 100 | 100 | 100 | ||
| TABLE 4 |
| Further additional results |
| SICKNESS SCORES |
| NMPF | Tx | Tx | ||
| PEPTIDES | 0 | 14 | 24 | 48 |
| PBS | 0, 0, 0, 0, 0, 0 | 5, 5, 5, 5, 4, 4 | 5, 5, 5, 5, 5, 5 | †††††† |
| NMPF-3 | 0, 0, 0, 0, 0, 0 | 3, 3, 3, 3, 3, 4 | 4, 4, 4, 4, 4, 4 | †††††† |
| NMPF-5 | 0, 0, 0, 0, 0, 0 | 5, 5, 5, 5, 5, 5 | 5, 5, 5, 5, 5, 5 | 2, 2, 2, 2, 2, 2 |
| NMPF-7 | 0, 0, 0, 0, 0, 0 | 1, 1, 4, 4, 4, 4 | 5, 5, 5, 5, 5, 5 | 2, 2, 2, 2, †† |
| NMPF-8 | 0, 0, 0, 0, 0, 0 | 3, 3, 5, 5, 5, 5 | 5, 5, 5, 5, 5, 5 | 2, 2, 4, 4, 4, 5 |
| NMPF-9 | 0, 0, 0, 0, 0, 0 | 3, 3, 4, 4, 5, 5 | 2, 2, 2, 2, 2, 2 | 1, 1, 2, 2, 2, 2 |
| NMPF-11 | 0, 0, 0, 0, 0, 0 | 1, 1, 3, 3, 4, 4, | 2, 2, 2, 2, 4, 4 | 1, 1, 1, 1, 1, 1 |
| NMPF-12 | 0, 0, 0, 0, 0, 0 | 1, 1, 1, 1, 3, 3 | 1, 1, 1, 1, 1, 1 | 1, 1, 1, 1, 1, 1 |
| NMPF-43 | 0, 0, 0, 0, 0, 0 | 1, 1, 4, 4, 4, 4 | 1, 1, 1, 1, 3, 3 | 2, 2, 2, 2, 2, 2 |
| NMPF-45 | 0, 0, 0, 0, 0, 0 | 5, 5, 5, 5, 4, 4 | 3, 3, 4, 4, 5, 5 | 2, 2, 4, 4, 5, 5 |
| NMPF-46 | 0, 0, 0, 0, 0, 0 | 1, 1, 2, 2, 3, 3 | 1, 1, 2, 2, 2, 2 | 1, 1, 1, 1, 1, 1 |
| NMPF-50 | 0, 0, 0, 0, 0, 0 | 1, 1, 1, 1, 3, 3 | 2, 2, 2, 2, 3, 3 | 1, 1, 1, 1, 1, 1 |
| NMPF-53 | 0, 0, 0, 0, 0, 0 | 5, 5, 5, 5, 5, 5 | 5, 5, 5, 5, 5, 5 | 1, 1, 2, 2, 2, 2 |
| NMPF-58 | 0, 0, 0, 0, 0, 0 | 5, 5, 5, 5, 3, 3 | 5, 5, 5, 5, 3, 3 | 1, 1, 1, 1, 1, 1 |
| NMPF-60 | 0, 0, 0, 0, 0, 0 | 1, 1, 4, 4, 2, 2 | 2, 2, 2, 2, 4, 4 | 1, 1, 1, 1, 1, 1 |
| TABLE 5 |
| Summary of results of the various peptides in the various experiments. |
| ID | SEQUENCE | SEPSIS | ANGIOGENSIS | CAO | DC | NOD |
| NMPF-1 | VLPALPQVVC (SEQ ID NO: 20) | −+ | + | + | ||
| NMPF-2 | LQGVLPALPQ (SEQ ID NO: 49) | −+ | + | |||
| NMPF-3 | LQG | −+ | + | + | + | |
| NMPF-4 | LQGV (SEQ ID NO: 1) | + | + | + | + | |
| NMPF-5 | GVLPALPQ (SEQ ID NO: 33) | −+ | + | |||
| NMPF-6 | VLPALP (SEQ ID NO: 3) | + | + | + | + | |
| NMPF-7 | VLPALPQ (SEQ ID NO: 29) | + | + | + | ||
| NMPF-8 | GVLPALP (SEQ ID NO: 32) | −+ | + | |||
| NMPF-9 | VVC | + | + | + | ||
| NMPF-10 | QVVC (SEQ ID NO: 43) | |||||
| NMPF-11 | MTRV (SEQ ID NO: 42) | + | + | + | + | |
| NMPF-12 | MTR | −+ | + | + | ||
| NMPF-13 | LQGVLPALPQVVC (SEQ ID NO: 34) | + | + | |||
| NMPF-14 | cyclic-LQGVLPALPQVVC (SEQ ID NO: 34) | + | ||||
| NMPF-43 | AQG | + | + | + | ||
| NMPF-44 | LAG | + | ||||
| NMPF-45 | LQA | + | + | |||
| NMPF-46 | AQGV (SEQ ID NO: 2) | + | + | + | ||
| NMPF-47 | LAGV (SEQ ID NO: 26) | −+ | + | + | ||
| NMPF-48 | LQAV (SEQ ID NO: 52) | |||||
| NMPF-49 | LQGA (SEQ ID NO: 19) | + | ||||
| NMPF-50 | ALPALP (SEQ ID NO: 21) | + | + | |||
| NMPF-51 | VAPALP (SEQ ID NO: 22) | + | + | |||
| NMPF-52 | VLAALP (SEQ ID NO: 27) | |||||
| NMPF-53 | VLPAAP (SEQ ID NO: 117) | + | + | |||
| NMPF-54 | VLPALA (SEQ ID NO: 28) | |||||
| NMPF-55 | ALPALPQ (SEQ ID NO: 23) | + | ||||
| NMPF-56 | VAPALPQ (SEQ ID NO: 173) | + | ||||
| NMPF-57 | VLAALPQ (SEQ ID NO: 30) | |||||
| NMPF-58 | VLPAAPQ (SEQ ID NO: 24) | + | + | |||
| NMPF-59 | VLPALAQ (SEQ ID NO: 25) | + | + | |||
| NMPF-60 | VLPALPA (SEQ ID NO: 31) | + | + | |||
| NMPF-61 | VVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCAL | −+ | + | |||
| (SEQ ID NO: 35) | ||||||
| NMPF-62 | VVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQ | |||||
| (SEQ ID NO: 169) | ||||||
| NMPF-63 | SIRLPGCPRGVNPVVS (SEQ ID NO: 39) | −+ | ||||
| NMPF-64 | LPGCPRGVNPVVS (SEQ ID NO: 40) | + | ||||
| NMPF-65 | CPRGVNPVVS (SEQ ID NO: 50) | |||||
| NMPF-66 | LPGC (SEQ ID NO: 41) | + | + | + | ||
| NMPF-67 | CPRGVNP (SEQ ID NO: 170) | |||||
| NMPF-68 | PGCP (SEQ ID NO: 10) | −+ | ||||
| NMPF-69 | RPRCRPINATLAVEKEGCPVCITVNTTICAGYCPT | |||||
| (SEQ ID NO: 45) | ||||||
| NMPF-70 | MTRVLQGVLPALPQ (SEQ ID NO: 171) | −+ | ||||
| NMPF-71 | MTRVLPGVLPALPQVVC (SEQ ID NO: 174) | −+ | ||||
| NMPF-74 | CALCRRSTTDCGGPKDHPLTC (SEQ ID NO: 46) | |||||
| NMPF-75 | SKAPPPSLPSPSRLPGPC (SEQ ID NO: 172) | |||||
| NMPF-76 | TCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ | |||||
| (SEQ ID NO: 48) | ||||||
| + = effects; | ||||||
| −+ = variable effect; | ||||||
| no entry is no effect or not yet tested when table was assembled | ||||||
| TABLE 6 |
| MODULATION OF NO AND/OR TNF-α |
| TNF-A | ||||
| ID | SEQUENCE | TNF-A | NO | and NO |
| NMPF-1 | VLPALPQVVC | ++ | ++++ | ++++ |
| (SEQ ID NO: 20) | ||||
| NMPF-2 | LQGVLPALPQ | −+ | ++++ | ++++ |
| (SEQ ID NO: 49) | ||||
| NMPF-3 | LQG | + | ++++ | ++++ |
| NMPF-4 | LQGV | ++++ | ++++ | +++++++ |
| (SEQ ID NO: 1) | ||||
| NMPF-5 | GVLPALPQ | ++++ | ++++ | +++++++ |
| (SEQ ID NO: 33) | ||||
| NMPF-6 | VLPALP | ++++ | ++++ | +++++++ |
| (SEQ ID NO: 3) | ||||
| NMPF-7 | VLPALPQ | ++++ | ++++ | +++++++ |
| (SEQ ID NO: 29) | ||||
| NMPF-8 | GVLPALP | ++++ | ++++ | +++++++ |
| (SEQ ID NO: 32) | ||||
| NMPF-9 | VVC | ++++ | ++++ | +++++++ |
| NMPF-10 | QVVC | ++++ | +++ | ++++ |
| (SEQ ID NO: 43) | ||||
| NMPF-11 | MTRV | ++++ | ++++ | ++++ |
| (SEQ ID NO: 42) | ||||
| NMPF-12 | MTR | ++++ | ++++ | ++++ |
| NMPF-13 | LQGVLPALPQVVC | ++ | ++++ | ++++ |
| (SEQ ID NO: 34) | ||||
| NMPF-14 | cyclic- | ++ | ++++ | ++++ |
| LQGVLPALPQVVC | ||||
| (SEQ ID NO: 34) | ||||
| NMPF-43 | AQG | ++++ | ++++ | +++++++ |
| NMPF-44 | LAG | −+ | ++++ | ++++ |
| NMPF-45 | LQA | ++++ | ++++ | +++++++ |
| NMPF-46 | AQGV | ++++ | ++++ | +++++++ |
| (SEQ ID NO: 2) | ||||
| NMPF-47 | LAW | ++ | ++++ | ++++ |
| (SEQ ID NO: 26) | ||||
| NMPF-48 | LQAV | ++ | ++++ | ++++ |
| (SEQ ID NO: 52) | ||||
| NMPF-49 | LQGA | ++ | ++++ | ++++ |
| (SEQ ID NO: 19) | ||||
| NMPF-50 | ALPALP | ++++ | ++++ | +++++++ |
| (SEQ ID NO: 21) | ||||
| NMPF-51 | VAPALP | + | +++ | ++++ |
| (SEQ ID NO: 22) | ||||
| NMPF-52 | VLAALP | ++ | ++++ | ++++ |
| (SEQ ID NO: 27) | ||||
| NMPF-53 | VLPAAP | ++++ | ++++ | +++++++ |
| (SEQ ID NO: 117) | ||||
| NMPF-54 | VLPALA | + | ++++ | ++++ |
| (SEQ ID NO: 28) | ||||
| NMPF-55 | ALPALPQ | + | ++++ | ++++ |
| (SEQ ID NO: 23) | ||||
| NMPF-56 | VAPALPQ | −+ | ++++ | ++++ |
| (SEQ ID NO: 173) | ||||
| NMPF-57 | VLAALPQ | + | ++++ | ++++ |
| (SEQ ID NO: 30) | ||||
| NMPF-58 | VLPAAPQ | ++++ | ++++ | +++++++ |
| (SEQ ID NO: 24) | ||||
| NMPF-59 | VLPALAQ | ++ | ++++ | ++++ |
| (SEQ ID NO: 25) | ||||
| NMPF-60 | VLPALPA | ++++ | ++++ | +++++++ |
| (SEQ ID NO: 31) | ||||
| NMPF-61 | VVCNYRDVRFESIRLPGCP | −+ | ++++ | ++++ |
| RGVNPVVSYAVALSCQCAL | ||||
| (SEQ ID NO: 35) | ||||
| NMPF-62 | VVCNYRDVRFESIRLPGCP | −+ | +++ | ++++ |
| RGVNPVVSYAVALSCQ | ||||
| (SEQ ID NO: 169) | ||||
| NMPF-63 | SIRLPGCPRGVNPVVS | −+ | ++ | ++ |
| (SEQ ID NO: 39) | ||||
| NMPF-64 | LPGCPRGVNPVVS | ++ | ++++ | ++++ |
| (SEQ ID NO: 40) | ||||
| NMPF-65 | CPRGVNPVVS | ++ | +++ | +++ |
| (SEQ ID NO: 50) | ||||
| NMPF-66 | LPGC | +++ | ++ | +++ |
| (SEQ ID NO: 41) | ||||
| NMPF-67 | CPRGVNP | −+ | + | + |
| (SEQ ID NO: 170) | ||||
| NMPF-68 | PGCP | + | + | +++ |
| (SEQ ID NO: 10) | ||||
| NMPF-69 | RPRCRPINATLAVEKEGCP | −+ | ++ | ++ |
| VCITVNTTICAGYCPT | ||||
| (SEQ ID NO: 45) | ||||
| NMPF-70 | MTRVLQGVLPALPQ | −+ | + | + |
| (SEQ ID NO: 171) | ||||
| INMPF-71 | MTRVLPGVLPALPQVVC | −+ | −+ | −+ |
| (SEQ ID NO: 174) | ||||
| NMPF-74 | CALCRRSTTDCGGPKDHPL | −+ | ++ | + |
| TC | ||||
| (SEQ ID NO: 46) | ||||
| NMPF-75 | SKAPPPSLPSPSRLPGPS | + | ++ | ++ |
| (SEQ ID NO: 172) | ||||
| NMPF-76 | TCDDPRFQDSSSSKAPPPS | + | + | + |
| LPSPSRLPGPSDTPILPQ | ||||
| (SEQ ID NO: 48) | ||||
| NMPF-76 | CRRSTTDCGGPKDHPLTC | + | + | + |
| (SEQ ID NO: 47) | ||||
| from −+ to +++++++ indicates from barely active to very active in modulating | ||||
Monkey Experiment
Efficacy of NMPF, here a mixture 1:1:1 of LQGV (SEQ ID NO:1), AQGV (SEQ ID NO:2) and VLPALP (SEQ ID NO:3), administered in a gram-negative induced rhesus monkey sepsis model for prevention of septic shock.
Overwhelming inflammatory and immune responses are essential features of septic shock and play a central part in the pathogenesis of tissue damage, multiple organ failure, and death induced by sepsis. Cytokines, especially tumor necrosis factor (TNF)-α interleukin (IL)-1β, and macrophage migration inhibitory factor (MIF), have been shown to be critical mediators of septic shock. Yet, traditional anti-TNF and anti-IL-1 therapies have not demonstrated much benefit for patients with severe sepsis. We have designed peptides that block completely LPS induced septic shock in mice, even when treatment with these peptides is started up to 24 hours after LPS injection. These peptides are also able to inhibit the production of MIF. This finding provides the possibility of therapeutic use of these peptides for the treatment of patients suffering from septic shock. Since primates are evolutionary more closer to humans, we tested these peptides for their safety and effectiveness in a primate system.
Experimental Design
| EXPERIMENTAL | |||
| TREATMENT | |||
| (independent variable, | |||
| e.g., placebo treated | |||
| GROUP | control group) | BIOTECHNIQUES | NUMBER |
| animal I | i.v. infusion of a lethal | Live E. coli infusion | N = 1 |
| dose of live | Blood sampling | ||
| Escherichia. coli (10E10 | No recovery (section) | ||
| CFU/kg) + antibiotics + | |||
| placebo treated | |||
| animal II | i.v. infusion of a lethal | Live E. coli infusion | N = 1 |
| dose of live | Blood sampling | ||
| Escherichia. coli (10E10 | No recovery (section) | ||
| CFU/kg) + antibiotics + | |||
| oligopeptide (5 mg/kg | |||
| of each of 3 peptides) | |||
Only naive monkeys were used in this preclinical study to exclude any interaction with previous treatments. The animals were sedated with ketamine hydrochloride. Animals were intubated orally and allowed to breathe freely. The animals were kept anesthetized with O2/N2O/isoflurane. The animals received atropin as pre-medication for O2/N20/isoflurane anesthesia. A level of surgical anesthesia was maintained during the 2 h infusion of E. coli and for 6 h following E. coli challenge, after which the endothracheal tubes were removed and the animals were euthanized. Before bacteria were induced, a 1 hour pre-infusion monitoring of heart-rate and blood pressure was performed.
Two rhesus monkeys were infused with a 10 10CFU per kg of the Gram negative bacterium E. coli to induce a fatal septic shock. One monkey received placebo-treatment and was sacrificed within 7 hours after infusion of the bacteria without recovery from the anesthesia. The second monkey received treatment with test compound and was sacrificed at the same time point.
In a limited dose-titration experiment performed with the same bacterium strain in 1991, the used dose proved to induce fatal shock within 8 hours. In recent experiments, a 3-fold lower dose was used inducing clear clinical and pathomorphological signs of septic shock without fatal outcome.
The monkeys were kept anesthetized throughout the observation period and sacrificed 7 hours after the start of the bacterium infusion for pathological examination. The animals underwent a gross necropsy in which the abdominal and thorax cavities were opened and internal organs examined in situ.
Full Description of the Experiment with Three Rhesus Monkeys
The study was conducted in rhesus monkeys (Maccaca mulatta). Only experimentally naive monkeys were used in the study to exclude any interaction with previous treatments. Prior to the experiment, the state of health of the animals was assessed physically by a veterinarian. All animals had been declared to be in good health and were free of pathogenic ecto- and endoparasites and common bacteriological infections: Yersinia pestis, Yersinia enterocolitica, Yersinia pseudotuberculosis, Shigella, Aeromonas hydrophilia, pathogenic Campylobacter species and Salmonella.
Reagents. The Escherichia coli strain was purchased from ATCC (E. coli; 086a: K61 serotype, ATCC 33985). In a control experiment, the strain proved equally susceptible to bactericidal factors in human and rhesus monkey serum. Prior to the experiment, a fresh culture was set-up; the E. coli strain was cultured for one day, harvested and washed thoroughly to remove free endotoxine. Prior to infusion into the animal, the number and viability of the bacteria were assessed. Serial dilutions of the E. coli stock were plated on BHI agar and cultured overnight at 37° C. The colonies on each plate were counted and the number of colony-forming units per ml was calculated. The body weight measurement of the day of the experiment was used to calculate the E. coli dose and E. coli stock was suspended in isotonic saline (N.P.B.I., Emmer-Compascuum, NL) at the concentration needed for infusion (total dose volume for infusion approximately 10 ml/kg. The E. coli suspension was kept on ice until infusion.
Antibiotic was used to synchronize the shock induction in the monkeys. Baytril (Baytril 2.5%, Bayer, Del.) was used instead of gentamycin, as the strain proved only marginally susceptible to the latter antibiotic. Individual animals were identified by a number or letter combination tattooed on the chest.
Experimental design.
| EXPERIMENTAL | ||||
| GROUP | TREATMENT | |||
| (number/ | (independent variable, | |||
| letter or other | e.g., placebo treated | NUM- | ||
| identification | control group) | BER | SEX | |
| Animal I | i.v. infusion of a lethal | Live E. coli | N = 1 | F |
| dose of live | infusion | |||
| Escherichia. coli (10E10 | Blood sampling | |||
| CFU/kg) + antibiotic + | No recovery | |||
| placebo treated | ||||
| Animal II | i.v. infusion of a lethal | Live E. coli | N = 1 | F |
| dose of live | infusion | |||
| Escherichia. coli (10E10 | Blood sampling | |||
| CFU/kg) + antibiotic + | No recovery | |||
| NMPF-4, -6, -46; each | (section) | |||
| 5 mg/kg | ||||
| Animal III | i.v. infusion of a lethal | Live E. coli | N = 1 | F |
| dose of live | infusion | |||
| Escherichia. coli (10E10 | Blood sampling | |||
| CFU/kg) + antibiotic + | Recovery and | |||
| NMPF-4, -6, -46; each | survival | |||
| 5 mg/kg | ||||
Anesthesia. All animals were fasted overnight prior to the experiment. On the morning of the experiment, the animals were sedated with ketamine hydrochloride (Tesink, NL) and transported to the surgery. The animal was placed on its side on a temperature-controlled heating pad to support body temperature. Rectal temperature was monitored using a Vet-OX 5700. The animals were intubated orally and were allowed to breathe freely. The animals were kept anesthesized using O2/N2O/isoflurane inhalation anesthesia during the E. coli infusion and the 7 hour observation period following E. coli challenge, after which the endothracheal tubes were removed and the animals were euthanized or allowed to recover from anesthesia. The femoral or the cephalic vein was cannulated and used for infusing isotonic saline, live E. coli and antibiotic administration. Insensible fluid loss was compensated for by infusing isotonic saline containing 2.5% glucose (Fresenius, 's Hertogenbosch, NL) at a rate of 3.3 ml/kg/hr.
Preparative actions. During anesthesia the animals were instrumented for measurement of blood pressure (with an automatic cuff), heart rate and body temperature. Isotonic saline was infused at 3.3 ml/kg/hr to compensate for fluid loss. Femoral vessels were cannulated for infusion of E. coli and antibiotics. Temperature-controlled heating pads were used to support body temperature. The monkeys were continuously monitored during the E. coli challenge and for the 6 hr period following E. coli administration. After 7 hrs, 2 animals (the control animal and one treated with NMPF) were sacrificed to compare the direct effect of the compound at the level of histology. The 3rd animal, treated with NMPF, was allowed to recover from anesthesia and was intensively observed during the first 12 hours after recovery followed by frequent daily observation. The decision to allow the 3rd animal to recover was made after consulting with the veterinarian.
Induction of septic shock. Before the infusion of E. coli, a 1 hr pre-infusion monitoring of heart-rate and blood pressure was performed. All three animals received an i.v. injection of E. coli 086 (k61 serotype; ATCC 33985) at a lethal dose of 10×109 CFU/kg body weight. In a dose titration study with this batch performed in 1991, this bacterial dose induced lethal shock within 8 hrs after the start of the infusion. The infusion period was 2 hrs.
Antibiotics. Baytril was administered intravenously immediately after completion of the 2 h.E. coli infusion (i.v.; dose 9 mg/kg).
Treatment with NMPF. 30 minutes post-onset of E. coli infusion, the animals were administered a single intravenous bolus injection of a mixer of NMPF oligopeptides. The oligopeptide mixer contained the following NMPF peptides: LQGV (SEQ ID NO: 1) (5 mg/kg), AQGV (SEQ ID NO:2) (5 mg/kg) and VLPALP (SEQ ID NO:3) (5 mg/kg). These NMPF peptides were dissolved in 0.9% sodium chloride for injection (N.P.B.I., Emmer Compascuum, NL).
Results
Preliminary Monkey Results
An anti-shock effect of the test compound on sepsis in the monkey treated with the oligopeptide mixture, namely the inhibition of the effect of the sepsis in this early 7-hour trajectory of this primate model, was observed. Immunomodulatory effects with these peptides have been observed in vitro/ex vivo such as in T-cell assays, the inhibition of pathological Thl immune responses, suppression of inflammatory cytokines (MIF), increase in production of anti-inflammatory cytokines (IL-10, TGF-beta) and immunomodulatory effects on antigen-presenting cells (APC) like dendritic cells and macrophages.
The following organs were weighed and a bacterial count was performed: kidneys, liver, lungs, lymph nodes, and gross lesions.
Tissues of all organs were preserved in neutral aqueous phosphate buffered 4% solution of formaldehyde. Lymphoid organs were cryopreserved. All tissues will be processed for histopathological examination.
Further Results Obtained in the Three-monkey Experiment
Monkey 429(control). Female monkey (5.66 kg) received an i.v. injection of E. coli 086 (10E10 CFU/kg). In a dose titration study with this batch performed in 1991, this bacterial dose induced lethal shock within 8 hrs after the start of the infusion. The infusion period was 2 hrs. Baytril was administered intravenously immediately after completion of the 2 h. E. coli infusion (i.v.; dose 9 mg/kg). After the E. coli injection, the monkey was observed by the authorized veterinarian without knowing which of the monkeys received NMPF treatment. The clinical observations were as follows: vomiting, undetectable pulse, heart arythmia, abnormalities in ECG: signs of ventricle dilatation/heart decompensation (prolonged QRS complex, extra systoles), decreased blood clotting and forced respiration. In addition, there was big fluctuation in heart rate (30-150 beats per minute), collapse of both systolic and diastolic blood pressure (35/20 mmHg) and decrease in blood oxygen concentration (80-70%). Seven hours after the start of the E. coli infusion, monkey began to vomit blood and feces, and have convulsions. After final examination, the veterinarian did not give permission to let this monkey awake. At this time point, the control monkey was euthanized. Hereafter, post-mortem examination was conducted and internal organs were examined in situ. A number of internal bleedings were found by the pathologist.
Monkey 459(NMPF). Female monkey (5.44 kg) received an i.v. injection of E. coli 086 (10E10 CFU/kg). In a dose titration study with this batch performed in 1991, this bacterial dose induced lethal shock within 8 hrs after the start of the infusion. The infusion period was 2 hrs. Thirty minutes after the initiation of E. coli infusion, NMPF was i.v. injected in a single bolus injection. Baytril was administered intravenously immediately after completion of the 2 h. E. coli infusion (i.v.; dose 9 mg/kg). After the E. coli injection, this monkey was also observed by the authorized veterinarian without knowing which of the monkeys received NMPF treatment. The clinical observations were as follows: normal pulse, heart sounds normal, normal ECG, higher heart-rate but otherwise stable (180 beats per minute), no hypotension (75/30 mmHg), normal blood oxygen concentration (95-85%), lungs sound normal, normal turgor. Seven hours after the start of the E. coli infusion, the clinical condition of the monkey was stable. After final examination, the veterinarian did give permission to let this monkey awake due to her stable condition. In order to compare the hematological and immunological parameters between the control and NMPF-treated monkey, at this time point the NMPF-treated monkey 459 was euthanized. Hereafter, post-mortem examination was conducted and internal organs were examined in situ. No macroscopic internal bleedings were found by the pathologist.
Monkey 427(NMPF). Female monkey (4.84 kg) received an i.v. injection of E. coli 086 (10E10 CFU/kg). In a dose titration study with this batch performed in 1991, this bacterial dose induced lethal shock within 8 hrs after the start of the infusion. The infusion period was 2 hrs. Thirty minutes after the initiation of E. coli infusion, NMPF was i.v. injected. Baytril was administered intravenously immediately after completion of the 2 h. E. coli infusion (i.v.; dose 9 mg/kg). After the E. coli injection, this monkey was also observed by the authorized veterinarian doctor without knowing which of the monkeys received NMPF treatment. The clinical observations were as follows: normal pulse, heart sounds normal, normal ECG, moderately higher heart-rate but otherwise stable (160 beats per minute), no hypotension (70/30 mmHg), normal blood oxygen concentration (95-90%), lungs sound normal, normal turgor. Seven hours after the start of the E. coli infusion, the clinical condition of the monkey was stable. After final examination, the veterinarian did give permission to let this monkey wake up due to her stable condition. The monkey woke up quickly, she was alert and there was a slow disappearance of oedema.
Claims (1)
1. A composition comprising one or more purified or isolated peptides of the sequence AQGV (SEQ ID NO:2).
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US13/065,317 USRE43309E1 (en) | 2000-03-29 | 2011-03-17 | Immunoregulatory compositions |
Applications Claiming Priority (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP00201139 | 2000-03-29 | ||
| EP00201139A EP1138692A1 (en) | 2000-03-29 | 2000-03-29 | Fragments of human chorionic gonadotropin (hcg) as immunoregulator |
| PCT/NL2001/000259 WO2001072831A2 (en) | 2000-03-29 | 2001-03-29 | Immunoregulator |
| EP01203748A EP1300418A1 (en) | 2001-10-04 | 2001-10-04 | Gene regulation by oligopeptides |
| EP01203748 | 2001-10-04 | ||
| US10/028,075 US20030113733A1 (en) | 2001-10-04 | 2001-12-21 | Gene regulator |
| US10/262,522 US7365155B2 (en) | 2000-03-29 | 2002-09-30 | Immunoregulator |
| PCT/NL2002/000639 WO2003029292A2 (en) | 2001-10-04 | 2002-10-04 | Gene regulatory peptides |
| US10/753,510 US7358330B2 (en) | 2001-03-29 | 2004-01-07 | Immunoregulatory compositions |
| US13/065,317 USRE43309E1 (en) | 2000-03-29 | 2011-03-17 | Immunoregulatory compositions |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US10/753,510 Reissue US7358330B2 (en) | 2000-03-29 | 2004-01-07 | Immunoregulatory compositions |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| USRE43309E1 true USRE43309E1 (en) | 2012-04-10 |
Family
ID=46300652
Family Applications (4)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US10/753,510 Ceased US7358330B2 (en) | 2000-03-29 | 2004-01-07 | Immunoregulatory compositions |
| US11/859,265 Abandoned US20080076719A1 (en) | 2001-03-29 | 2007-09-21 | Immunoregulatory compositions |
| US12/069,401 Abandoned US20080306009A1 (en) | 2001-03-29 | 2008-02-08 | Immunoregulatory compositions |
| US13/065,317 Expired - Lifetime USRE43309E1 (en) | 2000-03-29 | 2011-03-17 | Immunoregulatory compositions |
Family Applications Before (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US10/753,510 Ceased US7358330B2 (en) | 2000-03-29 | 2004-01-07 | Immunoregulatory compositions |
| US11/859,265 Abandoned US20080076719A1 (en) | 2001-03-29 | 2007-09-21 | Immunoregulatory compositions |
| US12/069,401 Abandoned US20080306009A1 (en) | 2001-03-29 | 2008-02-08 | Immunoregulatory compositions |
Country Status (1)
| Country | Link |
|---|---|
| US (4) | US7358330B2 (en) |
Families Citing this family (32)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20050227925A1 (en) * | 2004-04-08 | 2005-10-13 | Robbert Benner | Compositions capable of reducing elevated blood urea concentration |
| US20040202645A1 (en) * | 2003-04-08 | 2004-10-14 | Khan Nisar Ahmed | Administration of gene-regulatory peptides |
| EP1138692A1 (en) | 2000-03-29 | 2001-10-04 | Erasmus Universiteit Rotterdam | Fragments of human chorionic gonadotropin (hcg) as immunoregulator |
| US20030220258A1 (en) * | 2001-12-21 | 2003-11-27 | Robbert Benner | Treatment of ischemic events |
| US6921751B1 (en) * | 1998-05-20 | 2005-07-26 | Erasmus Universiteit Rotterdam | Immunoregulator |
| US8680059B2 (en) * | 1998-05-20 | 2014-03-25 | Biotempt B.V. | Oligopeptide acetate and formulations thereof |
| US6844315B2 (en) | 1998-05-20 | 2005-01-18 | Erasmus Universiteit Rotterdam | Immunoregulator |
| EP1300418A1 (en) * | 2001-10-04 | 2003-04-09 | Erasmus Universiteit Rotterdam | Gene regulation by oligopeptides |
| USRE43279E1 (en) | 2000-03-29 | 2012-03-27 | Biotemp B.V. | Compositions capable of reducing elevated blood urea concentration |
| US7358330B2 (en) * | 2001-03-29 | 2008-04-15 | Biotempt B.V. | Immunoregulatory compositions |
| US20030220259A1 (en) * | 2001-12-21 | 2003-11-27 | Robbert Benner | Treatment of neurological disorders |
| US7786084B2 (en) * | 2001-12-21 | 2010-08-31 | Biotempt B.V. | Treatment of burns |
| US20080242837A1 (en) * | 2001-12-21 | 2008-10-02 | Khan Nisar A | Peptide compositions |
| US20030220261A1 (en) * | 2001-12-21 | 2003-11-27 | Khan Nisar Ahmed | Treatment of iatrogenic disease |
| US20030220260A1 (en) * | 2001-12-21 | 2003-11-27 | Khan Nisar Ahmed | Peptide compositions |
| US7501391B2 (en) * | 2001-12-21 | 2009-03-10 | Biotempt B.V. | Treatment of transplant survival |
| US20030220257A1 (en) * | 2001-12-21 | 2003-11-27 | Robbert Benner | Treatment of trauma |
| US20080318871A1 (en) * | 2001-12-21 | 2008-12-25 | Khan Nisar A | Treatment of neurological disorders |
| US7560433B2 (en) * | 2001-12-21 | 2009-07-14 | Biotempt B.V. | Treatment of multiple sclerosis (MS) |
| US20040013661A1 (en) * | 2001-12-21 | 2004-01-22 | Gert Wensvoort | Stratification |
| US20030224995A1 (en) * | 2001-12-21 | 2003-12-04 | Khan Nisar Ahmed | Treatment of burns |
| US7517529B2 (en) * | 2003-04-08 | 2009-04-14 | Biotempt B.V. | Treatment of type I diabetes |
| US20090227505A1 (en) * | 2004-01-07 | 2009-09-10 | Biotempt B.V. | Methods and uses for protein breakdown products |
| US20090191105A1 (en) * | 2004-08-30 | 2009-07-30 | Kazuhiro Tanahashi | Fractionation Apparatus |
| CA2614084A1 (en) * | 2005-07-05 | 2007-01-11 | Biotempt B.V. | Treatment of tumors |
| US8168181B2 (en) | 2006-02-13 | 2012-05-01 | Alethia Biotherapeutics, Inc. | Methods of impairing osteoclast differentiation using antibodies that bind siglec-15 |
| EP2438962A3 (en) | 2006-02-13 | 2012-07-18 | Alethia Biotherapeutics Inc. | Polynucleotides and polypeptide sequences involved in the process of bone remodeling |
| WO2007097624A1 (en) * | 2006-02-21 | 2007-08-30 | Biotempt B.V. | Pharmaceutical compositions for the treatment of influenza infections |
| EP1864692A1 (en) | 2006-06-07 | 2007-12-12 | Biotempt B.V. | Use of peptides for the control of radiation injury |
| PL2120991T3 (en) * | 2007-02-12 | 2014-07-31 | Biotempt Bv | Treatment of trauma hemorrhage with short oligopeptides |
| KR20150036274A (en) | 2012-07-19 | 2015-04-07 | 알레시아 바이오쎄라퓨틱스 인코포레이티드 | Anti-siglec-15 antibodies |
| WO2023059188A1 (en) | 2021-10-05 | 2023-04-13 | Biotempt B.V. | Angiogenic control, preferably combined with glycaemic control. |
Citations (106)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4427660A (en) | 1982-03-03 | 1984-01-24 | Research Corporation | Formyl-methionyl chemotatic peptide antibiotic conjugates useful in treating infections |
| US4571336A (en) | 1983-08-25 | 1986-02-18 | Endorphin, Inc. | Immune stimulation |
| DE3715662A1 (en) | 1986-05-12 | 1987-11-19 | Wellcome Found | NEW PHARMACEUTICAL APPLICATION |
| US4753965A (en) | 1987-04-09 | 1988-06-28 | Merrell Dow Pharmaceuticals, Inc. | Method of treating multiple sclerosis with chalcone derivatives |
| US4855285A (en) | 1985-12-04 | 1989-08-08 | The Ohio State University Research Foundation | Antigenic modification of polypeptides |
| US4977244A (en) | 1985-06-27 | 1990-12-11 | The United States Of America As Represented By The Department Of Health And Human Services | Uromodulin and a process of purifying it |
| US5002961A (en) | 1987-10-19 | 1991-03-26 | Merrell Dow Pharmaceuticals | Method for reducing injury with imidazol-2-thionecarboxamides |
| US5055447A (en) | 1988-07-28 | 1991-10-08 | Genentech, Inc. | Method and compositions for the treatment and prevention of septic shock |
| WO1992020795A1 (en) | 1991-05-17 | 1992-11-26 | Cetus Oncology Corporation | INHIBITOR OF NF-λB TRANSCRIPTIONAL ACTIVATOR AND USES THEREOF |
| US5223397A (en) | 1991-06-05 | 1993-06-29 | Sangstat Medical Corporation | Soluble hla cross-match |
| US5308834A (en) | 1989-02-14 | 1994-05-03 | Incyte Pharmaceuticals, Inc. | Treatment of endotoxin-associated shock and prevention thereof using a BPI protein |
| US5380668A (en) | 1993-07-06 | 1995-01-10 | University Of Utah Research Foundation | Compounds having the antigenicity of hCG |
| US5436270A (en) | 1993-04-07 | 1995-07-25 | National Science Council | Method for protecting against endotoxin-induced shock |
| FR2706772B1 (en) | 1993-06-22 | 1995-09-01 | Vacsyn Sa | |
| WO1996004008A1 (en) | 1994-08-05 | 1996-02-15 | The Government Of The United States Of America, Represented By The Secretary Of The Department Of Health And Human Services | Treatment of cancer with human chorionic gonadotropin |
| WO1996033218A1 (en) | 1995-04-21 | 1996-10-24 | Allelix Biopharmaceuticals Inc. | Anti-haemorrhagic peptides |
| EP0572688B1 (en) | 1992-05-30 | 1997-05-07 | Predrag Dr.Sc. Sikiric | Peptides with organo-protective activity, the process for preparing them and their use in therapy |
| JPH09176187A (en) | 1995-12-27 | 1997-07-08 | Kagaku Gijutsucho Hoshasen Igaku Sogo Kenkyusho | Histidine-containing peptide having active oxygen scavenging activity |
| US5700781A (en) | 1994-10-04 | 1997-12-23 | Harris; Pamela Jo | Method for treating Kaposi's sarcoma and HIV infections |
| WO1997049721A1 (en) | 1996-06-24 | 1997-12-31 | University Of Maryland Biotechnology Institute | Methods of treatment of wasting syndrome based on administration of derivatives of human chorionic gonadotropin |
| WO1997049418A1 (en) | 1996-06-24 | 1997-12-31 | University Of Maryland Biotechnology Institute | Methods of promoting hematopoiesis using derivatives of human chorionic gonadotropin |
| WO1997049373A3 (en) | 1996-06-24 | 1998-02-26 | Univ Maryland Biotech Inst | Treatment and prevention of hiv infection by administration of derivatives of human chorionic gonadotropin |
| WO1997049432A9 (en) | 1997-06-24 | 1998-03-19 | Treatment and prevention of cancer by administration of derivatives of human chorionic gonadotropin | |
| WO1998006742A3 (en) | 1996-08-13 | 1998-06-18 | Ronald Mathison | Peptides for treatment of inflammation and shock |
| WO1998034631A1 (en) | 1997-02-07 | 1998-08-13 | Thomas Jefferson University | Peptide mimetics of the cytokine receptor gamma chain |
| WO1998035691A1 (en) | 1997-02-15 | 1998-08-20 | Proscript, Inc. | Treatment of infarcts through inhibition of nf-kappab |
| US5801193A (en) | 1997-04-15 | 1998-09-01 | Immune Modulation, Inc. | Compositions and methods for immunosuppressing |
| US5837478A (en) * | 1993-12-23 | 1998-11-17 | Icos Corporation | Method of identifying modulators of binding between and VCAM-1 |
| US5851997A (en) | 1994-10-04 | 1998-12-22 | Harris; Pamela Jo | Use of human chorionic gonadotropin as an immune-potentiating antiviral agent |
| US5854004A (en) | 1991-11-25 | 1998-12-29 | Boehringer Ingleheim Gmbh | Process for screening substances capable of modulating a receptor-dependent cellular signal transmission path |
| US5856440A (en) * | 1988-05-10 | 1999-01-05 | Alpha-1 Biomedicals, Inc. | Solid phase process for synthesizing thymosin α1 |
| WO1999031227A3 (en) | 1997-12-12 | 1999-07-29 | Univ Western Ontario | NOVEL PEPTIDE, apoEp1.B, COMPOSITIONS AND USES THEREOF |
| US5942494A (en) | 1995-10-06 | 1999-08-24 | The Trustees Of Columbia University In The City Of New York | Stimulation of gene expression and synthesis of heat shock protein 72/73 (HSP 70) |
| US5958413A (en) | 1990-11-01 | 1999-09-28 | Celltech Limited | Use of antibodies to TNF or fragments derived thereof and xanthine derivatives for combination therapy and compositions therefor |
| US5972924A (en) | 1995-01-20 | 1999-10-26 | Maas Biolab, Llc | Treatment of cerebral ischemia and cerebral damage with neuroprotective agents |
| US5981486A (en) | 1995-04-13 | 1999-11-09 | Chugai Seiyaku Kabushiki Kaisha | Peptide suppressing IκBα phosphorylation |
| US5994126A (en) | 1992-04-01 | 1999-11-30 | The Rockefeller University | Method for in vitro proliferation of dendritic cell precursors and their use to produce immunogens |
| US5997871A (en) | 1996-06-24 | 1999-12-07 | University Of Maryland Biotechnology Insitute | Treatment and prevention of cancer by administration of derivatives of human chorionic gonadotropin |
| WO1999059617A3 (en) | 1998-05-20 | 2000-01-13 | Univ Erasmus | Immunoregulator |
| WO2000017348A1 (en) | 1998-09-17 | 2000-03-30 | Hopital Sainte-Justine | G protein-coupled receptor agonists or antagonists |
| US6051596A (en) | 1990-08-10 | 2000-04-18 | Anormed, Inc. | Immunosuppressive compositions |
| US6075150A (en) | 1998-01-26 | 2000-06-13 | Cv Therapeutics, Inc. | α-ketoamide inhibitors of 20S proteasome |
| US6150500A (en) | 1996-07-12 | 2000-11-21 | Salerno; John C. | Activators of endothelial nitric oxide synthase |
| WO2001010907A2 (en) | 1999-08-06 | 2001-02-15 | University Of Maryland Biotechnology Institute | Therapeutic polypeptides and methods for using same |
| WO2001010457A2 (en) | 1999-08-09 | 2001-02-15 | Tripep Ab | Pharmaceutical compositions containing tripeptides |
| WO2001029069A1 (en) | 1999-10-15 | 2001-04-26 | Histatek, Llc | N-formyl peptide receptor complex with a g-protein kinase signal pathway modification agent |
| WO2001029067A1 (en) | 1999-10-20 | 2001-04-26 | Sankt-Peterburgskaya Obschestvennaya Organizatsya 'institut Biroregulyatsii I Gerontologii Szo Ramn' | Tetrapeptide stimulating functional activity of neurones, pharmacological agent based thereon and method of use thereof |
| DE19953339A1 (en) | 1999-11-05 | 2001-05-17 | Goldham Pharma Gmbh | Secret fragments |
| US6235281B1 (en) | 1994-02-07 | 2001-05-22 | Knoll Aktiengesellschaft | Use of anti-TNF antibodies as drugs for the treatment of disorders with an elevated serum level of interleukin-6 |
| WO2001036454A1 (en) | 1999-11-18 | 2001-05-25 | Ceremedix, Inc. | Compositions and methods for counteracting effects of reactive oxygen species and free radicals |
| WO2001051508A1 (en) | 2000-01-14 | 2001-07-19 | Science & Technology Corporation @ Unm | Peptide inhibitors of lfa-1/icam-1 interaction |
| WO2001068113A1 (en) | 2000-03-10 | 2001-09-20 | Monsanto Technology Llc | Anti-hypertensive peptides |
| EP1138692A1 (en) | 2000-03-29 | 2001-10-04 | Erasmus Universiteit Rotterdam | Fragments of human chorionic gonadotropin (hcg) as immunoregulator |
| US6310041B1 (en) | 1999-03-09 | 2001-10-30 | Fornix Biosciences N.V. | Synthetic complementary peptides and ophthalmologic uses thereof |
| WO2001083554A2 (en) | 2000-05-02 | 2001-11-08 | Praecis Pharmaceuticals Incorporated | Anti-inflammatory compounds and uses thereof |
| US6361992B1 (en) | 1996-05-08 | 2002-03-26 | The United States Of America As Represented By The Department Of Health And Human Services | Thyroid stimulating hormone superagonists |
| US20020041871A1 (en) | 2000-06-01 | 2002-04-11 | Brudnak Mark A. | Genomeceutical and/or enzymatic composition and method for treating autism |
| US20020064501A1 (en) | 1998-05-20 | 2002-05-30 | Khan Nisar Ahmed | Immunoregulator |
| US20020147306A1 (en) | 1998-11-20 | 2002-10-10 | Danny Lin | Peptides that modulate the interaction of B class ephrins and PDZ domains |
| US20020155106A1 (en) | 2000-12-01 | 2002-10-24 | Hammond David J. | Method of identifying a ligand for a target molecule |
| WO2002085117A1 (en) | 2001-04-24 | 2002-10-31 | Eisai Co., Ltd. | Methods and compositions for preventing and treating septic shock and endotoxemia |
| US6489296B1 (en) | 1997-10-20 | 2002-12-03 | Eli Lilly And Company | Method of reducing mortality in severe sepsis |
| US6507788B1 (en) | 1999-02-25 | 2003-01-14 | Société de Conseils de Recherches et D'Applications Scientifiques (S.C.R.A.S.) | Rational selection of putative peptides from identified nucleotide, or peptide sequences, of unknown function |
| EP1300418A1 (en) | 2001-10-04 | 2003-04-09 | Erasmus Universiteit Rotterdam | Gene regulation by oligopeptides |
| US6583109B1 (en) | 1997-06-24 | 2003-06-24 | Robert C. Gallo | Therapeutic polypeptides from β-hCG and derivatives |
| US20030119720A1 (en) | 2001-03-29 | 2003-06-26 | Khan Nisar Ahmed | Oligopeptide treatment of anthrax |
| US6586403B1 (en) | 2000-07-20 | 2003-07-01 | Salpep Biotechnology, Inc. | Treating allergic reactions and inflammatory responses with tri-and dipeptides |
| US20030148955A1 (en) | 1999-04-19 | 2003-08-07 | Pluenneke John D. | Soluble tumor necrosis factor receptor treatment of medical disorders |
| US20030186244A1 (en) | 2002-03-26 | 2003-10-02 | Perlegen Sciences, Inc. | Pharmaceutical and diagnostic business systems and methods |
| US6630138B2 (en) | 2000-02-11 | 2003-10-07 | Eli Lilly And Company | Protein C derivatives |
| US6642201B1 (en) | 1998-06-23 | 2003-11-04 | Obschestvo S Ogranichennoi Otvetstven Nostiji “Klinika Instituta Bioregulyatsii Gerontologii” | Use of a dipeptide for stimulating repair processes |
| US6645934B1 (en) | 1997-08-16 | 2003-11-11 | Eberhard-Karls-Universität Tübingen | Peptide with radio protective effect |
| US20030212253A1 (en) | 2002-04-15 | 2003-11-13 | The American National Red Cross | Plasma protein-binding ligands |
| US20030215434A1 (en) | 2001-12-21 | 2003-11-20 | Khan Nisar Ahmed | Treatment of multiple sclerosis (MS) |
| US20030220257A1 (en) | 2001-12-21 | 2003-11-27 | Robbert Benner | Treatment of trauma |
| US20030219425A1 (en) | 2001-12-21 | 2003-11-27 | Khan Nisar Ahmed | Treatment of transplant survival |
| US20030220259A1 (en) | 2001-12-21 | 2003-11-27 | Robbert Benner | Treatment of neurological disorders |
| US20030220261A1 (en) | 2001-12-21 | 2003-11-27 | Khan Nisar Ahmed | Treatment of iatrogenic disease |
| US20030220258A1 (en) | 2001-12-21 | 2003-11-27 | Robbert Benner | Treatment of ischemic events |
| US20030220260A1 (en) | 2001-12-21 | 2003-11-27 | Khan Nisar Ahmed | Peptide compositions |
| US20030224995A1 (en) | 2001-12-21 | 2003-12-04 | Khan Nisar Ahmed | Treatment of burns |
| US20040013661A1 (en) | 2001-12-21 | 2004-01-22 | Gert Wensvoort | Stratification |
| US6727227B1 (en) | 1999-05-11 | 2004-04-27 | Obschestvo S Ogranichennoi Otvetstven-Nostiju “Klinika Instituta {overscore (B)}ioregulyatsii Gerontologii” | Tetrapetide revealing geroprotective effect, pharmacological substance on its basis, and the method of its application |
| US20040208885A1 (en) | 2001-03-29 | 2004-10-21 | Khan Nisar Ahmed | Immunoregulatoratory compositions |
| US6831057B2 (en) | 1997-10-28 | 2004-12-14 | The University Of North Carolina At Chapel Hill | Use of NF-κB inhibition in combination therapy for cancer |
| US20050037430A1 (en) | 2000-03-29 | 2005-02-17 | Biotempt B.V. | Methods and uses for protein breakdown products |
| US6894028B2 (en) | 2001-04-06 | 2005-05-17 | Zengen, Inc. | Use of KPV tripeptide for dermatological disorders |
| US20050107314A1 (en) | 2001-05-24 | 2005-05-19 | Gorczynski Reginald M. | Modulation of cd200 receptors |
| US6921751B1 (en) | 1998-05-20 | 2005-07-26 | Erasmus Universiteit Rotterdam | Immunoregulator |
| US20050227925A1 (en) | 2004-04-08 | 2005-10-13 | Robbert Benner | Compositions capable of reducing elevated blood urea concentration |
| US20060111292A1 (en) | 2003-04-08 | 2006-05-25 | Biotempt, B.V. | Compositions for mucosal and oral administration comprising HCG fragments |
| US20060173162A1 (en) | 2002-08-15 | 2006-08-03 | Rene Djurup | Bactericidak anti-apoptotic, pro-inflammatory and anti-inflammatory peptides of heparin-binding protein (hbp) |
| US20070111948A1 (en) | 2003-09-04 | 2007-05-17 | Azim Turdiev | Agent derived from tortoise spleen stimulating mammalian hemopoiesis |
| US20070197447A1 (en) | 1998-05-20 | 2007-08-23 | Khan Nisar A | Oligopeptide acetate and formulations thereof |
| US20070219138A1 (en) | 2000-03-29 | 2007-09-20 | Biotempt B.V. | Compositions capable of reducing elevated blood urea concentration |
| US7316819B2 (en) | 2001-03-08 | 2008-01-08 | Unigene Laboratories, Inc. | Oral peptide pharmaceutical dosage form and method of production |
| US20080027007A1 (en) | 2006-03-07 | 2008-01-31 | Robbert Benner | Control of radiation injury |
| US20080076714A1 (en) | 2003-04-08 | 2008-03-27 | Biotempt B.V. | Administration of gene-regulatory peptides |
| US20080153755A1 (en) | 2005-07-05 | 2008-06-26 | Biotempt B.V. | Treatment of tumors |
| US20080171094A1 (en) | 2001-12-21 | 2008-07-17 | Robbert Benner | Treatment of burns |
| US20080194489A1 (en) | 2001-12-21 | 2008-08-14 | Khan Nisar A | Treatment of iatrogenic disease |
| US20080242618A1 (en) | 2001-12-21 | 2008-10-02 | Khan Nisar A | Stratification |
| US20080242837A1 (en) | 2001-12-21 | 2008-10-02 | Khan Nisar A | Peptide compositions |
| US20080267936A1 (en) | 2007-02-12 | 2008-10-30 | Biotempt B.V. | Treatment of trauma-hemorrhage with short oligopeptides |
| US20090042807A1 (en) | 1998-05-20 | 2009-02-12 | Nisar Ahmed Khan | Oligopeptide treatment of ischemia reperfusion injury |
| US20090227505A1 (en) | 2004-01-07 | 2009-09-10 | Biotempt B.V. | Methods and uses for protein breakdown products |
Family Cites Families (34)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3855397A (en) * | 1973-04-12 | 1974-12-17 | Allied Chem | Method of producing sodium carbonate and bicarbonate spherules from brine |
| US3898328A (en) * | 1973-12-03 | 1975-08-05 | Syntex Inc | Dry stable composition for the treatment of scours and dehydration |
| DE2360794C2 (en) * | 1973-12-06 | 1984-12-06 | Hoechst Ag, 6230 Frankfurt | Process for the production of peptides |
| IL44774A (en) * | 1974-05-06 | 1977-07-31 | Baron E | Pharmaceutical composition containing acetyl salicyclic acid |
| GB1518364A (en) * | 1976-05-05 | 1978-07-19 | Beecham Group Ltd | Pharmaceutical composition |
| GB1524740A (en) * | 1976-11-09 | 1978-09-13 | Reckitt & Colmann Prod Ltd | Pharmaceutical compositions for use in the suppression of gastric reflux |
| US4108846A (en) * | 1977-02-01 | 1978-08-22 | Hoffmann-La Roche Inc. | Solid phase synthesis with base N alpha-protecting group cleavage |
| US4289750A (en) * | 1978-10-16 | 1981-09-15 | Kopp Klaus F | Therapy of conditions which may be associated with altered renal function and dosage forms therefor |
| US4265874A (en) * | 1980-04-25 | 1981-05-05 | Alza Corporation | Method of delivering drug with aid of effervescent activity generated in environment of use |
| JPS5822474B2 (en) * | 1980-06-10 | 1983-05-09 | 天野製薬株式会社 | Method for producing cholecystokinin pancreozymin C-terminal peptide amide sulfate ester |
| US4351762A (en) * | 1981-03-10 | 1982-09-28 | Bioresearch, Inc. | Rapid, quantitative peptide synthesis using mixed anhydrides |
| US5137669A (en) * | 1988-03-02 | 1992-08-11 | Endocon, Inc. | Manufacture of partially fused peptide pellet |
| US5175254A (en) * | 1988-09-24 | 1992-12-29 | Societe D'expansion Scientifque Expansia | Solid phase peptide synthesis using a polyacrylic support in aqueous solution |
| PH30995A (en) * | 1989-07-07 | 1997-12-23 | Novartis Inc | Sustained release formulations of water soluble peptides. |
| US5070187A (en) * | 1989-11-03 | 1991-12-03 | Trustees Of Boston University | Pharmacologically effective antagonists of arginine-vasopressin |
| CA2050425A1 (en) * | 1990-09-03 | 1992-03-04 | Yoshiaki Uda | Pharmaceutical composition and its mucous use |
| US5200507A (en) * | 1991-04-12 | 1993-04-06 | Mallinckrodt Specialty Chemicals Company | Method of separating a peptide from a resin |
| TW333456B (en) * | 1992-12-07 | 1998-06-11 | Takeda Pharm Ind Co Ltd | A pharmaceutical composition of sustained-release preparation the invention relates to a pharmaceutical composition of sustained-release preparation which comprises a physiologically active peptide. |
| ES2255477T5 (en) * | 1993-07-29 | 2010-04-08 | The United States Of America, Represented By The Secretary, Department Of Health And Human Services | USE OF PACLITAXEL AND ITS DERIVATIVES IN THE MANUFACTURE OF A MEDICINAL PRODUCT FOR THE RESTREATMENT TREATMENT. |
| US5594091A (en) * | 1994-02-21 | 1997-01-14 | Takeda Chemical Industries, Ltd. | Matrix for sustained-release preparation |
| US5595760A (en) * | 1994-09-02 | 1997-01-21 | Delab | Sustained release of peptides from pharmaceutical compositions |
| GB2293100A (en) * | 1994-09-15 | 1996-03-20 | Medeva Europ Ltd | Pharmaceutical compositions with deuterium oxide |
| US5688489A (en) * | 1995-09-15 | 1997-11-18 | Resolution Pharmaceuticals, Inc. | Non-receptor mediated imaging agents |
| CA2180786C (en) * | 1996-07-02 | 2008-05-27 | David Lightfoot | Plants containing the gdha gene and methods of use thereof |
| GB9624927D0 (en) * | 1996-11-29 | 1997-01-15 | Oxford Glycosciences Uk Ltd | Gels and their use |
| US5966712A (en) * | 1996-12-12 | 1999-10-12 | Incyte Pharmaceuticals, Inc. | Database and system for storing, comparing and displaying genomic information |
| US6416959B1 (en) * | 1997-02-27 | 2002-07-09 | Kenneth Giuliano | System for cell-based screening |
| US6379970B1 (en) * | 1999-04-30 | 2002-04-30 | The Arizona Board Of Regents On Behalf Of The University Of Arizona | Analysis of differential protein expression |
| US6539102B1 (en) * | 2000-09-01 | 2003-03-25 | Large Scale Proteomics | Reference database |
| EP1217540A1 (en) * | 2000-11-29 | 2002-06-26 | Lafayette Software Inc. | Methods of organizing data and processing queries in a database system, and database system and software product for implementing such method |
| US7098305B2 (en) * | 2001-09-06 | 2006-08-29 | Ardana Bioscience Limited | Sustained release of microcrystalline peptide suspensions |
| US7432245B2 (en) * | 2002-06-07 | 2008-10-07 | Abbott Laboratories Inc. | Pharmaceutical formulation comprising a peptide angiogenesis inhibitor |
| DE602004032457D1 (en) * | 2003-11-07 | 2011-06-09 | Novartis Ag | NTEN |
| EP2109054A1 (en) * | 2008-04-09 | 2009-10-14 | Biotempt B.V. | Methods for identifying biologically active peptides and predicting their function |
-
2004
- 2004-01-07 US US10/753,510 patent/US7358330B2/en not_active Ceased
-
2007
- 2007-09-21 US US11/859,265 patent/US20080076719A1/en not_active Abandoned
-
2008
- 2008-02-08 US US12/069,401 patent/US20080306009A1/en not_active Abandoned
-
2011
- 2011-03-17 US US13/065,317 patent/USRE43309E1/en not_active Expired - Lifetime
Patent Citations (146)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4427660A (en) | 1982-03-03 | 1984-01-24 | Research Corporation | Formyl-methionyl chemotatic peptide antibiotic conjugates useful in treating infections |
| US4571336A (en) | 1983-08-25 | 1986-02-18 | Endorphin, Inc. | Immune stimulation |
| US4977244A (en) | 1985-06-27 | 1990-12-11 | The United States Of America As Represented By The Department Of Health And Human Services | Uromodulin and a process of purifying it |
| US4855285A (en) | 1985-12-04 | 1989-08-08 | The Ohio State University Research Foundation | Antigenic modification of polypeptides |
| DE3715662A1 (en) | 1986-05-12 | 1987-11-19 | Wellcome Found | NEW PHARMACEUTICAL APPLICATION |
| GB2194886A (en) | 1986-05-12 | 1988-03-23 | Wellcome Found | Medicaments containing tissue plasminogen activator |
| US4753965A (en) | 1987-04-09 | 1988-06-28 | Merrell Dow Pharmaceuticals, Inc. | Method of treating multiple sclerosis with chalcone derivatives |
| US5002961A (en) | 1987-10-19 | 1991-03-26 | Merrell Dow Pharmaceuticals | Method for reducing injury with imidazol-2-thionecarboxamides |
| US5856440A (en) * | 1988-05-10 | 1999-01-05 | Alpha-1 Biomedicals, Inc. | Solid phase process for synthesizing thymosin α1 |
| US5055447A (en) | 1988-07-28 | 1991-10-08 | Genentech, Inc. | Method and compositions for the treatment and prevention of septic shock |
| US5308834A (en) | 1989-02-14 | 1994-05-03 | Incyte Pharmaceuticals, Inc. | Treatment of endotoxin-associated shock and prevention thereof using a BPI protein |
| US6051596A (en) | 1990-08-10 | 2000-04-18 | Anormed, Inc. | Immunosuppressive compositions |
| US5958413A (en) | 1990-11-01 | 1999-09-28 | Celltech Limited | Use of antibodies to TNF or fragments derived thereof and xanthine derivatives for combination therapy and compositions therefor |
| WO1992020795A1 (en) | 1991-05-17 | 1992-11-26 | Cetus Oncology Corporation | INHIBITOR OF NF-λB TRANSCRIPTIONAL ACTIVATOR AND USES THEREOF |
| US5223397A (en) | 1991-06-05 | 1993-06-29 | Sangstat Medical Corporation | Soluble hla cross-match |
| US5854004A (en) | 1991-11-25 | 1998-12-29 | Boehringer Ingleheim Gmbh | Process for screening substances capable of modulating a receptor-dependent cellular signal transmission path |
| US5994126A (en) | 1992-04-01 | 1999-11-30 | The Rockefeller University | Method for in vitro proliferation of dendritic cell precursors and their use to produce immunogens |
| US6211151B1 (en) | 1992-05-30 | 2001-04-03 | Predrag Sikiric | Peptides with organo-protective activity, a process for preparation thereof and their use in therapy |
| EP0572688B1 (en) | 1992-05-30 | 1997-05-07 | Predrag Dr.Sc. Sikiric | Peptides with organo-protective activity, the process for preparing them and their use in therapy |
| US5436270A (en) | 1993-04-07 | 1995-07-25 | National Science Council | Method for protecting against endotoxin-induced shock |
| FR2706772B1 (en) | 1993-06-22 | 1995-09-01 | Vacsyn Sa | |
| US5380668A (en) | 1993-07-06 | 1995-01-10 | University Of Utah Research Foundation | Compounds having the antigenicity of hCG |
| US5837478A (en) * | 1993-12-23 | 1998-11-17 | Icos Corporation | Method of identifying modulators of binding between and VCAM-1 |
| US6235281B1 (en) | 1994-02-07 | 2001-05-22 | Knoll Aktiengesellschaft | Use of anti-TNF antibodies as drugs for the treatment of disorders with an elevated serum level of interleukin-6 |
| US5677275A (en) | 1994-08-05 | 1997-10-14 | The United States Of America As Represented By The Department Of Health And Human Services | Treatment of cancer with human chorionic gonadotropin |
| WO1996004008A1 (en) | 1994-08-05 | 1996-02-15 | The Government Of The United States Of America, Represented By The Secretary Of The Department Of Health And Human Services | Treatment of cancer with human chorionic gonadotropin |
| US5877148A (en) | 1994-08-05 | 1999-03-02 | The United States Of America As Represented By The Department Of Health And Human Services | Treatment of cancer with human chorionic gonadotropin |
| US5700781A (en) | 1994-10-04 | 1997-12-23 | Harris; Pamela Jo | Method for treating Kaposi's sarcoma and HIV infections |
| US5851997A (en) | 1994-10-04 | 1998-12-22 | Harris; Pamela Jo | Use of human chorionic gonadotropin as an immune-potentiating antiviral agent |
| US5972924A (en) | 1995-01-20 | 1999-10-26 | Maas Biolab, Llc | Treatment of cerebral ischemia and cerebral damage with neuroprotective agents |
| US5981486A (en) | 1995-04-13 | 1999-11-09 | Chugai Seiyaku Kabushiki Kaisha | Peptide suppressing IκBα phosphorylation |
| WO1996033218A1 (en) | 1995-04-21 | 1996-10-24 | Allelix Biopharmaceuticals Inc. | Anti-haemorrhagic peptides |
| US5942494A (en) | 1995-10-06 | 1999-08-24 | The Trustees Of Columbia University In The City Of New York | Stimulation of gene expression and synthesis of heat shock protein 72/73 (HSP 70) |
| JPH09176187A (en) | 1995-12-27 | 1997-07-08 | Kagaku Gijutsucho Hoshasen Igaku Sogo Kenkyusho | Histidine-containing peptide having active oxygen scavenging activity |
| US6361992B1 (en) | 1996-05-08 | 2002-03-26 | The United States Of America As Represented By The Department Of Health And Human Services | Thyroid stimulating hormone superagonists |
| US6319504B1 (en) | 1996-06-24 | 2001-11-20 | University Of Maryland Biotechnology Institute | Treatment and prevention of HIV infection by administration of derivatives of human chorionic gonadotropin |
| WO1997049418A1 (en) | 1996-06-24 | 1997-12-31 | University Of Maryland Biotechnology Institute | Methods of promoting hematopoiesis using derivatives of human chorionic gonadotropin |
| US5968513A (en) | 1996-06-24 | 1999-10-19 | University Of Maryland Biotechnology Institute | Method of promoting hematopoiesis using derivatives of human chorionic gonadotropin |
| US20030049273A1 (en) | 1996-06-24 | 2003-03-13 | Gallo Robert C. | Treatment and prevention of HIV infection by administration of derivatives of human chorionic gonadotropin |
| WO1997049721A1 (en) | 1996-06-24 | 1997-12-31 | University Of Maryland Biotechnology Institute | Methods of treatment of wasting syndrome based on administration of derivatives of human chorionic gonadotropin |
| WO1997049373A3 (en) | 1996-06-24 | 1998-02-26 | Univ Maryland Biotech Inst | Treatment and prevention of hiv infection by administration of derivatives of human chorionic gonadotropin |
| US5997871A (en) | 1996-06-24 | 1999-12-07 | University Of Maryland Biotechnology Insitute | Treatment and prevention of cancer by administration of derivatives of human chorionic gonadotropin |
| US6699656B2 (en) | 1996-06-24 | 2004-03-02 | University Of Maryland Biotechnology Institute | Treatment and prevention of HIV infection by administration of derivatives of human chorionic gonadotropin |
| US6150500A (en) | 1996-07-12 | 2000-11-21 | Salerno; John C. | Activators of endothelial nitric oxide synthase |
| US7094760B2 (en) | 1996-08-13 | 2006-08-22 | Salpep Biotechnology, Inc. | Peptides for treatment of inflammation and shock |
| WO1998006742A3 (en) | 1996-08-13 | 1998-06-18 | Ronald Mathison | Peptides for treatment of inflammation and shock |
| WO1998034631A1 (en) | 1997-02-07 | 1998-08-13 | Thomas Jefferson University | Peptide mimetics of the cytokine receptor gamma chain |
| WO1998035691A1 (en) | 1997-02-15 | 1998-08-20 | Proscript, Inc. | Treatment of infarcts through inhibition of nf-kappab |
| US5801193A (en) | 1997-04-15 | 1998-09-01 | Immune Modulation, Inc. | Compositions and methods for immunosuppressing |
| US6583109B1 (en) | 1997-06-24 | 2003-06-24 | Robert C. Gallo | Therapeutic polypeptides from β-hCG and derivatives |
| US6620416B1 (en) | 1997-06-24 | 2003-09-16 | University Of Maryland Biotechnology Institute | Method for treating HIV |
| WO1997049432A9 (en) | 1997-06-24 | 1998-03-19 | Treatment and prevention of cancer by administration of derivatives of human chorionic gonadotropin | |
| US6596688B1 (en) | 1997-06-24 | 2003-07-22 | University Of Maryland Biotechnology Institute | Method for promoting hematopoiesis |
| US6645934B1 (en) | 1997-08-16 | 2003-11-11 | Eberhard-Karls-Universität Tübingen | Peptide with radio protective effect |
| US6489296B1 (en) | 1997-10-20 | 2002-12-03 | Eli Lilly And Company | Method of reducing mortality in severe sepsis |
| US6831057B2 (en) | 1997-10-28 | 2004-12-14 | The University Of North Carolina At Chapel Hill | Use of NF-κB inhibition in combination therapy for cancer |
| WO1999031227A3 (en) | 1997-12-12 | 1999-07-29 | Univ Western Ontario | NOVEL PEPTIDE, apoEp1.B, COMPOSITIONS AND USES THEREOF |
| US6652860B1 (en) | 1997-12-12 | 2003-11-25 | University Of Western Ontario | Peptide, apoEp 1.B, compositions and uses thereof |
| US6075150A (en) | 1998-01-26 | 2000-06-13 | Cv Therapeutics, Inc. | α-ketoamide inhibitors of 20S proteasome |
| US20090042807A1 (en) | 1998-05-20 | 2009-02-12 | Nisar Ahmed Khan | Oligopeptide treatment of ischemia reperfusion injury |
| WO1999059617A3 (en) | 1998-05-20 | 2000-01-13 | Univ Erasmus | Immunoregulator |
| US6921751B1 (en) | 1998-05-20 | 2005-07-26 | Erasmus Universiteit Rotterdam | Immunoregulator |
| US20050119184A1 (en) | 1998-05-20 | 2005-06-02 | Khan Nisar A. | Immunoregulator |
| US20070197447A1 (en) | 1998-05-20 | 2007-08-23 | Khan Nisar A | Oligopeptide acetate and formulations thereof |
| US7820617B2 (en) | 1998-05-20 | 2010-10-26 | Biotempt B.V. | Methods of selecting immunoregulator peptides obtained from gonadotropins |
| US20020064501A1 (en) | 1998-05-20 | 2002-05-30 | Khan Nisar Ahmed | Immunoregulator |
| US6844315B2 (en) | 1998-05-20 | 2005-01-18 | Erasmus Universiteit Rotterdam | Immunoregulator |
| US7402322B2 (en) | 1998-05-20 | 2008-07-22 | Biotempt B.V. | Methods of treatment for septic shock with urine extract |
| US6642201B1 (en) | 1998-06-23 | 2003-11-04 | Obschestvo S Ogranichennoi Otvetstven Nostiji “Klinika Instituta Bioregulyatsii Gerontologii” | Use of a dipeptide for stimulating repair processes |
| WO2000017348A1 (en) | 1998-09-17 | 2000-03-30 | Hopital Sainte-Justine | G protein-coupled receptor agonists or antagonists |
| US20020147306A1 (en) | 1998-11-20 | 2002-10-10 | Danny Lin | Peptides that modulate the interaction of B class ephrins and PDZ domains |
| US6507788B1 (en) | 1999-02-25 | 2003-01-14 | Société de Conseils de Recherches et D'Applications Scientifiques (S.C.R.A.S.) | Rational selection of putative peptides from identified nucleotide, or peptide sequences, of unknown function |
| US6310041B1 (en) | 1999-03-09 | 2001-10-30 | Fornix Biosciences N.V. | Synthetic complementary peptides and ophthalmologic uses thereof |
| US20030148955A1 (en) | 1999-04-19 | 2003-08-07 | Pluenneke John D. | Soluble tumor necrosis factor receptor treatment of medical disorders |
| US6727227B1 (en) | 1999-05-11 | 2004-04-27 | Obschestvo S Ogranichennoi Otvetstven-Nostiju “Klinika Instituta {overscore (B)}ioregulyatsii Gerontologii” | Tetrapetide revealing geroprotective effect, pharmacological substance on its basis, and the method of its application |
| WO2001011048A2 (en) | 1999-08-06 | 2001-02-15 | University Of Maryland Biotechnology Institute | Therapeutic polypeptides and methods for using same |
| WO2001010907A2 (en) | 1999-08-06 | 2001-02-15 | University Of Maryland Biotechnology Institute | Therapeutic polypeptides and methods for using same |
| WO2001010457A2 (en) | 1999-08-09 | 2001-02-15 | Tripep Ab | Pharmaceutical compositions containing tripeptides |
| WO2001029069A1 (en) | 1999-10-15 | 2001-04-26 | Histatek, Llc | N-formyl peptide receptor complex with a g-protein kinase signal pathway modification agent |
| WO2001029067A1 (en) | 1999-10-20 | 2001-04-26 | Sankt-Peterburgskaya Obschestvennaya Organizatsya 'institut Biroregulyatsii I Gerontologii Szo Ramn' | Tetrapeptide stimulating functional activity of neurones, pharmacological agent based thereon and method of use thereof |
| EP1224212B1 (en) | 1999-10-20 | 2003-07-09 | Sankt-Peterburgskaya Obschestvennaya Organizatsya "Institut Biroregulyatsii i Gerontologii szo Ramn" | Tetrapeptide stimulating functional activity of neurones, pharmacological agent based thereon and method of use thereof |
| DE19953339A1 (en) | 1999-11-05 | 2001-05-17 | Goldham Pharma Gmbh | Secret fragments |
| WO2001036454A1 (en) | 1999-11-18 | 2001-05-25 | Ceremedix, Inc. | Compositions and methods for counteracting effects of reactive oxygen species and free radicals |
| WO2001051508A1 (en) | 2000-01-14 | 2001-07-19 | Science & Technology Corporation @ Unm | Peptide inhibitors of lfa-1/icam-1 interaction |
| US6630138B2 (en) | 2000-02-11 | 2003-10-07 | Eli Lilly And Company | Protein C derivatives |
| WO2001068113A1 (en) | 2000-03-10 | 2001-09-20 | Monsanto Technology Llc | Anti-hypertensive peptides |
| US20070219138A1 (en) | 2000-03-29 | 2007-09-20 | Biotempt B.V. | Compositions capable of reducing elevated blood urea concentration |
| US20050037430A1 (en) | 2000-03-29 | 2005-02-17 | Biotempt B.V. | Methods and uses for protein breakdown products |
| WO2001072831A3 (en) | 2000-03-29 | 2002-04-25 | Univ Erasmus | Immunoregulator |
| US7365155B2 (en) | 2000-03-29 | 2008-04-29 | Biotempt B.V. | Immunoregulator |
| US20030166556A1 (en) | 2000-03-29 | 2003-09-04 | Khan Nisar Ahmed | Immunoregulator |
| US7576174B2 (en) | 2000-03-29 | 2009-08-18 | Biotempt B.V. | Compositions capable of reducing elevated blood urea concentration |
| EP1138692A1 (en) | 2000-03-29 | 2001-10-04 | Erasmus Universiteit Rotterdam | Fragments of human chorionic gonadotropin (hcg) as immunoregulator |
| WO2001083554A2 (en) | 2000-05-02 | 2001-11-08 | Praecis Pharmaceuticals Incorporated | Anti-inflammatory compounds and uses thereof |
| US20020041871A1 (en) | 2000-06-01 | 2002-04-11 | Brudnak Mark A. | Genomeceutical and/or enzymatic composition and method for treating autism |
| US6586403B1 (en) | 2000-07-20 | 2003-07-01 | Salpep Biotechnology, Inc. | Treating allergic reactions and inflammatory responses with tri-and dipeptides |
| US20020155106A1 (en) | 2000-12-01 | 2002-10-24 | Hammond David J. | Method of identifying a ligand for a target molecule |
| US7316819B2 (en) | 2001-03-08 | 2008-01-08 | Unigene Laboratories, Inc. | Oral peptide pharmaceutical dosage form and method of production |
| US7175679B2 (en) | 2001-03-29 | 2007-02-13 | Biotempt B.V. | Oligopeptide treatment of NF-κB mediated inflammation |
| US20030119720A1 (en) | 2001-03-29 | 2003-06-26 | Khan Nisar Ahmed | Oligopeptide treatment of anthrax |
| US20080306009A1 (en) | 2001-03-29 | 2008-12-11 | Biotempt B.V. | Immunoregulatory compositions |
| US20040208885A1 (en) | 2001-03-29 | 2004-10-21 | Khan Nisar Ahmed | Immunoregulatoratory compositions |
| US6894028B2 (en) | 2001-04-06 | 2005-05-17 | Zengen, Inc. | Use of KPV tripeptide for dermatological disorders |
| WO2002085117A1 (en) | 2001-04-24 | 2002-10-31 | Eisai Co., Ltd. | Methods and compositions for preventing and treating septic shock and endotoxemia |
| US20050107314A1 (en) | 2001-05-24 | 2005-05-19 | Gorczynski Reginald M. | Modulation of cd200 receptors |
| EP1300418A1 (en) | 2001-10-04 | 2003-04-09 | Erasmus Universiteit Rotterdam | Gene regulation by oligopeptides |
| US20080176243A1 (en) | 2001-10-04 | 2008-07-24 | Biotempt. B.V. | Gene regulator |
| WO2003029292A2 (en) | 2001-10-04 | 2003-04-10 | Erasmus Universiteit Rotterdam | Gene regulatory peptides |
| US20050214943A1 (en) | 2001-10-04 | 2005-09-29 | Khan Nisar A | Gene regulatory peptides |
| US20030113733A1 (en) | 2001-10-04 | 2003-06-19 | Khan Nisar Asmed | Gene regulator |
| US7524820B1 (en) | 2001-10-04 | 2009-04-28 | Biotempt B.V. | Compounds of therapeutic value in the treatment of multiple sclerosis and other diseases wherein foamy cells are involved in the disease etiology |
| US7560433B2 (en) | 2001-12-21 | 2009-07-14 | Biotempt B.V. | Treatment of multiple sclerosis (MS) |
| US20040013661A1 (en) | 2001-12-21 | 2004-01-22 | Gert Wensvoort | Stratification |
| US20030220260A1 (en) | 2001-12-21 | 2003-11-27 | Khan Nisar Ahmed | Peptide compositions |
| US20030220258A1 (en) | 2001-12-21 | 2003-11-27 | Robbert Benner | Treatment of ischemic events |
| US20070054860A1 (en) | 2001-12-21 | 2007-03-08 | Biotempt B.V. | Treatment of ischemic events |
| US20030224995A1 (en) | 2001-12-21 | 2003-12-04 | Khan Nisar Ahmed | Treatment of burns |
| US20030220261A1 (en) | 2001-12-21 | 2003-11-27 | Khan Nisar Ahmed | Treatment of iatrogenic disease |
| US20030220259A1 (en) | 2001-12-21 | 2003-11-27 | Robbert Benner | Treatment of neurological disorders |
| US20030219425A1 (en) | 2001-12-21 | 2003-11-27 | Khan Nisar Ahmed | Treatment of transplant survival |
| US7786084B2 (en) | 2001-12-21 | 2010-08-31 | Biotempt B.V. | Treatment of burns |
| US7501391B2 (en) | 2001-12-21 | 2009-03-10 | Biotempt B.V. | Treatment of transplant survival |
| US20030220257A1 (en) | 2001-12-21 | 2003-11-27 | Robbert Benner | Treatment of trauma |
| US20080242837A1 (en) | 2001-12-21 | 2008-10-02 | Khan Nisar A | Peptide compositions |
| US20080171094A1 (en) | 2001-12-21 | 2008-07-17 | Robbert Benner | Treatment of burns |
| US20030215434A1 (en) | 2001-12-21 | 2003-11-20 | Khan Nisar Ahmed | Treatment of multiple sclerosis (MS) |
| US20080242618A1 (en) | 2001-12-21 | 2008-10-02 | Khan Nisar A | Stratification |
| US20080194489A1 (en) | 2001-12-21 | 2008-08-14 | Khan Nisar A | Treatment of iatrogenic disease |
| US20030186244A1 (en) | 2002-03-26 | 2003-10-02 | Perlegen Sciences, Inc. | Pharmaceutical and diagnostic business systems and methods |
| US20030212253A1 (en) | 2002-04-15 | 2003-11-13 | The American National Red Cross | Plasma protein-binding ligands |
| US20060173162A1 (en) | 2002-08-15 | 2006-08-03 | Rene Djurup | Bactericidak anti-apoptotic, pro-inflammatory and anti-inflammatory peptides of heparin-binding protein (hbp) |
| US20080076714A1 (en) | 2003-04-08 | 2008-03-27 | Biotempt B.V. | Administration of gene-regulatory peptides |
| US7517529B2 (en) | 2003-04-08 | 2009-04-14 | Biotempt B.V. | Treatment of type I diabetes |
| US20060111292A1 (en) | 2003-04-08 | 2006-05-25 | Biotempt, B.V. | Compositions for mucosal and oral administration comprising HCG fragments |
| US20100004172A1 (en) | 2003-04-08 | 2010-01-07 | Khan Nisar A | Compositions for mucosal and oral administration comprising hcg fragments |
| US20070111948A1 (en) | 2003-09-04 | 2007-05-17 | Azim Turdiev | Agent derived from tortoise spleen stimulating mammalian hemopoiesis |
| US20090227505A1 (en) | 2004-01-07 | 2009-09-10 | Biotempt B.V. | Methods and uses for protein breakdown products |
| US20050227925A1 (en) | 2004-04-08 | 2005-10-13 | Robbert Benner | Compositions capable of reducing elevated blood urea concentration |
| US20060142205A1 (en) | 2004-04-08 | 2006-06-29 | Robbert Benner | Compositions capable of reducing elevated blood urea concentration |
| US7662776B2 (en) | 2005-07-05 | 2010-02-16 | Biotempt B.V. | Treatment of tumors using short peptides from human chorionic gonadotropin (HCG) |
| US20080153755A1 (en) | 2005-07-05 | 2008-06-26 | Biotempt B.V. | Treatment of tumors |
| US20090281033A1 (en) | 2006-03-07 | 2009-11-12 | Biotempt B.V. | Control of radiation injury |
| US20090291901A1 (en) | 2006-03-07 | 2009-11-26 | Biotempt B.V. | Control of radiation injury |
| US20080027007A1 (en) | 2006-03-07 | 2008-01-31 | Robbert Benner | Control of radiation injury |
| US7795226B2 (en) | 2006-03-07 | 2010-09-14 | Biotempt B.V. | Control of radiation injury |
| US20080267936A1 (en) | 2007-02-12 | 2008-10-30 | Biotempt B.V. | Treatment of trauma-hemorrhage with short oligopeptides |
Non-Patent Citations (101)
| Title |
|---|
| Abeyama et al., A role of NF-kappaB-dependent gene transactivation in sunburn. The Journal of Clinical Investigation, vol. 105, No. 12, pp. 1751-1759, Jun. 2000. |
| Abraham, E., "Coagulation Abnormalities in Acute Lung Injury and Sepsis," Am. J. Respir. Cell Mol. Biol., 2000, pp. 401-404, vol. 22. |
| Adib-Conquy et al., "NF-kappaB Expression in Mononuclear Cells in Patients with Sepsis Reseambles That Observed in Lipopolysaccharide Tolerance," Am. J. Respir. Crit. Care Med., 2000, pp. 1877-1883, vol. 162. |
| Albini, A., et al., "Old drugs as novel angiogenesis inhibitors: Preclinical studies with NAC, hCG, EGCG and somatostatin," 17 Clinical & Experimental Metastasis 739 (1999). |
| Arima et al., "IL-2-Induced Growth of CD8= T Cell Prolymphocytic Leukemia Cells Mediated by NF-kappaB Induction and IL-2 Receptor alpha Expression," Leukemia Research, 1998, pp. 265-273, vol. 22, No. 3. |
| Babu, V. V. Suresh (Synthetic Communications 29 (1)m 79-91, 1999. |
| Baeuerle et al., "Function and Activation of NF-kappaB in the Immune System," Annu. Rev. Immunol., 1994, pp. 141-179, vol. 12. |
| Bethea et al., "Traumatic Spinal Cord Injury Induces Nuclear Factor-kappaB Activation," The Journal of Neuroscience, May 1, 1998, pp. 3251-3260, vol. 18, No. 9. |
| Blackwell, Timothy S., et al., "The Role of Nuclear Factor-kB in Cytokine Gene Regulation," 17 Am. J. Respir. Cell Mol. Biol. 3-9 (1997). |
| Bodfish et al., "Treating the Core Features of Autism: Are We There Yet?" Mental Retardation and Developmental Disabilities Research Reviews, 2004, pp. 318-326, vol. 10. |
| Brown et al., "Two Forms of NF-kappaB1 (p105/p50) in Murine Macrophages: Differential Regulation by Lipopolysaccaride, Interleukin-2, and Interferon-gamma," Journal of Interferon and Cytokine Research, 1997, pp. 295-306, vol. 17. |
| Capizzi, Investigational New Drugs, 1996, 14:249-256. |
| Christman et al., Nuclear factor kappaB: a pivotal role in the systemic inflammatory response syndrome and new target for therapy, Intens Care Med, 1998, pp. 1131-1138, vol. 24. |
| Connelly et al., Biphasic Regulation of NF-kB activity Underlies the Pro- and Anti-Inflammatory Actions of Nitric Oxide. The Journal of Immunology, 2001, pp. 3873-3881, 166, The Americal Association of Immunologists, USA. |
| Cook et al., Modified total lymphoid irradiation and low does coricosteroids in progressive multiple sclerosis. Journal of Neurological Sciences, vol. 152, pp. 172-181, 1997. |
| Cui et al., Am. J. Physiol. Integr. Comp. Physiol., 2004, pp. R699-R709, vol. 286. |
| Dwinnell et al., Atlas of Diseases of the Kidney, Blackwell Sciences, 1999, pp. 12.1-12.12, Ch. 12. |
| Emmel et al., "Cyclosporin A Specifically Inhibits Function of Nuclear Proteins Involved in T Cell Activation," Science, Dec. 22, 1989, pp. 1617-1620. |
| Epinat et al., "Diverse agents act at multiple levels to inhibit the Rel/NF-kappaB signal transduction pathway," Oncogene, 1999, pp. 6896-6909, vol. 18. |
| Faust et al., "Disseminated intravascular coagulation and purpura fulminans secondary to infection," Bailliere's Clinical Haematology, 2000, 179-197, vol. 13, No. 2. |
| Flores et al., NFkappaB and AP-1 DNA binding activity in patients with multiple sclerosis. J. Neuroimmunol. vol. 135, No. 1-2, pp. 141-147, Feb. 2003. |
| Friedlander, Tackling anthrax, Nature, Nov. 8, 2001, pp. 160-161, vol. 414. |
| Gould, Salt selection for basic drugs, Int. J. Pharm., 1986, pp. 201-217, vol. 33. |
| International Search Report, International Application No. PCT/NL02/00639, mailed Aug. 4, 2003 (8 pages). |
| Iskandar et al., "Effects of a urinary factor from women in early pregnancy on HIV-1, SIV and associated disease", Nature Medicine, Apr. 1998, vol. 4, No. 4, pp. 428-434. |
| Ivanov et al., "Hemoglobin as a Source of Endogenous Bioactive Peptides: The Concept of Tissue-Specific Peptide Pool," Biopolymers, 1997, pp. 171-188, vol. 39. |
| Jimenez-Garza et al., "Early Effects of Modulation Nuclear factor-kappaB Activation on Traumatic Spinal Cord Injury in Rats," Ann. N.Y. Acad. Sci., 2005, pp. 148-150, vol. 1053. |
| Jyonouchi et al., Proinflammatory and regulatory cytokine production associated with innate and adaptive immune responses in children with autism spectrum disorders and developmental regression, J Neuroim., 2001, pp. 170-179, vol. 120. |
| Kachra et al., "Low Molecular Weight Components but Not Dimetric HCG Inhibit Growth and Down-Regulate AP-1 Transcription Factor in Kaposi's Sarcoma Cells," Endocrinology, 1997, pp. 4038-4041, vol. 138, No. 9. |
| Kalns et al., Biochem. Biophys. Res. Comm., 2002, pp. 41-44, vol. 292. |
| Kalns et al., Biochem. Biophys. Res. Comm., 2002, pp. 506-509, vol. 297. |
| Kanungo et al., Advanced Maturation of Heteropneustes Fossilis (Bloch) by Oral Administration of Human Chorionic Gonadotropin, J. Adv. Zool., 1999, pp. 1-5, vol. 20. |
| Keller, S., et al., "Human Chorionic Gonadotropin (hCG) Is a Potent Angiogenic Factor for Uterine Endothelial Cells in Vitro," 20(5-6) Placenta, p. A37 (Jul. 1999). |
| Khan, Nisar A., et al., "Inhibition of Diabetes in NOD Mice by Human Pregnancy Factor," 62(12) Human Immunology 1315-1323 (Dec. 2001). |
| Khan, Nisar A., et al., "Inhibition of Septic Shock in Mice by an Oligopeptide From the beta-Chain of Human Chorionic Gonadotrophin Hormone," 63(1) Human Immunology 1-7 (Jan. 2002). |
| Khan, Nisar A., et al., "Inhibition of Septic Shock in Mice by an Oligopeptide From the β-Chain of Human Chorionic Gonadotrophin Hormone," 63(1) Human Immunology 1-7 (Jan. 2002). |
| Khavinson et al, Gerontological Aspects of Genome Peptide Regulation, 2005, S. Karger AG, Basel, Switzerland. |
| Khavinson et al., "Effects of Livagen Peptide on Chromatin Activation in Lymphocytes from Old People," Bulletin of Experimental Biology and Medicine, Oct. 2002, pp. 389-392, vol. 134, No. 4. |
| Khavinson et al., "Effects of Short Peptides on Lymphocyte Chromatin in Senile Subjects," Bulletin of Experimental Biology and Medicine, Jan. 2004, pp. 78-81, vol. 137, No. 1. |
| Khavinson et al., "Epithalon Peptide Induces Telomerase Activity and Telomere Elongation in Human Somatic Cells," Bulletin of Experimental Biology and Medicine, Jun. 2003, pp. 590-592, vol. 135, No. 6. |
| Khavinson et al., "Inductive Activity of Retinal Peptides," Bulletin of Experimental Biology and Medicine, Nov. 2002, pp. 482-484, vol. 134, No. 5. |
| Khavinson et al., "Mechanisms Underlying Geroprotective Effects of Peptides," Bulletin of Experimental Biology and Medicine, Jan. 2002, pp. 1-5, vol. 133, No. 1. |
| Khavinson et al., "Peptide Promotes Overcoming of the Division Limit in Human Somatic Cell," Bulletin of Experimental Biology and Medicine, May 2004, pp. 503-506, vol. 137, No. 5. |
| Kidd et al., "Autism, An Extreme Challenge to Integrative Medicine, Part II: Medical Management," Alternative Medicine Review, 2002, pp. 472-499, vol. 7, No. 6. |
| Kronfol et al., "Cytokines and the Brain: Implications for Clinical Psychiatry," Am. J. Psychiatry, May 2000, pp. 683-694, vol. 157, No. 5. |
| Lang et al., "Induction of apoptosis in Kaposi's sarcoma spindle cell cultures by the subunits of human chorionic gonadotropin", AIDS 1997, vol. 11, No. 11, pp. 1333-1340. |
| Li et al., "NF-kappaB Regulation in the Immune System," Nature Reviews/Immunology, Oct. 2002, pp. 725-734, vol. 2. |
| Lunardi-Iskandar et al., "Effects of a urinary factor from women in early pregnancy on HIV-a, SIV and associated disease," Nature Medicine, pril 1998, pp. 428-434, vol. 4, No. 4. |
| MacDonald et al., "Interleukin-15 (IL-15) Induced NF-kappaB Activation and IL-8 Production in Human Neutrophils," Blood, Dec. 15, 1998, pp. 4828-4835, vol. 92, No. 12. |
| Malek-Ahmadi, P., "Role of Cytokines in Psychopathology: Therapeutic Implications," Drug News Prospects, Jun. 1998, pp. 271-276, vol. 11, No. 5. |
| Manna et al., Human chorionic gonadotropin suppresses activation of nuclear transcription factor-kappa B and activator protein-1 induced by tumor necrosis factor, The Journal of Biological Chemistry, May 2000, pp. 13307-13314, vol. 275, No. 18. |
| McBean et al., "Rodent Models of Global Cerebral Ischemia: A Comparison of Two-Vessel Occlusion and Four-Vessel Occlusion," Gen. Pharmac., 1998, pp. 431-434, vol. 30, No. 4. |
| Medzhitov, Toll-like Receptors and Innate Immunity, Nature Reviews/Immunology, Nov. 2001, pp. 135-145, vol. 1. |
| Merck Index, 17th ed. 1999, pp. 1145-1146, 1841-1848, 2539, 2551. |
| Merriam-Webster Medical Dictionary, 1994, p. 82. |
| Moayeri et al., Journal of Clinical Investigation. Sep. 2003, pp. 670-682, vol. 112, No. 5. |
| Morozov et al., "Natural and Synthetic Thymic Peptides as Therapeutics for Immune Dysfunction," Int. J. Immunopharmac., 1997, pp. 501-505, vol. 19, No. 9/10. |
| Muchmore et al., Immunoregulatory Properties of Fractions from Human Pregnancy Urine: Evidence that Human Chorionic Gonadotropin is not Responsible, The Journal of Immunology, Mar. 1997, pp. 881-886, vol. 118, No. 3. |
| Muchmore et al., Purification and Characterization of a Mannose-Containing Disaccharide Obtained from Human Pregnancy Urine, Journal of Experimental Medicine, Dec. 1984, pp. 1672-1685, vol. 160. |
| Neely et al., "Then and now: Studies using a burned mouse model reflect trends in burn research over the past 25 years," Burns, 1999, pp. 603-609, vol. 25. |
| Ngo et al., The protein folding problem and tertiary structure prediction, 1994, pp. 492-494. |
| Office Action for U.S. Appl. No. 10/409,032 dated Aug. 20, 2008. |
| Office Action for U.S. Appl. No. 10/409,032 dated Jan. 15, 2008. |
| Office Action for U.S. Appl. No. 10/409,032 dated Jun. 1, 2009. |
| Office Action for U.S. Appl. No. 10/409,032 dated May 17, 2007. |
| Office Action for U.S. Appl. No. 11/593,329 dated Apr. 6, 2009. |
| Office Action for U.S. Appl. No. 11/593,329 dated Mar. 5, 2010. |
| Office Action for U.S. Appl. No. 11/600,294 dated Apr. 3, 2009. |
| Office Action for U.S. Appl. No. 11/600,294 dated Dec. 17, 2009. |
| Office Action for U.S. Appl. No. 11/986,043 dated Feb. 18, 2010. |
| Office Action for U.S. Appl. No. 11/986,043 dated Jul. 29, 2010. |
| Oka et al., Immunosuppression in organ transplation, Japanese Journal of Pharmacology, vol. 71, No. 2, pp. 89-100, Jun. 1996. |
| Patil, A., et al., "The Study of the Effect of Human Chorionic Gonadotrophic (HCG) Hormone on the Survival of Adrenal Medulla Transplant in Brain. Preliminary Study," 87 Acta Neurochir (Wien) 76-78 (1987). |
| PCT International Preliminary Examination Report, PCT/NL99/00313, dated Jul. 21, 2000, 6 pages. |
| PCT International Search Report, PCT/EP2005/003707, dated Jul. 5, 2005. |
| PCT International Search Report, PCT/EP99/00313, dated Nov. 29, 1999, 3 pages. |
| PCT International Search Report, PCT/NL01/00259, dated Dec. 18, 2001, 3 pages. |
| PCT International Search Report, PCT/NL01/00259, dated Dec. 18, 2001. |
| Pellizzari et al., FEBS Letters, 1999, pp. 199-204, vol. 462. |
| Rohrig et al., Growth-stimulating Influence of Human Chorionic Gonadotropin (hCG) on Plasmodium falciparum in vitro, Zentralblatt Bakt, 1999, pp. 89-99, vol. 289. |
| Samaniego et al., Induction of Programmed Cell Death in Kaposi's Sarcoma Cells by Preparations of Human Chorionic Gonadotropin, Journal of the National Cancer Institute, Jan. 20, 1999, pp. 135-143, vol. 91, No. 2. |
| Slater, Lewis M., et al., "Decreased Mortality of Murine Graft-Versus-Host Disease by Human Chorionic gonadotropin,"23(1) Transplantation 103-104 (Jan. 1977). |
| Smith et al., "Recent develpments in drug therapy for multiple sclerosis," Multiple Sclerosis, 1999, pp. 110-120, vol. 5. |
| Sovak et al., Aberrant nuclear factor-kappa B/Rel expression and the pathogenesis of breast cancer, The Journal of Clinical Investigation, Dec. 1997, pp. 2952-2960, vol. 100, No. 12. |
| Tak et al., NF-kappaB: a key role in inflammatory disease, J Clin Invest., 2001, pp. 7-11, vol. 107. |
| Tan et al., The role of activation of nuclear factor-kappa B of rat brain in the pathogenesis of experimental allergic encephalomyelitis, Acta Physiol Sinica, 2003, pp. 58-64, vol. 55. |
| Tovey et al., Mucosal Cytokine Therapy: Marked Antiviral and Antitumor Activity, J. Interferon Cytokine Res., 1999, pp. 911-921, vol. 19. |
| Traystman, R., "Animal Models of Focal and Global Cerebral Ischemia," ILAR Journal, 2003, pp. 85-95, vol. 44, No. 2. |
| U.S. Appl. No. 11/593,329, filed Nov. 6, 2006, Title: Treatment of Ischemic Events. |
| U.S. Appl. No. 11/600,294, filed Nov. 15, 2006, Title: Oligopeptide Acetate and Formulations Thereof. |
| U.S. Appl. No. 11/975,284, filed Oct. 17, 2007, Title: Treatment for Tumors. |
| U.S. Appl. No. 11/981,491, filed Oct. 30, 2007, Title: Treatment of Iatrogenic Disease. |
| U.S. Appl. No. 11/982,293, filed Oct. 31, 2007, Title: Stratification. |
| U.S. Appl. No. 11/986,043, filed Oct. 30, 2007, Title: Peptide Compositions. |
| U.S. Appl. No. 12/001,035, filed Dec. 6, 2007, Title: Gene Regulator. |
| Weinberger et al., "Mechanisms Mediating Biologic Activity of Synthetic Proline, Glycine, and Hydroxyproline Polypeptides in Human Neurophils," Mediators of Inflammation, 2005, pp. 31-38, vol. 1. |
| Wu et al., Gonadotropin-Releasing Hormone (GNRH) Cleavage Products are Involved in the Regulation of GNRH Gene Expression in the GT1-7 Neuronal Cell Line, Society for Neuroscience Abstracts, Nov. 4, 2000, pp. 7.8, XP009091566, vol. 26, No. 1-2. |
| Wulczyn, F. Gregory, et al., "Th NF-kB/Rel and IkB gene families: mediators of immune response and inflammation," 74(12) J. Mol. Med. 749-769 (1996). |
| Yamamoto, Y., et al., "Role of the Nf-kB Pathway in the Pathogenesis of Human Disease States," 1(3) Current Molecular Medicine 287-296 (Jul. 2001). |
| Yang et al., "Increased cortical nuclear factor kappaB (NF-kappaB) DNA binding activity after traumatic brain injury in rats," Neuroscience Letters, 1995, pp. 101-104, vol. 197. |
| Zhou et al., Transplantation tolerance in NF-kappaB-impaired mice is not due to regulation but is prevented transgenic expression of Bcl-xL. The Journal of Immunology, vol. 174, No. 6, pp. 3447-3453, Mar. 2005. |
Also Published As
| Publication number | Publication date |
|---|---|
| US20040208885A1 (en) | 2004-10-21 |
| US7358330B2 (en) | 2008-04-15 |
| US20080076719A1 (en) | 2008-03-27 |
| US20080306009A1 (en) | 2008-12-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| USRE43309E1 (en) | Immunoregulatory compositions | |
| EP1755634B1 (en) | Oligopeptides for reducing elevated blood urea concentration | |
| US20080153755A1 (en) | Treatment of tumors | |
| US8680059B2 (en) | Oligopeptide acetate and formulations thereof | |
| CN118638210B (en) | Preparation method and application of long-acting PTH analogs | |
| EP0347931B1 (en) | Polypeptide comprising repeated cell-adhesive core sequences | |
| US7576174B2 (en) | Compositions capable of reducing elevated blood urea concentration | |
| WO2022042590A1 (en) | Polypeptides for repairing skin wounds or mucosal injuries, and applications thereof | |
| JP2024545747A (en) | Pentapeptides and their uses | |
| JP7046990B2 (en) | Prodrug peptide with improved medicinal properties | |
| EP2058328B1 (en) | Biologically active peptide VAPEEHPTLLTEAPLNPK derivatives | |
| JP3002213B2 (en) | Peptides and drugs containing this peptide | |
| CN120265642A (en) | Compound, preparation method and application thereof | |
| USRE43279E1 (en) | Compositions capable of reducing elevated blood urea concentration | |
| CN114989259A (en) | Small molecular peptide Ped4 and application thereof | |
| JPH06172203A (en) | Agent for inhibiting abnormal cell producing fibronectin receptor | |
| HK40090321A (en) | Polypeptide for repairing mucosal damage or skin wound and use thereof | |
| HK1126790B (en) | Biologically active peptide vapeehptllteaplnpk derivatives |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| FEPP | Fee payment procedure |
Free format text: PAYOR NUMBER ASSIGNED (ORIGINAL EVENT CODE: ASPN); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY |
|
| FPAY | Fee payment |
Year of fee payment: 8 |
|
| FEPP | Fee payment procedure |
Free format text: MAINTENANCE FEE REMINDER MAILED (ORIGINAL EVENT CODE: REM.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY |