US9994443B2 - Modified nicotinic compounds and related methods - Google Patents
Modified nicotinic compounds and related methods Download PDFInfo
- Publication number
- US9994443B2 US9994443B2 US13/289,211 US201113289211A US9994443B2 US 9994443 B2 US9994443 B2 US 9994443B2 US 201113289211 A US201113289211 A US 201113289211A US 9994443 B2 US9994443 B2 US 9994443B2
- Authority
- US
- United States
- Prior art keywords
- substituted
- compound
- unsubstituted
- polymer
- nicotine
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Fee Related
Links
- 150000001875 compounds Chemical class 0.000 title claims abstract description 88
- 238000000034 method Methods 0.000 title claims abstract description 69
- 239000000203 mixture Substances 0.000 claims abstract description 89
- 239000002539 nanocarrier Substances 0.000 claims description 164
- 229920000642 polymer Polymers 0.000 claims description 162
- 229960002715 nicotine Drugs 0.000 claims description 124
- SNICXCGAKADSCV-UHFFFAOYSA-N nicotine Natural products CN1CCCC1C1=CC=CN=C1 SNICXCGAKADSCV-UHFFFAOYSA-N 0.000 claims description 89
- SNICXCGAKADSCV-JTQLQIEISA-N (-)-Nicotine Chemical group CN1CCC[C@H]1C1=CC=CN=C1 SNICXCGAKADSCV-JTQLQIEISA-N 0.000 claims description 87
- IAYPIBMASNFSPL-UHFFFAOYSA-N Ethylene oxide Chemical class C1CO1 IAYPIBMASNFSPL-UHFFFAOYSA-N 0.000 claims description 36
- 125000003118 aryl group Chemical group 0.000 claims description 27
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 claims description 25
- 239000001301 oxygen Substances 0.000 claims description 25
- 229910052760 oxygen Inorganic materials 0.000 claims description 25
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 claims description 24
- 238000005481 NMR spectroscopy Methods 0.000 claims description 23
- 229960005486 vaccine Drugs 0.000 claims description 22
- 229920000747 poly(lactic acid) Polymers 0.000 claims description 21
- 229920001577 copolymer Chemical class 0.000 claims description 19
- 125000000217 alkyl group Chemical group 0.000 claims description 17
- AEMRFAOFKBGASW-UHFFFAOYSA-N Glycolic acid Polymers OCC(O)=O AEMRFAOFKBGASW-UHFFFAOYSA-N 0.000 claims description 14
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 claims description 14
- 229910052717 sulfur Inorganic materials 0.000 claims description 14
- 239000011593 sulfur Substances 0.000 claims description 14
- 229920000728 polyester Polymers 0.000 claims description 13
- 229910052757 nitrogen Inorganic materials 0.000 claims description 12
- NOWKCMXCCJGMRR-UHFFFAOYSA-N Aziridine Chemical class C1CN1 NOWKCMXCCJGMRR-UHFFFAOYSA-N 0.000 claims description 11
- 150000001335 aliphatic alkanes Chemical class 0.000 claims description 11
- 150000001336 alkenes Chemical class 0.000 claims description 11
- 125000003545 alkoxy group Chemical group 0.000 claims description 11
- 125000003282 alkyl amino group Chemical group 0.000 claims description 11
- 125000002877 alkyl aryl group Chemical group 0.000 claims description 11
- 125000004414 alkyl thio group Chemical group 0.000 claims description 11
- 125000000623 heterocyclic group Chemical group 0.000 claims description 11
- VOVUARRWDCVURC-UHFFFAOYSA-N thiirane Chemical class C1CS1 VOVUARRWDCVURC-UHFFFAOYSA-N 0.000 claims description 11
- 125000004169 (C1-C6) alkyl group Chemical group 0.000 claims description 8
- 125000002252 acyl group Chemical group 0.000 claims description 8
- 125000000547 substituted alkyl group Chemical group 0.000 claims description 8
- 125000003107 substituted aryl group Chemical group 0.000 claims description 8
- 239000004952 Polyamide Substances 0.000 claims description 7
- DZJXKISLUDYJSV-UHFFFAOYSA-N [N].C1CCNC1 Chemical group [N].C1CCNC1 DZJXKISLUDYJSV-UHFFFAOYSA-N 0.000 claims description 7
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 claims description 7
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 7
- 229920002647 polyamide Polymers 0.000 claims description 7
- 229920001610 polycaprolactone Polymers 0.000 claims description 6
- 229920002732 Polyanhydride Polymers 0.000 claims description 5
- 229920000954 Polyglycolide Polymers 0.000 claims description 5
- 239000004632 polycaprolactone Substances 0.000 claims description 5
- 229920002292 Nylon 6 Polymers 0.000 claims description 4
- 229920002988 biodegradable polymer Polymers 0.000 claims description 4
- 239000004621 biodegradable polymer Substances 0.000 claims description 4
- 239000004417 polycarbonate Substances 0.000 claims description 4
- 229920000515 polycarbonate Polymers 0.000 claims description 4
- 229920001855 polyketal Polymers 0.000 claims description 3
- 230000005875 antibody response Effects 0.000 abstract description 3
- 239000000243 solution Substances 0.000 description 141
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 133
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 93
- YXFVVABEGXRONW-UHFFFAOYSA-N Toluene Chemical compound CC1=CC=CC=C1 YXFVVABEGXRONW-UHFFFAOYSA-N 0.000 description 90
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 84
- 108091007433 antigens Proteins 0.000 description 82
- 102000036639 antigens Human genes 0.000 description 82
- 239000000427 antigen Substances 0.000 description 80
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 77
- -1 alum Chemical class 0.000 description 77
- XKRFYHLGVUSROY-UHFFFAOYSA-N Argon Chemical compound [Ar] XKRFYHLGVUSROY-UHFFFAOYSA-N 0.000 description 66
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 65
- WYURNTSHIVDZCO-UHFFFAOYSA-N Tetrahydrofuran Chemical compound C1CCOC1 WYURNTSHIVDZCO-UHFFFAOYSA-N 0.000 description 54
- 238000006243 chemical reaction Methods 0.000 description 51
- 238000003756 stirring Methods 0.000 description 50
- 239000007787 solid Substances 0.000 description 47
- 239000002671 adjuvant Substances 0.000 description 46
- 229920001223 polyethylene glycol Polymers 0.000 description 44
- 238000002360 preparation method Methods 0.000 description 35
- 239000002105 nanoparticle Substances 0.000 description 34
- 229910052786 argon Inorganic materials 0.000 description 33
- 238000001914 filtration Methods 0.000 description 27
- 238000010992 reflux Methods 0.000 description 27
- 210000003719 b-lymphocyte Anatomy 0.000 description 25
- 239000003921 oil Substances 0.000 description 25
- 239000000126 substance Substances 0.000 description 25
- 238000001816 cooling Methods 0.000 description 24
- 230000003993 interaction Effects 0.000 description 24
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 23
- 238000007151 ring opening polymerisation reaction Methods 0.000 description 23
- 239000002245 particle Substances 0.000 description 22
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 21
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 21
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 20
- 239000000706 filtrate Substances 0.000 description 20
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 18
- 210000001744 T-lymphocyte Anatomy 0.000 description 17
- 239000002202 Polyethylene glycol Substances 0.000 description 16
- 150000001412 amines Chemical class 0.000 description 16
- 239000000047 product Substances 0.000 description 16
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 15
- 102000002689 Toll-like receptor Human genes 0.000 description 15
- 108020000411 Toll-like receptor Proteins 0.000 description 15
- 239000010410 layer Substances 0.000 description 15
- 229920001606 poly(lactic acid-co-glycolic acid) Polymers 0.000 description 15
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 14
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical class CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 14
- 239000004626 polylactic acid Substances 0.000 description 14
- 150000001720 carbohydrates Chemical class 0.000 description 13
- 239000002552 dosage form Substances 0.000 description 13
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 13
- JJTUDXZGHPGLLC-UHFFFAOYSA-N lactide Chemical compound CC1OC(=O)C(C)OC1=O JJTUDXZGHPGLLC-UHFFFAOYSA-N 0.000 description 13
- 238000006116 polymerization reaction Methods 0.000 description 13
- 229950010550 resiquimod Drugs 0.000 description 13
- 239000000725 suspension Substances 0.000 description 13
- GQHTUMJGOHRCHB-UHFFFAOYSA-N 2,3,4,6,7,8,9,10-octahydropyrimido[1,2-a]azepine Chemical compound C1CCCCN2CCCN=C21 GQHTUMJGOHRCHB-UHFFFAOYSA-N 0.000 description 12
- 239000000556 agonist Substances 0.000 description 12
- 235000014633 carbohydrates Nutrition 0.000 description 12
- 239000003795 chemical substances by application Substances 0.000 description 12
- 150000002118 epoxides Chemical class 0.000 description 12
- BXNMTOQRYBFHNZ-UHFFFAOYSA-N resiquimod Chemical compound C1=CC=CC2=C(N(C(COCC)=N3)CC(C)(C)O)C3=C(N)N=C21 BXNMTOQRYBFHNZ-UHFFFAOYSA-N 0.000 description 12
- JWUJQDFVADABEY-UHFFFAOYSA-N 2-methyltetrahydrofuran Chemical compound CC1CCCO1 JWUJQDFVADABEY-UHFFFAOYSA-N 0.000 description 11
- 238000001035 drying Methods 0.000 description 11
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 11
- 235000019341 magnesium sulphate Nutrition 0.000 description 11
- 108090000765 processed proteins & peptides Proteins 0.000 description 11
- 102000004169 proteins and genes Human genes 0.000 description 11
- 108090000623 proteins and genes Proteins 0.000 description 11
- HEMHJVSKTPXQMS-UHFFFAOYSA-M sodium hydroxide Inorganic materials [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 11
- 238000010908 decantation Methods 0.000 description 10
- 239000001257 hydrogen Substances 0.000 description 10
- 229910052739 hydrogen Inorganic materials 0.000 description 10
- 150000002632 lipids Chemical class 0.000 description 10
- 239000002904 solvent Substances 0.000 description 10
- KWYUFKZDYYNOTN-UHFFFAOYSA-M Potassium hydroxide Chemical compound [OH-].[K+] KWYUFKZDYYNOTN-UHFFFAOYSA-M 0.000 description 9
- 229940045713 antineoplastic alkylating drug ethylene imines Drugs 0.000 description 9
- 235000019439 ethyl acetate Nutrition 0.000 description 9
- 230000003308 immunostimulating effect Effects 0.000 description 9
- 239000000463 material Substances 0.000 description 9
- 239000011159 matrix material Substances 0.000 description 9
- 150000002918 oxazolines Chemical class 0.000 description 9
- FVKFHMNJTHKMRX-UHFFFAOYSA-N 3,4,6,7,8,9-hexahydro-2H-pyrimido[1,2-a]pyrimidine Chemical compound C1CCN2CCCNC2=N1 FVKFHMNJTHKMRX-UHFFFAOYSA-N 0.000 description 8
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 8
- BZLVMXJERCGZMT-UHFFFAOYSA-N Methyl tert-butyl ether Chemical compound COC(C)(C)C BZLVMXJERCGZMT-UHFFFAOYSA-N 0.000 description 8
- IMNFDUFMRHMDMM-UHFFFAOYSA-N N-Heptane Chemical compound CCCCCCC IMNFDUFMRHMDMM-UHFFFAOYSA-N 0.000 description 8
- PMZURENOXWZQFD-UHFFFAOYSA-L Sodium Sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O PMZURENOXWZQFD-UHFFFAOYSA-L 0.000 description 8
- 235000011089 carbon dioxide Nutrition 0.000 description 8
- 230000008878 coupling Effects 0.000 description 8
- 238000010168 coupling process Methods 0.000 description 8
- 238000005859 coupling reaction Methods 0.000 description 8
- 239000000839 emulsion Substances 0.000 description 8
- 230000028993 immune response Effects 0.000 description 8
- 208000015181 infectious disease Diseases 0.000 description 8
- IVSZLXZYQVIEFR-UHFFFAOYSA-N m-xylene Chemical group CC1=CC=CC(C)=C1 IVSZLXZYQVIEFR-UHFFFAOYSA-N 0.000 description 8
- 239000000843 powder Substances 0.000 description 8
- 238000003786 synthesis reaction Methods 0.000 description 8
- RYHBNJHYFVUHQT-UHFFFAOYSA-N 1,4-Dioxane Chemical compound C1COCCO1 RYHBNJHYFVUHQT-UHFFFAOYSA-N 0.000 description 7
- 0 CN1CCCC1C1=CC=CN=C1.[2*]C([3*])(C[1*]C)C([4*])([5*])C[H] Chemical compound CN1CCCC1C1=CC=CN=C1.[2*]C([3*])(C[1*]C)C([4*])([5*])C[H] 0.000 description 7
- 108020004414 DNA Proteins 0.000 description 7
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 7
- 125000004429 atom Chemical group 0.000 description 7
- 239000003054 catalyst Substances 0.000 description 7
- 238000005119 centrifugation Methods 0.000 description 7
- 230000000295 complement effect Effects 0.000 description 7
- 239000005457 ice water Substances 0.000 description 7
- 238000004519 manufacturing process Methods 0.000 description 7
- 150000003839 salts Chemical class 0.000 description 7
- 230000008685 targeting Effects 0.000 description 7
- MBNVSWHUJDDZRH-UHFFFAOYSA-N 2-methylthiirane Chemical compound CC1CS1 MBNVSWHUJDDZRH-UHFFFAOYSA-N 0.000 description 6
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 6
- 206010012335 Dependence Diseases 0.000 description 6
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 6
- JVTAAEKCZFNVCJ-REOHCLBHSA-N L-lactic acid Chemical compound C[C@H](O)C(O)=O JVTAAEKCZFNVCJ-REOHCLBHSA-N 0.000 description 6
- 108091034117 Oligonucleotide Proteins 0.000 description 6
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 6
- UORVGPXVDQYIDP-UHFFFAOYSA-N borane Chemical compound B UORVGPXVDQYIDP-UHFFFAOYSA-N 0.000 description 6
- ARCJQKUWGAZPFX-OKILXGFUSA-N cis-stilbene oxide Chemical compound C1([C@H]2[C@H](O2)C=2C=CC=CC=2)=CC=CC=C1 ARCJQKUWGAZPFX-OKILXGFUSA-N 0.000 description 6
- 235000014113 dietary fatty acids Nutrition 0.000 description 6
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 6
- 239000003814 drug Substances 0.000 description 6
- PLONEVHFXDFSLA-UHFFFAOYSA-N ethyl hexanoate;tin(2+) Chemical compound [Sn+2].CCCCCC(=O)OCC PLONEVHFXDFSLA-UHFFFAOYSA-N 0.000 description 6
- 229930195729 fatty acid Natural products 0.000 description 6
- 239000000194 fatty acid Substances 0.000 description 6
- 230000002209 hydrophobic effect Effects 0.000 description 6
- 239000004310 lactic acid Substances 0.000 description 6
- 235000014655 lactic acid Nutrition 0.000 description 6
- 239000013554 lipid monolayer Substances 0.000 description 6
- 239000007788 liquid Substances 0.000 description 6
- 229920002521 macromolecule Polymers 0.000 description 6
- 239000002480 mineral oil Substances 0.000 description 6
- 235000010446 mineral oil Nutrition 0.000 description 6
- 239000008188 pellet Substances 0.000 description 6
- 239000002953 phosphate buffered saline Substances 0.000 description 6
- BWHMMNNQKKPAPP-UHFFFAOYSA-L potassium carbonate Chemical compound [K+].[K+].[O-]C([O-])=O BWHMMNNQKKPAPP-UHFFFAOYSA-L 0.000 description 6
- NTTOTNSKUYCDAV-UHFFFAOYSA-N potassium hydride Chemical compound [KH] NTTOTNSKUYCDAV-UHFFFAOYSA-N 0.000 description 6
- 229910000105 potassium hydride Inorganic materials 0.000 description 6
- 102000004196 processed proteins & peptides Human genes 0.000 description 6
- 238000011321 prophylaxis Methods 0.000 description 6
- 239000002002 slurry Substances 0.000 description 6
- 239000006228 supernatant Substances 0.000 description 6
- YLQBMQCUIZJEEH-UHFFFAOYSA-N tetrahydrofuran Natural products C=1C=COC=1 YLQBMQCUIZJEEH-UHFFFAOYSA-N 0.000 description 6
- 239000003053 toxin Substances 0.000 description 6
- 231100000765 toxin Toxicity 0.000 description 6
- 238000011282 treatment Methods 0.000 description 6
- 238000005406 washing Methods 0.000 description 6
- DEYLVDCFTICBTB-WCBMZHEXSA-N (2s,3s)-1-methyl-5-oxo-2-pyridin-3-ylpyrrolidine-3-carboxylic acid Chemical compound OC(=O)[C@H]1CC(=O)N(C)[C@@H]1C1=CC=CN=C1 DEYLVDCFTICBTB-WCBMZHEXSA-N 0.000 description 5
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 5
- NYEZZYQZRQDLEH-UHFFFAOYSA-N 2-ethyl-4,5-dihydro-1,3-oxazole Chemical compound CCC1=NCCO1 NYEZZYQZRQDLEH-UHFFFAOYSA-N 0.000 description 5
- 241000894006 Bacteria Species 0.000 description 5
- 239000000232 Lipid Bilayer Substances 0.000 description 5
- 206010028980 Neoplasm Diseases 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 210000004027 cell Anatomy 0.000 description 5
- 238000004587 chromatography analysis Methods 0.000 description 5
- 239000012043 crude product Substances 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 210000002443 helper t lymphocyte Anatomy 0.000 description 5
- IXCSERBJSXMMFS-UHFFFAOYSA-N hydrogen chloride Substances Cl.Cl IXCSERBJSXMMFS-UHFFFAOYSA-N 0.000 description 5
- 229910000041 hydrogen chloride Inorganic materials 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 238000002156 mixing Methods 0.000 description 5
- 239000000178 monomer Substances 0.000 description 5
- PSHKMPUSSFXUIA-UHFFFAOYSA-N n,n-dimethylpyridin-2-amine Chemical compound CN(C)C1=CC=CC=N1 PSHKMPUSSFXUIA-UHFFFAOYSA-N 0.000 description 5
- 229920000058 polyacrylate Polymers 0.000 description 5
- 229920000136 polysorbate Polymers 0.000 description 5
- 229920002451 polyvinyl alcohol Polymers 0.000 description 5
- 235000019422 polyvinyl alcohol Nutrition 0.000 description 5
- 239000003755 preservative agent Substances 0.000 description 5
- 238000000746 purification Methods 0.000 description 5
- KSBAEPSJVUENNK-UHFFFAOYSA-L tin(ii) 2-ethylhexanoate Chemical compound [Sn+2].CCCCC(CC)C([O-])=O.CCCCC(CC)C([O-])=O KSBAEPSJVUENNK-UHFFFAOYSA-L 0.000 description 5
- MYKUKUCHPMASKF-VIFPVBQESA-N (S)-nornicotine Chemical compound C1CCN[C@@H]1C1=CC=CN=C1 MYKUKUCHPMASKF-VIFPVBQESA-N 0.000 description 4
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 4
- PBNKHXAUAGIZGH-QPHWGWKJSA-N C1CO1.CC(=O)O.CN1CC[C@@H](CO)C1C1=CC=CN=C1.CN1CC[C@@H](COCCO)C1C1=CC=CN=C1 Chemical compound C1CO1.CC(=O)O.CN1CC[C@@H](CO)C1C1=CC=CN=C1.CN1CC[C@@H](COCCO)C1C1=CC=CN=C1 PBNKHXAUAGIZGH-QPHWGWKJSA-N 0.000 description 4
- XRJJZFCKJBNEDQ-UHFFFAOYSA-N CCCPCC.CN1CCCC1C1=CC=CN=C1 Chemical compound CCCPCC.CN1CCCC1C1=CC=CN=C1 XRJJZFCKJBNEDQ-UHFFFAOYSA-N 0.000 description 4
- 229920001661 Chitosan Polymers 0.000 description 4
- UIKROCXWUNQSPJ-UHFFFAOYSA-N Cotinine Natural products C1CC(=O)N(C)C1C1=CC=CN=C1 UIKROCXWUNQSPJ-UHFFFAOYSA-N 0.000 description 4
- 229920000742 Cotton Polymers 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 4
- MYKUKUCHPMASKF-UHFFFAOYSA-N Nornicotine Natural products C1CCNC1C1=CC=CN=C1 MYKUKUCHPMASKF-UHFFFAOYSA-N 0.000 description 4
- 239000004372 Polyvinyl alcohol Substances 0.000 description 4
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 4
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- 230000005867 T cell response Effects 0.000 description 4
- 239000002253 acid Substances 0.000 description 4
- 150000004703 alkoxides Chemical class 0.000 description 4
- 229940037003 alum Drugs 0.000 description 4
- YZXBAPSDXZZRGB-DOFZRALJSA-N arachidonic acid Natural products CCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(O)=O YZXBAPSDXZZRGB-DOFZRALJSA-N 0.000 description 4
- 239000000872 buffer Substances 0.000 description 4
- 229950006073 cotinine Drugs 0.000 description 4
- 239000002274 desiccant Substances 0.000 description 4
- 239000006185 dispersion Substances 0.000 description 4
- 238000002296 dynamic light scattering Methods 0.000 description 4
- 238000005538 encapsulation Methods 0.000 description 4
- 150000004665 fatty acids Chemical class 0.000 description 4
- 238000009472 formulation Methods 0.000 description 4
- 239000003999 initiator Substances 0.000 description 4
- 239000002502 liposome Substances 0.000 description 4
- 239000012280 lithium aluminium hydride Substances 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 229910052751 metal Inorganic materials 0.000 description 4
- 239000002184 metal Substances 0.000 description 4
- IPCSVZSSVZVIGE-UHFFFAOYSA-N n-hexadecanoic acid Natural products CCCCCCCCCCCCCCCC(O)=O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 description 4
- 108020004707 nucleic acids Proteins 0.000 description 4
- 150000007523 nucleic acids Chemical class 0.000 description 4
- 102000039446 nucleic acids Human genes 0.000 description 4
- 230000004044 response Effects 0.000 description 4
- 239000000741 silica gel Substances 0.000 description 4
- 229910002027 silica gel Inorganic materials 0.000 description 4
- 239000000377 silicon dioxide Substances 0.000 description 4
- 229910052938 sodium sulfate Inorganic materials 0.000 description 4
- 235000011152 sodium sulphate Nutrition 0.000 description 4
- LMBFAGIMSUYTBN-MPZNNTNKSA-N teixobactin Chemical compound C([C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@H](CCC(N)=O)C(=O)N[C@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@H]1C(N[C@@H](C)C(=O)N[C@@H](C[C@@H]2NC(=N)NC2)C(=O)N[C@H](C(=O)O[C@H]1C)[C@@H](C)CC)=O)NC)C1=CC=CC=C1 LMBFAGIMSUYTBN-MPZNNTNKSA-N 0.000 description 4
- 125000003396 thiol group Chemical class [H]S* 0.000 description 4
- UIKROCXWUNQSPJ-VIFPVBQESA-N (-)-cotinine Chemical compound C1CC(=O)N(C)[C@@H]1C1=CC=CN=C1 UIKROCXWUNQSPJ-VIFPVBQESA-N 0.000 description 3
- DFNSRHLHJWUDTH-UHFFFAOYSA-N 1-(3-methylphenyl)sulfonylaziridine Chemical compound CC1=CC=CC(S(=O)(=O)N2CC2)=C1 DFNSRHLHJWUDTH-UHFFFAOYSA-N 0.000 description 3
- FBFJOZZTIXSPPR-UHFFFAOYSA-N 1-(4-aminobutyl)-2-(ethoxymethyl)imidazo[4,5-c]quinolin-4-amine Chemical class C1=CC=CC2=C(N(C(COCC)=N3)CCCCN)C3=C(N)N=C21 FBFJOZZTIXSPPR-UHFFFAOYSA-N 0.000 description 3
- LXRYXHPECAPIQA-UHFFFAOYSA-N 1-benzylsulfonylaziridine Chemical compound C1CN1S(=O)(=O)CC1=CC=CC=C1 LXRYXHPECAPIQA-UHFFFAOYSA-N 0.000 description 3
- XLJQPXVBQNJNLW-UHFFFAOYSA-N 1-methylaziridine Chemical compound CN1CC1 XLJQPXVBQNJNLW-UHFFFAOYSA-N 0.000 description 3
- YKNKBBMRKMLLJS-UHFFFAOYSA-N 1-phenylaziridine Chemical compound C1CN1C1=CC=CC=C1 YKNKBBMRKMLLJS-UHFFFAOYSA-N 0.000 description 3
- SYQIWVMFOAHDMK-UHFFFAOYSA-N 2,2,3,3-tetramethyloxirane Chemical compound CC1(C)OC1(C)C SYQIWVMFOAHDMK-UHFFFAOYSA-N 0.000 description 3
- OIVRMEOAUMQHAQ-UHFFFAOYSA-N 2,3-diphenylaziridine Chemical compound N1C(C=2C=CC=CC=2)C1C1=CC=CC=C1 OIVRMEOAUMQHAQ-UHFFFAOYSA-N 0.000 description 3
- ICVNPQMUUHPPOK-UHFFFAOYSA-N 2-(4-fluorophenyl)oxirane Chemical compound C1=CC(F)=CC=C1C1OC1 ICVNPQMUUHPPOK-UHFFFAOYSA-N 0.000 description 3
- FALRKNHUBBKYCC-UHFFFAOYSA-N 2-(chloromethyl)pyridine-3-carbonitrile Chemical compound ClCC1=NC=CC=C1C#N FALRKNHUBBKYCC-UHFFFAOYSA-N 0.000 description 3
- QIQQWSQARNQPLP-UHFFFAOYSA-N 2-(diethoxymethyl)oxirane Chemical compound CCOC(OCC)C1CO1 QIQQWSQARNQPLP-UHFFFAOYSA-N 0.000 description 3
- LKMJVFRMDSNFRT-UHFFFAOYSA-N 2-(methoxymethyl)oxirane Chemical compound COCC1CO1 LKMJVFRMDSNFRT-UHFFFAOYSA-N 0.000 description 3
- QNYBOILAKBSWFG-UHFFFAOYSA-N 2-(phenylmethoxymethyl)oxirane Chemical compound C1OC1COCC1=CC=CC=C1 QNYBOILAKBSWFG-UHFFFAOYSA-N 0.000 description 3
- AQZRARFZZMGLHL-UHFFFAOYSA-N 2-(trifluoromethyl)oxirane Chemical compound FC(F)(F)C1CO1 AQZRARFZZMGLHL-UHFFFAOYSA-N 0.000 description 3
- OZDGMOYKSFPLSE-UHFFFAOYSA-N 2-Methylaziridine Chemical compound CC1CN1 OZDGMOYKSFPLSE-UHFFFAOYSA-N 0.000 description 3
- SFJRUJUEMVAZLM-UHFFFAOYSA-N 2-[(2-methylpropan-2-yl)oxymethyl]oxirane Chemical compound CC(C)(C)OCC1CO1 SFJRUJUEMVAZLM-UHFFFAOYSA-N 0.000 description 3
- LSONWRHLFZYHIN-UHFFFAOYSA-N 2-[(4-phenoxyphenyl)sulfonylmethyl]thiirane Chemical compound C=1C=C(OC=2C=CC=CC=2)C=CC=1S(=O)(=O)CC1CS1 LSONWRHLFZYHIN-UHFFFAOYSA-N 0.000 description 3
- VRKMUVCLRNFYKO-UHFFFAOYSA-N 2-decylthiirane Chemical compound CCCCCCCCCCC1CS1 VRKMUVCLRNFYKO-UHFFFAOYSA-N 0.000 description 3
- NJWSNNWLBMSXQR-UHFFFAOYSA-N 2-hexyloxirane Chemical compound CCCCCCC1CO1 NJWSNNWLBMSXQR-UHFFFAOYSA-N 0.000 description 3
- FUCNFCAABRZCTR-UHFFFAOYSA-N 2-hexylthiirane Chemical compound CCCCCCC1CS1 FUCNFCAABRZCTR-UHFFFAOYSA-N 0.000 description 3
- HIZNVUOFOHXPBF-UHFFFAOYSA-N 2-methyl-4,5-dihydro-1,3-oxazole;2-phenyl-4,5-dihydro-1,3-oxazole Chemical compound CC1=NCCO1.O1CCN=C1C1=CC=CC=C1 HIZNVUOFOHXPBF-UHFFFAOYSA-N 0.000 description 3
- GBIKLFWSUVVUKT-UHFFFAOYSA-N 2-phenylaziridine Chemical compound C1NC1C1=CC=CC=C1 GBIKLFWSUVVUKT-UHFFFAOYSA-N 0.000 description 3
- UGNSMKDDFAUGFT-UHFFFAOYSA-N 4,4-dimethyl-2-phenyl-5h-1,3-oxazole Chemical compound CC1(C)COC(C=2C=CC=CC=2)=N1 UGNSMKDDFAUGFT-UHFFFAOYSA-N 0.000 description 3
- XYABHURTMBEOGW-UHFFFAOYSA-N 4,5-Dihydro-4,4-dimethyl-2-(3-pyridyl)oxazole Chemical compound CC1(C)COC(C=2C=NC=CC=2)=N1 XYABHURTMBEOGW-UHFFFAOYSA-N 0.000 description 3
- JJTUDXZGHPGLLC-IMJSIDKUSA-N 4511-42-6 Chemical compound C[C@@H]1OC(=O)[C@H](C)OC1=O JJTUDXZGHPGLLC-IMJSIDKUSA-N 0.000 description 3
- PQWJNIJNYRPOAA-UHFFFAOYSA-N 7-thiabicyclo[4.1.0]heptane Chemical compound C1CCCC2SC21 PQWJNIJNYRPOAA-UHFFFAOYSA-N 0.000 description 3
- MELPJGOMEMRMPL-UHFFFAOYSA-N 9-oxabicyclo[6.1.0]nonane Chemical compound C1CCCCCC2OC21 MELPJGOMEMRMPL-UHFFFAOYSA-N 0.000 description 3
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 3
- 108010088751 Albumins Proteins 0.000 description 3
- 102000009027 Albumins Human genes 0.000 description 3
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 3
- 208000035473 Communicable disease Diseases 0.000 description 3
- 229940046168 CpG oligodeoxynucleotide Drugs 0.000 description 3
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 3
- 241001082241 Lythrum hyssopifolia Species 0.000 description 3
- 241000699670 Mus sp. Species 0.000 description 3
- 229910019142 PO4 Inorganic materials 0.000 description 3
- FQYUMYWMJTYZTK-UHFFFAOYSA-N Phenyl glycidyl ether Chemical compound C1OC1COC1=CC=CC=C1 FQYUMYWMJTYZTK-UHFFFAOYSA-N 0.000 description 3
- 229920001165 Poly(4-hydroxy-l-proline ester Polymers 0.000 description 3
- 229920002873 Polyethylenimine Polymers 0.000 description 3
- 239000004743 Polypropylene Substances 0.000 description 3
- GOOHAUXETOMSMM-UHFFFAOYSA-N Propylene oxide Chemical compound CC1CO1 GOOHAUXETOMSMM-UHFFFAOYSA-N 0.000 description 3
- AWMVMTVKBNGEAK-UHFFFAOYSA-N Styrene oxide Chemical compound C1OC1C1=CC=CC=C1 AWMVMTVKBNGEAK-UHFFFAOYSA-N 0.000 description 3
- 229940124613 TLR 7/8 agonist Drugs 0.000 description 3
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 3
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 3
- 238000010521 absorption reaction Methods 0.000 description 3
- 150000001408 amides Chemical class 0.000 description 3
- 150000008064 anhydrides Chemical class 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 3
- 229920001400 block copolymer Polymers 0.000 description 3
- 229910000085 borane Inorganic materials 0.000 description 3
- 201000011510 cancer Diseases 0.000 description 3
- 150000004649 carbonic acid derivatives Chemical class 0.000 description 3
- 125000002091 cationic group Chemical group 0.000 description 3
- 229920006317 cationic polymer Polymers 0.000 description 3
- 125000004122 cyclic group Chemical group 0.000 description 3
- HPNMFZURTQLUMO-UHFFFAOYSA-N diethylamine Chemical compound CCNCC HPNMFZURTQLUMO-UHFFFAOYSA-N 0.000 description 3
- 238000004821 distillation Methods 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 239000003480 eluent Substances 0.000 description 3
- 125000005313 fatty acid group Chemical group 0.000 description 3
- 238000010438 heat treatment Methods 0.000 description 3
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 3
- 230000036039 immunity Effects 0.000 description 3
- 230000003053 immunization Effects 0.000 description 3
- 238000002649 immunization Methods 0.000 description 3
- 239000012678 infectious agent Substances 0.000 description 3
- 230000000977 initiatory effect Effects 0.000 description 3
- 239000008101 lactose Substances 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 150000004702 methyl esters Chemical class 0.000 description 3
- 150000007530 organic bases Chemical class 0.000 description 3
- 102000007863 pattern recognition receptors Human genes 0.000 description 3
- 108010089193 pattern recognition receptors Proteins 0.000 description 3
- 229920001983 poloxamer Polymers 0.000 description 3
- 229920002721 polycyanoacrylate Polymers 0.000 description 3
- 229920000570 polyether Polymers 0.000 description 3
- 229920000193 polymethacrylate Polymers 0.000 description 3
- 229920001155 polypropylene Polymers 0.000 description 3
- 229920001282 polysaccharide Polymers 0.000 description 3
- 239000005017 polysaccharide Substances 0.000 description 3
- 150000004804 polysaccharides Chemical class 0.000 description 3
- IUBQJLUDMLPAGT-UHFFFAOYSA-N potassium bis(trimethylsilyl)amide Chemical compound C[Si](C)(C)N([K])[Si](C)(C)C IUBQJLUDMLPAGT-UHFFFAOYSA-N 0.000 description 3
- 229910000027 potassium carbonate Inorganic materials 0.000 description 3
- 125000002924 primary amino group Chemical class [H]N([H])* 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 238000011084 recovery Methods 0.000 description 3
- 238000000926 separation method Methods 0.000 description 3
- 150000003384 small molecules Chemical group 0.000 description 3
- 229940014800 succinic anhydride Drugs 0.000 description 3
- QAOWNCQODCNURD-UHFFFAOYSA-N sulfuric acid Substances OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 3
- 239000004094 surface-active agent Substances 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- PAPBSGBWRJIAAV-UHFFFAOYSA-N ε-Caprolactone Chemical compound O=C1CCCCCO1 PAPBSGBWRJIAAV-UHFFFAOYSA-N 0.000 description 3
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 2
- YYGNTYWPHWGJRM-UHFFFAOYSA-N (6E,10E,14E,18E)-2,6,10,15,19,23-hexamethyltetracosa-2,6,10,14,18,22-hexaene Chemical compound CC(C)=CCCC(C)=CCCC(C)=CCCC=C(C)CCC=C(C)CCC=C(C)C YYGNTYWPHWGJRM-UHFFFAOYSA-N 0.000 description 2
- KILNVBDSWZSGLL-KXQOOQHDSA-N 1,2-dihexadecanoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCCCCCCCCC KILNVBDSWZSGLL-KXQOOQHDSA-N 0.000 description 2
- ADFXKUOMJKEIND-UHFFFAOYSA-N 1,3-dicyclohexylurea Chemical compound C1CCCCC1NC(=O)NC1CCCCC1 ADFXKUOMJKEIND-UHFFFAOYSA-N 0.000 description 2
- RKDVKSZUMVYZHH-UHFFFAOYSA-N 1,4-dioxane-2,5-dione Chemical compound O=C1COC(=O)CO1 RKDVKSZUMVYZHH-UHFFFAOYSA-N 0.000 description 2
- VQFKFAKEUMHBLV-BYSUZVQFSA-N 1-O-(alpha-D-galactosyl)-N-hexacosanoylphytosphingosine Chemical compound CCCCCCCCCCCCCCCCCCCCCCCCCC(=O)N[C@H]([C@H](O)[C@H](O)CCCCCCCCCCCCCC)CO[C@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O VQFKFAKEUMHBLV-BYSUZVQFSA-N 0.000 description 2
- NIXOWILDQLNWCW-UHFFFAOYSA-N 2-Propenoic acid Natural products OC(=O)C=C NIXOWILDQLNWCW-UHFFFAOYSA-N 0.000 description 2
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 description 2
- VHYFNPMBLIVWCW-UHFFFAOYSA-N 4-Dimethylaminopyridine Chemical compound CN(C)C1=CC=NC=C1 VHYFNPMBLIVWCW-UHFFFAOYSA-N 0.000 description 2
- HBAQYPYDRFILMT-UHFFFAOYSA-N 8-[3-(1-cyclopropylpyrazol-4-yl)-1H-pyrazolo[4,3-d]pyrimidin-5-yl]-3-methyl-3,8-diazabicyclo[3.2.1]octan-2-one Chemical class C1(CC1)N1N=CC(=C1)C1=NNC2=C1N=C(N=C2)N1C2C(N(CC1CC2)C)=O HBAQYPYDRFILMT-UHFFFAOYSA-N 0.000 description 2
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical class CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 2
- 108010042708 Acetylmuramyl-Alanyl-Isoglutamine Proteins 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 208000023275 Autoimmune disease Diseases 0.000 description 2
- 230000003844 B-cell-activation Effects 0.000 description 2
- 108020000946 Bacterial DNA Proteins 0.000 description 2
- UKMSUNONTOPOIO-UHFFFAOYSA-N Behenic acid Natural products CCCCCCCCCCCCCCCCCCCCCC(O)=O UKMSUNONTOPOIO-UHFFFAOYSA-N 0.000 description 2
- FERIUCNNQQJTOY-UHFFFAOYSA-N Butyric acid Natural products CCCC(O)=O FERIUCNNQQJTOY-UHFFFAOYSA-N 0.000 description 2
- MVUCLRFMWCQCMO-UHFFFAOYSA-N CC1OC(=O)C(C)OC1=O.CCOCC1CCN(C)C1C1=CC=CN=C1.COCC1CCN(C)C1C1=CC=CN=C1 Chemical compound CC1OC(=O)C(C)OC1=O.CCOCC1CCN(C)C1C1=CC=CN=C1.COCC1CCN(C)C1C1=CC=CN=C1 MVUCLRFMWCQCMO-UHFFFAOYSA-N 0.000 description 2
- MNSMJUQJCYGPIL-UHFFFAOYSA-N CC1OC(=O)C(C)OC1=O.CN1CCC(COCCO)C1C1=CC=CN=C1.CN1CCC(COCO)C1C1=CC=CN=C1 Chemical compound CC1OC(=O)C(C)OC1=O.CN1CCC(COCCO)C1C1=CC=CN=C1.CN1CCC(COCO)C1C1=CC=CN=C1 MNSMJUQJCYGPIL-UHFFFAOYSA-N 0.000 description 2
- WWZKQHOCKIZLMA-UHFFFAOYSA-N Caprylic acid Natural products CCCCCCCC(O)=O WWZKQHOCKIZLMA-UHFFFAOYSA-N 0.000 description 2
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 2
- 241000606153 Chlamydia trachomatis Species 0.000 description 2
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical class [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 2
- 102100030886 Complement receptor type 1 Human genes 0.000 description 2
- 102100032768 Complement receptor type 2 Human genes 0.000 description 2
- 102000004127 Cytokines Human genes 0.000 description 2
- 108090000695 Cytokines Proteins 0.000 description 2
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 2
- JVTAAEKCZFNVCJ-UWTATZPHSA-N D-lactic acid Chemical compound C[C@@H](O)C(O)=O JVTAAEKCZFNVCJ-UWTATZPHSA-N 0.000 description 2
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 description 2
- GHVNFZFCNZKVNT-UHFFFAOYSA-N Decanoic acid Natural products CCCCCCCCCC(O)=O GHVNFZFCNZKVNT-UHFFFAOYSA-N 0.000 description 2
- QOSSAOTZNIDXMA-UHFFFAOYSA-N Dicylcohexylcarbodiimide Chemical compound C1CCCCC1N=C=NC1CCCCC1 QOSSAOTZNIDXMA-UHFFFAOYSA-N 0.000 description 2
- 241000305071 Enterobacterales Species 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 229930186217 Glycolipid Natural products 0.000 description 2
- 101000727061 Homo sapiens Complement receptor type 1 Proteins 0.000 description 2
- 101000941929 Homo sapiens Complement receptor type 2 Proteins 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- 102000002227 Interferon Type I Human genes 0.000 description 2
- 108010014726 Interferon Type I Proteins 0.000 description 2
- OYHQOLUKZRVURQ-HZJYTTRNSA-N Linoleic acid Chemical compound CCCCC\C=C/C\C=C/CCCCCCCC(O)=O OYHQOLUKZRVURQ-HZJYTTRNSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 229930195725 Mannitol Natural products 0.000 description 2
- LSDPWZHWYPCBBB-UHFFFAOYSA-N Methanethiol Chemical compound SC LSDPWZHWYPCBBB-UHFFFAOYSA-N 0.000 description 2
- BAVYZALUXZFZLV-UHFFFAOYSA-N Methylamine Chemical compound NC BAVYZALUXZFZLV-UHFFFAOYSA-N 0.000 description 2
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 2
- MZRVEZGGRBJDDB-UHFFFAOYSA-N N-Butyllithium Chemical compound [Li]CCCC MZRVEZGGRBJDDB-UHFFFAOYSA-N 0.000 description 2
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 2
- 102000012064 NLR Proteins Human genes 0.000 description 2
- 108091005686 NOD-like receptors Proteins 0.000 description 2
- 241000588652 Neisseria gonorrhoeae Species 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 229920001273 Polyhydroxy acid Polymers 0.000 description 2
- 108091036414 Polyinosinic:polycytidylic acid Proteins 0.000 description 2
- 229920001213 Polysorbate 20 Polymers 0.000 description 2
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 2
- 241001222774 Salmonella enterica subsp. enterica serovar Minnesota Species 0.000 description 2
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 241000607762 Shigella flexneri Species 0.000 description 2
- 239000004147 Sorbitan trioleate Substances 0.000 description 2
- PRXRUNOAOLTIEF-ADSICKODSA-N Sorbitan trioleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCC\C=C/CCCCCCCC)[C@H]1OC[C@H](O)[C@H]1OC(=O)CCCCCCC\C=C/CCCCCCCC PRXRUNOAOLTIEF-ADSICKODSA-N 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- BHEOSNUKNHRBNM-UHFFFAOYSA-N Tetramethylsqualene Natural products CC(=C)C(C)CCC(=C)C(C)CCC(C)=CCCC=C(C)CCC(C)C(=C)CCC(C)C(C)=C BHEOSNUKNHRBNM-UHFFFAOYSA-N 0.000 description 2
- 108010060752 Toll-Like Receptor 8 Proteins 0.000 description 2
- 102100033110 Toll-like receptor 8 Human genes 0.000 description 2
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 2
- UZQJVUCHXGYFLQ-AYDHOLPZSA-N [(2s,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-4-[(2r,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-3,5-dihydroxy-6-(hydroxymethyl)-4-[(2s,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]oxy-3,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-3,5-dihydroxy-6-(hy Chemical compound O([C@H]1[C@H](O)[C@@H](CO)O[C@H]([C@@H]1O)O[C@H]1[C@H](O)[C@@H](CO)O[C@H]([C@@H]1O)O[C@H]1CC[C@]2(C)[C@H]3CC=C4[C@@]([C@@]3(CC[C@H]2[C@@]1(C=O)C)C)(C)CC(O)[C@]1(CCC(CC14)(C)C)C(=O)O[C@H]1[C@@H]([C@@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O[C@H]4[C@@H]([C@@H](O[C@H]5[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O5)O)[C@H](O)[C@@H](CO)O4)O)[C@H](O)[C@@H](CO)O3)O)[C@H](O)[C@@H](CO)O2)O)[C@H](O)[C@@H](CO)O1)O)[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O UZQJVUCHXGYFLQ-AYDHOLPZSA-N 0.000 description 2
- 238000013019 agitation Methods 0.000 description 2
- 150000001299 aldehydes Chemical class 0.000 description 2
- 235000010443 alginic acid Nutrition 0.000 description 2
- 229920000615 alginic acid Polymers 0.000 description 2
- 229940100198 alkylating agent Drugs 0.000 description 2
- 239000002168 alkylating agent Substances 0.000 description 2
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 2
- 229940024606 amino acid Drugs 0.000 description 2
- 150000001413 amino acids Chemical class 0.000 description 2
- 229920003144 amino alkyl methacrylate copolymer Polymers 0.000 description 2
- 125000003277 amino group Chemical group 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 2
- CBHOOMGKXCMKIR-UHFFFAOYSA-N azane;methanol Chemical compound N.OC CBHOOMGKXCMKIR-UHFFFAOYSA-N 0.000 description 2
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 2
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 2
- 238000009835 boiling Methods 0.000 description 2
- UWTDFICHZKXYAC-UHFFFAOYSA-N boron;oxolane Chemical compound [B].C1CCOC1 UWTDFICHZKXYAC-UHFFFAOYSA-N 0.000 description 2
- RBHJBMIOOPYDBQ-UHFFFAOYSA-N carbon dioxide;propan-2-one Chemical compound O=C=O.CC(C)=O RBHJBMIOOPYDBQ-UHFFFAOYSA-N 0.000 description 2
- 239000000919 ceramic Substances 0.000 description 2
- 229940038705 chlamydia trachomatis Drugs 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 108010047295 complement receptors Proteins 0.000 description 2
- 102000006834 complement receptors Human genes 0.000 description 2
- 238000013329 compounding Methods 0.000 description 2
- 239000012141 concentrate Substances 0.000 description 2
- NZNMSOFKMUBTKW-UHFFFAOYSA-N cyclohexanecarboxylic acid Chemical compound OC(=O)C1CCCCC1 NZNMSOFKMUBTKW-UHFFFAOYSA-N 0.000 description 2
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 2
- 229940022769 d- lactic acid Drugs 0.000 description 2
- 239000000412 dendrimer Substances 0.000 description 2
- 229920000736 dendritic polymer Polymers 0.000 description 2
- FRKBLBQTSTUKOV-UHFFFAOYSA-N diphosphatidyl glycerol Natural products OP(O)(=O)OCC(OP(O)(O)=O)COP(O)(O)=O FRKBLBQTSTUKOV-UHFFFAOYSA-N 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- PRAKJMSDJKAYCZ-UHFFFAOYSA-N dodecahydrosqualene Natural products CC(C)CCCC(C)CCCC(C)CCCCC(C)CCCC(C)CCCC(C)C PRAKJMSDJKAYCZ-UHFFFAOYSA-N 0.000 description 2
- 238000012377 drug delivery Methods 0.000 description 2
- 229920001971 elastomer Polymers 0.000 description 2
- 230000009881 electrostatic interaction Effects 0.000 description 2
- 231100000317 environmental toxin Toxicity 0.000 description 2
- VKOBVWXKNCXXDE-UHFFFAOYSA-N ethyl stearic acid Natural products CCCCCCCCCCCCCCCCCCCC(O)=O VKOBVWXKNCXXDE-UHFFFAOYSA-N 0.000 description 2
- 239000000284 extract Substances 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 239000006260 foam Substances 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- 125000000524 functional group Chemical group 0.000 description 2
- 239000007789 gas Substances 0.000 description 2
- 239000008103 glucose Substances 0.000 description 2
- 239000000383 hazardous chemical Substances 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 229920001519 homopolymer Polymers 0.000 description 2
- 150000002431 hydrogen Chemical class 0.000 description 2
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 2
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 2
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 2
- UFVKGYZPFZQRLF-UHFFFAOYSA-N hydroxypropyl methyl cellulose Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)O)C(CO)O1 UFVKGYZPFZQRLF-UHFFFAOYSA-N 0.000 description 2
- 229940124669 imidazoquinoline Drugs 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 230000002163 immunogen Effects 0.000 description 2
- 239000011261 inert gas Substances 0.000 description 2
- 229910052500 inorganic mineral Inorganic materials 0.000 description 2
- 150000002500 ions Chemical class 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 150000003951 lactams Chemical class 0.000 description 2
- 150000002596 lactones Chemical class 0.000 description 2
- ZCSHNCUQKCANBX-UHFFFAOYSA-N lithium diisopropylamide Chemical compound [Li+].CC(C)[N-]C(C)C ZCSHNCUQKCANBX-UHFFFAOYSA-N 0.000 description 2
- 229910003002 lithium salt Inorganic materials 0.000 description 2
- 239000000594 mannitol Substances 0.000 description 2
- 235000010355 mannitol Nutrition 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 208000030159 metabolic disease Diseases 0.000 description 2
- 239000002923 metal particle Substances 0.000 description 2
- 229920000609 methyl cellulose Polymers 0.000 description 2
- POULHZVOKOAJMA-UHFFFAOYSA-N methyl undecanoic acid Natural products CCCCCCCCCCCC(O)=O POULHZVOKOAJMA-UHFFFAOYSA-N 0.000 description 2
- 239000001923 methylcellulose Substances 0.000 description 2
- 239000000693 micelle Substances 0.000 description 2
- 239000011859 microparticle Substances 0.000 description 2
- 235000010755 mineral Nutrition 0.000 description 2
- 239000011707 mineral Substances 0.000 description 2
- BSOQXXWZTUDTEL-ZUYCGGNHSA-N muramyl dipeptide Chemical compound OC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@H]1[C@H](O)[C@@H](CO)O[C@@H](O)[C@@H]1NC(C)=O BSOQXXWZTUDTEL-ZUYCGGNHSA-N 0.000 description 2
- AOHAPDDBNAPPIN-UHFFFAOYSA-N myristicinic acid Natural products COC1=CC(C(O)=O)=CC2=C1OCO2 AOHAPDDBNAPPIN-UHFFFAOYSA-N 0.000 description 2
- WQEPLUUGTLDZJY-UHFFFAOYSA-N n-Pentadecanoic acid Natural products CCCCCCCCCCCCCCC(O)=O WQEPLUUGTLDZJY-UHFFFAOYSA-N 0.000 description 2
- FUZZWVXGSFPDMH-UHFFFAOYSA-N n-hexanoic acid Natural products CCCCCC(O)=O FUZZWVXGSFPDMH-UHFFFAOYSA-N 0.000 description 2
- 239000002086 nanomaterial Substances 0.000 description 2
- 230000003533 narcotic effect Effects 0.000 description 2
- 210000000581 natural killer T-cell Anatomy 0.000 description 2
- 208000015122 neurodegenerative disease Diseases 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 235000006408 oxalic acid Nutrition 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 230000001717 pathogenic effect Effects 0.000 description 2
- 150000003905 phosphatidylinositols Chemical class 0.000 description 2
- 229920001432 poly(L-lactide) Polymers 0.000 description 2
- 229920003229 poly(methyl methacrylate) Polymers 0.000 description 2
- 229940115272 polyinosinic:polycytidylic acid Drugs 0.000 description 2
- 229920000656 polylysine Polymers 0.000 description 2
- 239000004926 polymethyl methacrylate Substances 0.000 description 2
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 2
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 2
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 2
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 2
- 229920006324 polyoxymethylene Polymers 0.000 description 2
- 229940068977 polysorbate 20 Drugs 0.000 description 2
- 229940068968 polysorbate 80 Drugs 0.000 description 2
- 229920000053 polysorbate 80 Polymers 0.000 description 2
- 229920002635 polyurethane Polymers 0.000 description 2
- 239000004814 polyurethane Substances 0.000 description 2
- 235000011181 potassium carbonates Nutrition 0.000 description 2
- 230000002335 preservative effect Effects 0.000 description 2
- 239000002096 quantum dot Substances 0.000 description 2
- 239000011541 reaction mixture Substances 0.000 description 2
- 229940044601 receptor agonist Drugs 0.000 description 2
- 239000000018 receptor agonist Substances 0.000 description 2
- 229930182490 saponin Natural products 0.000 description 2
- 150000007949 saponins Chemical class 0.000 description 2
- 235000017709 saponins Nutrition 0.000 description 2
- 235000017557 sodium bicarbonate Nutrition 0.000 description 2
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 2
- 229910000029 sodium carbonate Inorganic materials 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 238000000527 sonication Methods 0.000 description 2
- 235000019337 sorbitan trioleate Nutrition 0.000 description 2
- 229960000391 sorbitan trioleate Drugs 0.000 description 2
- 238000001179 sorption measurement Methods 0.000 description 2
- 238000001694 spray drying Methods 0.000 description 2
- 229940031439 squalene Drugs 0.000 description 2
- TUHBEKDERLKLEC-UHFFFAOYSA-N squalene Natural products CC(=CCCC(=CCCC(=CCCC=C(/C)CCC=C(/C)CC=C(C)C)C)C)C TUHBEKDERLKLEC-UHFFFAOYSA-N 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 125000001424 substituent group Chemical group 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- UMGDCJDMYOKAJW-UHFFFAOYSA-N thiourea Chemical compound NC(N)=S UMGDCJDMYOKAJW-UHFFFAOYSA-N 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- GVJHHUAWPYXKBD-IEOSBIPESA-N α-tocopherol Chemical compound OC1=C(C)C(C)=C2O[C@@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-IEOSBIPESA-N 0.000 description 2
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 1
- DQJCDTNMLBYVAY-ZXXIYAEKSA-N (2S,5R,10R,13R)-16-{[(2R,3S,4R,5R)-3-{[(2S,3R,4R,5S,6R)-3-acetamido-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-5-(ethylamino)-6-hydroxy-2-(hydroxymethyl)oxan-4-yl]oxy}-5-(4-aminobutyl)-10-carbamoyl-2,13-dimethyl-4,7,12,15-tetraoxo-3,6,11,14-tetraazaheptadecan-1-oic acid Chemical compound NCCCC[C@H](C(=O)N[C@@H](C)C(O)=O)NC(=O)CC[C@H](C(N)=O)NC(=O)[C@@H](C)NC(=O)C(C)O[C@@H]1[C@@H](NCC)C(O)O[C@H](CO)[C@H]1O[C@H]1[C@H](NC(C)=O)[C@@H](O)[C@H](O)[C@@H](CO)O1 DQJCDTNMLBYVAY-ZXXIYAEKSA-N 0.000 description 1
- ASWBNKHCZGQVJV-UHFFFAOYSA-N (3-hexadecanoyloxy-2-hydroxypropyl) 2-(trimethylazaniumyl)ethyl phosphate Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(O)COP([O-])(=O)OCC[N+](C)(C)C ASWBNKHCZGQVJV-UHFFFAOYSA-N 0.000 description 1
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 description 1
- 229930182840 (S)-nicotine Natural products 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- PORPENFLTBBHSG-MGBGTMOVSA-N 1,2-dihexadecanoyl-sn-glycerol-3-phosphate Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(O)=O)OC(=O)CCCCCCCCCCCCCCC PORPENFLTBBHSG-MGBGTMOVSA-N 0.000 description 1
- SNKAWJBJQDLSFF-NVKMUCNASA-N 1,2-dioleoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCC\C=C/CCCCCCCC SNKAWJBJQDLSFF-NVKMUCNASA-N 0.000 description 1
- TZCPCKNHXULUIY-RGULYWFUSA-N 1,2-distearoyl-sn-glycero-3-phosphoserine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCCCC TZCPCKNHXULUIY-RGULYWFUSA-N 0.000 description 1
- BIABMEZBCHDPBV-MPQUPPDSSA-N 1,2-palmitoyl-sn-glycero-3-phospho-(1'-sn-glycerol) Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@@H](O)CO)OC(=O)CCCCCCCCCCCCCCC BIABMEZBCHDPBV-MPQUPPDSSA-N 0.000 description 1
- ARAFEULRMHFMDE-UHFFFAOYSA-N 1,3-oxazolidine-2,5-dione Chemical compound O=C1CNC(=O)O1 ARAFEULRMHFMDE-UHFFFAOYSA-N 0.000 description 1
- FJLUATLTXUNBOT-UHFFFAOYSA-N 1-Hexadecylamine Chemical compound CCCCCCCCCCCCCCCCN FJLUATLTXUNBOT-UHFFFAOYSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- HGRCYYVHIILPMN-UHFFFAOYSA-N 2-(2-bromoethyl)-1,4-dioxane Chemical compound BrCCC1COCCO1 HGRCYYVHIILPMN-UHFFFAOYSA-N 0.000 description 1
- SMZOUWXMTYCWNB-UHFFFAOYSA-N 2-(2-methoxy-5-methylphenyl)ethanamine Chemical compound COC1=CC=C(C)C=C1CCN SMZOUWXMTYCWNB-UHFFFAOYSA-N 0.000 description 1
- ASDQMECUMYIVBG-UHFFFAOYSA-N 2-[2-(2-aminoethoxy)ethoxy]ethanol Chemical compound NCCOCCOCCO ASDQMECUMYIVBG-UHFFFAOYSA-N 0.000 description 1
- MSWZFWKMSRAUBD-IVMDWMLBSA-N 2-amino-2-deoxy-D-glucopyranose Chemical compound N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O MSWZFWKMSRAUBD-IVMDWMLBSA-N 0.000 description 1
- CFWRDBDJAOHXSH-SECBINFHSA-N 2-azaniumylethyl [(2r)-2,3-diacetyloxypropyl] phosphate Chemical compound CC(=O)OC[C@@H](OC(C)=O)COP(O)(=O)OCCN CFWRDBDJAOHXSH-SECBINFHSA-N 0.000 description 1
- LDLCZOVUSADOIV-UHFFFAOYSA-N 2-bromoethanol Chemical compound OCCBr LDLCZOVUSADOIV-UHFFFAOYSA-N 0.000 description 1
- VKNASXZDGZNEDA-UHFFFAOYSA-N 2-cyanoethyl 2-methylprop-2-enoate Chemical compound CC(=C)C(=O)OCCC#N VKNASXZDGZNEDA-UHFFFAOYSA-N 0.000 description 1
- SFPNZPQIIAJXGL-UHFFFAOYSA-N 2-ethoxyethyl 2-methylprop-2-enoate Chemical class CCOCCOC(=O)C(C)=C SFPNZPQIIAJXGL-UHFFFAOYSA-N 0.000 description 1
- JVSMEQMKTLJOCA-UHFFFAOYSA-N 2-ethyl-4,5-dihydro-1,3-oxazole;3-(1-methylpyrrolidin-2-yl)pyridine Chemical compound CCC1=NCCO1.CN1CCCC1C1=CC=CN=C1 JVSMEQMKTLJOCA-UHFFFAOYSA-N 0.000 description 1
- YEDUAINPPJYDJZ-UHFFFAOYSA-N 2-hydroxybenzothiazole Chemical compound C1=CC=C2SC(O)=NC2=C1 YEDUAINPPJYDJZ-UHFFFAOYSA-N 0.000 description 1
- RMZNXRYIFGTWPF-UHFFFAOYSA-N 2-nitrosoacetic acid Chemical compound OC(=O)CN=O RMZNXRYIFGTWPF-UHFFFAOYSA-N 0.000 description 1
- QCDWFXQBSFUVSP-UHFFFAOYSA-N 2-phenoxyethanol Chemical compound OCCOC1=CC=CC=C1 QCDWFXQBSFUVSP-UHFFFAOYSA-N 0.000 description 1
- CRJPADMTLBRIQY-UHFFFAOYSA-N 2h-pyridin-3-ylidenemethanamine Chemical compound NC=C1CN=CC=C1 CRJPADMTLBRIQY-UHFFFAOYSA-N 0.000 description 1
- RHKWIGHJGOEUSM-UHFFFAOYSA-N 3h-imidazo[4,5-h]quinoline Chemical class C1=CN=C2C(N=CN3)=C3C=CC2=C1 RHKWIGHJGOEUSM-UHFFFAOYSA-N 0.000 description 1
- HIQIXEFWDLTDED-UHFFFAOYSA-N 4-hydroxy-1-piperidin-4-ylpyrrolidin-2-one Chemical compound O=C1CC(O)CN1C1CCNCC1 HIQIXEFWDLTDED-UHFFFAOYSA-N 0.000 description 1
- 108091027075 5S-rRNA precursor Proteins 0.000 description 1
- XZIIFPSPUDAGJM-UHFFFAOYSA-N 6-chloro-2-n,2-n-diethylpyrimidine-2,4-diamine Chemical compound CCN(CC)C1=NC(N)=CC(Cl)=N1 XZIIFPSPUDAGJM-UHFFFAOYSA-N 0.000 description 1
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 description 1
- GJCOSYZMQJWQCA-UHFFFAOYSA-N 9H-xanthene Chemical compound C1=CC=C2CC3=CC=CC=C3OC2=C1 GJCOSYZMQJWQCA-UHFFFAOYSA-N 0.000 description 1
- 229920002126 Acrylic acid copolymer Polymers 0.000 description 1
- 241000251468 Actinopterygii Species 0.000 description 1
- 244000247812 Amorphophallus rivieri Species 0.000 description 1
- 235000001206 Amorphophallus rivieri Nutrition 0.000 description 1
- 229920000856 Amylose Polymers 0.000 description 1
- 102100037435 Antiviral innate immune response receptor RIG-I Human genes 0.000 description 1
- 101710127675 Antiviral innate immune response receptor RIG-I Proteins 0.000 description 1
- 108091023037 Aptamer Proteins 0.000 description 1
- 208000012657 Atopic disease Diseases 0.000 description 1
- 241000271566 Aves Species 0.000 description 1
- 108091008875 B cell receptors Proteins 0.000 description 1
- 235000021357 Behenic acid Nutrition 0.000 description 1
- 239000005711 Benzoic acid Substances 0.000 description 1
- ZOXJGFHDIHLPTG-UHFFFAOYSA-N Boron Chemical compound [B] ZOXJGFHDIHLPTG-UHFFFAOYSA-N 0.000 description 1
- 241000589969 Borreliella burgdorferi Species 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- ZXUHABIOOYATJC-UHFFFAOYSA-N BrCCC1OCCCO1.CN1C(=O)C(CCC2OCCCO2)CC1C1=CC=CN=C1.CN1C(=O)CCC1C1=CC=CN=C1 Chemical compound BrCCC1OCCCO1.CN1C(=O)C(CCC2OCCCO2)CC1C1=CC=CN=C1.CN1C(=O)CCC1C1=CC=CN=C1 ZXUHABIOOYATJC-UHFFFAOYSA-N 0.000 description 1
- DPUOLQHDNGRHBS-UHFFFAOYSA-N Brassidinsaeure Natural products CCCCCCCCC=CCCCCCCCCCCCC(O)=O DPUOLQHDNGRHBS-UHFFFAOYSA-N 0.000 description 1
- MEUCJWZALWGJQH-UHFFFAOYSA-N C#CC#CC#CC#C[Sn]C#CC#CC#CC#C.CC(CSCCCC1=CC=C(C2CCCN2C)C=N1)SCCO.CC(CSCCCC1=CC=C(C2CCCN2C)C=N1)SCCOC(=O)CCCCCO.O=C1CCCCCO1.O=O.O=O.[HH].[HH].[HH].[HH].[HH].[HH].[HH].[HH].[HH].[HH].[HH].[HH].[HH].[HH] Chemical compound C#CC#CC#CC#C[Sn]C#CC#CC#CC#C.CC(CSCCCC1=CC=C(C2CCCN2C)C=N1)SCCO.CC(CSCCCC1=CC=C(C2CCCN2C)C=N1)SCCOC(=O)CCCCCO.O=C1CCCCCO1.O=O.O=O.[HH].[HH].[HH].[HH].[HH].[HH].[HH].[HH].[HH].[HH].[HH].[HH].[HH].[HH] MEUCJWZALWGJQH-UHFFFAOYSA-N 0.000 description 1
- AFWTZXXDGQBIKW-UHFFFAOYSA-N C14 surfactin Natural products CCCCCCCCCCCC1CC(=O)NC(CCC(O)=O)C(=O)NC(CC(C)C)C(=O)NC(CC(C)C)C(=O)NC(C(C)C)C(=O)NC(CC(O)=O)C(=O)NC(CC(C)C)C(=O)NC(CC(C)C)C(=O)O1 AFWTZXXDGQBIKW-UHFFFAOYSA-N 0.000 description 1
- DRBSUOWRCLCFOO-UHFFFAOYSA-N C1=CN=CC(C2CCCN2)=C1.COC(=O)CCCCN1CCCC1C1=CC=CN=C1.COCCC(=O)O Chemical compound C1=CN=CC(C2CCCN2)=C1.COC(=O)CCCCN1CCCC1C1=CC=CN=C1.COCCC(=O)O DRBSUOWRCLCFOO-UHFFFAOYSA-N 0.000 description 1
- RXMKLRBPVQOVPX-UHFFFAOYSA-N C1=CN=CC(C2CCCN2)=C1.NCC(=O)NCC(=O)N1CCCC1C1=CC=CN=C1.O=C1CNC(=O)O1 Chemical compound C1=CN=CC(C2CCCN2)=C1.NCC(=O)NCC(=O)N1CCCC1C1=CC=CN=C1.O=C1CNC(=O)O1 RXMKLRBPVQOVPX-UHFFFAOYSA-N 0.000 description 1
- CUBNBDTVFUJUDE-UHFFFAOYSA-N C1=CN=CC(C2CCCN2)=C1.O=C(O)CCC(=O)N1CCCC1C1=CC=CN=C1.O=C1CCC(=O)O1 Chemical compound C1=CN=CC(C2CCCN2)=C1.O=C(O)CCC(=O)N1CCCC1C1=CC=CN=C1.O=C1CCC(=O)O1 CUBNBDTVFUJUDE-UHFFFAOYSA-N 0.000 description 1
- PBNKHXAUAGIZGH-UHFFFAOYSA-N C1CO1.CC(=O)O.CN1CCC(CO)C1C1=CC=CN=C1.CN1CCC(COCCO)C1C1=CC=CN=C1 Chemical compound C1CO1.CC(=O)O.CN1CCC(CO)C1C1=CC=CN=C1.CN1CCC(COCCO)C1C1=CC=CN=C1 PBNKHXAUAGIZGH-UHFFFAOYSA-N 0.000 description 1
- KKZMTXJCQLIFJU-UHFFFAOYSA-N C1CO1.CCCCCN1CCCC1C1=CC=CN=C1.OCCCCN1CCCC1C1=CC=CN=C1.[KH] Chemical compound C1CO1.CCCCCN1CCCC1C1=CC=CN=C1.OCCCCN1CCCC1C1=CC=CN=C1.[KH] KKZMTXJCQLIFJU-UHFFFAOYSA-N 0.000 description 1
- PRBOCGUKVRTYIU-UHFFFAOYSA-N C1CO1.CCCNCC1CCN(C)C1C1=CC=CN=C1.CN1CCC(CNCCO)C1C1=CC=CN=C1 Chemical compound C1CO1.CCCNCC1CCN(C)C1C1=CC=CN=C1.CN1CCC(CNCCO)C1C1=CC=CN=C1 PRBOCGUKVRTYIU-UHFFFAOYSA-N 0.000 description 1
- GIXZVTIDDWSXJS-XZVVQQHRSA-M CC(=O)CCCN1CCCC1C1=CC=CN=C1.[2H]C#C.[Li]OC(=O)CCCN1CCCC1C1=CC=CN=C1 Chemical compound CC(=O)CCCN1CCCC1C1=CC=CN=C1.[2H]C#C.[Li]OC(=O)CCCN1CCCC1C1=CC=CN=C1 GIXZVTIDDWSXJS-XZVVQQHRSA-M 0.000 description 1
- LAJTXFYAOBAAPS-UHFFFAOYSA-N CC(C(OC1C#C)=O)OC1=O Chemical compound CC(C(OC1C#C)=O)OC1=O LAJTXFYAOBAAPS-UHFFFAOYSA-N 0.000 description 1
- JMOAIYUAZQTWCP-DBKPQDGCSA-N CC(CSCCCC1=CC=C(C2CCCN2C)C=N1)SCCO.CC(S)CSCCCC1=CC=C(C2CCCN2C)C=N1.CC1CS1.CN1CCCC1C1=CC=C(CCCO)N=C1.CN1CCCC1C1=CC=C(CCCS)N=C1.CN1CCCC1C1=CC=C(CCCS)N=C1.NC(N)=S.OCCBr.[2H]B[U] Chemical compound CC(CSCCCC1=CC=C(C2CCCN2C)C=N1)SCCO.CC(S)CSCCCC1=CC=C(C2CCCN2C)C=N1.CC1CS1.CN1CCCC1C1=CC=C(CCCO)N=C1.CN1CCCC1C1=CC=C(CCCS)N=C1.CN1CCCC1C1=CC=C(CCCS)N=C1.NC(N)=S.OCCBr.[2H]B[U] JMOAIYUAZQTWCP-DBKPQDGCSA-N 0.000 description 1
- GJRYORUIRGUUGR-UHFFFAOYSA-N CC1=CC=C(S(=O)(=O)OC2CCN(C)C2C2=CC=CN=C2)C=C1.CCC(=O)N(CCO)CCN(CC1CCN(C)C1C1=CC=CN=C1)C(=O)CC.CCC1N=CCO1 Chemical compound CC1=CC=C(S(=O)(=O)OC2CCN(C)C2C2=CC=CN=C2)C=C1.CCC(=O)N(CCO)CCN(CC1CCN(C)C1C1=CC=CN=C1)C(=O)CC.CCC1N=CCO1 GJRYORUIRGUUGR-UHFFFAOYSA-N 0.000 description 1
- BQWMYEGDVFMUKV-UHFFFAOYSA-N CC1OC(=O)C(C)OC1=O.CCC(=O)N(CCO)CCN(CC1CCN(C)C1C1=CC=CN=C1)C(=O)CC.CCCN(CCN(CC1CCN(C)C1C1=CC=CN=C1)C(=O)CC)C(=O)CC.O=C1COC(=O)CO1 Chemical compound CC1OC(=O)C(C)OC1=O.CCC(=O)N(CCO)CCN(CC1CCN(C)C1C1=CC=CN=C1)C(=O)CC.CCCN(CCN(CC1CCN(C)C1C1=CC=CN=C1)C(=O)CC)C(=O)CC.O=C1COC(=O)CO1 BQWMYEGDVFMUKV-UHFFFAOYSA-N 0.000 description 1
- LQCFJTLJVPYJPF-UHFFFAOYSA-N CC1OC(=O)C(C)OC1=O.CCN(CCCC1CC(C2=CC=CN=C2)N(C)C1)CCCC1CC(C2=CC=CN=C2)N(C)C1.CN(CCCC1CC(C2=CC=CN=C2)N(C)C1)CCCC1CC(C2=CC=CN=C2)N(C)C1 Chemical compound CC1OC(=O)C(C)OC1=O.CCN(CCCC1CC(C2=CC=CN=C2)N(C)C1)CCCC1CC(C2=CC=CN=C2)N(C)C1.CN(CCCC1CC(C2=CC=CN=C2)N(C)C1)CCCC1CC(C2=CC=CN=C2)N(C)C1 LQCFJTLJVPYJPF-UHFFFAOYSA-N 0.000 description 1
- YKTIIASKBFBYRP-URJGYUORSA-N CC1OC(=O)C(C)OC1=O.CCOC[C@@H]1CCN(C)C1C1=CC=CN=C1.COC[C@@H]1CCN(C)C1C1=CC=CN=C1.[2H]B[3H] Chemical compound CC1OC(=O)C(C)OC1=O.CCOC[C@@H]1CCN(C)C1C1=CC=CN=C1.COC[C@@H]1CCN(C)C1C1=CC=CN=C1.[2H]B[3H] YKTIIASKBFBYRP-URJGYUORSA-N 0.000 description 1
- VWBOJJLQVNUMRI-BGVBTLRWSA-N CC1OC(=O)C(C)OC1=O.CCOC[C@@H]1CCN(C)C1C1=CC=CN=C1.COC[C@@H]1CCN(C)C1C1=CC=CN=C1.[2H]B[U] Chemical compound CC1OC(=O)C(C)OC1=O.CCOC[C@@H]1CCN(C)C1C1=CC=CN=C1.COC[C@@H]1CCN(C)C1C1=CC=CN=C1.[2H]B[U] VWBOJJLQVNUMRI-BGVBTLRWSA-N 0.000 description 1
- WATCAJGZUGRCPO-QEVLCHTKSA-N CC1OC(=O)C(C)OC1=O.CN1CCC[C@H]1C1=CC=C(CCCC2CCC(C(=O)NCO)CC2)N=C1.COCNC(=O)C1CCC(CCCC2=CC=C([C@@H]3CCCN3C)C=N2)CC1 Chemical compound CC1OC(=O)C(C)OC1=O.CN1CCC[C@H]1C1=CC=C(CCCC2CCC(C(=O)NCO)CC2)N=C1.COCNC(=O)C1CCC(CCCC2=CC=C([C@@H]3CCCN3C)C=N2)CC1 WATCAJGZUGRCPO-QEVLCHTKSA-N 0.000 description 1
- AYQKGZKKIJVXPN-UHFFFAOYSA-N CC1OC(=O)C(C)OC1=O.OCCOCCCCN1CCCC1C1=CC=CN=C1.OCOCCCCN1CCCC1C1=CC=CN=C1 Chemical compound CC1OC(=O)C(C)OC1=O.OCCOCCCCN1CCCC1C1=CC=CN=C1.OCOCCCCN1CCCC1C1=CC=CN=C1 AYQKGZKKIJVXPN-UHFFFAOYSA-N 0.000 description 1
- ZLRARDFVOIZDGZ-UHFFFAOYSA-O CCC(=O)N(CCO)CCN(CC1CCN(C)C1C1=CC=CN=C1)C(=O)CC.CN1CCC(CCCCNCCO)C1C1=CC=CN=C1.O.[H+] Chemical compound CCC(=O)N(CCO)CCN(CC1CCN(C)C1C1=CC=CN=C1)C(=O)CC.CN1CCC(CCCCNCCO)C1C1=CC=CN=C1.O.[H+] ZLRARDFVOIZDGZ-UHFFFAOYSA-O 0.000 description 1
- QQVXDYQCROQTCX-HSYKALSRSA-N CCO.CN1CCC[C@H]1C1=CC=C(CCCC2CCC(C(=O)NCO)CC2)N=C1.CN1CCC[C@H]1C1=CC=C(CCCC2CCC(C(=O)O)CC2)N=C1 Chemical compound CCO.CN1CCC[C@H]1C1=CC=C(CCCC2CCC(C(=O)NCO)CC2)N=C1.CN1CCC[C@H]1C1=CC=C(CCCC2CCC(C(=O)O)CC2)N=C1 QQVXDYQCROQTCX-HSYKALSRSA-N 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- JDJFSWWBKQMRNR-UHFFFAOYSA-N CN(CCCC1CC(C2=CC=CN=C2)N(C)C1)CCCC1CC(C2=CC=CN=C2)N(C)C1.CN(CCCC1CC(C2=CC=CN=C2)N(C)C1=O)CCCC1CC(C2=CC=CN=C2)N(C)C1=O Chemical compound CN(CCCC1CC(C2=CC=CN=C2)N(C)C1)CCCC1CC(C2=CC=CN=C2)N(C)C1.CN(CCCC1CC(C2=CC=CN=C2)N(C)C1=O)CCCC1CC(C2=CC=CN=C2)N(C)C1=O JDJFSWWBKQMRNR-UHFFFAOYSA-N 0.000 description 1
- HBZQIYDSDMPEJU-UHFFFAOYSA-N CN.CN(CCCC1CC(C2=CC=CN=C2)N(C)C1=O)CCCC1CC(C2=CC=CN=C2)N(C)C1=O.Cl.[H]C(=O)CCC1CC(C2=CC=CN=C2)N(C)C1=O Chemical compound CN.CN(CCCC1CC(C2=CC=CN=C2)N(C)C1=O)CCCC1CC(C2=CC=CN=C2)N(C)C1=O.Cl.[H]C(=O)CCC1CC(C2=CC=CN=C2)N(C)C1=O HBZQIYDSDMPEJU-UHFFFAOYSA-N 0.000 description 1
- HMRJXFDHNDXBPO-UHFFFAOYSA-N CN1C(=O)C(CCC2OCCCO2)CC1C1=CC=CN=C1.[H]C(=O)CCC1CC(C2=CC=CN=C2)N(C)C1=O Chemical compound CN1C(=O)C(CCC2OCCCO2)CC1C1=CC=CN=C1.[H]C(=O)CCC1CC(C2=CC=CN=C2)N(C)C1=O HMRJXFDHNDXBPO-UHFFFAOYSA-N 0.000 description 1
- VAUWMBDCXHDITL-UHFFFAOYSA-N CN1C(=O)CC(C(=O)NCCO)C1C1=CC=CN=C1.CN1C(=O)CC(COC=O)C1C1=CC=CN=C1.NCCO Chemical compound CN1C(=O)CC(C(=O)NCCO)C1C1=CC=CN=C1.CN1C(=O)CC(COC=O)C1C1=CC=CN=C1.NCCO VAUWMBDCXHDITL-UHFFFAOYSA-N 0.000 description 1
- VMAKCODLNCDQKE-UHFFFAOYSA-N CN1C(=O)CC(C(=O)NCCO)C1C1=CC=CN=C1.CN1CCC(CNCCO)C1C1=CC=CN=C1 Chemical compound CN1C(=O)CC(C(=O)NCCO)C1C1=CC=CN=C1.CN1CCC(CNCCO)C1C1=CC=CN=C1 VMAKCODLNCDQKE-UHFFFAOYSA-N 0.000 description 1
- JITGYFLSMPSFRX-YGJXFZMTSA-N CN1C(=O)CC(C(=O)NCOC(=O)C2CC(=O)N(C)C2C2=CC=CN=C2)C1C1=CC=CN=C1.CN1C(=O)CC(C(=O)NCOC(=O)C2CC(=O)N(C)C2C2=CC=CN=C2)C1C1=CC=CN=C1.CN1CCC(CNCO)C1C1=CC=CN=C1.O=C=O.[2H]C#C.[H]C1CC(=O)N(C)C1C1=CC=CN=C1 Chemical compound CN1C(=O)CC(C(=O)NCOC(=O)C2CC(=O)N(C)C2C2=CC=CN=C2)C1C1=CC=CN=C1.CN1C(=O)CC(C(=O)NCOC(=O)C2CC(=O)N(C)C2C2=CC=CN=C2)C1C1=CC=CN=C1.CN1CCC(CNCO)C1C1=CC=CN=C1.O=C=O.[2H]C#C.[H]C1CC(=O)N(C)C1C1=CC=CN=C1 JITGYFLSMPSFRX-YGJXFZMTSA-N 0.000 description 1
- OWWIBQDFYOIQDK-CMLGFVDSSA-N CN1CC[C@H](CO)C1C1=CC=CN=C1.O=C1CCC(=O)O1.O=C=O.O=CC1=CC=CN=C1.[H]C1CC(=O)N(C)C1C1=CC=CN=C1 Chemical compound CN1CC[C@H](CO)C1C1=CC=CN=C1.O=C1CCC(=O)O1.O=C=O.O=CC1=CC=CN=C1.[H]C1CC(=O)N(C)C1C1=CC=CN=C1 OWWIBQDFYOIQDK-CMLGFVDSSA-N 0.000 description 1
- CHTXIHOYITWPHQ-UHFFFAOYSA-M COC(=O)CCCN1CCCC1C1=CC=CN=C1.O.[Li]CCCC.[Li]OC(=O)CCCN1CCCC1C1=CC=CN=C1 Chemical compound COC(=O)CCCN1CCCC1C1=CC=CN=C1.O.[Li]CCCC.[Li]OC(=O)CCCN1CCCC1C1=CC=CN=C1 CHTXIHOYITWPHQ-UHFFFAOYSA-M 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical class [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- PTHCMJGKKRQCBF-UHFFFAOYSA-N Cellulose, microcrystalline Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC)C(CO)O1 PTHCMJGKKRQCBF-UHFFFAOYSA-N 0.000 description 1
- 229920002101 Chitin Polymers 0.000 description 1
- 241000938605 Crocodylia Species 0.000 description 1
- 239000001879 Curdlan Substances 0.000 description 1
- 229920002558 Curdlan Polymers 0.000 description 1
- 229920000858 Cyclodextrin Polymers 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- 229930182843 D-Lactic acid Natural products 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- AEMOLEFTQBMNLQ-VANFPWTGSA-N D-mannopyranuronic acid Chemical compound OC1O[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@@H]1O AEMOLEFTQBMNLQ-VANFPWTGSA-N 0.000 description 1
- HMFHBZSHGGEWLO-SOOFDHNKSA-N D-ribofuranose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H]1O HMFHBZSHGGEWLO-SOOFDHNKSA-N 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- URXZXNYJPAJJOQ-UHFFFAOYSA-N Erucic acid Natural products CCCCCCC=CCCCCCCCCCCCC(O)=O URXZXNYJPAJJOQ-UHFFFAOYSA-N 0.000 description 1
- 239000004386 Erythritol Substances 0.000 description 1
- UNXHWFMMPAWVPI-UHFFFAOYSA-N Erythritol Natural products OCC(O)C(O)CO UNXHWFMMPAWVPI-UHFFFAOYSA-N 0.000 description 1
- VGGSQFUCUMXWEO-UHFFFAOYSA-N Ethene Chemical compound C=C VGGSQFUCUMXWEO-UHFFFAOYSA-N 0.000 description 1
- 239000005977 Ethylene Substances 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 108010040721 Flagellin Proteins 0.000 description 1
- 229930091371 Fructose Natural products 0.000 description 1
- 239000005715 Fructose Substances 0.000 description 1
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- IAJILQKETJEXLJ-UHFFFAOYSA-N Galacturonsaeure Natural products O=CC(O)C(O)C(O)C(O)C(O)=O IAJILQKETJEXLJ-UHFFFAOYSA-N 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- JZNWSCPGTDBMEW-UHFFFAOYSA-N Glycerophosphorylethanolamin Natural products NCCOP(O)(=O)OCC(O)CO JZNWSCPGTDBMEW-UHFFFAOYSA-N 0.000 description 1
- ZWZWYGMENQVNFU-UHFFFAOYSA-N Glycerophosphorylserin Natural products OC(=O)C(N)COP(O)(=O)OCC(O)CO ZWZWYGMENQVNFU-UHFFFAOYSA-N 0.000 description 1
- 108010007979 Glycocholic Acid Proteins 0.000 description 1
- 229920002527 Glycogen Polymers 0.000 description 1
- 108010015899 Glycopeptides Proteins 0.000 description 1
- 102000002068 Glycopeptides Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 101000831496 Homo sapiens Toll-like receptor 3 Proteins 0.000 description 1
- 101000669447 Homo sapiens Toll-like receptor 4 Proteins 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 229920001612 Hydroxyethyl starch Polymers 0.000 description 1
- 229920001202 Inulin Polymers 0.000 description 1
- 229920002752 Konjac Polymers 0.000 description 1
- 241000222727 Leishmania donovani Species 0.000 description 1
- 235000021353 Lignoceric acid Nutrition 0.000 description 1
- CQXMAMUUWHYSIY-UHFFFAOYSA-N Lignoceric acid Natural products CCCCCCCCCCCCCCCCCCCCCCCC(=O)OCCC1=CC=C(O)C=C1 CQXMAMUUWHYSIY-UHFFFAOYSA-N 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 241000712079 Measles morbillivirus Species 0.000 description 1
- CERQOIWHTDAKMF-UHFFFAOYSA-N Methacrylic acid Chemical compound CC(=C)C(O)=O CERQOIWHTDAKMF-UHFFFAOYSA-N 0.000 description 1
- VVQNEPGJFQJSBK-UHFFFAOYSA-N Methyl methacrylate Chemical compound COC(=O)C(C)=C VVQNEPGJFQJSBK-UHFFFAOYSA-N 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 241000711386 Mumps virus Species 0.000 description 1
- 241000186362 Mycobacterium leprae Species 0.000 description 1
- KWYHDKDOAIKMQN-UHFFFAOYSA-N N,N,N',N'-tetramethylethylenediamine Chemical compound CN(C)CCN(C)C KWYHDKDOAIKMQN-UHFFFAOYSA-N 0.000 description 1
- 239000007832 Na2SO4 Substances 0.000 description 1
- IGFHQQFPSIBGKE-UHFFFAOYSA-N Nonylphenol Natural products CCCCCCCCCC1=CC=C(O)C=C1 IGFHQQFPSIBGKE-UHFFFAOYSA-N 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- VFVASOGKTXABGI-UHFFFAOYSA-N O=C(O)CCC(=O)N1CCCC1C1=CC=CN=C1.OCCCCN1CCCC1C1=CC=CN=C1 Chemical compound O=C(O)CCC(=O)N1CCCC1C1=CC=CN=C1.OCCCCN1CCCC1C1=CC=CN=C1 VFVASOGKTXABGI-UHFFFAOYSA-N 0.000 description 1
- REYJJPSVUYRZGE-UHFFFAOYSA-N Octadecylamine Chemical compound CCCCCCCCCCCCCCCCCCN REYJJPSVUYRZGE-UHFFFAOYSA-N 0.000 description 1
- 239000005642 Oleic acid Substances 0.000 description 1
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 description 1
- 235000021314 Palmitic acid Nutrition 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 1
- RVGRUAULSDPKGF-UHFFFAOYSA-N Poloxamer Chemical compound C1CO1.CC1CO1 RVGRUAULSDPKGF-UHFFFAOYSA-N 0.000 description 1
- 229920006022 Poly(L-lactide-co-glycolide)-b-poly(ethylene glycol) Polymers 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 108010039918 Polylysine Proteins 0.000 description 1
- 229920001710 Polyorthoester Polymers 0.000 description 1
- 239000004721 Polyphenylene oxide Substances 0.000 description 1
- 229920001214 Polysorbate 60 Polymers 0.000 description 1
- 229920002642 Polysorbate 65 Polymers 0.000 description 1
- 229920002651 Polysorbate 85 Polymers 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- 229920002396 Polyurea Polymers 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 239000004373 Pullulan Substances 0.000 description 1
- 229920001218 Pullulan Polymers 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 241000725643 Respiratory syncytial virus Species 0.000 description 1
- PYMYPHUHKUWMLA-LMVFSUKVSA-N Ribose Natural products OC[C@@H](O)[C@@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-LMVFSUKVSA-N 0.000 description 1
- 241000710799 Rubella virus Species 0.000 description 1
- 229920002125 Sokalan® Polymers 0.000 description 1
- 241001135759 Sphingomonas sp. Species 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- UCKMPCXJQFINFW-UHFFFAOYSA-N Sulphide Chemical compound [S-2] UCKMPCXJQFINFW-UHFFFAOYSA-N 0.000 description 1
- 230000006044 T cell activation Effects 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 108010060825 Toll-Like Receptor 7 Proteins 0.000 description 1
- 102000008235 Toll-Like Receptor 9 Human genes 0.000 description 1
- 108010060818 Toll-Like Receptor 9 Proteins 0.000 description 1
- 102100024324 Toll-like receptor 3 Human genes 0.000 description 1
- 102100039360 Toll-like receptor 4 Human genes 0.000 description 1
- 102100039390 Toll-like receptor 7 Human genes 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Natural products NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 1
- LEHOTFFKMJEONL-UHFFFAOYSA-N Uric Acid Chemical compound N1C(=O)NC(=O)C2=C1NC(=O)N2 LEHOTFFKMJEONL-UHFFFAOYSA-N 0.000 description 1
- 238000005411 Van der Waals force Methods 0.000 description 1
- 108020000999 Viral RNA Proteins 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 1
- DHKHKXVYLBGOIT-UHFFFAOYSA-N acetaldehyde Diethyl Acetal Natural products CCOC(C)OCC DHKHKXVYLBGOIT-UHFFFAOYSA-N 0.000 description 1
- 150000001241 acetals Chemical class 0.000 description 1
- VUBTYKDZOQNADH-UHFFFAOYSA-N acetyl hexadecanoate Chemical compound CCCCCCCCCCCCCCCC(=O)OC(C)=O VUBTYKDZOQNADH-UHFFFAOYSA-N 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 239000011149 active material Substances 0.000 description 1
- 125000002015 acyclic group Chemical group 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N adenyl group Chemical class N1=CN=C2N=CNC2=C1N GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- 125000003158 alcohol group Chemical group 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- JAZBEHYOTPTENJ-JLNKQSITSA-N all-cis-5,8,11,14,17-icosapentaenoic acid Chemical compound CC\C=C/C\C=C/C\C=C/C\C=C/C\C=C/CCCC(O)=O JAZBEHYOTPTENJ-JLNKQSITSA-N 0.000 description 1
- 239000013566 allergen Substances 0.000 description 1
- 230000000961 alloantigen Effects 0.000 description 1
- 229940087168 alpha tocopherol Drugs 0.000 description 1
- HMFHBZSHGGEWLO-UHFFFAOYSA-N alpha-D-Furanose-Ribose Natural products OCC1OC(O)C(O)C1O HMFHBZSHGGEWLO-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
- AZDRQVAHHNSJOQ-UHFFFAOYSA-N alumane Chemical class [AlH3] AZDRQVAHHNSJOQ-UHFFFAOYSA-N 0.000 description 1
- 150000003863 ammonium salts Chemical class 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 150000001449 anionic compounds Chemical class 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 239000002518 antifoaming agent Substances 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 239000003434 antitussive agent Substances 0.000 description 1
- 229940124584 antitussives Drugs 0.000 description 1
- 239000012062 aqueous buffer Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- PYMYPHUHKUWMLA-WDCZJNDASA-N arabinose Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)C=O PYMYPHUHKUWMLA-WDCZJNDASA-N 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 239000012298 atmosphere Substances 0.000 description 1
- 238000010533 azeotropic distillation Methods 0.000 description 1
- 150000001541 aziridines Chemical class 0.000 description 1
- 230000006399 behavior Effects 0.000 description 1
- 235000010233 benzoic acid Nutrition 0.000 description 1
- MSWZFWKMSRAUBD-UHFFFAOYSA-N beta-D-galactosamine Natural products NC1C(O)OC(CO)C(O)C1O MSWZFWKMSRAUBD-UHFFFAOYSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- 239000003181 biological factor Substances 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 229910052796 boron Inorganic materials 0.000 description 1
- 150000001719 carbohydrate derivatives Chemical class 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 150000007942 carboxylates Chemical group 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 229920001525 carrageenan Polymers 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 238000006555 catalytic reaction Methods 0.000 description 1
- 230000008568 cell cell communication Effects 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 229930183167 cerebroside Natural products 0.000 description 1
- 150000001784 cerebrosides Chemical class 0.000 description 1
- 230000003196 chaotropic effect Effects 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 239000002575 chemical warfare agent Substances 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 150000001840 cholesterol esters Chemical class 0.000 description 1
- UWHZIFQPPBDJPM-FPLPWBNLSA-N cis-vaccenic acid Chemical compound CCCCCC\C=C/CCCCCCCCCC(O)=O UWHZIFQPPBDJPM-FPLPWBNLSA-N 0.000 description 1
- 238000005354 coacervation Methods 0.000 description 1
- 239000011247 coating layer Substances 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 239000012230 colorless oil Substances 0.000 description 1
- 238000004891 communication Methods 0.000 description 1
- 230000024203 complement activation Effects 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 239000000498 cooling water Substances 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 235000019316 curdlan Nutrition 0.000 description 1
- 229940078035 curdlan Drugs 0.000 description 1
- 229940097362 cyclodextrins Drugs 0.000 description 1
- VZFUCHSFHOYXIS-UHFFFAOYSA-N cycloheptane carboxylic acid Natural products OC(=O)C1CCCCCC1 VZFUCHSFHOYXIS-UHFFFAOYSA-N 0.000 description 1
- 239000000409 cytokine receptor agonist Substances 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 150000001982 diacylglycerols Chemical class 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- RNPXCFINMKSQPQ-UHFFFAOYSA-N dicetyl hydrogen phosphate Chemical compound CCCCCCCCCCCCCCCCOP(O)(=O)OCCCCCCCCCCCCCCCC RNPXCFINMKSQPQ-UHFFFAOYSA-N 0.000 description 1
- 229940093541 dicetylphosphate Drugs 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 229960003983 diphtheria toxoid Drugs 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000016097 disease of metabolism Diseases 0.000 description 1
- ZGSPNIOCEDOHGS-UHFFFAOYSA-L disodium [3-[2,3-di(octadeca-9,12-dienoyloxy)propoxy-oxidophosphoryl]oxy-2-hydroxypropyl] 2,3-di(octadeca-9,12-dienoyloxy)propyl phosphate Chemical compound [Na+].[Na+].CCCCCC=CCC=CCCCCCCCC(=O)OCC(OC(=O)CCCCCCCC=CCC=CCCCCC)COP([O-])(=O)OCC(O)COP([O-])(=O)OCC(OC(=O)CCCCCCCC=CCC=CCCCCC)COC(=O)CCCCCCCC=CCC=CCCCCC ZGSPNIOCEDOHGS-UHFFFAOYSA-L 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- MBMBGCFOFBJSGT-KUBAVDMBSA-N docosahexaenoic acid Natural products CC\C=C/C\C=C/C\C=C/C\C=C/C\C=C/C\C=C/CCC(O)=O MBMBGCFOFBJSGT-KUBAVDMBSA-N 0.000 description 1
- JRBPAEWTRLWTQC-UHFFFAOYSA-N dodecylamine Chemical compound CCCCCCCCCCCCN JRBPAEWTRLWTQC-UHFFFAOYSA-N 0.000 description 1
- 239000011363 dried mixture Substances 0.000 description 1
- JAZBEHYOTPTENJ-UHFFFAOYSA-N eicosapentaenoic acid Natural products CCC=CCC=CCC=CCC=CCC=CCCCC(O)=O JAZBEHYOTPTENJ-UHFFFAOYSA-N 0.000 description 1
- 238000004945 emulsification Methods 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- DPUOLQHDNGRHBS-KTKRTIGZSA-N erucic acid Chemical compound CCCCCCCC\C=C/CCCCCCCCCCCC(O)=O DPUOLQHDNGRHBS-KTKRTIGZSA-N 0.000 description 1
- 235000019414 erythritol Nutrition 0.000 description 1
- 229940009714 erythritol Drugs 0.000 description 1
- UNXHWFMMPAWVPI-ZXZARUISSA-N erythritol Chemical compound OC[C@H](O)[C@H](O)CO UNXHWFMMPAWVPI-ZXZARUISSA-N 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- FARYTWBWLZAXNK-WAYWQWQTSA-N ethyl (z)-3-(methylamino)but-2-enoate Chemical compound CCOC(=O)\C=C(\C)NC FARYTWBWLZAXNK-WAYWQWQTSA-N 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 150000002191 fatty alcohols Chemical class 0.000 description 1
- 239000012065 filter cake Substances 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- LQJBNNIYVWPHFW-QXMHVHEDSA-N gadoleic acid Chemical compound CCCCCCCCCC\C=C/CCCCCCCC(O)=O LQJBNNIYVWPHFW-QXMHVHEDSA-N 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- VZCCETWTMQHEPK-UHFFFAOYSA-N gamma-Linolensaeure Natural products CCCCCC=CCC=CCC=CCCCCC(O)=O VZCCETWTMQHEPK-UHFFFAOYSA-N 0.000 description 1
- VZCCETWTMQHEPK-QNEBEIHSSA-N gamma-linolenic acid Chemical compound CCCCC\C=C/C\C=C/C\C=C/CCCCC(O)=O VZCCETWTMQHEPK-QNEBEIHSSA-N 0.000 description 1
- 229960002518 gentamicin Drugs 0.000 description 1
- 229960002442 glucosamine Drugs 0.000 description 1
- 150000002327 glycerophospholipids Chemical class 0.000 description 1
- RFDAIACWWDREDC-FRVQLJSFSA-N glycocholic acid Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCC(O)=O)C)[C@@]2(C)[C@@H](O)C1 RFDAIACWWDREDC-FRVQLJSFSA-N 0.000 description 1
- 229940096919 glycogen Drugs 0.000 description 1
- 150000002339 glycosphingolipids Chemical class 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 229920000578 graft copolymer Polymers 0.000 description 1
- 150000004820 halides Chemical class 0.000 description 1
- 231100001261 hazardous Toxicity 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 208000002672 hepatitis B Diseases 0.000 description 1
- 229920002674 hyaluronan Polymers 0.000 description 1
- 229960003160 hyaluronic acid Drugs 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 description 1
- DNZMDASEFMLYBU-RNBXVSKKSA-N hydroxyethyl starch Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@@H]1O.OCCOC[C@H]1O[C@H](OCCO)[C@H](OCCO)[C@@H](OCCO)[C@@H]1OCCO DNZMDASEFMLYBU-RNBXVSKKSA-N 0.000 description 1
- 229940050526 hydroxyethylstarch Drugs 0.000 description 1
- 150000002466 imines Chemical class 0.000 description 1
- 229960002751 imiquimod Drugs 0.000 description 1
- DOUYETYNHWVLEO-UHFFFAOYSA-N imiquimod Chemical compound C1=CC=CC2=C3N(CC(C)C)C=NC3=C(N)N=C21 DOUYETYNHWVLEO-UHFFFAOYSA-N 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000008102 immune modulation Effects 0.000 description 1
- 208000026278 immune system disease Diseases 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 239000012442 inert solvent Substances 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 239000002198 insoluble material Substances 0.000 description 1
- 230000008611 intercellular interaction Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- JYJIGFIDKWBXDU-MNNPPOADSA-N inulin Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)OC[C@]1(OC[C@]2(OC[C@]3(OC[C@]4(OC[C@]5(OC[C@]6(OC[C@]7(OC[C@]8(OC[C@]9(OC[C@]%10(OC[C@]%11(OC[C@]%12(OC[C@]%13(OC[C@]%14(OC[C@]%15(OC[C@]%16(OC[C@]%17(OC[C@]%18(OC[C@]%19(OC[C@]%20(OC[C@]%21(OC[C@]%22(OC[C@]%23(OC[C@]%24(OC[C@]%25(OC[C@]%26(OC[C@]%27(OC[C@]%28(OC[C@]%29(OC[C@]%30(OC[C@]%31(OC[C@]%32(OC[C@]%33(OC[C@]%34(OC[C@]%35(OC[C@]%36(O[C@@H]%37[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O%37)O)[C@H]([C@H](O)[C@@H](CO)O%36)O)[C@H]([C@H](O)[C@@H](CO)O%35)O)[C@H]([C@H](O)[C@@H](CO)O%34)O)[C@H]([C@H](O)[C@@H](CO)O%33)O)[C@H]([C@H](O)[C@@H](CO)O%32)O)[C@H]([C@H](O)[C@@H](CO)O%31)O)[C@H]([C@H](O)[C@@H](CO)O%30)O)[C@H]([C@H](O)[C@@H](CO)O%29)O)[C@H]([C@H](O)[C@@H](CO)O%28)O)[C@H]([C@H](O)[C@@H](CO)O%27)O)[C@H]([C@H](O)[C@@H](CO)O%26)O)[C@H]([C@H](O)[C@@H](CO)O%25)O)[C@H]([C@H](O)[C@@H](CO)O%24)O)[C@H]([C@H](O)[C@@H](CO)O%23)O)[C@H]([C@H](O)[C@@H](CO)O%22)O)[C@H]([C@H](O)[C@@H](CO)O%21)O)[C@H]([C@H](O)[C@@H](CO)O%20)O)[C@H]([C@H](O)[C@@H](CO)O%19)O)[C@H]([C@H](O)[C@@H](CO)O%18)O)[C@H]([C@H](O)[C@@H](CO)O%17)O)[C@H]([C@H](O)[C@@H](CO)O%16)O)[C@H]([C@H](O)[C@@H](CO)O%15)O)[C@H]([C@H](O)[C@@H](CO)O%14)O)[C@H]([C@H](O)[C@@H](CO)O%13)O)[C@H]([C@H](O)[C@@H](CO)O%12)O)[C@H]([C@H](O)[C@@H](CO)O%11)O)[C@H]([C@H](O)[C@@H](CO)O%10)O)[C@H]([C@H](O)[C@@H](CO)O9)O)[C@H]([C@H](O)[C@@H](CO)O8)O)[C@H]([C@H](O)[C@@H](CO)O7)O)[C@H]([C@H](O)[C@@H](CO)O6)O)[C@H]([C@H](O)[C@@H](CO)O5)O)[C@H]([C@H](O)[C@@H](CO)O4)O)[C@H]([C@H](O)[C@@H](CO)O3)O)[C@H]([C@H](O)[C@@H](CO)O2)O)[C@@H](O)[C@H](O)[C@@H](CO)O1 JYJIGFIDKWBXDU-MNNPPOADSA-N 0.000 description 1
- 229940029339 inulin Drugs 0.000 description 1
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 description 1
- 235000010485 konjac Nutrition 0.000 description 1
- 239000000252 konjac Substances 0.000 description 1
- 239000000832 lactitol Substances 0.000 description 1
- 235000010448 lactitol Nutrition 0.000 description 1
- VQHSOMBJVWLPSR-JVCRWLNRSA-N lactitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O VQHSOMBJVWLPSR-JVCRWLNRSA-N 0.000 description 1
- 229960003451 lactitol Drugs 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 159000000002 lithium salts Chemical class 0.000 description 1
- 210000003141 lower extremity Anatomy 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- 239000000845 maltitol Substances 0.000 description 1
- 235000010449 maltitol Nutrition 0.000 description 1
- VQHSOMBJVWLPSR-WUJBLJFYSA-N maltitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O VQHSOMBJVWLPSR-WUJBLJFYSA-N 0.000 description 1
- 229940035436 maltitol Drugs 0.000 description 1
- 229960001855 mannitol Drugs 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 1
- 150000002739 metals Chemical class 0.000 description 1
- 229920003145 methacrylic acid copolymer Polymers 0.000 description 1
- 125000005397 methacrylic acid ester group Chemical group 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 239000003094 microcapsule Substances 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 238000003801 milling Methods 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- QAPAPLIQQTVEJZ-UHFFFAOYSA-N n-[(3-fluorophenyl)methyl]ethanamine Chemical compound CCNCC1=CC=CC(F)=C1 QAPAPLIQQTVEJZ-UHFFFAOYSA-N 0.000 description 1
- 239000002070 nanowire Substances 0.000 description 1
- 230000001338 necrotic effect Effects 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- SNQQPOLDUKLAAF-UHFFFAOYSA-N nonylphenol Chemical compound CCCCCCCCCC1=CC=CC=C1O SNQQPOLDUKLAAF-UHFFFAOYSA-N 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 239000004533 oil dispersion Substances 0.000 description 1
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 1
- 150000002889 oleic acids Chemical class 0.000 description 1
- 230000014207 opsonization Effects 0.000 description 1
- 239000012044 organic layer Substances 0.000 description 1
- 229920000620 organic polymer Polymers 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 238000010979 pH adjustment Methods 0.000 description 1
- SECPZKHBENQXJG-FPLPWBNLSA-N palmitoleic acid Chemical compound CCCCCC\C=C/CCCCCCCC(O)=O SECPZKHBENQXJG-FPLPWBNLSA-N 0.000 description 1
- 125000000913 palmityl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 244000045947 parasite Species 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 238000005191 phase separation Methods 0.000 description 1
- 229960005323 phenoxyethanol Drugs 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical class [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000008055 phosphate buffer solution Substances 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 150000008105 phosphatidylcholines Chemical class 0.000 description 1
- 150000008104 phosphatidylethanolamines Chemical class 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 235000011007 phosphoric acid Nutrition 0.000 description 1
- 229960000502 poloxamer Drugs 0.000 description 1
- 229920000962 poly(amidoamine) Polymers 0.000 description 1
- 229940065514 poly(lactide) Drugs 0.000 description 1
- 229920002627 poly(phosphazenes) Polymers 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 229920000768 polyamine Polymers 0.000 description 1
- 229920000573 polyethylene Polymers 0.000 description 1
- 235000010989 polyoxyethylene sorbitan monostearate Nutrition 0.000 description 1
- 239000001818 polyoxyethylene sorbitan monostearate Substances 0.000 description 1
- 235000010988 polyoxyethylene sorbitan tristearate Nutrition 0.000 description 1
- 239000001816 polyoxyethylene sorbitan tristearate Substances 0.000 description 1
- 229920001299 polypropylene fumarate Polymers 0.000 description 1
- 229940113124 polysorbate 60 Drugs 0.000 description 1
- 229940099511 polysorbate 65 Drugs 0.000 description 1
- 229940113171 polysorbate 85 Drugs 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 229920006295 polythiol Polymers 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 235000015320 potassium carbonate Nutrition 0.000 description 1
- 239000001103 potassium chloride Substances 0.000 description 1
- 235000011164 potassium chloride Nutrition 0.000 description 1
- TYJJADVDDVDEDZ-UHFFFAOYSA-M potassium hydrogencarbonate Chemical compound [K+].OC([O-])=O TYJJADVDDVDEDZ-UHFFFAOYSA-M 0.000 description 1
- 159000000001 potassium salts Chemical class 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 238000000425 proton nuclear magnetic resonance spectrum Methods 0.000 description 1
- 235000019423 pullulan Nutrition 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 239000008213 purified water Substances 0.000 description 1
- QJZUKDFHGGYHMC-UHFFFAOYSA-N pyridine-3-carbaldehyde Chemical compound O=CC1=CC=CN=C1 QJZUKDFHGGYHMC-UHFFFAOYSA-N 0.000 description 1
- 125000001453 quaternary ammonium group Chemical group 0.000 description 1
- 229920013730 reactive polymer Polymers 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 238000006722 reduction reaction Methods 0.000 description 1
- 238000005932 reductive alkylation reaction Methods 0.000 description 1
- 230000015227 regulation of liquid surface tension Effects 0.000 description 1
- 238000012429 release testing Methods 0.000 description 1
- 239000002342 ribonucleoside Substances 0.000 description 1
- WBHHMMIMDMUBKC-QJWNTBNXSA-M ricinoleate Chemical compound CCCCCC[C@@H](O)C\C=C/CCCCCCCC([O-])=O WBHHMMIMDMUBKC-QJWNTBNXSA-M 0.000 description 1
- 229940066675 ricinoleate Drugs 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 239000000932 sedative agent Substances 0.000 description 1
- 230000001624 sedative effect Effects 0.000 description 1
- 239000004065 semiconductor Substances 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- BEOOHQFXGBMRKU-UHFFFAOYSA-N sodium cyanoborohydride Chemical compound [Na+].[B-]C#N BEOOHQFXGBMRKU-UHFFFAOYSA-N 0.000 description 1
- FHHPUSMSKHSNKW-SMOYURAASA-M sodium deoxycholate Chemical compound [Na+].C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC([O-])=O)C)[C@@]2(C)[C@@H](O)C1 FHHPUSMSKHSNKW-SMOYURAASA-M 0.000 description 1
- 239000012321 sodium triacetoxyborohydride Substances 0.000 description 1
- 238000000935 solvent evaporation Methods 0.000 description 1
- 238000000638 solvent extraction Methods 0.000 description 1
- 229940035044 sorbitan monolaurate Drugs 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 229960002920 sorbitol Drugs 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000000021 stimulant Substances 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- UIUJIQZEACWQSV-UHFFFAOYSA-N succinic semialdehyde Chemical compound OC(=O)CCC=O UIUJIQZEACWQSV-UHFFFAOYSA-N 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000005846 sugar alcohols Chemical class 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L sulfate group Chemical group S(=O)(=O)([O-])[O-] QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- NJGWOFRZMQRKHT-UHFFFAOYSA-N surfactin Natural products CC(C)CCCCCCCCCC1CC(=O)NC(CCC(O)=O)C(=O)NC(CC(C)C)C(=O)NC(CC(C)C)C(=O)NC(C(C)C)C(=O)NC(CC(O)=O)C(=O)NC(CC(C)C)C(=O)NC(CC(C)C)C(=O)O1 NJGWOFRZMQRKHT-UHFFFAOYSA-N 0.000 description 1
- NJGWOFRZMQRKHT-WGVNQGGSSA-N surfactin C Chemical compound CC(C)CCCCCCCCC[C@@H]1CC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)O1 NJGWOFRZMQRKHT-WGVNQGGSSA-N 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 229920001059 synthetic polymer Polymers 0.000 description 1
- 229960000814 tetanus toxoid Drugs 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 150000003553 thiiranes Chemical class 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 150000003568 thioethers Chemical class 0.000 description 1
- 229910052718 tin Inorganic materials 0.000 description 1
- 229960000984 tocofersolan Drugs 0.000 description 1
- 229940125725 tranquilizer Drugs 0.000 description 1
- 239000003204 tranquilizing agent Substances 0.000 description 1
- 230000002936 tranquilizing effect Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 229920001664 tyloxapol Polymers 0.000 description 1
- MDYZKJNTKZIUSK-UHFFFAOYSA-N tyloxapol Chemical compound O=C.C1CO1.CC(C)(C)CC(C)(C)C1=CC=C(O)C=C1 MDYZKJNTKZIUSK-UHFFFAOYSA-N 0.000 description 1
- 229960004224 tyloxapol Drugs 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 238000002255 vaccination Methods 0.000 description 1
- 239000012646 vaccine adjuvant Substances 0.000 description 1
- 229940124931 vaccine adjuvant Drugs 0.000 description 1
- 238000005292 vacuum distillation Methods 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 239000003643 water by type Substances 0.000 description 1
- 238000010626 work up procedure Methods 0.000 description 1
- 238000002424 x-ray crystallography Methods 0.000 description 1
- 229920001285 xanthan gum Polymers 0.000 description 1
- 239000000811 xylitol Substances 0.000 description 1
- 235000010447 xylitol Nutrition 0.000 description 1
- 229960002675 xylitol Drugs 0.000 description 1
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 1
- 239000002076 α-tocopherol Substances 0.000 description 1
- 235000004835 α-tocopherol Nutrition 0.000 description 1
Classifications
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B82—NANOTECHNOLOGY
- B82Y—SPECIFIC USES OR APPLICATIONS OF NANOSTRUCTURES; MEASUREMENT OR ANALYSIS OF NANOSTRUCTURES; MANUFACTURE OR TREATMENT OF NANOSTRUCTURES
- B82Y5/00—Nanobiotechnology or nanomedicine, e.g. protein engineering or drug delivery
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0013—Therapeutic immunisation against small organic molecules, e.g. cocaine, nicotine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/385—Haptens or antigens, bound to carriers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/56—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
- A61K47/59—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/56—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
- A61K47/59—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
- A61K47/60—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/30—Drugs for disorders of the nervous system for treating abuse or dependence
- A61P25/34—Tobacco-abuse
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D401/00—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
- C07D401/02—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings
- C07D401/04—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings directly linked by a ring-member-to-ring-member bond
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08G—MACROMOLECULAR COMPOUNDS OBTAINED OTHERWISE THAN BY REACTIONS ONLY INVOLVING UNSATURATED CARBON-TO-CARBON BONDS
- C08G65/00—Macromolecular compounds obtained by reactions forming an ether link in the main chain of the macromolecule
- C08G65/02—Macromolecular compounds obtained by reactions forming an ether link in the main chain of the macromolecule from cyclic ethers by opening of the heterocyclic ring
- C08G65/26—Macromolecular compounds obtained by reactions forming an ether link in the main chain of the macromolecule from cyclic ethers by opening of the heterocyclic ring from cyclic ethers and other compounds
- C08G65/2603—Macromolecular compounds obtained by reactions forming an ether link in the main chain of the macromolecule from cyclic ethers by opening of the heterocyclic ring from cyclic ethers and other compounds the other compounds containing oxygen
- C08G65/2606—Macromolecular compounds obtained by reactions forming an ether link in the main chain of the macromolecule from cyclic ethers by opening of the heterocyclic ring from cyclic ethers and other compounds the other compounds containing oxygen containing hydroxyl groups
- C08G65/2609—Macromolecular compounds obtained by reactions forming an ether link in the main chain of the macromolecule from cyclic ethers by opening of the heterocyclic ring from cyclic ethers and other compounds the other compounds containing oxygen containing hydroxyl groups containing aliphatic hydroxyl groups
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08G—MACROMOLECULAR COMPOUNDS OBTAINED OTHERWISE THAN BY REACTIONS ONLY INVOLVING UNSATURATED CARBON-TO-CARBON BONDS
- C08G65/00—Macromolecular compounds obtained by reactions forming an ether link in the main chain of the macromolecule
- C08G65/02—Macromolecular compounds obtained by reactions forming an ether link in the main chain of the macromolecule from cyclic ethers by opening of the heterocyclic ring
- C08G65/26—Macromolecular compounds obtained by reactions forming an ether link in the main chain of the macromolecule from cyclic ethers by opening of the heterocyclic ring from cyclic ethers and other compounds
- C08G65/2618—Macromolecular compounds obtained by reactions forming an ether link in the main chain of the macromolecule from cyclic ethers by opening of the heterocyclic ring from cyclic ethers and other compounds the other compounds containing nitrogen
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08G—MACROMOLECULAR COMPOUNDS OBTAINED OTHERWISE THAN BY REACTIONS ONLY INVOLVING UNSATURATED CARBON-TO-CARBON BONDS
- C08G65/00—Macromolecular compounds obtained by reactions forming an ether link in the main chain of the macromolecule
- C08G65/02—Macromolecular compounds obtained by reactions forming an ether link in the main chain of the macromolecule from cyclic ethers by opening of the heterocyclic ring
- C08G65/32—Polymers modified by chemical after-treatment
- C08G65/329—Polymers modified by chemical after-treatment with organic compounds
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08G—MACROMOLECULAR COMPOUNDS OBTAINED OTHERWISE THAN BY REACTIONS ONLY INVOLVING UNSATURATED CARBON-TO-CARBON BONDS
- C08G65/00—Macromolecular compounds obtained by reactions forming an ether link in the main chain of the macromolecule
- C08G65/02—Macromolecular compounds obtained by reactions forming an ether link in the main chain of the macromolecule from cyclic ethers by opening of the heterocyclic ring
- C08G65/32—Polymers modified by chemical after-treatment
- C08G65/329—Polymers modified by chemical after-treatment with organic compounds
- C08G65/333—Polymers modified by chemical after-treatment with organic compounds containing nitrogen
- C08G65/33303—Polymers modified by chemical after-treatment with organic compounds containing nitrogen containing amino group
- C08G65/33317—Polymers modified by chemical after-treatment with organic compounds containing nitrogen containing amino group heterocyclic
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08G—MACROMOLECULAR COMPOUNDS OBTAINED OTHERWISE THAN BY REACTIONS ONLY INVOLVING UNSATURATED CARBON-TO-CARBON BONDS
- C08G65/00—Macromolecular compounds obtained by reactions forming an ether link in the main chain of the macromolecule
- C08G65/02—Macromolecular compounds obtained by reactions forming an ether link in the main chain of the macromolecule from cyclic ethers by opening of the heterocyclic ring
- C08G65/32—Polymers modified by chemical after-treatment
- C08G65/329—Polymers modified by chemical after-treatment with organic compounds
- C08G65/333—Polymers modified by chemical after-treatment with organic compounds containing nitrogen
- C08G65/33396—Polymers modified by chemical after-treatment with organic compounds containing nitrogen having oxygen in addition to nitrogen
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08G—MACROMOLECULAR COMPOUNDS OBTAINED OTHERWISE THAN BY REACTIONS ONLY INVOLVING UNSATURATED CARBON-TO-CARBON BONDS
- C08G73/00—Macromolecular compounds obtained by reactions forming a linkage containing nitrogen with or without oxygen or carbon in the main chain of the macromolecule, not provided for in groups C08G12/00 - C08G71/00
- C08G73/02—Polyamines
- C08G73/0206—Polyalkylene(poly)amines
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08G—MACROMOLECULAR COMPOUNDS OBTAINED OTHERWISE THAN BY REACTIONS ONLY INVOLVING UNSATURATED CARBON-TO-CARBON BONDS
- C08G73/00—Macromolecular compounds obtained by reactions forming a linkage containing nitrogen with or without oxygen or carbon in the main chain of the macromolecule, not provided for in groups C08G12/00 - C08G71/00
- C08G73/02—Polyamines
- C08G73/0233—Polyamines derived from (poly)oxazolines, (poly)oxazines or having pendant acyl groups
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08L—COMPOSITIONS OF MACROMOLECULAR COMPOUNDS
- C08L2203/00—Applications
- C08L2203/02—Applications for biomedical use
Definitions
- compositions and methods that provide chemical compounds, compositions, and related methods that provide chemical structures to present the nicotinic structures and analogs.
- a compound comprising:
- R 1 is a linker connecting any atom in the nicotine residue to G;
- G and Q are independently oxygen, sulfur, —NH—, or —NR—, wherein R comprises alkyl, substituted alkyl, acyl, aryl, or substituted aryl;
- R2, R3, R4, and R5, independently, are H or an alkyl group; or R2 and R3, independently, are oxygen and R4 and R5, independently, are H or an alkyl group; or R4 and R5, independently, are oxygen and R2 and R3, independently, are H or an alkyl group;
- n is an integer ranging from 1 to 500; with the proviso that if R 1 is covalently bound to a methyl residue present at the pyrrolidine nitrogen at position 1′ of the nicotine residue, then m is an integer ranging from 50-500; and
- n is the number of polymeric moieties of
- R 1 is either absent or comprises substituted or unsubstituted C1-C18 alkene or alkane, substituted or unsubstituted C1-C18 alkoxy, substituted or unsubstituted alkylamino, substituted or unsubstituted alkylthio, substituted or unsubstituted aryl, substituted or unsubstituted alkylaryl, substituted or unsubstituted heterocycle or substituted or unsubstituted alkylheterocycle.
- R 2 comprises H, substituted or unsubstituted C1-C18 alkene or alkane, substituted or unsubstituted C1-C18 alkoxy, substituted or unsubstituted alkylamino, substituted or unsubstituted alkylthio, substituted or unsubstituted aryl, substituted or unsubstituted alkylaryl, substituted or unsubstituted heterocycle, substituted or unsubstituted alkylheterocyclic.
- R 3 comprises H, substituted or unsubstituted C1-C18 alkene or alkane, substituted or unsubstituted C1-C18 alkoxy, substituted or unsubstituted alkylamino, substituted or unsubstituted alkylthio, substituted or unsubstituted aryl, substituted or unsubstituted alkylaryl, substituted or unsubstituted heterocycle, substituted or unsubstituted alkylheterocyclic.
- R 4 comprises H, substituted or unsubstituted C1-C18 alkene or alkane, substituted or unsubstituted C1-C18 alkoxy, substituted or unsubstituted alkylamino, substituted or unsubstituted alkylthio, substituted or unsubstituted aryl, substituted or unsubstituted alkylaryl, substituted or unsubstituted heterocycle, substituted or unsubstituted alkylheterocyclic.
- R 5 comprises H, substituted or unsubstituted C1-C18 alkene or alkane, substituted or unsubstituted C1-C18 alkoxy, substituted or unsubstituted alkylamino, substituted or unsubstituted alkylthio, substituted or unsubstituted aryl, substituted or unsubstituted alkylaryl, substituted or unsubstituted heterocycle, substituted or unsubstituted alkylheterocyclic.
- G comprises oxygen. In another embodiment, G comprises sulfur. In yet another embodiment, G comprises nitrogen.
- Q comprises oxygen. In another embodiment, Q comprises sulfur. In still another embodiment, Q comprises nitrogen.
- m ranges from 20 to 500. In another embodiment, m ranges from 50 to 500. In still another embodiment, m ranges from 100 to 500. In yet another embodiment, m ranges from 200 to 500.
- n is an integer ranging from 1 to 12. In another embodiment, n ranges from 1 to 5. In yet another embodiment, n ranges from 1 to 2. In still another embodiment, n equals 1.
- R 1 comprises C 1 -C 6
- G and Q comprise oxygen
- R 2 , R 3 , R 4 , and R 5 comprise hydrogen
- m ranges from 45 to 180
- n equals 1.
- the nicotine residue comprises optically pure (+)-(2′R, 3′R) or ( ⁇ )-(2′S, 3′S)-hydroxylmethyl nicotine derivatives.
- P 1 is a polymer comprising monomeric residues of unsubstituted or substituted ethylene oxide, ethylene sulfide and/or ethyleneimine, and copolymers thereof, with the proviso that if R 1 is covalently bound to a methyl residue present at the pyrrolidine nitrogen at position 1′ of the nicotine residue, then P 1 is not a polymer comprising 1-40 monomeric residues of unsubstituted ethylene oxide;
- G and Q are independently oxygen, sulfur, —NH—, or —NR—, wherein R comprises alkyl, substituted alkyl, acyl, aryl, or substituted aryl;
- R 1 is a linker connecting any atom in the nicotine residue to polymer P 1 through G;
- P 2 is a second polymer covalently attached to Q
- n is the number of polymeric moieties of —[R 1 -G-P 1 -Q-P 2 ] connected to the nicotine residue is provided.
- P 1 comprises monomeric residues of unsubstituted or substituted ethylene oxide.
- the ethylene oxide is substituted with C 1 -C 6 alkyl or aryl.
- P 1 comprises monomeric residues of unsubstituted or substituted ethylene sulfide.
- the ethylene sulfide is substituted with C 1 -C 6 alkyl or aryl.
- P 1 comprises monomeric residues of unsubstituted or substituted ethyleneimine.
- the ethyleneimine is substituted with C 1 -C 6 alkyl or aryl.
- P 1 possesses a number average molecular weight ranging from 2 kilodalton to 10 kilodalton, as determined by nuclear magnetic resonance.
- R 1 is either absent or comprises substituted or unsubstituted C1-C18 alkene or alkane, substituted or unsubstituted C1-C18 alkoxy, substituted or unsubstituted alkylamino, substituted or unsubstituted alkylthio, substituted or unsubstituted aryl, substituted or unsubstituted alkylaryl, substituted or unsubstituted heterocycle or substituted or unsubstituted alkylheterocycle.
- P 2 comprises a biodegradable polymer.
- P 2 comprises polyester, polyamide, polycarbonates, polyanhydrides, polyketals or co-polymers thereof.
- the polyester comprises polylactide, polyglycolide, polycaprolactone, polylactide-co-glycolide, or co-polymers thereof.
- the polyamide comprises polycaprolactam.
- P 2 possesses a number average molecular weight ranging from 10 kilodaltons to 100 kilodaltons, as determined by nuclear magnetic resonance.
- G comprises oxygen. In another embodiment, G comprises sulfur. In yet another embodiment, G comprises nitrogen.
- Q comprises oxygen. In another embodiment, Q comprises sulfur. In yet another embodiment, Q comprises nitrogen.
- n is an integer ranging from 1 to 12. In another embodiment, n ranges from 1 to 5. In still another embodiment, n ranges from 1 to 2. In yet another embodiment, n equals 1.
- R 1 comprises —CH 2 —
- G and Q comprise oxygen
- P 1 comprises a polymer that comprises monomeric residues of unsubstituted ethylene oxide
- P 2 comprises polylactide
- n equals 1.
- the nicotine residue comprises optically pure (+)-(2′R, 3′R) or ( ⁇ )-(2′S, 3′S)— hydroxylmethyl nicotine derivatives.
- a method comprising: administering any of the compounds provided herein to a subject.
- a vaccine comprising any of the compounds provided herein.
- the vaccine further comprises a synthetic nanocarrier.
- the vaccine further comprises an additional antigen or an adjuvant.
- the vaccine further comprises a pharmaceutically acceptable excipient.
- a method comprising administering any of the vaccine provided herein to a subject is provided.
- composition comprising any of the compounds provided herein and a pharmaceutically acceptable excipient is provided.
- any of the compounds, compositions or vaccines provided may be for use in therapy or prophylaxis.
- any of the compounds, compositions or vaccines provided may be for use in any of the methods provided.
- any of the compounds, compositions or vaccines provided may be for use in a method of prophylaxis or treatment of an addiction or a condition resulting from exposure to a toxin, hazardous substance, environmental toxin or other harmful agent, infection or infectious disease.
- said addiction is an addiction to nicotine.
- a polymer includes a mixture of two or more such molecules or a mixture of differing molecular weights of a single polymer species
- a synthetic nanocarrier includes a mixture of two or more such synthetic nanocarriers or a plurality of such synthetic nanocarriers
- reference to a “DNA molecule” includes a mixture of two or more such DNA molecules or a plurality of such DNA molecules
- reference to “an adjuvant” includes a mixture of two or more such materials or a plurality of adjuvant molecules, and the like.
- the term “comprise” or variations thereof such as “comprises” or “comprising” are to be read to indicate the inclusion of any recited integer (e.g. a feature, element, characteristic, property, method/process step or limitation) or group of integers (e.g. features, element, characteristics, properties, method/process steps or limitations) but not the exclusion of any other integer or group of integers.
- the term “comprising” is inclusive and does not exclude additional, unrecited integers or method/process steps.
- compositions and methods comprising or may be replaced with “consisting essentially of” or “consisting of”.
- the phrase “consisting essentially of” is used herein to require the specified integer(s) or steps as well as those which do not materially affect the character or function of the claimed invention.
- the term “consisting” is used to indicate the presence of the recited integer (e.g. a feature, element, characteristic, property, method/process step or limitation) or group of integers (e.g. features, element, characteristics, properties, method/process steps or limitations) alone.
- R 1 is a linker connecting any atom in the nicotine residue to G;
- G and Q are independently oxygen, sulfur, —NH—, or —NR—, wherein R comprises alkyl, substituted alkyl, acyl, aryl, or substituted aryl;
- R 2 , R 3 , R 4 , and R 5 independently, are H or an alkyl group; or R 2 and R 3 , independently, are oxygen and R 4 and R 5 , independently, are H or an alkyl group; or R 4 and R 5 , independently, are oxygen and R 2 and R 3 , independently, are H or an alkyl group;
- n is an integer ranging from 1 to 500; with the proviso that if R 1 is covalently bound to a methyl residue present at the pyrrolidine nitrogen at position 1′ of the nicotine residue, then m is an integer ranging from 50-500; and
- n is the number of polymeric moieties of
- R 2 , R 3 , R 4 , and/or R 5 independently, comprise H, substituted or unsubstituted C1-C18 alkene or alkane, substituted or unsubstituted C1-C18 alkoxy, substituted or unsubstituted alkylamino, substituted or unsubstituted alkylthio, substituted or unsubstituted aryl, substituted or unsubstituted alkylaryl, substituted or unsubstituted heterocycle, or substituted or unsubstituted alkylheterocyclic.
- P 1 is a polymer comprising monomeric residues of unsubstituted, or C 1 -C 6 alkyl or aryl substituted, ethylene oxide, ethylene sulfide and/or ethyleneimine, and copolymers thereof, with the proviso that if R 1 is covalently bound to a methyl residue present at the pyrrolidine nitrogen at position 1′ of the nicotine residue, then P 1 is not a polymer comprising 1-40 monomeric residues of unsubstituted ethylene oxide;
- G and Q are independently oxygen, sulfur, —NH—, or —NR—, wherein R comprises alkyl, substituted alkyl, acyl, aryl, or substituted aryl;
- R 1 is a linker connecting any atom in the nicotine residue to polymer P 1 through G;
- P 2 is a second polymer covalently attached to Q
- n is the number of polymeric moieties of —[R 1 -G-P 1 -Q-P 2 ] connected to the nicotine residue.
- adjuvant means an agent that does not constitute a specific antigen, but boosts the strength and longevity of immune response to a concomitantly administered antigen.
- adjuvants may include, but are not limited to stimulators of pattern recognition receptors, such as Toll-like receptors, RIG-1 and NOD-like receptors (NLR), mineral salts, such as alum, alum combined with monphosphoryl lipid (MPL) A of Enterobacteria, such as Escherihia coli, Salmonella minnesota, Salmonella typhimurium , or Shigella flexneri or specifically with MPL® (AS04), MPL A of above-mentioned bacteria separately, saponins, such as QS-21, Quil-A, ISCOMs, ISCOMATRIXTM, emulsions such as MF59TM Montanide® ISA 51 and ISA 720, AS02 (QS21+squalene+MPL®), liposomes and liposomal formulations such
- gonorrheae Chlamydia trachomatis and others, or chitosan particles
- depot-forming agents such as Pluronic® block co-polymers, specifically modified or prepared peptides, such as muramyl dipeptide, aminoalkyl glucosaminide 4-phosphates, such as RC529, or proteins, such as bacterial toxoids or toxin fragments.
- adjuvants comprise agonists for pattern recognition receptors (PRR), including, but not limited to Toll-Like Receptors (TLRs), specifically TLRs 2, 3, 4, 5, 7, 8, 9 and/or combinations thereof.
- adjuvants comprise agonists for Toll-Like Receptors 3, agonists for Toll-Like Receptors 7 and 8, or agonists for Toll-Like Receptor 9; preferably the recited adjuvants comprise imidazoquinolines; such as R848; adenine derivatives, such as those disclosed in U.S. Pat. No.
- synthetic nanocarriers incorporate as adjuvants compounds that are agonists for toll-like receptors (TLRs) 7 & 8 (“TLR 7/8 agonists”).
- TLR 7/8 agonists are agonists for toll-like receptors
- a synthetic nanocarrier incorporates an adjuvant that promotes DC maturation (needed for priming of naive T cells) and the production of cytokines, such as type I interferons, which promote antibody immune responses.
- adjuvants also may comprise immunostimulatory RNA molecules, such as but not limited to dsRNA, poly I:C or poly I:poly C12U (available as Ampligen®, both poly I:C and poly I:C12U being known as TLR3 stimulants), and/or those disclosed in F. Heil et al., “Species-Specific Recognition of Single-Stranded RNA via Toll-like Receptor 7 and 8” Science 303(5663), 1526-1529 (2004); J. Vollmer et al., “Immune modulation by chemically modified ribonucleosides and oligoribonucleotides” WO 2008033432 A2; A.
- immunostimulatory RNA molecules such as but not limited to dsRNA, poly I:C or poly I:poly C12U (available as Ampligen®, both poly I:C and poly I:C12U being known as TLR3 stimulants), and/or those disclosed in F. Heil et al., “Species
- an adjuvant may be a TLR-4 agonist, such as bacterial lipopolysacccharide (LPS), VSV-G, and/or HMGB-1.
- adjuvants may comprise TLR-5 agonists, such as flagellin, or portions or derivatives thereof, including but not limited to those disclosed in U.S. Pat. Nos. 6,130,082, 6,585,980, and 7,192,725.
- synthetic nanocarriers incorporate a ligand for Toll-like receptor (TLR)-9, such as immunostimulatory DNA molecules comprising CpGs, which induce type I interferon secretion, and stimulate T and B cell activation leading to increased antibody production and cytotoxic T cell responses
- TLR Toll-like receptor
- CpG motifs in bacterial DNA trigger direct B cell activation. Nature. 1995. 374:546-549; Chu et al. CpG oligodeoxynucleotides act as adjuvants that switch on T helper 1 (Th1) immunity. J. Exp. Med. 1997. 186:1623-1631; Lipford et al.
- CpG-containing synthetic oligonucleotides promote B and cytotoxic T cell responses to protein antigen: a new class of vaccine adjuvants.
- adjuvants may be proinflammatory stimuli released from necrotic cells (e.g., urate crystals).
- adjuvants may be activated components of the complement cascade (e.g., CD21, CD35, etc.).
- adjuvants may be activated components of immune complexes.
- the adjuvants also include complement receptor agonists, such as a molecule that binds to CD21 or CD35.
- the complement receptor agonist induces endogenous complement opsonization of the synthetic nanocarrier.
- adjuvants are cytokines, which are small proteins or biological factors (in the range of 5 kD-20 kD) that are released by cells and have specific effects on cell-cell interaction, communication and behavior of other cells.
- the cytokine receptor agonist is a small molecule, antibody, fusion protein, or aptamer.
- the dose of adjuvant may be coupled to synthetic nanocarriers, preferably, all of the dose of adjuvant is coupled to synthetic nanocarriers. In other embodiments, at least a portion of the dose of the adjuvant is not coupled to the synthetic nanocarriers.
- the dose of adjuvant comprises two or more types of adjuvants. For instance, and without limitation, adjuvants that act on different TLR receptors may be combined. As an example, in an embodiment a TLR 7/8 agonist may be combined with a TLR 9 agonist. In another embodiment, a TLR 7/8 agonist may be combined with a TLR 4 agonist. In yet another embodiment, a TLR 9 agonist may be combined with a TLR 3 agonist.
- administering means providing a drug to a subject in a manner that is pharmacologically useful.
- Antigen means a B cell antigen or T cell antigen. In embodiments, antigens are coupled to the synthetic nanocarriers. In other embodiments, antigens are not coupled to the synthetic nanocarriers. In embodiments antigens are coadministered with the synthetic nanocarriers. In other embodiments antigens are not coadministered with the synthetic nanocarriers. “Type(s) of antigens” means molecules that share the same, or substantially the same, antigenic characteristics.
- B cell antigen means any antigen that is or recognized by and triggers an immune response in a B cell (e.g., an antigen that is specifically recognized by a B cell receptor on a B cell).
- an antigen that is a T cell antigen is also a B cell antigen.
- the T cell antigen is not also a B cell antigen.
- B cell antigens include, but are not limited to proteins, peptides, small molecules, and carbohydrates.
- the B cell antigen comprises a non-protein antigen (i.e., not a protein or peptide antigen).
- the B cell antigen comprises a carbohydrate associated with an infectious agent.
- the B cell antigen comprises a glycoprotein or glycopeptide associated with an infectious agent.
- the infectious agent can be a bacterium, virus, fungus, protozoan, or parasite.
- the B cell antigen comprises a poorly immunogenic antigen.
- the B cell antigen comprises an abused substance or a portion thereof.
- the B cell antigen comprises an addictive substance or a portion thereof.
- Addictive substances include, but are not limited to, nicotine, a narcotic, a cough suppressant, a tranquilizer, and a sedative.
- the B cell antigen comprises a toxin, such as a toxin from a chemical weapon or natural sources.
- the B cell antigen may also comprise a hazardous environmental agent.
- the B cell antigen comprises a self antigen.
- the B cell antigen comprises an alloantigen, an allergen, a contact sensitizer, a degenerative disease antigen, a hapten, an infectious disease antigen, a cancer antigen, an atopic disease antigen, an autoimmune disease antigen, an addictive substance, a xenoantigen, or a metabolic disease enzyme or enzymatic product thereof.
- Couple or “Coupled” or “Couples” (and the like) means to chemically associate one entity (for example a moiety) with another.
- the coupling is covalent, meaning that the coupling occurs in the context of the presence of a covalent bond between the two entities.
- the non-covalent coupling is mediated by non-covalent interactions including but not limited to charge interactions, affinity interactions, metal coordination, physical adsorption, host-guest interactions, hydrophobic interactions, TT stacking interactions, hydrogen bonding interactions, van der Waals interactions, magnetic interactions, electrostatic interactions, dipole-dipole interactions, and/or combinations thereof.
- encapsulation is a form of coupling.
- Dosage form means a pharmacologically and/or immunologically active material in a medium, carrier, vehicle, or device suitable for administration to a subject.
- Encapsulate means to enclose at least a portion of a substance within a synthetic nanocarrier. In some embodiments, a substance is enclosed completely within a synthetic nanocarrier. In other embodiments, most or all of a substance that is encapsulated is not exposed to the local environment external to the synthetic nanocarrier. In other embodiments, no more than 50%, 40%, 30%, 20%, 10% or 5% is exposed to the local environment. Encapsulation is distinct from absorption, which places most or all of a substance on a surface of a synthetic nanocarrier, and leaves the substance exposed to the local environment external to the synthetic nanocarrier.
- Linker means a moiety that connects two chemical components together through either single covalent bonds or multiple covalent bonds.
- “Maximum dimension of a synthetic nanocarrier” means the largest dimension of a nanocarrier measured along any axis of the synthetic nanocarrier. “Minimum dimension of a synthetic nanocarrier” means the smallest dimension of a synthetic nanocarrier measured along any axis of the synthetic nanocarrier. For example, for a spheriodal synthetic nanocarrier, the maximum and minimum dimension of a synthetic nanocarrier would be substantially identical, and would be the size of its diameter. Similarly, for a cuboidal synthetic nanocarrier, the minimum dimension of a synthetic nanocarrier would be the smallest of its height, width or length, while the maximum dimension of a synthetic nanocarrier would be the largest of its height, width or length.
- a minimum dimension of at least 75%, preferably at least 80%, more preferably at least 90%, of the synthetic nanocarriers in a sample, based on the total number of synthetic nanocarriers in the sample is greater than 100 nm.
- a maximum dimension of at least 75%, preferably at least 80%, more preferably at least 90%, of the synthetic nanocarriers in a sample, based on the total number of synthetic nanocarriers in the sample is equal to or less than 5 ⁇ m.
- a minimum dimension of at least 75%, preferably at least 80%, more preferably at least 90%, of the synthetic nanocarriers in a sample, based on the total number of synthetic nanocarriers in the sample is greater than 110 nm, more preferably greater than 120 nm, more preferably greater than 130 nm, and more preferably still greater than 150 nm.
- aspects ratios of the maximum and minimum dimensions of inventive synthetic nanocarriers may vary depending on the embodiment. For instance, aspect ratios of the maximum to minimum dimensions of the synthetic nanocarriers may vary from 1:1 to 1,000,000:1, preferably from 1:1 to 100,000:1, more preferably from 1:1 to 1000:1, still more preferably from 1:1 to 100:1, and yet more preferably from 1:1 to 10:1.
- a maximum dimension of at least 75%, preferably at least 80%, more preferably at least 90%, of the synthetic nanocarriers in a sample, based on the total number of synthetic nanocarriers in the sample is equal to or less than 3 ⁇ m, more preferably equal to or less than 2 ⁇ m, more preferably equal to or less than 1 ⁇ m, more preferably equal to or less than 800 nm, more preferably equal to or less than 600 nm, and more preferably still equal to or less than 500 nm.
- a maximum dimension of at least 75%, preferably at least 80%, more preferably at least 90%, of the synthetic nanocarriers in a sample, based on the total number of synthetic nanocarriers in the sample is equal to or greater than 100 nm, more preferably equal to or greater than 120 nm, more preferably equal to or greater than 130 nm, more preferably equal to or greater than 140 nm, and more preferably still equal to or greater than 150 nm.
- Measurement of synthetic nanocarrier sizes is obtained by suspending the synthetic nanocarriers in a liquid (usually aqueous) media and using dynamic light scattering (DLS) (e.g. using a Brookhaven ZetaPALS instrument).
- DLS dynamic light scattering
- a suspension of synthetic nanocarriers can be diluted from an aqueous buffer into purified water to achieve a final synthetic nanocarrier suspension concentration of approximately 0.01 to 0.1 mg/mL.
- the diluted suspension may be prepared directly inside, or transferred to, a suitable cuvette for DLS analysis.
- the cuvette may then be placed in the DLS, allowed to equilibrate to the controlled temperature, and then scanned for sufficient time to aquire a stable and reproducible distribution based on appropriate inputs for viscosity of the medium and refractive indicies of the sample. The effective diameter, or mean of the distribution, is then reported.
- “Pharmaceutically acceptable excipient” means a pharmacologically inactive material used together with the recited synthetic nanocarriers to formulate the inventive compositions.
- Pharmaceutically acceptable excipients comprise a variety of materials known in the art, including but not limited to saccharides (such as glucose, lactose, and the like), preservatives such as antimicrobial agents, reconstitution aids, colorants, saline (such as phosphate buffered saline), and buffers.
- “Release” or “Release Rate” means the rate that an entrapped substance transfers from a synthetic nanocarrier into local environment, such as a surrounding release media.
- the synthetic nanocarrier is prepared for the release testing by placing into the appropriate release media. This is generally done by exchanging a buffer after centrifugation to pellet the synthetic nanocarrier and reconstitution of the synthetic nanocarriers under a mild condition.
- the assay is started by placing the sample at 37° C. in an appropriate temperature-controlled apparatus. A sample is removed at various time points.
- the synthetic nanocarriers are separated from the release media by centrifugation to pellet the synthetic nanocarriers.
- the release media is assayed for the substance that has been released from the synthetic nanocarriers.
- the substance is measured using HPLC to determine the content and quality of the substance.
- the pellet containing the remaining entrapped substance is dissolved in solvents or hydrolyzed by base to free the entrapped substance from the synthetic nanocarriers.
- the pellet-contained substance is then also measured by HPLC after dissolution or destruction of the pellet to determine the content and quality of the substance that has not been released at a given time point.
- the mass balance is closed between substance that has been released into the release media and what remains in the synthetic nanocarriers. Data are presented as the fraction released or as the net release presented as micrograms released over time.
- Subject means animals, including warm blooded mammals such as humans and primates; avians; domestic household or farm animals such as cats, dogs, sheep, goats, cattle, horses and pigs; laboratory animals such as mice, rats and guinea pigs; fish; reptiles; zoo and wild animals; and the like.
- “Synthetic nanocarrier(s)” means a discrete object that is not found in nature, and that possesses at least one dimension that is less than or equal to 5 microns in size.
- Albumin nanoparticles are generally included as synthetic nanocarriers, however in certain embodiments the synthetic nanocarriers do not comprise albumin nanoparticles. In embodiments, inventive synthetic nanocarriers do not comprise chitosan.
- a synthetic nanocarrier can be, but is not limited to, one or a plurality of lipid-based nanoparticles, polymeric nanoparticles, metallic nanoparticles, surfactant-based emulsions, dendrimers, buckyballs, nanowires, virus-like particles, peptide or protein-based particles (such as albumin nanoparticles) and/or nanoparticles that are developed using a combination of nanomaterials such as lipid-polymer nanoparticles.
- Synthetic nanocarriers may be a variety of different shapes, including but not limited to spheroidal, cuboidal, pyramidal, oblong, cylindrical, toroidal, and the like.
- Synthetic nanocarriers according to the invention comprise one or more surfaces.
- Exemplary synthetic nanocarriers that can be adapted for use in the practice of the present invention comprise: (1) the biodegradable nanoparticles disclosed in U.S. Pat. No. 5,543,158 to Gref et al., (2) the polymeric nanoparticles of Published US Patent Application 20060002852 to Saltzman et al., (3) the lithographically constructed nanoparticles of Published US Patent Application 20090028910 to DeSimone et al., (4) the disclosure of WO 2009/051837 to von Andrian et al., (5) the nanoparticles disclosed in Published US Patent Application 2008/0145441 to Penades et al, (6) the protein nanoparticles disclosed in Published US Patent Application 20090226525 to de los Rios et al., (7) the virus-like particles disclosed in published US Patent Application 20060222652 to Sebbel et al., (8) the nucleic acid coupled virus-like particles disclosed in published US Patent Application 20060251677 to Bachmann et al.
- synthetic nanocarriers may possess an aspect ratio greater than 1:1, 1:1.2, 1:1.5, 1:2, 1:3, 1:5, 1:7, or greater than 1:10.
- Synthetic nanocarriers according to the invention that have a minimum dimension of equal to or less than about 100 nm, preferably equal to or less than 100 nm, do not comprise a surface with hydroxyl groups that activate complement or alternatively comprise a surface that consists essentially of moieties that are not hydroxyl groups that activate complement.
- synthetic nanocarriers according to the invention that have a minimum dimension of equal to or less than about 100 nm, preferably equal to or less than 100 nm, do not comprise a surface that substantially activates complement or alternatively comprise a surface that consists essentially of moieties that do not substantially activate complement.
- synthetic nanocarriers according to the invention that have a minimum dimension of equal to or less than about 100 nm, preferably equal to or less than 100 nm, do not comprise a surface that activates complement or alternatively comprise a surface that consists essentially of moieties that do not activate complement.
- synthetic nanocarriers exclude virus-like particles.
- the virus-like particles comprise non-natural adjuvant (meaning that the VLPs comprise an adjuvant other than naturally occurring RNA generated during the production of the VLPs).
- synthetic nanocarriers may possess an aspect ratio greater than 1:1, 1:1.2, 1:1.5, 1:2, 1:3, 1:5, 1:7, or greater than 1:10.
- T cell antigen means any antigen that is recognized by and triggers an immune response in a T cell (e.g., an antigen that is specifically recognized by a T cell receptor on a T cell or an NKT cell via presentation of the antigen or portion thereof bound to a Class I or Class II major histocompatability complex molecule (MHC), or bound to a CD1 complex).
- an antigen that is a T cell antigen is also a B cell antigen.
- the T cell antigen is not also a B cell antigen.
- T cell antigens generally are proteins or peptides.
- T cell antigens may be an antigen that stimulates a CD8+ T cell response, a CD4+ T cell response, or both. The nanocarriers, therefore, in some embodiments can effectively stimulate both types of responses.
- the T cell antigen is a T helper cell antigen (i.e. one that can generate an enhanced response to a B cell antigen, preferably an unrelated B cell antigen, through stimulation of T cell help).
- a T helper cell antigen may comprise one or more peptides obtained or derived from tetanus toxoid, Epstein-Barr virus, influenza virus, respiratory syncytial virus, measles virus, mumps virus, rubella virus, cytomegalovirus, adenovirus, diphtheria toxoid, or a PADRE peptide (known from the work of Sette et al. U.S. Pat. No. 7,202,351).
- a T helper cell antigen may comprise one or more lipids, or glycolipids, including but not limited to: ⁇ -galactosylceramide ( ⁇ -GalCer), ⁇ -linked glycosphingolipids (from Sphingomonas spp.), galactosyl diacylglycerols (from Borrelia burgdorferi ), lypophosphoglycan (from Leishmania donovani ), and phosphatidylinositol tetramannoside (PIM4) (from Mycobacterium leprae ).
- ⁇ -galactosylceramide ⁇ -GalCer
- ⁇ -linked glycosphingolipids from Sphingomonas spp.
- galactosyl diacylglycerols from Borrelia burgdorferi
- lypophosphoglycan from Leishmania donovani
- PIM4 phosphatidylinositol tetramann
- CD4+ T-cell antigens may be derivatives of a CD4+ T-cell antigen that is obtained from a source, such as a natural source.
- CD4+ T-cell antigen sequences such as those peptides that bind to MHC II, may have at least 70%, 80%, 90%, or 95% identity to the antigen obtained from the source.
- the T cell antigen preferably a T helper cell antigen, may be coupled to, or uncoupled from, a synthetic nanocarrier.
- Vaccine means a composition of matter that improves the immune response to a particular pathogen or disease.
- a vaccine typically contains factors that stimulate a subject's immune system to recognize a specific antigen as foreign and eliminate it from the subject's body.
- a vaccine also establishes an immunologic ‘memory’ so the antigen will be quickly recognized and responded to if a person is re-challenged.
- Vaccines can be prophylactic (for example to prevent future infection by any pathogen), or therapeutic (for example a vaccine against a tumor specific antigen for the treatment of cancer).
- a vaccine may comprise dosage forms according to the invention.
- the invention provides for compounds of Formula I:
- R 1 is a linker connecting any atom in the nicotine residue to G;
- G and Q are independently oxygen, sulfur, —NH—, or —NR—, wherein R comprises alkyl, substituted alkyl, acyl, aryl, or substituted aryl;
- R2, R3, R4, and R5, independently, are H or an alkyl group; or R2 and R3, independently, are oxygen and R4 and R5, independently, are H or an alkyl group; or R4 and R5, independently, are oxygen and R2 and R3, independently, are H or an alkyl group;
- n is an integer ranging from 1 to 500; with the proviso that if R 1 is covalently bound to a methyl residue present at the pyrrolidine nitrogen at position 1′ of the nicotine residue, then m is an integer ranging from 50-500; and
- n is the number of polymeric moieties of
- R 1 is either absent or comprises substituted or unsubstituted C1-C18 alkene or alkane, substituted or unsubstituted C1-C18 alkoxy, substituted or unsubstituted alkylamino, substituted or unsubstituted alkylthio, substituted or unsubstituted aryl, substituted or unsubstituted alkylaryl, substituted or unsubstituted heterocycle or substituted or unsubstituted alkylheterocycle.
- R 2 , R 3 , R 4 , and/or R 5 independently, comprise H, substituted or unsubstituted C1-C18 alkene or alkane, substituted or unsubstituted C1-C18 alkoxy, substituted or unsubstituted alkylamino, substituted or unsubstituted alkylthio, substituted or unsubstituted aryl, substituted or unsubstituted alkylaryl, substituted or unsubstituted heterocycle, or substituted or unsubstituted alkylheterocyclic.
- n is an integer ranging from 1 to 12, preferably n ranges from 1 to 5, more preferably n ranges from 1 to 2, and still more preferably n equals 1.
- an inventive compound of Formula I is contemplated, wherein R 1 comprises C 1 -C 6 , G and Q comprise oxygen; R 2 , R 3 , R 4 , and R 5 comprise hydrogen, m ranges from 45 to 180, and n equals 1.
- Compounds useful for initiating ring opening polymerization of epoxides, thioepoxides and ethyleneimines or oxazolines include, but are not limited to 1′-hydroxyalkylnicotine such as 1′-hydroxyethylnicotine, 1′-hydroxybutylnicotine, 3′-hydroxyalkylnicotine such as 3′-hydroxymethylnicotine, 4′-hydroxyalkylnicotine such as 4′-hydroxymethylnicotine and 4′-hydroxyethylnicotine, 5′-hydroxyalkylnicotine such as 5′-hydroxypropyl nicotine, 2-hydroxyalkylnicotine such as 2-hydroxymethylnicotine, 4-hydroxyalkylnicotine such as 4-hydroxymethylnicotine, 6-hydroxyalkylnicotine such as 6-hydroxymethylnicotine, 6-hydroxyethylnicotine, and 6-hydroxypropyl nicotine.
- 1′-hydroxyalkylnicotine such as 1′-hydroxyethylnicotine, 1′
- the nicotine residue may comprise optically pure enantiomers, such as (+)-(2′R, 3′R) or ( ⁇ )-(2′S, 3′S)-hydroxylmethyl nicotine derivatives.
- the nicotine residue may comprise a racemic mixture.
- the optically pure enantiomers may be separated from one another using chiral separation techniques, for instance using a chiral separation column such as a Chiral Daicel IC® column.
- epoxides suitable for polymerization in the practice of the present invention include but are not limited to; ethylene oxide, propylene oxide glycidyl methyl ether, 2,2,3,3-tetramethyloxirane, 3,3,3-Trifluoro-1,2-epoxypropane, styrene oxide, cyclooctene oxide, 1,2-epoxyoctane, tert-Butyl glycidyl ether, 4-Fluorophenyloxirane, Glycidaldehyde diethyl acetal, Phenyl glycidyl ether, Benzyl glycidyl ether, cis, and trans-Stilbene oxide, and many others.
- thiiranes suitable for polymerization in the practice of the present invention include but are not limited to; ethylene sulfide, propylene sulfide, Cyclohexene sulfide, 1,2-Epithiooctane, 1,2-Epithiododecane, 4-phenoxyphenyl 2-thiiranylmethyl sulfone and many others.
- ethyleneimines and oxazolines suitable for polymerization in the practice of the present invention include but are not limited to; aziridine, 2-methylaziridine, 1-(benzylsulfonyl)aziridine, 1-(toluene-3-sulfonyl)aziridine, 2-phenylaziridine, 2,3-diphenylaziridine, 1-methylaziridine, 1-phenylaziridine, 2-ethyl-2-oxazoline, 2-methyl2-oxazoline 2-phenyl-2-oxazoline, 4,4-Dimethyl-2-phenyl-2-oxazoline, 3-(4,4-dimethyl-4,5-dihydro-1,3-oxazol-2-yl)pyridine, and many others.
- Polymers as covered by Formula I are made by ring opening polymerization of epoxides, thioepoxides, aziridines or 2-alkyl-2-oxazolines.
- the actual conditions used depend on the particular polymer of Formula I to be synthesized.
- epoxide and thioepoxide polymerizations are typically initiated with an anionic compound.
- a nicotine compound with an alcohol containing substituent can be converted to the alkoxide by reaction with a strong base. This nicotine alkoxide may then used to initiate ring opening polymerization of an amount of epoxide or thioepoxide chosen to provide the nicotine substituted polyether or polythioether of a particular molecular weight.
- Polyacylethylenimines may be formed by ring opening polymerization of 2-alkyl-2-oxazolines using a cationic initiator or alkylating agent.
- a nicotine compound with an alcohol containing substituent may be converted to a halide or sulfonate ester.
- This alkylating agent may then be used to initiate ring opening polymerization of an amount of 2-alkyl-2-oxazoline chosen to provide the nicotine substituted polyacylethylenimines of a particular molecular weight.
- P 1 is a polymer comprising monomeric residues of unsubstituted, or C 1 -C 6 alkyl or aryl substituted, ethylene oxide, ethylene sulfide and/or ethyleneimine, and copolymers thereof, with the proviso that if R 1 is covalently bound to a methyl residue present at the pyrrolidine nitrogen at position 1′ of the nicotine residue, then P 1 is not a polymer comprising 1-40 monomeric residues of unsubstituted ethylene oxide;
- G and Q are independently oxygen, sulfur, —NH—, or —NR—, wherein R comprises alkyl, substituted alkyl, acyl, aryl, or substituted aryl;
- R 1 is a linker connecting any atom in the nicotine residue to polymer P 1 through G;
- P 2 is a second polymer covalently attached to Q
- n is the number of polymeric moieties of —[R 1 -G-P 1 -Q-P 2 ] connected to the nicotine residue.
- R 1 is either absent or comprises substituted or unsubstituted C1-C18 alkene or alkane, substituted or unsubstituted C1-C18 alkoxy, substituted or unsubstituted alkylamino, substituted or unsubstituted alkylthio, substituted or unsubstituted aryl, substituted or unsubstituted alkylaryl, substituted or unsubstituted heterocycle or substituted or unsubstituted alkylheterocycle.
- P 2 comprises a biodegradable polymer.
- the biodegradable polymer comprises polyester, polyamide, polycarbonates, polyanhydrides, polyketals or co-polymers thereof.
- the polyester comprises polylactide, polyglycolide, polycaprolactone, polylactide-co-glycolide, or co-polymers thereof;
- the polyamide comprises polycaprolactam.
- the molecular weight of the polymeric portions of compounds of Formula I or Formula II may be varied.
- the molecular weights of P 1 and P 2 may be adjusted to maximize the ability of the inventive compounds to self-assemble during a typical emulsion process and to form nanoparticles.
- P 1 possesses a number average molecular weight ranging from 2 kilodaltons to 10 kilodaltons, preferably P 1 possesses a number average molecular weight ranging from 3 kilodaltons to 6 kilodaltons, as determined by nuclear magnetic resonance.
- P 2 possesses a number average molecular weight ranging from 10 kilodaltons to 100 kilodaltons, P 2 possesses a number average molecular weight ranging from 15 kilodaltons to 30 kilodaltons, preferably as determined by nuclear magnetic resonance.
- number average molecular weight can be determined by proton NMR wherein the ratio of the polymer repeating units to the end group is established and then multiplied by theoretical repeating unit molecular weight.
- a known weight concentration may be established and then titrated in the presence of an indicator dye with an appropriate neutralizing agent of known molar concentration to provide moles of end group per mass of polymer.
- Polymer number average molecular weights can also be determined using conventional NMR techniques, such as those generally explained at sigmaaldrich.com/materials-science/polymer-science/polymer-analysis.html. Any of the molecular weights of the polymers provided herein may be a number average molecular weight.
- n is an integer ranging from 1 to 12, preferably n ranges from 1 to 5, more preferably n ranges from 1 to 2, and still more preferably n equals 1.
- the invention provides a compound of Formula II, wherein R 1 comprises —CH 2 —, G and Q comprise oxygen, P 1 comprises a polymer that comprises monomeric residues of unsubstituted ethylene oxide; P 2 comprises polylactide, and n equals 1.
- compounds useful for initiating ring opening polymerization of epoxides, thioepoxides and ethyleneimines or oxazolines include, but are not limited to 1′-hydroxyalkylnicotine such as 1′-hydroxyethylnicotine, 1′-hydroxybutylnicotine, 3′-hydroxyalkylnicotine such as 3′-hydroxymethylnicotine, 4′-hydroxyalkylnicotine such as 4′-hydroxymethylnicotine and 4′-hydroxyethylnicotine, 5′-hydroxyalkylnicotine such as 5′-hydroxypropyl nicotine, 2-hydroxyalkylnicotine such as 2-hydroxymethylnicotine, 4-hydroxyalkylnicotine such as 4-hydroxymethylnicotine, 6-hydroxyalkylnicotine such as 6-hydroxymethylnicotine, 6-hydroxyethylnicotine, and 6-hydroxypropyl nicotine.
- 1′-hydroxyalkylnicotine such as 1′-hydroxyethylnicotine, 1′-hydroxy
- epoxides include but are not limited to; ethylene oxide, propylene oxide glycidyl methyl ether, 2,2,3,3-tetramethyloxirane, 3,3,3-Trifluoro-1,2-epoxypropane, styrene oxide, cyclooctene oxide, 1,2-epoxyoctane, tert-Butyl glycidyl ether, 4-Fluorophenyloxirane, Glycidaldehyde diethyl acetal, Phenyl glycidyl ether, Benzyl glycidyl ether, cis, and trans-Stilbene oxide, and many others.
- thioepoxides include but are not limited to; ethylene sulfide, propylene sulfide, Cyclohexene sulfide, 1,2-Epithiooctane, 1,2-Epithiododecane, 4-phenoxyphenyl 2-thiiranylmethyl sulfone and many others.
- ethyleneimines, and oxazolines include but are not limited to; aziridine, 2-methylaziridine, 1-(benzylsulfonyl)aziridine, 1-(toluene-3-sulfonyl)aziridine, 2-phenylaziridine, 2,3-diphenylaziridine, 1-methylaziridine, 1-phenylaziridine, 2-ethyl-2-oxazoline, 2-methyl2-oxazoline 2-phenyl-2-oxazoline, 4,4-Dimethyl-2-phenyl-2-oxazoline, 3-(4,4-dimethyl-4,5-dihydro-1,3-oxazol-2-yl)pyridine, and many others.
- the polymers comprising these monomers all are examples of nicotine-P 1 conjugates of Formula I.
- the nicotine-P 1 conjugates of Formula I can then be used to initiate polymerization of a second monomer to provide the compound of Formula II.
- compounds of Formula II formed by ring opening polymerization of cyclic esters, lactones, anhydrides, carbonates, lactams, and N-carboxyanhydrides.
- compounds of Formula II formed by ring opening polymerization of lactide, and caprolactone.
- the ring opening polymerization of these can be initiated by compounds of Formula I, often at elevated temperatures, under the influence of a catalyst such as tin (II) ethylhexanoate or an amine catalyst such as TBD (1,5,7-triazabicyclo[4,4,0]dec-5-ene), DBU (1,8-diazabicyclo[5,4,0]undec-7-ene), DMAP (dimethylaminopyridine) as well as other catalysts known to those skilled in the art.
- a catalyst such as tin (II) ethylhexanoate or an amine catalyst such as TBD (1,5,7-triazabicyclo[4,4,0]dec-5-ene), DBU (1,8-diazabicyclo[5,4,0]undec-7-ene), DMAP (dimethylaminopyridine) as well as other catalysts known to those skilled in the art.
- Compounds useful for initiating ring opening polymerization of epoxides, thioepoxides and ethyleneimines or oxazolines include, but are not limited to 1′-hydroxyalkylnicotine such as 1′-hydroxyethylnicotine, 1′-hydroxybutylnicotine, 3′-hydroxyalkylnicotine such as 3′-hydroxymethylnicotine, 4′-hydroxyalkylnicotine such as 4′-hydroxymethylnicotine and 4′-hydroxyethylnicotine, 5′-hydroxyalkylnicotine such as 5′-hydroxypropyl nicotine, 2-hydroxyalkylnicotine such as 2-hydroxymethylnicotine, 4-hydroxyalkylnicotine such as 4-hydroxymethylnicotine, 6-hydroxyalkylnicotine such as 6-hydroxymethylnicotine, 6-hydroxyethylnicotine, and 6-hydroxypropyl nicotine.
- 1′-hydroxyalkylnicotine such as 1′-hydroxyethylnicotine, 1′
- epoxides include but are not limited to; ethylene oxide, propylene oxide glycidyl methyl ether, 2,2,3,3-tetramethyloxirane, 3,3,3-Trifluoro-1,2-epoxypropane, styrene oxide, cyclooctene oxide, 1,2-epoxyoctane, tert-Butyl glycidyl ether, 4-Fluorophenyloxirane, Glycidaldehyde diethyl acetal, Phenyl glycidyl ether, Benzyl glycidyl ether, cis, and trans-Stilbene oxide, and many others.
- thioepoxides include but are not limited to; ethylene sulfide, propylene sulfide, Cyclohexene sulfide, 1,2-Epithiooctane, 1,2-Epithiododecane, 4-phenoxyphenyl 2-thiiranylmethyl sulfone and many others.
- ethyleneimines, and oxazolines include but are not limited to; aziridine, 2-methylaziridine, 1-(benzylsulfonyl)aziridine, 1-(toluene-3-sulfonyl)aziridine, 2-phenylaziridine, 2,3-diphenylaziridine, 1-methylaziridine, 1-phenylaziridine, 2-ethyl-2-oxazoline, 2-methyl2-oxazoline 2-phenyl-2-oxazoline, 4,4-Dimethyl-2-phenyl-2-oxazoline, 3-(4,4-dimethyl-4,5-dihydro-1,3-oxazol-2-yl)pyridine, and many others.
- the polymers comprising these monomers all are examples of nicotine-P 1 conjugates of Formula I.
- the nicotine-P 1 conjugates of Formula I can then be used to initiate polymerization of a second monomer to provide the compound of Formula II.
- compounds of Formula II formed by ring opening polymerization of cyclic esters, lactones, anhydrides, carbonates, lactams, and N-carboxyanhydrides.
- compounds of Formula II formed by ring opening polymerization of lactide, and caprolactone.
- the ring opening polymerization of these can be initiated by compounds of Formula I, often at elevated temperatures, under the influence of a catalyst such as tin (II) ethylhexanoate or an amine catalyst such as TBD (1,5,7-triazabicyclo[4,4,0]dec-5-ene), DBU (1,8-diazabicyclo[5,4,0]undec-7-ene), DMAP (dimethylaminopyridine) as well as other catalysts known to those skilled in the art.
- a catalyst such as tin (II) ethylhexanoate or an amine catalyst such as TBD (1,5,7-triazabicyclo[4,4,0]dec-5-ene), DBU (1,8-diazabicyclo[5,4,0]undec-7-ene), DMAP (dimethylaminopyridine) as well as other catalysts known to those skilled in the art.
- Compounds of Formula II may be produced by the ring opening polymerization of cyclic esters, carbonates or anhydrides wherein the polymerization is initiated by a polymer of Formula I.
- Typical catalysts for this process include metals such as tin(II) ethylhexanoate and organic bases such as 1,5,7-triazabicyclo[4,4,0]dec-5-ene (TBD), 1,8-diazabicyclo[5,4,0]undec-7-ene (DBU), or 4-dimethylaminopyridine (DMAP).
- TBD 1,5,7-triazabicyclo[4,4,0]dec-5-ene
- DBU 1,8-diazabicyclo[5,4,0]undec-7-ene
- DMAP 4-dimethylaminopyridine
- the polymerization can be carried out without solvent at elevated temperature (100-200° C.), or in an inert solvent such as toluene at reflux temperature.
- compositions and/or vaccines may comprise one or more adjuvants, and one or more additional antigens, in addition to the inventive compounds.
- Formulation of vaccines that comprise the inventive compounds may be performed using conventional techniques.
- inventive compounds may also be incorporated into synthetic nanocarriers.
- the compounds may be adsorbed onto the surface of synthetic nanocarriers, preferably leaving the nicotine residue exposed where it could serve as a B cell antigen.
- the compounds may be covalently bound to a surface of synthetic nanocarriers, again preferably leaving the nicotine residue exposed where it could serve as a B cell antigen.
- inventive compositions may comprise synthetic nanocarriers that comprise the inventive compounds.
- synthetic nanocarriers are spheres or spheroids.
- synthetic nanocarriers are flat or plate-shaped.
- synthetic nanocarriers are cubes or cubic.
- synthetic nanocarriers are ovals or ellipses.
- synthetic nanocarriers are cylinders, cones, or pyramids.
- At least 80%, at least 90%, or at least 95% of the synthetic nanocarriers may have a minimum dimension or maximum dimension that falls within 5%, 10%, or 20% of the average diameter or average dimension of the synthetic nanocarriers.
- a population of synthetic nanocarriers may be heterogeneous with respect to size, shape, and/or composition.
- Synthetic nanocarriers can be solid or hollow and can comprise one or more layers. In some embodiments, each layer has a unique composition and unique properties relative to the other layer(s).
- synthetic nanocarriers may have a core/shell structure, wherein the core is one layer (e.g. a polymeric core) and the shell is a second layer (e.g. a lipid bilayer or monolayer). Synthetic nanocarriers may comprise a plurality of different layers.
- synthetic nanocarriers may optionally comprise one or more lipids.
- a synthetic nanocarrier may comprise a liposome.
- a synthetic nanocarrier may comprise a lipid bilayer.
- a synthetic nanocarrier may comprise a lipid monolayer.
- a synthetic nanocarrier may comprise a micelle.
- a synthetic nanocarrier may comprise a core comprising a polymeric matrix surrounded by a lipid layer (e.g., lipid bilayer, lipid monolayer, etc.).
- a synthetic nanocarrier may comprise a non-polymeric core (e.g., metal particle, quantum dot, ceramic particle, bone particle, viral particle, proteins, nucleic acids, carbohydrates, etc.) surrounded by a lipid layer (e.g., lipid bilayer, lipid monolayer, etc.).
- a non-polymeric core e.g., metal particle, quantum dot, ceramic particle, bone particle, viral particle, proteins, nucleic acids, carbohydrates, etc.
- lipid layer e.g., lipid bilayer, lipid monolayer, etc.
- synthetic nanocarriers can comprise one or more polymers.
- such a polymer can be surrounded by a coating layer (e.g., liposome, lipid monolayer, micelle, etc.).
- various elements of the synthetic nanocarriers can be coupled with the polymer.
- an immunofeature surface, targeting moiety, and/or oligonucleotide can be covalently associated with a polymeric matrix. In some embodiments, covalent association is mediated by a linker. In some embodiments, an immunofeature surface, targeting moiety, and/or oligonucleotide can be noncovalently associated with a polymeric matrix. For example, in some embodiments, an immunofeature surface, targeting moiety, and/or oligonucleotide can be encapsulated within, surrounded by, and/or dispersed throughout a polymeric matrix. Alternatively or additionally, an immunofeature surface, targeting moiety, and/or nucleotide can be associated with a polymeric matrix by hydrophobic interactions, charge interactions, van der Waals forces, etc.
- a polymeric matrix comprises one or more polymers.
- Polymers may be natural or unnatural (synthetic) polymers.
- Polymers may be homopolymers or copolymers comprising two or more monomers. In terms of sequence, copolymers may be random, block, or comprise a combination of random and block sequences.
- polymers in accordance with the present invention are organic polymers.
- polymers suitable for use in the present invention include, but are not limited to, polyethylenes, polycarbonates (e.g. poly(1,3-dioxan-2one)), polyanhydrides (e.g. poly(sebacic anhydride)), polypropylfumerates, polyamides (e.g. polycaprolactam), polyacetals, polyethers, polyesters (e.g., polylactide, polyglycolide, polylactide-co-glycolide, polycaprolactone, polyhydroxyacid (e.g.
- polymers in accordance with the present invention include polymers which have been approved for use in humans by the U.S. Food and Drug Administration (FDA) under 21 C.F.R. ⁇ 177.2600, including but not limited to polyesters (e.g., polylactic acid, poly(lactic-co-glycolic acid), polycaprolactone, polyvalerolactone, poly(1,3-dioxan-2one)); polyanhydrides (e.g., poly(sebacic anhydride)); polyethers (e.g., polyethylene glycol); polyurethanes; polymethacrylates; polyacrylates; and polycyanoacrylates.
- FDA U.S. Food and Drug Administration
- polymers can be hydrophilic.
- polymers may comprise anionic groups (e.g., phosphate group, sulphate group, carboxylate group); cationic groups (e.g., quaternary amine group); or polar groups (e.g., hydroxyl group, thiol group, amine group).
- a synthetic nanocarrier comprising a hydrophilic polymeric matrix generates a hydrophilic environment within the synthetic nanocarrier.
- polymers can be hydrophobic.
- a synthetic nanocarrier comprising a hydrophobic polymeric matrix generates a hydrophobic environment within the synthetic nanocarrier. Selection of the hydrophilicity or hydrophobicity of the polymer may have an impact on the nature of materials that are incorporated (e.g. coupled) within the synthetic nanocarrier.
- polymers may be modified with one or more moieties and/or functional groups.
- moieties or functional groups can be used in accordance with the present invention.
- polymers may be modified with polyethylene glycol (PEG), with a carbohydrate, and/or with acyclic polyacetals derived from polysaccharides (Papisov, 2001, ACS Symposium Series, 786:301).
- PEG polyethylene glycol
- Certain embodiments may be made using the general teachings of U.S. Pat. No. 5,543,158 to Gref et al., or WO publication WO2009/051837 by Von Andrian et al.
- the inventive compounds may be used in the making of such embodiments, particularly if a B cell response against nicotine or nicotine-like compounds is desired.
- polymers may be modified with a lipid or fatty acid group.
- a fatty acid group may be one or more of butyric, caproic, caprylic, capric, lauric, myristic, palmitic, stearic, arachidic, behenic, or lignoceric acid.
- a fatty acid group may be one or more of palmitoleic, oleic, vaccenic, linoleic, alpha-linoleic, gamma-linoleic, arachidonic, gadoleic, arachidonic, eicosapentaenoic, docosahexaenoic, or erucic acid.
- polymers may be polyesters, including copolymers comprising lactic acid and glycolic acid units, such as poly(lactic acid-co-glycolic acid) and poly(lactide-co-glycolide), collectively referred to herein as “PLGA”; and homopolymers comprising glycolic acid units, referred to herein as “PGA,” and lactic acid units, such as poly-L-lactic acid, poly-D-lactic acid, poly-D,L-lactic acid, poly-L-lactide, poly-D-lactide, and poly-D,L-lactide, collectively referred to herein as “PLA.”
- exemplary polyesters include, for example, polyhydroxyacids; PEG copolymers and copolymers of lactide and glycolide (e.g., PLA-PEG copolymers, PGA-PEG copolymers, PLGA-PEG copolymers, and derivatives thereof.
- polyesters include, for example, poly(caprolactone), poly(caprolactone)-PEG copolymers, poly(L-lactide-co-L-lysine), poly(serine ester), poly(4-hydroxy-L-proline ester), poly[ ⁇ -(4-aminobutyl)-L-glycolic acid], and derivatives thereof.
- a polymer may be PLGA.
- PLGA is a biocompatible and biodegradable co-polymer of lactic acid and glycolic acid, and various forms of PLGA are characterized by the ratio of lactic acid:glycolic acid.
- Lactic acid can be L-lactic acid, D-lactic acid, or D,L-lactic acid.
- the degradation rate of PLGA can be adjusted by altering the lactic acid:glycolic acid ratio.
- PLGA to be used in accordance with the present invention is characterized by a lactic acid:glycolic acid ratio of approximately 85:15, approximately 75:25, approximately 60:40, approximately 50:50, approximately 40:60, approximately 25:75, or approximately 15:85.
- polymers may be one or more acrylic polymers.
- acrylic polymers include, for example, acrylic acid and methacrylic acid copolymers, methyl methacrylate copolymers, ethoxyethyl methacrylates, cyanoethyl methacrylate, aminoalkyl methacrylate copolymer, poly(acrylic acid), poly(methacrylic acid), methacrylic acid alkylamide copolymer, poly(methyl methacrylate), poly(methacrylic acid anhydride), methyl methacrylate, polymethacrylate, poly(methyl methacrylate) copolymer, polyacrylamide, aminoalkyl methacrylate copolymer, glycidyl methacrylate copolymers, polycyanoacrylates, and combinations comprising one or more of the foregoing polymers.
- the acrylic polymer may comprise fully-polymerized copolymers of acrylic and methacrylic acid esters with a low content of quaternary ammoni
- polymers can be cationic polymers.
- cationic polymers are able to condense and/or protect negatively charged strands of nucleic acids (e.g. DNA, or derivatives thereof).
- Amine-containing polymers such as poly(lysine) (Zauner et al., 1998, Adv. Drug Del. Rev., 30:97; and Kabanov et al., 1995, Bioconjugate Chem., 6:7), poly(ethylene imine) (PEI; Boussif et al., 1995, Proc. Natl. Acad.
- inventive synthetic nanocarriers may not comprise (or may exclude) cationic polymers.
- polymers can be degradable polyesters bearing cationic side chains (Putnam et al., 1999, Macromolecules, 32:3658; Barrera et al., 1993, J. Am. Chem. Soc., 115:11010; Kwon et al., 1989, Macromolecules, 22:3250; Lim et al., 1999, J. Am. Chem. Soc., 121:5633; and Zhou et al., 1990, Macromolecules, 23:3399).
- polyesters include poly(L-lactide-co-L-lysine) (Barrera et al., 1993, J. Am. Chem.
- polymers can be linear or branched polymers. In some embodiments, polymers can be dendrimers. In some embodiments, polymers can be substantially cross-linked to one another. In some embodiments, polymers can be substantially free of cross-links. In some embodiments, polymers can be used in accordance with the present invention without undergoing a cross-linking step. It is further to be understood that inventive synthetic nanocarriers may comprise block copolymers, graft copolymers, blends, mixtures, and/or adducts of any of the foregoing and other polymers. Those skilled in the art will recognize that the polymers listed herein represent an exemplary, not comprehensive, list of polymers that can be of use in accordance with the present invention.
- synthetic nanocarriers do not comprise a polymeric component.
- synthetic nanocarriers may comprise metal particles, quantum dots, ceramic particles, etc.
- a non-polymeric synthetic nanocarrier is an aggregate of non-polymeric components, such as an aggregate of metal atoms (e.g., gold atoms).
- synthetic nanocarriers may optionally comprise one or more amphiphilic entities.
- an amphiphilic entity can promote the production of synthetic nanocarriers with increased stability, improved uniformity, or increased viscosity.
- amphiphilic entities can be associated with the interior surface of a lipid membrane (e.g., lipid bilayer, lipid monolayer, etc.). Many amphiphilic entities known in the art are suitable for use in making synthetic nanocarriers in accordance with the present invention.
- amphiphilic entities include, but are not limited to, phosphoglycerides; phosphatidylcholines; dipalmitoyl phosphatidylcholine (DPPC); dioleylphosphatidyl ethanolamine (DOPE); dioleyloxypropyltriethylammonium (DOTMA); dioleoylphosphatidylcholine; cholesterol; cholesterol ester; diacylglycerol; diacylglycerolsuccinate; diphosphatidyl glycerol (DPPG); hexanedecanol; fatty alcohols such as polyethylene glycol (PEG); polyoxyethylene-9-lauryl ether; a surface active fatty acid, such as palmitic acid or oleic acid; fatty acids; fatty acid monoglycerides; fatty acid diglycerides; fatty acid amides; sorbitan trioleate (Span®85) glycocholate; sorbitan monolaurate (Span®20); polysorbate 20
- amphiphilic entity component may be a mixture of different amphiphilic entities. Those skilled in the art will recognize that this is an exemplary, not comprehensive, list of substances with surfactant activity. Any amphiphilic entity may be used in the production of synthetic nanocarriers to be used in accordance with the present invention.
- synthetic nanocarriers may optionally comprise one or more carbohydrates.
- Carbohydrates may be natural or synthetic.
- a carbohydrate may be a derivatized natural carbohydrate.
- a carbohydrate comprises monosaccharide or disaccharide, including but not limited to glucose, fructose, galactose, ribose, lactose, sucrose, maltose, trehalose, cellbiose, mannose, xylose, arabinose, glucoronic acid, galactoronic acid, mannuronic acid, glucosamine, galatosamine, and neuramic acid.
- a carbohydrate is a polysaccharide, including but not limited to pullulan, cellulose, microcrystalline cellulose, hydroxypropyl methylcellulose (HPMC), hydroxycellulose (HC), methylcellulose (MC), dextran, cyclodextran, glycogen, hydroxyethylstarch, carageenan, glycon, amylose, chitosan, N,O-carboxylmethylchitosan, algin and alginic acid, starch, chitin, inulin, konjac, glucommannan, pustulan, heparin, hyaluronic acid, curdlan, and xanthan.
- the inventive synthetic nanocarriers do not comprise (or specifically exclude) carbohydrates, such as a polysaccharide.
- the carbohydrate may comprise a carbohydrate derivative such as a sugar alcohol, including but not limited to mannitol, sorbitol, xylitol, erythritol, maltitol, and lactitol.
- compositions according to the invention comprise inventive synthetic nanocarriers in combination with pharmaceutically acceptable excipients, such as preservatives, buffers, saline, or phosphate buffered saline.
- inventive synthetic nanocarriers are suspended in sterile saline solution for injection together with a preservative.
- the adjuvant when preparing synthetic nanocarriers as carriers for adjuvants for use in vaccines, methods for coupling the adjuvants to the synthetic nanocarriers may be useful. If the adjuvant is a small molecule it may be of advantage to attach the adjuvant to a polymer prior to the assembly of the synthetic nanocarriers. In embodiments, it may also be an advantage to prepare the synthetic nanocarriers with surface groups that are used to couple the adjuvant to the synthetic nanocarrier through the use of these surface groups rather than attaching the adjuvant to a polymer and then using this polymer conjugate in the construction of synthetic nanocarriers.
- the adjuvant can be coupled by absorption to a pre-formed synthetic nanocarrier or it can be coupled by encapsulation during the formation of the synthetic nanocarrier.
- Synthetic nanocarriers may be prepared using a wide variety of methods known in the art.
- synthetic nanocarriers can be formed by methods as nanoprecipitation, flow focusing fluidic channels, spray drying, single and double emulsion solvent evaporation, solvent extraction, phase separation, milling, microemulsion procedures, microfabrication, nanofabrication, sacrificial layers, simple and complex coacervation, and other methods well known to those of ordinary skill in the art.
- aqueous and organic solvent syntheses for monodisperse semiconductor, conductive, magnetic, organic, and other nanomaterials have been described (Pellegrino et al., 2005, Small, 1:48; Murray et al., 2000, Ann. Rev. Mat.
- Various materials may be encapsulated into synthetic nanocarriers as desirable using a variety of methods including but not limited to C. Astete et al., “Synthesis and characterization of PLGA nanoparticles” J. Biomater. Sci. Polymer Edn, Vol. 17, No. 3, pp. 247-289 (2006); K. Avgoustakis “Pegylated Poly(Lactide) and Poly(Lactide-Co-Glycolide) Nanoparticles: Preparation, Properties and Possible Applications in Drug Delivery” Current Drug Delivery 1:321-333 (2004); C. Reis et al., “Nanoencapsulation I. Methods for preparation of drug-loaded polymeric nanoparticles” Nanomedicine 2:8-21 (2006); P.
- synthetic nanocarriers are prepared by a nanoprecipitation process or spray drying. Conditions used in preparing synthetic nanocarriers may be altered to yield particles of a desired size or property (e.g., hydrophobicity, hydrophilicity, external morphology, “stickiness,” shape, etc.). The method of preparing the synthetic nanocarriers and the conditions (e.g., solvent, temperature, concentration, air flow rate, etc.) used may depend on the materials to be coupled to the synthetic nanocarriers and/or the composition of the polymer matrix.
- Conditions used in preparing synthetic nanocarriers may be altered to yield particles of a desired size or property (e.g., hydrophobicity, hydrophilicity, external morphology, “stickiness,” shape, etc.).
- the method of preparing the synthetic nanocarriers and the conditions (e.g., solvent, temperature, concentration, air flow rate, etc.) used may depend on the materials to be coupled to the synthetic nanocarriers and/or the composition of the polymer matrix.
- particles prepared by any of the above methods have a size range outside of the desired range, particles can be sized, for example, using a sieve.
- Elements of the inventive synthetic nanocarriers may be coupled to the overall synthetic nanocarrier, e.g., by one or more covalent bonds, or may be coupled by means of one or more linkers. Additional methods of functionalizing synthetic nanocarriers may be adapted from Published US Patent Application 2006/0002852 to Saltzman et al., Published US Patent Application 2009/0028910 to DeSimone et al., or Published International Patent Application WO/2008/127532 A1 to Murthy et al.
- synthetic nanocarriers can be coupled to immunofeature surfaces, targeting moieties, adjuvants, various antigens, and/or other elements directly or indirectly via non-covalent interactions.
- the non-covalent coupling is mediated by non-covalent interactions including but not limited to charge interactions, affinity interactions, metal coordination, physical adsorption, host-guest interactions, hydrophobic interactions, TT stacking interactions, hydrogen bonding interactions, van der Waals interactions, magnetic interactions, electrostatic interactions, dipole-dipole interactions, and/or combinations thereof.
- Such couplings may be arranged to be on an external surface or an internal surface of an inventive synthetic nanocarrier.
- encapsulation and/or absorption are/is a form of coupling.
- the inventive synthetic nanocarriers can be combined with other adjuvants by admixing in the same vehicle or delivery system.
- adjuvants may include, but are not limited to mineral salts, such as alum, alum combined with monphosphoryl lipid (MPL) A of Enterobacteria, such as Escherihia coli, Salmonella minnesota, Salmonella typhimurium , or Shigella flexneri or specifically with MPL® (AS04), MPL A of above-mentioned bacteria separately, saponins, such as QS-21, Quil-A, ISCOMs, ISCOMATRIXTM, emulsions such as MF59TM, Montanide® ISA 51 and ISA 720, AS02 (QS21+squalene+MPL®), liposomes and liposomal formulations such as AS01, synthesized or specifically prepared microparticles and microcarriers such as bacteria-derived outer membrane vesicles (OMV) of N.
- gonorrheae Chlamydia trachomatis and others, or chitosan particles
- depot-forming agents such as Pluronic® block co-polymers, specifically modified or prepared peptides, such as muramyl dipeptide, aminoalkyl glucosaminide 4-phosphates such as RC529, or proteins, such as bacterial toxoids or toxin fragments.
- the doses of such other adjuvants can be determined using conventional dose ranging studies.
- the inventive synthetic nanocarriers can be combined with an antigen different, similar or identical to those coupled to a nanocarrier (with or without adjuvant, utilizing or not utilizing another delivery vehicle) administered separately at a different time-point and/or at a different body location and/or by a different immunization route or with another antigen and/or adjuvant-carrying synthetic nanocarrier administered separately at a different time-point and/or at a different body location and/or by a different immunization route.
- Synthetic nanocarriers may be combined to form pharmaceutical dosage forms according to the present invention using traditional pharmaceutical mixing methods. These include liquid-liquid mixing in which two or more suspensions, each containing one or more subset of nanocarriers, are directly combined or are brought together via one or more vessels containing diluent. As synthetic nanocarriers may also be produced or stored in a powder form, dry powder-powder mixing could be performed as could the re-suspension of two or more powders in a common media. Depending on the properties of the nanocarriers and their interaction potentials, there may be advantages conferred to one or another route of mixing.
- Typical inventive compositions that comprise synthetic nanocarriers may comprise inorganic or organic buffers (e.g., sodium or potassium salts of phosphate, carbonate, acetate, or citrate) and pH adjustment agents (e.g., hydrochloric acid, sodium or potassium hydroxide, salts of citrate or acetate, amino acids and their salts) antioxidants (e.g., ascorbic acid, alpha-tocopherol), surfactants (e.g., polysorbate 20, polysorbate 80, polyoxyethylene9-10 nonyl phenol, sodium desoxycholate), solution and/or cryo/lyo stabilizers (e.g., sucrose, lactose, mannitol, trehalose), osmotic adjustment agents (e.g., salts or sugars), antibacterial agents (e.g., benzoic acid, phenol, gentamicin), antifoaming agents (e.g., polydimethylsilozone), preservatives (e.g.,
- compositions according to the invention comprise inventive synthetic nanocarriers in combination with pharmaceutically acceptable excipients.
- the compositions may be made using conventional pharmaceutical manufacturing and compounding techniques to arrive at useful dosage forms. Techniques suitable for use in practicing the present invention may be found in Handbook of Industrial Mixing: Science and Practice , Edited by Edward L. Paul, Victor A. Atiemo-Obeng, and Suzanne M. Kresta, 2004 John Wiley & Sons, Inc.; and Pharmaceutics: The Science of Dosage Form Design, 2nd Ed. Edited by M. E. Auten, 2001, Churchill Livingstone.
- inventive synthetic nanocarriers are suspended in sterile saline solution for injection together with a preservative.
- compositions of the invention can be made in any suitable manner, and the invention is in no way limited to compositions that can be produced using the methods described herein. Selection of an appropriate method may require attention to the properties of the particular moieties being associated.
- inventive synthetic nanocarriers are manufactured under sterile conditions or are terminally sterilized. This can ensure that resulting composition are sterile and non-infectious, thus improving safety when compared to non-sterile compositions. This provides a valuable safety measure, especially when subjects receiving synthetic nanocarriers have immune defects, are suffering from infection, and/or are susceptible to infection.
- inventive synthetic nanocarriers may be lyophilized and stored in suspension or as lyophilized powder depending on the formulation strategy for extended periods without losing activity.
- compositions may be administered by a variety of routes of administration, including but not limited to parenteral (such as subcutaneous, intramuscular, intravenous, or intradermal), pulmonary, sublingual, oral, intranasal, transnasal, intramucosal, transmucosal, rectal, ophthalmic, transcutaneous, transdermal or by a combination of these routes.
- parenteral such as subcutaneous, intramuscular, intravenous, or intradermal
- pulmonary sublingual
- oral intranasal
- transnasal intramucosal
- transmucosal transmucosal
- rectal ophthalmic
- Doses of dosage forms contain varying amounts of populations of synthetic nanocarriers and varying amounts of the compounds of Formulas I or II, according to the invention.
- the amount of synthetic nanocarriers and/or antigens present in the inventive dosage forms can be varied according to the nature of the antigens, the therapeutic benefit to be accomplished, and other such parameters.
- dose ranging studies can be conducted to establish optimal therapeutic amount of the population of synthetic nanocarriers and the amount of antigens to be present in the dosage form.
- the synthetic nanocarriers and the antigens are present in the dosage form in an amount effective to generate an immune response to the antigens upon administration to a subject. It may be possible to determine amounts of the antigens effective to generate an immune response using conventional dose ranging studies and techniques in subjects.
- Inventive dosage forms may be administered at a variety of frequencies.
- at least one administration of the dosage form is sufficient to generate a pharmacologically relevant response.
- at least two administrations, at least three administrations, or at least four administrations, of the dosage form are utilized to ensure a pharmacologically relevant response.
- compositions and methods described herein can be used to induce, enhance, suppress, modulate, direct, or redirect an immune response.
- the compositions and methods described herein can be used in the diagnosis, prophylaxis and/or treatment of conditions such as cancers, infectious diseases, metabolic diseases, degenerative diseases, autoimmune diseases, inflammatory diseases, immunological diseases, or other disorders and/or conditions.
- the compositions and methods described herein can also be used for the prophylaxis or treatment of an addiction, such as an addiction to nicotine or a narcotic.
- the compounds of Formulas I or II are used in the prophylaxis or treatment of an addiction to nicotine.
- the compositions and methods described herein can also be used for the prophylaxis and/or treatment of a condition resulting from the exposure to a toxin, hazardous substance, environmental toxin, or other harmful agent.
- Monoamino poly(ethylene glycol) from JenKem with a molecular weight of 3.5 KD (0.20 gm, 5.7 ⁇ 10 ⁇ 5 moles) and an excess of trans-4-cotininecarboxylic acid (0.126 gm, 5.7 ⁇ 10 ⁇ 4 moles) were dissolved in dimethylformamide (5.0 mL).
- the solution was stirred and dicyclohexylcarbodiimide (0.124 gm, 6.0 ⁇ 10 ⁇ 4 moles) was added. This solution was stirred overnight at room temperature. Water (0.10 mL) was added and stirring was continued for an additional 15 minutes. The precipitate of dicyclohexyl urea was removed by filtration and the filtrates were evaporated under vacuum.
- the cotinine/PEG polymer (0.20 gm, 5.7 ⁇ 10 ⁇ 5 moles) was dissolved in dry tetrahydrofuran (10 mL) under nitrogen and the solution was stirred as a solution of lithium aluminum hydride in tetrahydrofuran (1.43 mL of 2.0M, 2.85 ⁇ 10 ⁇ 3 moles) was added. The addition of the lithium aluminum hydride caused the polymer to precipitate as a gelatinous mass. The reaction was heated to 80° C. under a slow stream of nitrogen and the tetrahydrofuran was allowed to evaporate. The residue was then heated at 80° C. for 2 hours. After cooling, water (0.5 mL) was cautiously added.
- Trans-4-Cotininecarboxylic acid, methyl ester (7.1 gm, 3.03 ⁇ 10 ⁇ 2 moles) and ethanolamine (2.22 gm, 3.64 ⁇ 10 ⁇ 2 moles) were combined and heated at 150° C. for 45 minutes.
- the reaction mass was cooled to about 85° C. and boiling tetrahydrofuran (75 mL) was added.
- the mixture was stirred to provide a solution which was cooled on ice.
- the amine was purified by chromatography on silica gel using 15% of 0.3N methanolic ammonia in methylene chloride (200 mL) followed by 20% of 0.6N methanolic ammonia in methylene chloride. The fractions containing the amine were pooled and evaporated to provide the purified amine as colorless oil in a yield of 1.23 gm.
- 3′-Hydroxyethylaminomethylnicotine (1.10 gm, 4.67 ⁇ 10 ⁇ 3 moles) was dissolved in dry dioxane (100 mL) in a pressure flask. A portion of the dioxane (25 mL) was removed by distillation to remove water via azeotropic distillation. This solution was cooled under argon on ice. Potassium hexamethyldisilazide (9.3 mL of 0.5M in toluene, 4.65 ⁇ 10 ⁇ 3 moles) was added via syringe and stirring was continued on ice for 15 minutes.
- ethylene oxide 25 mL, 22 gm, 0.50 moles
- the flask was sealed and the reaction was stirred at room temperature overnight.
- the reaction was then heated at 50° C. for 30 minutes before being cooled to room temperature.
- the flask was opened and concentrated hydrochloric acid (2.0 mL) was added. After stirring for 30 minutes the solvents were removed under vacuum.
- the viscous liquid residue was stirred with diethyl ether (500 mL) which caused the polymer to separate as a white powder. This was isolated by filtration, washed with ether and dried under vacuum. The polymer was obtained in a yield of 7.2 gm and had a molecular weight of 2200 as determined by NMR.
- Monoamino poly(ethylene glycol)hydrochloride from JenKem with a molecular weight of 3.5 KD (350 mg, 1.0 ⁇ 10 ⁇ 5 moles) was dissolved in chloroform (10 mL). To this solution was added the cotinine aldehyde (116 mg, 5 ⁇ 10 ⁇ 4 moles) followed by acetic acid (60 mg, 1.0 ⁇ 10 ⁇ 3 moles) and sodium triacetoxyborohydride (212 mg, 1.0 ⁇ 10 ⁇ 3 moles). The reaction was stirred at room temperature overnight. Solid sodium bicarbonate (100 mg) was added and stirring was continued for 2 hours.
- the reaction mixture was centrifuged to remove a small amount of solids and the supernatant was placed on top of a silica column (1′′ ⁇ 10′′).
- the column was developed with 10% methanol in methylene chloride (200 mL) followed by 20% methanol in methylene chloride (500 mL).
- the fractions containing the polymer were pooled and evaporated. After drying under high vacuum the polymer was obtained as a white solid in a yield of 227 mg.
- the cotinine polymer (200 mg) was dissolved in dry THF (10 mL) under nitrogen and a solution of lithium aluminum hydride (1.5 mL of 2.0 M in THF, 3 ⁇ 10 ⁇ 3 moles) was added via syringe. The reaction was heated at 80° C. for 2 hours. After cooling, water (0.5 mL) was added followed by 10% methanol in methylene chloride (15 mL). After stirring for 15 minutes the slurry was filtered through a Celite pad which was washed with methylene chloride (10 mL). The combined filtrates were evaporated under vacuum to provide the nicotine polymer in a yield of 200 mg. NMR clearly showed the nicotine in a ratio of 2 nicotines per poly(ethylene) glycol.
- Nornicotine (1.48 gm, 0.01 moles) and succinic anhydride (1.00 gm, 0.01 moles) were combined in chloroform (15 mL). This mixture was brought to reflux causing the succinic anhydride to dissolve. The solution was then stirred at room temperature overnight. The chloroform was removed under vacuum and the residue was dried under high vacuum to give the amide as a tan foam in a yield of 2.4 gm.
- succinoylated nornicotine (2.4 gm, 9.7 ⁇ 10 ⁇ 3 moles) was dissolved in dry THF (30 mL) and the solution was stirred on ice under an atmosphere of argon.
- a solution of lithium aluminum hydride in THF (11.0 mL of a 2.0M solution, 2.2 ⁇ 10 ⁇ 2 moles) was slowly added. After the addition was complete, the hazy solution was heated at reflux for 2 hours. The pale yellow solution that had formed was stirred at room temperature overnight. After cooling on ice, the reaction was treated with water (0.83 mL) followed by 15% sodium hydroxide (0.83 mL) and then water again (2.5 mL).
- the resulting slurry was stirred at room temperature for 30 minutes and was then filtered to remove the aluminum salts.
- the solids were washed with THF (25 mL) and the combined filtrates were evaporated under vacuum.
- the crude product was purified by chromatography on silica using 15% methanol in methylene chloride as eluent. The fractions containing the product were pooled and evaporated under vacuum to provide the nicotine derivative as a pale yellow oil in a yield of 1.2 gm.
- the nicotine alcohol (1.30 gm, 5.9 ⁇ 10 ⁇ 3 moles) was dissolved in dry THF (120 mL) under a blanket of argon in a pressure bottle.
- Potassium hydride suspension in mineral oil (780 mg of a 30% oil dispersion, 5.8 ⁇ 10 ⁇ 3 moles) was added and the reaction was stirred at room temperature for one hour when the hydrogen evolution had stopped and the potassium hydride had dissolved.
- This solution was cooled on ice and condensed ethylene oxide (23.6 gm, 0.535 moles) was added. The pressure flask was sealed and the reaction was stirred overnight at room temperature.
- the THF was removed under vacuum and the semi-solid residue was dissolved in chloroform (10 mL).
- Nornicotine (2.18 gm, 1.47 ⁇ 10 ⁇ 2 moles) and succinic semialdehyde (10 gm of a 15% solution in water, 1.5 gm, 1.47 ⁇ 10 ⁇ 2 moles) were dissolved in acetonitrile (50 mL). This solution was stirred at room temperature as sodium cyanoborohydride (0.92 gm, 1.47 ⁇ 10 ⁇ 2 moles) and acetic acid (0.88 gm, 1.47 ⁇ 10 ⁇ 2 moles) was added. The reaction was stirred at room temperature overnight. The solution was filtered to remove some solids and the filtrates were evaporated to dryness under vacuum.
- the methyl ester (248 mg, 1.0 ⁇ 10 ⁇ 3 moles) was dissolved in THF (10 mL). Methanol (5 mL) and water (200 ⁇ L) were treated with n-butyl lithium (500 ⁇ L of 2.0M in hexanes, 1.0 ⁇ 10 ⁇ 3 moles) and this solution was added to the THF solution of the methyl ester. The solution was refluxed for 30 minutes and was then left at room temperature overnight. The solvents were removed under vacuum and the solid residue was dried under vacuum. Ether (50 mL) was added and this mixture was stirred overnight. The solid which resulted was isolated by centrifugation and was washed with ether. After drying under vacuum the lithium salt was isolated as a white powder in a yield of 141 mg.
- the nicotine carboxylic acid lithium salt (113 mg, 5.0 ⁇ 10 ⁇ 4 moles) was stirred in DMF (2.0 mL) and hydrogen chloride dissolved in dioxane (4M) was added until an aliquot in water had a pH of 5.0 (250 ⁇ L). To this solution was added N-hydroxysuccinimide (57.5 mg, 5.0 ⁇ 10 ⁇ 4 moles) and dicyclohexyl carbodiimide (103 mg, 5.0 ⁇ 10 ⁇ 4 moles). This solution was stirred at room temperature overnight.
- the resulting slurry was treated with a solution of aminopoly(ethylene)glycol hydrochloride (750 mg, 2.14 ⁇ 10 ⁇ 4 moles) and diisopropylethylamine (1.0 mL) in DMF (5.0 mL). This solution was stirred at room temperature overnight. The reaction was filtered free of solids and the filtrates were evaporated under vacuum. The residue was subjected to chromatography on silica gel using 15% methanol in methylene chloride as eluent. The fractions containing the product were pooled and evaporated to provide the polymer conjugate as a white waxy solid.
- a solution of 3′-hydroxymethylnicotine (1.92 gm, 1.0 ⁇ 10 ⁇ 2 moles) was prepared in dry dioxane (100 mL). This solution was brought to reflux and a portion of the dioxane (50 mL) was allowed to distill from the flask to remove water. The flask and contents were cooled to room temperature under argon. The solution was then cooled to 10° C. and a solution of potassium bis-trimethylsilylamide (20 mL, 0.5 M in toluene, 1.0 ⁇ 10 ⁇ 2 moles) was added via syringe. This solution was kept at 10° C. under argon until needed for the next step.
- the flask was opened and acetic acid (0.6 gm, 1.0 ⁇ 10 ⁇ 2 moles) was added. After stirring for an additional 30 minutes, the polymer was precipitated by addition to diethyl ether (1.5 L) with stirring. The solid polymer was isolated by filtration and was washed with ether before being dried under vacuum. The yield of polymer was 48 gm (96%) with a molecular weight of about 5000 by GPC.
- a solution of trans-3′-hydroxymethylnicotine (1.92 gm, 1.0 ⁇ 10 ⁇ 2 moles) was prepared in dry dioxane (100 mL). This solution was brought to reflux and a portion of the dioxane (50 mL) was allowed to distill from the flask to remove water. The flask and contents were cooled to room temperature under argon. The solution was then cooled to 10° C. and potassium hydride (1.34 gm, 1.49 mL of a 30% suspension in mineral oil, 1.0 ⁇ 10 ⁇ 2 moles) was added via pipette. This solution was stirred at room temperature for an hour at which point hydrogen evolution had stopped.
- the solid polymer was isolated by filtration and was washed with TBME (2 ⁇ 100 mL). The polymer was partially dried by vacuum under a rubber dam before being recrystallized from 2-propanol (150 mL). The polymer was isolated by filtration and was washed with 2-propanol (50 mL) followed by TBME (100 mL) before being dried under vacuum. The yield of polymer was 42.2 gm (81%) with a molecular weight of about 4700 by NMR.
- a solution of trans-3′-hydroxymethylnicotine (1.92 gm, 1.0 ⁇ 10 ⁇ 2 moles) was prepared in dry 2-methyltetrahydrofuran (100 mL). This solution was brought to reflux and a portion of the 2-methyltetrahydrofuran (50 mL) was allowed to distill from the flask to remove water. The flask and contents were cooled to room temperature under argon. The solution was then cooled to 0° C. and potassium hydride (1.34 gm, 1.49 mL of a 30% suspension in mineral oil 1.0 ⁇ 10 ⁇ 2 moles) was added via pipette. This mixture was stirred at room temperature for 2 hours at which point hydrogen evolution had stopped.
- the polymer was isolated by filtration and was washed with 2-propanol (50 mL) followed by TBME (2 ⁇ 50 mL) before being dried under vacuum at 30° C.
- the yield of polymer was 42.7 gm (82.3%) with a molecular weight of about 4900 by NMR.
- a solution of trans-3′-hydroxymethylnicotine (3.85 gm, 2.0 ⁇ 10 ⁇ 2 moles) was prepared in dry 2-methyltetrahydrofuran (200 mL). This solution was brought to reflux and a portion of the 2-methyltetrahydrofuran (100 mL) was allowed to distill from the flask to remove water. The flask and contents were cooled in an ice bath under argon. The solution was then treated with potassium hydride (2.68 gm, 3.0 mL of a 30% suspension in mineral oil, 2.0 ⁇ 10 ⁇ 2 moles) was added via pipette. This mixture was stirred at room temperature for 1 hour at which point hydrogen evolution had stopped.
- ethylene oxide (8.8 gm, 9.9 mL, 0.20 moles) was condensed in a cooled, dry graduated cylinder.
- the ethylene oxide was added to the cooled reaction and the pressure flask was sealed.
- the reaction was warmed to 55° C. in an oil bath which caused an exothermic reaction to begin and the temperature rose to 65° C.
- a water bath was used to keep the temperature between 40-50° C. and the flask and contents were stirred at room temperature overnight.
- the flask was opened and acetic acid (3.6 gm, 6.0 ⁇ 10 ⁇ 2 moles) was added.
- a solution of trans-3′-hydroxymethylnicotine (3.85 gm, 2.0 ⁇ 10 ⁇ 2 moles) was prepared in dry 2-methyltetrahydrofuran (300 mL). This solution was brought to reflux and a portion of the 2-methyltetrahydrofuran (100 mL) was allowed to distill from the flask to remove water. The flask and contents were cooled in an ice bath under argon. The solution was then treated with potassium hydride (2.68 gm, 3.0 mL of a 30% suspension in mineral oil, 2.0 ⁇ 10 ⁇ 2 moles) was added via pipette. This mixture was stirred at room temperature for 2 hours at which point hydrogen evolution had stopped.
- ethylene oxide 40 gm, 44.9 mL, 0.91 moles
- ethylene oxide 40 gm, 44.9 mL, 0.91 moles
- the ethylene oxide was added to the cooled reaction and the pressure flask was sealed.
- the flask and contents were stirred at room temperature overnight.
- the flask was opened and acetic acid (1.8 gm, 3.0 ⁇ 10 ⁇ 2 moles) was added.
- the hazy solution was decanted through a cotton plug and was added to diethyl ether (1.0 L) with vigorous stirring. After settling, the solid polymer was isolated by filtration and was washed with ether before being dried under vacuum.
- the solid polymer was dissolved in boiling tetrahydrofuran (300 mL) and, after cooling, the solution was filtered through a thin pad of Celite to remove insoluble material.
- the clear filtrates were diluted with diethyl ether (600 mL) and this solution was cooled on ice for 2 hours with stirring.
- the polymer which had separated was isolated by filtration and was washed with ether before being dried under vacuum.
- the yield of polymer was 30 gm (68%) with a molecular weight of about 2 KD by NMR.
- a 100 mL round bottom flask, equipped with a stir bar and reflux condenser was charged with the PEG/nicotine polymer (0.081 gm, 2.2 ⁇ 10 ⁇ 5 moles) from example 1, D/L lactide (0.410 gm, 2.85 ⁇ 10 ⁇ 3 moles) and anhydrous sodium sulfate (0.380 gm). This was dried under vacuum at 55° C. for 8 hours. The flask was cooled and flushed with argon and then dry toluene (10 mL) was added.
- the flask was placed in an oil bath set at 120° C., and once the lactide had dissolved, tin ethylhexanoate (5.5 mg, 1.36 ⁇ 10 ⁇ 5 moles) was added. The reaction was allowed to proceed at 120° C. for 16 hours. After cooling to room temperature, water (15 mL) was added and stirring was continued for 30 minutes. Methylene chloride (200 mL) was added, and after agitation in a separatory funnel, the phases were allowed to settle. The methylene chloride layer was isolated and dried over anhydrous magnesium sulfate. After filtration to remove the drying agent, the filtrates were evaporated under vacuum to give the polymer as a colorless foam.
- the polymer was dissolved in tetrahydrofuran (10 mL) and this solution was slowly added to water (150 mL) with stirring. The precipitated polymer was isolated by centrifugation and the solid was dissolved in methylene chloride (10 mL). The methylene chloride was removed under vacuum and the residue was dried under vacuum. The yield was 0.38 gm.
- poly(ethylene)glycol—nicotine conjugate made as described in Example 2 (190 mg, 4.86 ⁇ 10 ⁇ 5 moles), D/L lactide (911 mg, 6.3 ⁇ 10 ⁇ 3 moles), and sodium sulfate (844 mg) were dried under vacuum at 50° C. for 8 hours.
- dry toluene (20 mL) The flask was purged with nitrogen and heated to 120° C. After stirring for 10 minutes, tin (II) ethylhexanoate (10 ⁇ L) was added and the reaction was stirred at 120° C. overnight under nitrogen. After cooling water (10 mL) was added and stirring was continued for 15 minutes.
- the PEG-nicotine conjugate (5.0 gm, 2.5 ⁇ 10 ⁇ 3 moles) made as described in Example 4 and D/L lactide (15 gm, 0.104 moles) were combined in toluene (300 mL). The mixture was heated to reflux and toluene (30 mL) was allowed to distill from the flask to remove water. After cooling slightly, tin (II) ethylhexanoate (300 ⁇ L) was added. Heating at 120° C. was continued overnight. After cooling the toluene was removed under vacuum and the residue was dissolved in chloroform (200 mL). This solution was washed with water (200 mL) and then dried over magnesium sulfate.
- a 1000 mL round bottom flask, equipped with a stir bar and reflux condenser was charged with the PEG/nicotine polymer (5.0 gm, 1.0 ⁇ 10 ⁇ 3 moles) described in example 6, D/L lactide (18.7 gm, 0.13 moles) and toluene (400 mL).
- a portion of the toluene (50 mL) was distilled from the flask to remove any water present and the solution was then cooled to about 100° C. and flushed with argon.
- the flask was placed in an oil bath set at 120° C. and tin ethylhexanoate (250 ⁇ L) was added. The reaction was allowed to proceed at 120° C.
- the polymer had a lactide —CH to PEG —CH 2 CH 2 — ratio of 2.1/4. If the PEG has a molecular weight of 5000 then the PLA has a molecular weight of 17,200.
- a 500 mL round bottom flask, equipped with a stir bar and reflux condenser was charged with the PEG/nicotine polymer (5.0 gm, 1.0 ⁇ 10 ⁇ 3 moles), D/L lactide (18.7 gm, 0.13 moles) and toluene (100 mL).
- a portion of the toluene (50 mL) was distilled from the flask to remove any water present and the solution was then cooled to about 100° C. and flushed with argon.
- the flask was placed in an oil bath set at 120° C. and tin ethylhexanoate (200 ⁇ L) was added. The reaction was allowed to proceed at 120° C. for 16 hours under argon with stirring.
- Step-1 Polymerization of dl-lactide with HO-PEG-Nic:
- the oil bath temperature was then lowered to ca. 105-110° C. while the azeotrope collector was removed and the drying tube on top of the condenser was replaced with argon balloon (or dry inert gas inlet).
- argon balloon or dry inert gas inlet.
- the dense solution was then added to a solution of 2-propanol (100 mL) with vigorous stirring and a sticky gel-like polymer precipitated out of the solution (the reaction flask was rinsed with ca. 10 mL of 2-propanol to transfer the residue solution. Stirring could be difficult and gentle shaking could be applied).
- the mixture was stirred or shaken for ca. 10 min and then allowed to settle.
- the top milky 2-propanol supernatant was then decanted (residue 2-propanol could be removed on a Rotavap).
- the residue polymer was then dissolved in 30 mL of EtOAc and transferred to an additional funnel (the flask is rinsed with ca. 5 mL of EtOAc, total volume was about 55 mL).
- Step-1 Polymerization of dl-lactide with HO-PEG-Nic:
- the crude imine was then dissolved in m-xylene (120 mL) and succinic anhydride (100 g, 1.0 mol, 1.0 eq) was added. The resulting mixture was heated at reflux for 22-30 h (a dark brown heavy mixture). The mixture was cooled to rt and the crude product solidified at bottom of the flask. m-Xylene was then decanted away (although not tried, m-xylene could be left in the flask during the workup) and the residue solids were carefully dissolved with 10% aq. NaHCO3 (1.6 L) with cooling (release of CO2) to ca. pH 8.5. The aqueous mixture (remaining m-xylene could be removed at this step) was washed with DCM (2 ⁇ 350 mL) and then de-colorized with activated carbon (10 g) (solution was still brown in color).
- the pH of the aqueous solution was then adjusted to 4.7 with conc. H3PO4 with cooling to precipitate the product.
- the mixture was cooled overnight.
- the white solids were collected and washed with cold water until no color in washes.
- the solids were dried at 40° C. under vacuum until constant weight as trans-4-cotininecarboxylic acid (103 g).
- the combined aqueous filtrates (ca. 2 L) were further concentrated to ca. 300 mL and cooled to precipitate out more products (21 g). Total recovery was 124 g (56% yd, H NMR). The product was used without further purification.
- the combined DCM phase was dried over Na2SO4 and concentrated to dryness to give crude trans-3′-hydroxymethylnicotine as a yellow liquid (ca. 30 g).
- the crude product was further purified by vacuum distillation to give pure trans-3′-hydroxymethylnicotine (bp 145-155 C/3-4 torr; recovery: 23.4 g from 30 g crude, 76%).
- the crude product can also be purified by chromatography on silica gel eluting with MeOH in DCM.
- Racemic trans-3′-hydroxymethylnicotine prepared from above procedure is subjected to chiral separation on a Chiral Daicel IC column (21 ⁇ 250 mm, 5 ⁇ m).
- the detailed conditions are as follows:
- a preparative SFC80 (Waters) instrument is set-up using stack-injection program (1.2 mL per injection, 100 mg compound, total 270 injections).
- a binary pump is used to deliver CO2 (liquid) and MeOH (with total 0.5% DEA).
- Each cycle is set-up for 4 min.
- the Peak #1 is collected during 2.05-2.25 min and Peak #2 is collected during 2.30-2.55 min.
- CO2 is evaporated, all Peak #1 and Peak #2 fractions are combined separately.
- the residues are concentrated at 35-45° C./5-10 mmHg until dryness.
- (2R′, 3R′)-PEG-Nic with MW of 5580 or (2S′, 3S′)-PEG-Nic with MW of 4280 was prepared by ring opening polymerization of ethylene oxide with the corresponding (+)-(2R′, 3R′) or ( ⁇ )-(2S′, 3S′)-hydroxymethylnicotine from Example 19.
- 6-substituted (S)-nicotine ((S)-trans-4-[3-(5-(1-methyl-2-pyrrolidnyl)-2-pyridinyl)propyl]cyclohexanecarboxylic acid) is prepared according to procedures as described in PCT WO 01/70730 A1 (165 mg, 0.5 mmol, 1.1 eq) and HO-PEG-NH2.HCl (MW 3500, 1.6 g, 0.45 mmol, 1.0 eq) are dissolved in dry DCM (10 mL).
- the cooled solution is then added to 300 mL of 2-propanol with vigorous stirring and a gel-like polymer is formed.
- the mixture is stirred or shaken for 20 min and allowed to settle.
- the top 2-propanol layer is decanted and the residue is washed sequentially with 2-propanol (50 mL) and t-butyl methylether (50 mL).
- the gel-like polymer is then dried under vacuum at 35 C to constant weight to give PLA-PEG-(S)-nicotine conjugate as a white solid (ca. 8 g recovery, Mn by H NMR is 23,000).
- 6-hydroxypropylnicotine is prepared according to the literature preparation [Seeman et al, Journal of Organic Chemistry 51, 1548, (1986)]. This compound is converted to the mercaptan by reaction with thiourea in the presence of concentrated hydrochloric acid [Buter and Kellogg, Organic Syntheses, Collective Volume 8, 592, (1993)]. This mercaptan is used to initiate ring opening polymerization of propylene sulfide in the following manner.
- a solution of 6-mercaptopropylnicotine (4.73 gm, 2.0 ⁇ 10 ⁇ 2 moles) is prepared in dry 2-methyltetrahydrofuran (300 mL). This solution is brought to reflux and a portion of the 2-methyltetrahydrofuran (100 mL) is allowed to distill from the flask to remove water. The flask and contents are cooled in an ice bath and the flask is flushed with argon. The solution is then treated with DBU (1,8-diazabicyclo[5,4,0]undec-7-ene, 3.04 gm, 2.0 ⁇ 10 ⁇ 2 moles). This mixture is stirred at room temperature for 1 hour and is then cooled on ice again.
- DBU 1,8-diazabicyclo[5,4,0]undec-7-ene
- Propylene sulfide (66.7 gm, 70 mL, 0.90 moles) is added to the cooled reaction and the flask is sealed under argon. The flask and contents are stirred at room temperature for 4 hours after which 2-bromoethanol (3.1 gm, 1.77 mL, 2.5 ⁇ 10 ⁇ 2 moles) is added. Stirring at room temperature is continued overnight. The resulting solution is evaporated under vacuum and the oily residue is dissolved in methylene chloride (300 mL) and this solution is washed with water (2 ⁇ 100 mL). After drying over sodium sulfate, the solution is filtered and evaporated under vacuum. After drying under high vacuum there is obtained 51.8 gm (70%) of a polypropylene sulfide (PPS) conjugate of nicotine terminated with an alcohol function.
- PPS polypropylene sulfide
- the PPS-nicotine conjugate (9.24 gm, 2.5 ⁇ 10 ⁇ 3 moles), made as described in Example 21, and ⁇ -caprolactone (11.9 gm, 0.104 moles) are combined in toluene (300 mL).
- the mixture is heated to reflux and toluene (30 mL) is allowed to distill from the flask to remove water.
- tin (II) ethylhexanoate 300 ⁇ L
- Heating at 120° C. is continued overnight.
- the toluene is removed under vacuum and the residue is dissolved in chloroform (200 mL). This solution is washed with water (200 mL) and then dried over magnesium sulfate.
- the toluenesulfonate ester of 3′-hydroxymethylnicotine is prepared by the literature method [Sanderson et al, International Immunopharmacology, 3, 137, (2003)].
- a 500 mL round bottom flask, equipped with a stir bar and reflux condenser is charged with the polyethyloxazoline-nicotine polymer (5.0 gm, 1.0 ⁇ 10 ⁇ 3 moles) from example 24, D/L lactide (14.4 gm, 0.10 moles), glycolide (3.48 gm, 0.03 moles) and toluene (100 mL).
- D/L lactide (14.4 gm, 0.10 moles
- glycolide 3.48 gm, 0.03 moles
- toluene 100 mL
- a portion of the toluene (50 mL) is distilled from the flask to remove any water present and the solution is then cooled to about 100° C. and flushed with argon.
- the flask is placed in an oil bath set at 120° C. and tin ethylhexanoate (200 ⁇ L) is added.
- the reaction is allowed to proceed at 120° C. for 16 hours under argon with stirring. After cooling to room temperature methylene chloride (250 mL) is added along with water (200 mL) and this mixture is shaken in a separatory funnel. The phases are allowed to settle and the methylene chloride layer is isolated and dried over anhydrous sodium sulfate. After filtration by decantation through a cotton plug to remove the drying agent, the filtrates are evaporated under vacuum to a volume of approximately 50 mL. This solution is stirred as 2-propanol (300 mL) is added which causes the polymer to precipitate as a sticky mass. The precipitated polymer is isolated by decantation of the 2-propanol. After washing with 2-propanol (50 mL) by decantation, any remaining 2-propanol is removed under vacuum before the polymer is dried under high vacuum.
- Resiquimod (aka R848) was synthesized according to the synthesis provided in Example 99 of U.S. Pat. No. 5,389,640 to Gerster et al.
- a PLA-PEG-nicotine conjugate was prepared at Selecta Biosciences using the method of example 16.
- the PLA-PEG-nicotine and PLA structures were confirmed by NMR and the molecular weights were determined by GPC.
- Solution #1 (0.4 mL), solution #2 (0.4 mL), solution #3 (0.4 mL) and solution #4 (0.1 mL) were combined in a small vial and the mixture was sonicated at 50% amplitude for 40 seconds using a Branson Digital Sonifier 250.
- solution #5 (2.0 mL) and sonication at 35% amplitude for 40 seconds using the Branson Digital Sonifier 250 formed the second emulsion. This was added to a beaker containing water (30 mL) and this mixture was stirred at room temperature for 2 hours to form the nanoparticles.
- a portion of the nanoparticle dispersion (1.0 mL) was diluted with water (14 mL) and this was concentrated by centrifugation in an Amicon Ultra centrifugal filtration device with a membrane cutoff of 100 KD. When the volume was about 250 ⁇ L, water (15 mL) was added and the particles were again concentrated to about 250 ⁇ L using the Amicon device.
- These nanoparticles contained both resiquimod and a protein encapsulated within the nanoparticle with nicotine displayed on the surface of the nanoparticle.
- Resiquimod (aka R848) was synthesized according to the synthesis provided in Example 99 of U.S. Pat. No. 5,389,640 to Gerster et al and was attached to PLA using HOBT as condensing agent.
- the PLA-PEG-nicotine conjugate was prepared at Selecta Biosciences using the method of Example 13.
- the PLA-PEG-nicotine and PLA structures were confirmed by NMR and the molecular weights were determined by GPC.
- Solution #1 (0.25 to 0.75 mL), solution #2 (0.25 mL), and solution #3 (0.25 to 0.5 mL) were combined in a small vial and the mixture was sonicated at 50% amplitude for 40 seconds using a Branson Digital Sonifier 250.
- solution #4 2.0 mL
- sonication at 35% amplitude for 40 seconds using the Branson Digital Sonifier 250 formed the second emulsion. This was added to a beaker containing phosphate buffer solution (30 mL) and this mixture was stirred at room temperature for 2 hours to form the nanoparticles.
- nanoparticle dispersion 7.0 mL was transferred to a centrifuge tube and spun at 5,300 g for one hour, supernatant was removed, and the pellet was re-suspended in 7.0 mL of phosphate buffered saline. The centrifuge procedure was repeated and the pellet was re-suspended in 2.2 mL of phosphate buffered saline for a final nanoparticle dispersion of about 10 mg/mL.
- These nanoparticles contained the adjuvant, resiquimod, covalently attached to PLA situated in the interior of the nanoparticle with nicotine displayed on the surface of the nanoparticle.
- mice Groups of five mice were immunized three times (subcutaneously, hind limbs) at 2-week intervals (days 0, 14 and 28) with 100 ⁇ g of synthetic nanocarriers from Example 29 or 30 and serum anti-nicotine antibodies were then measured on days 26, 40 and 54.
- EC50 for anti-nicotine antibodies are measured with a standard ELISA assay.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Polymers & Plastics (AREA)
- Pharmacology & Pharmacy (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- General Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Nanotechnology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Crystallography & Structural Chemistry (AREA)
- Molecular Biology (AREA)
- Medical Informatics (AREA)
- Biophysics (AREA)
- Addiction (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Neurosurgery (AREA)
- Psychiatry (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Plural Heterocyclic Compounds (AREA)
- Medicinal Preparation (AREA)
Abstract
Description
- 1. Resiquimod in methylene chloride @ 7.5 mg/mL
- 2. PLA-PEG-nicotine in methylene chloride @ 100 mg/mL
- 3. PLA in methylene chloride @ 100 mg/mL
- 4. Peptide in water @ 10 mg/mL, the peptide having the sequence:
| SEQ ID NO. 1 | |
| ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ |
- 5. Polyvinyl alcohol in water @50 mg/mL.
- 1. PLA-R848 conjugate @ 100 mg/mL in methylene chloride
- 2. PLA-PEG-nicotine in methylene chloride @ 100 mg/mL
- 3. PLA in methylene chloride @ 100 mg/mL
- 4. Polyvinyl alcohol in water @50 mg/mL.
Claims (29)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US13/289,211 US9994443B2 (en) | 2010-11-05 | 2011-11-04 | Modified nicotinic compounds and related methods |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US41059710P | 2010-11-05 | 2010-11-05 | |
| US13/289,211 US9994443B2 (en) | 2010-11-05 | 2011-11-04 | Modified nicotinic compounds and related methods |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| US20120114677A1 US20120114677A1 (en) | 2012-05-10 |
| US9994443B2 true US9994443B2 (en) | 2018-06-12 |
Family
ID=46019835
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/289,211 Expired - Fee Related US9994443B2 (en) | 2010-11-05 | 2011-11-04 | Modified nicotinic compounds and related methods |
Country Status (4)
| Country | Link |
|---|---|
| US (1) | US9994443B2 (en) |
| EP (1) | EP2640190A4 (en) |
| EA (1) | EA201390660A1 (en) |
| WO (1) | WO2012061717A1 (en) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10335395B2 (en) | 2013-05-03 | 2019-07-02 | Selecta Biosciences, Inc. | Methods of administering immunosuppressants having a specified pharmacodynamic effective life and therapeutic macromolecules for the induction of immune tolerance |
| US10420835B2 (en) | 2011-04-29 | 2019-09-24 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers for antigen-specific deletion of T effector cells |
| US10933129B2 (en) | 2011-07-29 | 2021-03-02 | Selecta Biosciences, Inc. | Methods for administering synthetic nanocarriers that generate humoral and cytotoxic T lymphocyte responses |
| US11426451B2 (en) | 2017-03-11 | 2022-08-30 | Selecta Biosciences, Inc. | Methods and compositions related to combined treatment with antiinflammatories and synthetic nanocarriers comprising an immunosuppressant |
| US11633422B2 (en) | 2014-09-07 | 2023-04-25 | Selecta Biosciences, Inc. | Methods and compositions for attenuating anti-viral transfer vector immune responses |
Families Citing this family (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| MX357630B (en) | 2009-05-27 | 2018-07-17 | Selecta Biosciences Inc | Targeted synthetic nanocarriers with ph sensitive release of immunomodulatory agents. |
| AU2010293059B2 (en) * | 2009-08-26 | 2017-03-16 | Selecta Biosciences, Inc. | Compositions that induce T cell help |
| EA030813B1 (en) | 2010-05-26 | 2018-10-31 | Селекта Байосайенсиз, Инк | Methods of generating an antibody immune response and enhancing local induction of immune cytokines when using synthetic nanocarriers coupled with adjuvants |
| PL2791160T3 (en) | 2011-12-16 | 2022-06-20 | Modernatx, Inc. | Modified mrna compositions |
| EP2971010B1 (en) | 2013-03-14 | 2020-06-10 | ModernaTX, Inc. | Formulation and delivery of modified nucleoside, nucleotide, and nucleic acid compositions |
| WO2015116775A1 (en) * | 2014-01-30 | 2015-08-06 | Trudeau Institute | Nanoparticles for immune stimulation |
| PL3981437T3 (en) | 2014-04-23 | 2025-02-24 | Modernatx, Inc. | Nucleic acid vaccines |
| AU2015289583A1 (en) | 2014-07-16 | 2017-02-02 | Modernatx, Inc. | Chimeric polynucleotides |
| CN109796436B (en) * | 2019-02-18 | 2021-07-13 | 上海阿拉丁生化科技股份有限公司 | Method for preparing high-purity (+/-) -trans-4' -carboxycotinine |
| WO2020176791A1 (en) * | 2019-02-28 | 2020-09-03 | Nano Vape Corporation | Nitric oxide releasing vaping formulations, compounds, use, and methods of forming |
| CN114034796A (en) * | 2021-11-16 | 2022-02-11 | 云南省烟草农业科学研究院 | Method for quantitatively analyzing 11 kinds of amide alkaloids in tobacco leaves by gas chromatography-quadrupole mass spectrometry |
Citations (213)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3996355A (en) | 1975-01-02 | 1976-12-07 | American Home Products Corporation | Permanent suspension pharmaceutical dosage form |
| US4021364A (en) | 1972-12-04 | 1977-05-03 | Prof. Dr. Peter Speiser | Microcapsules in the nanometric range and a method for their production |
| US4225581A (en) | 1975-03-20 | 1980-09-30 | Jorg Kreuter | Biological materials |
| US4950432A (en) | 1987-10-16 | 1990-08-21 | Board Of Regents, The University Of Texas System | Polyene microlide pre-liposomal powders |
| WO1992015582A1 (en) | 1991-03-01 | 1992-09-17 | Minnesota Mining And Manufacturing Company | 1-SUBSTITUTED, 2-SUBSTITUTED 1H-IMIDAZO[4,5-c]QUINOLIN-4-AMINES |
| US5175296A (en) | 1991-03-01 | 1992-12-29 | Minnesota Mining And Manufacturing Company | Imidazo[4,5-c]quinolin-4-amines and processes for their preparation |
| US5389640A (en) | 1991-03-01 | 1995-02-14 | Minnesota Mining And Manufacturing Company | 1-substituted, 2-substituted 1H-imidazo[4,5-c]quinolin-4-amines |
| US5395937A (en) | 1993-01-29 | 1995-03-07 | Minnesota Mining And Manufacturing Company | Process for preparing quinoline amines |
| US5543158A (en) | 1993-07-23 | 1996-08-06 | Massachusetts Institute Of Technology | Biodegradable injectable nanoparticles |
| EP0636031B1 (en) | 1992-04-16 | 1996-09-04 | Minnesota Mining And Manufacturing Company | Vaccine adjuvant |
| US5578325A (en) | 1993-07-23 | 1996-11-26 | Massachusetts Institute Of Technology | Nanoparticles and microparticles of non-linear hydrophilic-hydrophobic multiblock copolymers |
| US5663153A (en) | 1994-03-25 | 1997-09-02 | Isis Pharmaceuticals, Inc. | Immune stimulation by phosphorothioate oligonucleotide analogs |
| WO1997047623A1 (en) | 1996-06-10 | 1997-12-18 | Cytos Pharmaceuticals Llc | Imidazole derivatives as protective agents in reperfusion injury and severe inflammatory responses |
| WO1998014216A2 (en) | 1996-09-30 | 1998-04-09 | Immulogic Pharmaceutical Corporation | Hapten-carrier conjugates for use in drug-abuse therapy and methods for preparation of same |
| US5762904A (en) | 1993-07-23 | 1998-06-09 | Massachusetts Institute Of Technology | Oral delivery of vaccines using polymerized liposomes |
| WO1998037919A1 (en) | 1997-02-28 | 1998-09-03 | University Of Iowa Research Foundation | USE OF NUCLEIC ACIDS CONTAINING UNMETHYLATED CpG DINUCLEOTIDE IN THE TREATMENT OF LPS-ASSOCIATED DISORDERS |
| WO1998040100A1 (en) | 1997-03-10 | 1998-09-17 | Ottawa Civic Loeb Research Institute | USE OF NUCLEIC ACIDS CONTAINING UNMETHYLATED CpG DINUCLEOTIDE AS AN ADJUVANT |
| WO1998052581A1 (en) | 1997-05-20 | 1998-11-26 | Ottawa Civic Hospital Loeb Research Institute | Vectors and methods for immunization or therapeutic protocols |
| US5871747A (en) | 1992-09-11 | 1999-02-16 | Institut Pasteur | Antigen-carrying microparticles and their use in the indication of humoral or cellular responses |
| US5912017A (en) | 1987-05-01 | 1999-06-15 | Massachusetts Institute Of Technology | Multiwall polymeric microspheres |
| US5928647A (en) | 1993-01-11 | 1999-07-27 | Dana-Farber Cancer Institute | Inducing cytotoxic T lymphocyte responses |
| US5939100A (en) | 1993-11-01 | 1999-08-17 | Pharmacia And Upjohn Ab | Composition for drug delivery comprising nicotine or a derivative thereof and starch microspheres and method for the manufacturing thereof |
| WO1999056755A1 (en) | 1998-05-06 | 1999-11-11 | University Of Iowa Research Foundation | Methods for the prevention and treatment of parasitic infections and related diseases using cpg oligonucleotides |
| US5985325A (en) | 1997-06-13 | 1999-11-16 | American Home Products Corporation | Rapamycin formulations for oral administration |
| US5989591A (en) | 1997-03-14 | 1999-11-23 | American Home Products Corporation | Rapamycin formulations for oral administration |
| WO1999061054A1 (en) | 1998-05-29 | 1999-12-02 | Independent Pharmaceutica Ab | Nicotine immunogen |
| US6007845A (en) | 1994-07-22 | 1999-12-28 | Massachusetts Institute Of Technology | Nanoparticles and microparticles of non-linear hydrophilic-hydrophobic multiblock copolymers |
| WO2000006123A1 (en) | 1998-07-29 | 2000-02-10 | Chiron Corporation | Microparticles with adsorbent surfaces, methods of making same, and uses thereof |
| US6039969A (en) | 1996-10-25 | 2000-03-21 | 3M Innovative Properties Company | Immune response modifier compounds for treatment of TH2 mediated and related diseases |
| US6043224A (en) | 1996-09-05 | 2000-03-28 | The Massachusetts Institute Of Technology | Compositions and methods for treatment of neurological disorders and neurodegenerative diseases |
| US6060082A (en) | 1997-04-18 | 2000-05-09 | Massachusetts Institute Of Technology | Polymerized liposomes targeted to M cells and useful for oral or mucosal drug delivery |
| WO2000050075A2 (en) | 1999-02-26 | 2000-08-31 | Chiron S.P.A. | Enhancement of bactericidal activity of neisseria antigens with oligonucleotides containing cg motifs |
| US6130082A (en) | 1988-05-05 | 2000-10-10 | American Cyanamid Company | Recombinant flagellin vaccines |
| US6132723A (en) | 1995-06-07 | 2000-10-17 | Alberta Research Council | Immunogenic oligosaccharide compositions |
| US6194388B1 (en) | 1994-07-15 | 2001-02-27 | The University Of Iowa Research Foundation | Immunomodulatory oligonucleotides |
| US6197229B1 (en) | 1997-12-12 | 2001-03-06 | Massachusetts Institute Of Technology | Method for high supercoiled DNA content microspheres |
| US6207646B1 (en) | 1994-07-15 | 2001-03-27 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules |
| US6218371B1 (en) | 1998-04-03 | 2001-04-17 | University Of Iowa Research Foundation | Methods and products for stimulating the immune system using immunotherapeutic oligonucleotides and cytokines |
| US6232082B1 (en) | 1998-12-01 | 2001-05-15 | Nabi | Hapten-carrier conjugates for treating and preventing nicotine addiction |
| US6239116B1 (en) | 1994-07-15 | 2001-05-29 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules |
| US6245776B1 (en) | 1999-01-08 | 2001-06-12 | 3M Innovative Properties Company | Formulations and methods for treatment of mucosal associated conditions with an immune response modifier |
| US6254890B1 (en) | 1997-12-12 | 2001-07-03 | Massachusetts Institute Of Technology | Sub-100nm biodegradable polymer spheres capable of transporting and releasing nucleic acids |
| US6288040B1 (en) | 1997-10-17 | 2001-09-11 | Dss Drug Delivery Service Gesellschaft Zur Forderung Der Foshung In Phamazeutischer Technologi Und Biopharmazie Mbh | Medicament excipient particles for tissue-specific application of a medicament |
| WO2001068103A2 (en) | 2000-03-10 | 2001-09-20 | Dynavax Technologies Corporation | Treatment of herpes infection using immunomodulatory polynucleotide sequences |
| US6329381B1 (en) | 1997-11-28 | 2001-12-11 | Sumitomo Pharmaceuticals Company, Limited | Heterocyclic compounds |
| US6365187B2 (en) | 1992-04-24 | 2002-04-02 | Brown University Research Foundation | Bioadhesive microspheres and their use as drug delivery and imaging systems |
| US6486168B1 (en) | 1999-01-08 | 2002-11-26 | 3M Innovative Properties Company | Formulations and methods for treatment of mucosal associated conditions with an immune response modifier |
| US20030009029A1 (en) | 1998-06-18 | 2003-01-09 | Merck Patent Gmbh | Catalytic titanium (IV) oxide, mediated geminal symmetric dialkylation of carboxamides |
| US20030035804A1 (en) | 1996-09-16 | 2003-02-20 | Beth Israel Deaconess Medical Center | Drug complex for treatment of metastatic prostate cancer |
| US20030054042A1 (en) | 2001-09-14 | 2003-03-20 | Elaine Liversidge | Stabilization of chemical compounds using nanoparticulate formulations |
| US6558951B1 (en) | 1999-02-11 | 2003-05-06 | 3M Innovative Properties Company | Maturation of dendritic cells with immune response modifying compounds |
| US6565859B1 (en) | 1993-05-27 | 2003-05-20 | Novartis Ag | Galenical formulations |
| US6569463B2 (en) | 1999-11-23 | 2003-05-27 | Lipocine, Inc. | Solid carriers for improved delivery of hydrophobic active ingredients in pharmaceutical compositions |
| US6585980B1 (en) | 1997-04-11 | 2003-07-01 | The University Of Toronto | Flagellin gene, FlaC of Campylobacter |
| US20030133988A1 (en) | 2001-08-07 | 2003-07-17 | Fearon Karen L. | Immunomodulatory compositions, formulations, and methods for use thereof |
| US6605299B2 (en) | 1999-04-23 | 2003-08-12 | Alza Corporation | Releasable linkage and compositions containing same |
| US6608201B2 (en) | 1992-08-28 | 2003-08-19 | 3M Innovative Properties Company | Process for preparing 1-substituted, 2-substituted 1H-imidazo[4,5-c]quinolin-4-amines |
| US6610713B2 (en) | 2000-05-23 | 2003-08-26 | North Shore - Long Island Jewish Research Institute | Inhibition of inflammatory cytokine production by cholinergic agonists and vagus nerve stimulation |
| US20030165478A1 (en) | 2002-02-14 | 2003-09-04 | Sokoll Kenneth K. | Stabilized synthetic immunogen delivery system |
| WO2003086280A2 (en) | 2002-04-04 | 2003-10-23 | Coley Pharmaceutical Gmbh | Immunostimulatory g,u-containing oligoribonucleotides |
| WO2004009116A2 (en) | 2002-07-18 | 2004-01-29 | Cytos Biotechnology Ag | Hapten-carrier conjugates comprising virus like particles and uses thereof |
| US20040022840A1 (en) | 2002-04-12 | 2004-02-05 | Nagy Jon O. | Nanoparticle vaccines |
| US6693086B1 (en) | 1998-06-25 | 2004-02-17 | National Jewish Medical And Research Center | Systemic immune activation method using nucleic acid-lipid complexes |
| US6699474B1 (en) | 1990-08-20 | 2004-03-02 | Erich Hugo Cerny | Vaccine and immunserum against drugs of abuse |
| WO2004022594A2 (en) | 2002-09-06 | 2004-03-18 | Cytos Biotechnology Ag | Immune modulatory compounds and methods |
| US6723429B2 (en) | 1998-08-28 | 2004-04-20 | Celanese Ventures Gmbh | Method for preparing smooth-surface spherical microparticles completely or partially made of at least one water-insoluble linear polysaccharide and microparticles produced according to this method |
| US6747156B2 (en) | 2000-03-21 | 2004-06-08 | Independent Pharmaceutica Ab | Method of producing 6-substituted (s)-nicotine derivatives and intermediate compounds |
| US20040109894A1 (en) | 2002-12-09 | 2004-06-10 | Adi Shefer | PH triggered targeted controlled release systems for the delivery of pharmaceutical active ingredients |
| WO2004053104A2 (en) | 2002-12-11 | 2004-06-24 | Coley Pharmaceutical Group, Inc. | 5’ cpg nucleic acids and methods of use |
| WO2004058179A2 (en) | 2002-12-23 | 2004-07-15 | Dynavax Technologies Corporation | Immunostimulatory sequence oligonucleotides and methods of using the same |
| US20040141958A1 (en) | 1998-10-05 | 2004-07-22 | M&E Biotech A/S | Novel methods for therapeutic vaccination |
| US6767702B2 (en) | 1996-07-29 | 2004-07-27 | Nanosphere, Inc. | Nanoparticles having oligonucleotides attached thereto and uses therefor |
| US6800624B2 (en) | 1999-06-10 | 2004-10-05 | 3M Innovative Properties Company | Sulfonamide and sulfamide substituted imidazoquinolines |
| US6800296B1 (en) | 1999-05-19 | 2004-10-05 | Massachusetts Institute Of Technology | Modification of surfaces using biological recognition events |
| US6811975B2 (en) | 1998-07-14 | 2004-11-02 | Isis Pharmaceuticals, Inc. | Phosphorothioate oligonucleotides having modified internucleoside linkages |
| US20040247680A1 (en) | 2003-06-06 | 2004-12-09 | Farokhzad Omid C. | Targeted delivery of controlled release polymer systems |
| US20040258698A1 (en) | 2003-04-10 | 2004-12-23 | Wightman Paul D. | Delivery of immune response modifier compounds |
| US20050042298A1 (en) | 2003-08-20 | 2005-02-24 | Pardridge William M. | Immunonanoparticles |
| US20050079152A1 (en) | 2003-06-17 | 2005-04-14 | Bot Adrian Ian | Methods of elicit, enhance and sustain immune responses against MHC class I-restricted epitopes, for prophylactic or therapeutic purposes |
| US20050089524A1 (en) | 2002-03-01 | 2005-04-28 | Sanderson Sam D. | Compositions and compounds for use as molecular adjuvant for a nicotine vaccine |
| WO2005042018A2 (en) | 2003-10-30 | 2005-05-12 | Coley Pharmaceutical Gmbh | C-class oligonucleotide analogs with enhanced immunostimulatory potency |
| US20050107322A1 (en) | 2003-04-30 | 2005-05-19 | O'hagan Derek | Compositions for inducing immune responses |
| WO2005058282A1 (en) | 2003-12-18 | 2005-06-30 | Korea United Pharm, Inc | Double pellet formulation of proton pump inhibitors and clarithromycin for the treatment of gastrointestinal ulcer, and method for producing the same |
| US20050192248A1 (en) | 2003-10-08 | 2005-09-01 | Nyu Medical Center | Use of synthetic glycolipids as universal adjuvants for vaccines against cancer and infectious diseases |
| WO2005097993A2 (en) | 2004-02-19 | 2005-10-20 | Coley Pharmaceutical Group, Inc. | Immunostimulatory viral rna oligonucleotides |
| CN1692943A (en) | 2004-09-17 | 2005-11-09 | 四川大学 | Preparation and Application of CpG DNA Molecular Anti-infection Immune Preparation |
| WO2005110013A2 (en) | 2004-04-09 | 2005-11-24 | 3M Innovative Properties Company | Methods, compositions, and preparations for delivery of immune response modifiers |
| EP1221955B9 (en) | 1999-09-25 | 2005-11-30 | University Of Iowa Research Foundation | Immunostimulatory nucleic acids |
| US20060002852A1 (en) | 2004-07-01 | 2006-01-05 | Yale University | Targeted and high density drug loaded polymeric materials |
| US20060045868A1 (en) | 2004-08-25 | 2006-03-02 | Aegis Therapeutics Llc | Absorption enhancers for drug administration |
| WO2006031878A2 (en) | 2004-09-14 | 2006-03-23 | Novartis Vaccines And Diagnostics Inc. | Imidazoquinoline compounds |
| US7037523B2 (en) | 2001-11-02 | 2006-05-02 | Wockhardt Limited | Controlled release compositions for macrolide antimicrobial agents |
| US20060111271A1 (en) | 2004-11-24 | 2006-05-25 | Cerny Erich H | Active and passive immunization against pharmacologically active hapten molecules using a synthetic carrier compound composed of similar elements |
| US20060142202A1 (en) | 2000-12-08 | 2006-06-29 | 3M Innovative Properties Company | Compositions and methods for targeted delivery of immune response modifiers |
| US7097837B2 (en) | 2001-02-19 | 2006-08-29 | Pharmexa A/S | Synthetic vaccine agents |
| US20060234912A1 (en) | 2003-10-08 | 2006-10-19 | Wang Yu T | Methods for modulating neuronal responses |
| US20060241076A1 (en) | 2005-04-26 | 2006-10-26 | Coley Pharmaceutical Gmbh | Modified oligoribonucleotide analogs with enhanced immunostimulatory activity |
| US7132475B2 (en) | 2000-10-19 | 2006-11-07 | Ecole Polytechnique Federale De Lausanne | Block copolymers for multifunctional self-assembled systems |
| US7149574B2 (en) | 2003-06-09 | 2006-12-12 | Palo Alto Investors | Treatment of conditions through electrical modulation of the autonomic nervous system |
| WO2006135434A2 (en) | 2004-10-20 | 2006-12-21 | Coley Pharmaceutical Group, Inc. | Semi-soft c-class immunostimulatory oligonucleotides |
| WO2007001448A2 (en) | 2004-11-04 | 2007-01-04 | Massachusetts Institute Of Technology | Coated controlled release polymer particles as efficient oral delivery vehicles for biopharmaceuticals |
| WO2007003054A1 (en) | 2005-07-06 | 2007-01-11 | Shoichet Molly S | Method of biomolecule immobilization on polymers using click-type chemistry |
| US20070014807A1 (en) | 2003-09-03 | 2007-01-18 | Maida Anthony E Iii | Multiplex vaccine |
| US20070020620A1 (en) | 2005-07-14 | 2007-01-25 | Finn M G | Compositions and methods for coupling a plurality of compounds to a scaffold |
| EP1752141A1 (en) | 2004-04-29 | 2007-02-14 | Instituto Cientifico Y Tecnologico De Navarra, S.A. | Immune response stimulating composition comprising nanoparticles based on a methyl vinyl ether-maleic acid copolymer |
| US7192725B2 (en) | 2000-05-19 | 2007-03-20 | University Of Toronto | Flagellin gene, flaC of Campylobacter |
| WO2007040840A2 (en) | 2005-08-19 | 2007-04-12 | Array Biopharma Inc. | Aminodiazepines as toll-like receptor modulators |
| US20070116768A1 (en) | 2003-12-09 | 2007-05-24 | Michael Chorny | Sustained release preparations composed of biocompatible complex microparticles |
| US7223398B1 (en) | 1999-11-15 | 2007-05-29 | Dynavax Technologies Corporation | Immunomodulatory compositions containing an immunostimulatory sequence linked to antigen and methods of use thereof |
| WO2007062107A2 (en) | 2005-11-25 | 2007-05-31 | Coley Pharmaceutical Gmbh | Immunostimulatory oligoribonucleotides |
| WO2007070682A2 (en) | 2005-12-15 | 2007-06-21 | Massachusetts Institute Of Technology | System for screening particles |
| US7238368B2 (en) | 1999-04-23 | 2007-07-03 | Alza Corporation | Releasable linkage and compositions containing same |
| US7250403B2 (en) | 2000-03-10 | 2007-07-31 | Dynavax Technologies Corporation | Biodegradable immunomodulatory formulations and methods for use thereof |
| US20070184068A1 (en) | 2005-12-14 | 2007-08-09 | Cytos Biotechnology Ag | Immunostimulatory nucleic acid packaged particles for the treatment of hypersensitivity |
| US7262286B2 (en) | 2000-09-26 | 2007-08-28 | Idera Pharmaceuticals, Inc. | Modulation of immunostimulatory activity of immunostimulatory oligonucleotide analogs by positional chemical changes |
| WO2007109810A2 (en) | 2006-03-23 | 2007-09-27 | Novartis Ag | Methods for the preparation of imidazole-containing compounds |
| US7276489B2 (en) | 2002-10-24 | 2007-10-02 | Idera Pharmaceuticals, Inc. | Modulation of immunostimulatory properties of oligonucleotide-based compounds by optimal presentation of 5′ ends |
| CA2649149A1 (en) | 2006-04-11 | 2007-10-25 | Koko Kosmetikvertrieb Gmbh & Co. Kg | Nanoparticle containing nicotine and/or cotinine, dispersions, and use thereof |
| US20070264481A1 (en) | 2003-12-19 | 2007-11-15 | Desimone Joseph M | Isolated and fixed micro and nano structures and methods thereof |
| WO2007131972A1 (en) | 2006-05-12 | 2007-11-22 | Cytos Biotechnology Ag | Nicotine-carrier vaccine formulation |
| WO2007133807A2 (en) | 2006-05-15 | 2007-11-22 | Massachusetts Institute Of Technology | Polymers for functional particles |
| WO2007137117A2 (en) | 2006-05-17 | 2007-11-29 | Massachusetts Institute Of Technology | Aptamer-directed drug delivery |
| WO2007150030A2 (en) | 2006-06-23 | 2007-12-27 | Massachusetts Institute Of Technology | Microfluidic synthesis of organic nanoparticles |
| WO2007149802A2 (en) | 2006-06-19 | 2007-12-27 | 3M Innovative Properties Company | Formulation for delivery of immune response modifiers |
| US20080014281A1 (en) | 2006-06-16 | 2008-01-17 | Florida Atlantic University | Chitin Micro-Particles As An Adjuvant |
| US20080031899A1 (en) | 2006-02-21 | 2008-02-07 | Reddy Sai T | Nanoparticles for immunotherapy |
| WO2008019142A2 (en) | 2006-08-04 | 2008-02-14 | Massachusetts Institute Of Technology | Oligonucleotide systems for targeted intracellular delivery |
| US20080050450A1 (en) | 2006-06-26 | 2008-02-28 | Mutual Pharmaceutical Company, Inc. | Active Agent Formulations, Methods of Making, and Methods of Use |
| WO2008033432A2 (en) | 2006-09-12 | 2008-03-20 | Coley Pharmaceutical Group, Inc. | Immune modulation by chemically modified ribonucleosides and oligoribonucleotides |
| US7357936B1 (en) | 1998-10-16 | 2008-04-15 | Smithkline Beecham Biologicals, Sa | Adjuvant systems and vaccines |
| US7375180B2 (en) | 2003-02-13 | 2008-05-20 | 3M Innovative Properties Company | Methods and compositions related to IRM compounds and Toll-like receptor 8 |
| US7375234B2 (en) | 2002-05-30 | 2008-05-20 | The Scripps Research Institute | Copper-catalysed ligation of azides and acetylenes |
| US7387271B2 (en) | 2002-12-30 | 2008-06-17 | 3M Innovative Properties Company | Immunostimulatory combinations |
| US20080145441A1 (en) | 2000-10-16 | 2008-06-19 | Midatech Limited | Nanoparticles |
| US7390780B2 (en) | 1999-04-23 | 2008-06-24 | Alza Corporation | Gene delivery mediated by liposome-DNA complex with cleavable peg surface modification |
| WO2008079924A1 (en) | 2006-12-22 | 2008-07-03 | 3M Innovative Properties Company | Immune response modifier compositions and methods |
| US20080171059A1 (en) | 2006-08-07 | 2008-07-17 | Shanshan Wu Howland | Methods and compositions for increased priming of t-cells through cross-presentation of exogenous antigens |
| WO2008093173A1 (en) | 2007-01-31 | 2008-08-07 | Chongxi Yu | Positively charged water-soluble prodrugs of 1h-imidazo[4, 5-c]quinolin-4-amines and related compounds with very high skin penetration rates |
| US20080207550A1 (en) | 2000-12-27 | 2008-08-28 | Fearon Karen L | Immunomodulatory polynucleotides and methods of using the same |
| WO2008105773A2 (en) | 2006-03-31 | 2008-09-04 | Massachusetts Institute Of Technology | System for targeted delivery of therapeutic agents |
| US20080213377A1 (en) | 2006-12-08 | 2008-09-04 | Bhatia Sangeeta N | Delivery of Nanoparticles and/or Agents to Cells |
| US7427629B2 (en) | 2002-08-15 | 2008-09-23 | 3M Innovative Properties Company | Immunostimulatory compositions and methods of stimulating an immune response |
| WO2008115319A2 (en) | 2007-02-07 | 2008-09-25 | Regents Of The University Of California | Conjugates of synthetic tlr agonists and uses therefor |
| US20080234251A1 (en) | 2005-08-19 | 2008-09-25 | Array Biopharma Inc. | 8-Substituted Benzoazepines as Toll-Like Receptor Modulators |
| WO2008115641A2 (en) | 2007-02-15 | 2008-09-25 | Yale University | Modular nanoparticles for adaptable vaccines |
| WO2008124639A2 (en) | 2007-04-04 | 2008-10-16 | Massachusetts Institute Of Technology | Poly (amino acid) targeting moieties |
| WO2008124634A1 (en) | 2007-04-04 | 2008-10-16 | Massachusetts Institute Of Technology | Polymer-encapsulated reverse micelles |
| WO2008127532A1 (en) | 2007-04-12 | 2008-10-23 | Emory University | Novel strategies for delivery of active agents using micelles and particles |
| WO2008147456A2 (en) | 2006-11-20 | 2008-12-04 | Massachusetts Institute Of Technology | Drug delivery systems using fc fragments |
| US20090004118A1 (en) | 2004-10-07 | 2009-01-01 | Shuming Nie | Multifunctional Nanoparticle Conjugates And Their Use |
| US20090011009A1 (en) | 2006-01-23 | 2009-01-08 | Yissum Research Development Company Of The Hebrew University Of Jerusalem | Microspheres comprising nanocapsules containing a lipophilic drug |
| WO2009027971A2 (en) | 2007-08-27 | 2009-03-05 | H2Q Water Industries Ltd. | Antimicrobial polymers |
| US7501134B2 (en) | 2002-02-20 | 2009-03-10 | Novartis Vaccines And Diagnostics, Inc. | Microparticles with adsorbed polypeptide-containing molecules |
| WO2009038685A1 (en) | 2007-09-18 | 2009-03-26 | The Scripps Research Institute | Ligands for copper-catalyzed azide-alkyne cycloaddition reactions |
| US7517520B2 (en) | 2003-03-26 | 2009-04-14 | Cytos Biotechnology Ag | Packaging of immunostimulatory oligonucleotides into virus-like particles: method of preparation and use |
| WO2009051837A2 (en) | 2007-10-12 | 2009-04-23 | Massachusetts Institute Of Technology | Vaccine nanotechnology |
| US20090104268A1 (en) | 2004-10-01 | 2009-04-23 | Midatech Limited | Nanoparticles Comprising Antigens and Adjuvants, and Immunogenic Structures |
| US20090130210A1 (en) | 2007-09-11 | 2009-05-21 | Raheja Praveen | Pharmaceutical compositions of sirolimus |
| WO2009076158A1 (en) | 2007-12-07 | 2009-06-18 | Novartis Ag | Compositions for inducing immune responses |
| US20090169636A1 (en) | 2006-02-24 | 2009-07-02 | Derek O' Hagan | Microparticles containing biodegradable polymer and cationic polysaccharide for use in immunogenic compositions |
| WO2009109428A2 (en) | 2008-02-01 | 2009-09-11 | Alpha-O Peptides Ag | Self-assembling peptide nanoparticles useful as vaccines |
| WO2009111588A1 (en) | 2008-03-04 | 2009-09-11 | Liquidia Technologies, Inc. | Immunomodulator particles and methods of treating |
| US20090297614A1 (en) | 2006-04-13 | 2009-12-03 | Thomas William Rademacher | Nanoparticles for providing immune responses against infectious agents |
| US20090297621A1 (en) | 2008-06-03 | 2009-12-03 | Abbott Cardiovascular Systems Inc. | Microparticles For The Treatment Of Disease |
| WO2009158687A1 (en) | 2008-06-26 | 2009-12-30 | Anterios, Inc. | Dermal delivery |
| US20090324551A1 (en) | 2005-08-22 | 2009-12-31 | The Regents Of The University Of California Office Of Technology Transfer | Tlr agonists |
| US20090325292A1 (en) | 2007-08-24 | 2009-12-31 | Board Of Trustees Of Michigan State University | Functional polyglycolide nanoparticles derived from unimolecular micelles |
| WO2010003009A2 (en) | 2008-07-01 | 2010-01-07 | Emory University | Synergistic induction of humoral and cellular immunity by combinatorial activation of toll-like receptors |
| WO2010017330A1 (en) | 2008-08-06 | 2010-02-11 | Novartis Ag | Microparticles for use in immunogenic compositions |
| WO2010018131A1 (en) | 2008-08-11 | 2010-02-18 | Smithkline Beecham Corporation | Purine derivatives for use in the treatment of allergic, inflammatory and infectious diseases |
| WO2010018130A1 (en) | 2008-08-11 | 2010-02-18 | Smithkline Beecham Corporation | Purine derivatives for use in the treatment of allergic, inflammatory and infectious diseases |
| WO2010018133A1 (en) | 2008-08-11 | 2010-02-18 | Smithkline Beecham Corporation | Purine derivatives for use in the treatment of allergic, inflammatory and infectious diseases |
| WO2010018132A1 (en) | 2008-08-11 | 2010-02-18 | Smithkline Beecham Corporation | Compounds |
| US20100068285A1 (en) | 2008-06-16 | 2010-03-18 | Zale Stephen E | Drug Loaded Polymeric Nanoparticles and Methods of Making and Using Same |
| WO2010037566A1 (en) | 2008-10-02 | 2010-04-08 | Capsulution Pharma Ag | Improved nanoparticulate compositions of poorly soluble compounds |
| WO2010042870A1 (en) | 2008-10-12 | 2010-04-15 | Massachusetts Institute Of Technology | Adjuvant incorporation in immunonanotherapeutics |
| US20100092425A1 (en) * | 2008-10-12 | 2010-04-15 | Von Andrian Ulrich | Nicotine Immunonanotherapeutics |
| US20100098770A1 (en) | 2008-10-16 | 2010-04-22 | Manikandan Ramalingam | Sirolimus pharmaceutical formulations |
| US20100104653A1 (en) | 2007-08-16 | 2010-04-29 | Abbott Cardiovascular Systems Inc. | Nanoparticle-Coated Medical Devices And Formulations For Treating Vascular Disease |
| WO2010054215A1 (en) | 2008-11-06 | 2010-05-14 | Ventirx Pharmaceuticals, Inc. | Methods of synthesis of benzazepine derivatives |
| US20100129392A1 (en) * | 2008-10-12 | 2010-05-27 | Jinjun Shi | Targeting of Antigen Presenting Cells with Immunonanotherapeutics |
| US20100143453A1 (en) | 2006-12-11 | 2010-06-10 | Raymond Michel Schiffelers | Anti-inflammatory compounds containing compositions for treatment of cancer |
| US20100166876A1 (en) | 2006-02-10 | 2010-07-01 | Biocompatibles Uk Limited | Loading of hydrophobic drugs into hydrophilic polymer delivery systems |
| US20100172993A1 (en) | 2006-08-11 | 2010-07-08 | Amarjit Singh | Particles for delivery of active ingredients, process of making and compositions thereof |
| US20100233231A1 (en) | 2009-03-10 | 2010-09-16 | Roger Labrecque | Use of cryogenic processing to obtain a substantially-thickened formulation |
| WO2010115046A2 (en) | 2009-04-01 | 2010-10-07 | University Of Miami | Vaccine compositions and methods of use thereof |
| WO2010123569A2 (en) | 2009-04-21 | 2010-10-28 | Selecta Biosciences, Inc. | Immunonanotherapeutics providing a th1-biased response |
| WO2010128303A1 (en) | 2009-05-08 | 2010-11-11 | Hybrid Biosystems Limited | Multi- valent adjuvant display |
| US7842312B2 (en) | 2005-12-29 | 2010-11-30 | Cordis Corporation | Polymeric compositions comprising therapeutic agents in crystalline phases, and methods of forming the same |
| WO2010138192A2 (en) | 2009-05-27 | 2010-12-02 | Selecta Biosciences, Inc. | Nanocarriers possessing components with different rates of release |
| US20100316724A1 (en) | 2009-05-12 | 2010-12-16 | Innovata Limited | Composition |
| WO2010146606A1 (en) | 2009-06-19 | 2010-12-23 | Sun Pharma Advanced Research Company Ltd., | Nanodispersion of a drug and process for its preparation |
| US20110014281A1 (en) | 2007-12-19 | 2011-01-20 | Julian Aleksov | Drug delivery system for administration of poorly water soluble pharmaceutically active substances |
| US20110110965A1 (en) | 2009-08-26 | 2011-05-12 | Selecta Biosciences, Inc. | Compositions that induce t cell help |
| US20110171248A1 (en) | 2010-01-08 | 2011-07-14 | Selecta Biosciences, Inc. | Synthetic virus-like particles conjugated to human papillomavirus capsid peptides for use as vaccines |
| US20110262491A1 (en) | 2010-04-12 | 2011-10-27 | Selecta Biosciences, Inc. | Emulsions and methods of making nanocarriers |
| US20110272836A1 (en) | 2010-04-12 | 2011-11-10 | Selecta Biosciences, Inc. | Eccentric vessels |
| US20110293700A1 (en) * | 2010-05-26 | 2011-12-01 | Selecta Biosciences, Inc. | Nanocarrier compositions with uncoupled adjuvant |
| US20120058154A1 (en) | 2010-08-20 | 2012-03-08 | Selecta Biosciences, Inc. | Synthetic nanocarrier vaccines comprising peptides obtained or derived from human influenza a virus m2e |
| US20120070493A1 (en) | 2010-08-23 | 2012-03-22 | Selecta Biosciences, Inc. | Targeted multi-epitope dosage forms for induction of an immune response to antigens |
| US20120171229A1 (en) | 2010-12-30 | 2012-07-05 | Selecta Biosciences, Inc. | Synthetic nanocarriers with reactive groups that release biologically active agents |
| US20120244222A1 (en) | 2011-03-25 | 2012-09-27 | Selecta Biosciences, Inc. | Osmotic mediated release synthetic nanocarriers |
| US20120276156A1 (en) | 2011-04-29 | 2012-11-01 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarrier compositions with transplantable graft antigens and methods of use |
| US20130028941A1 (en) | 2011-07-29 | 2013-01-31 | Selecta Biosciences, Inc. | Synthetic nanocarriers that generate humoral and cytotoxic t lymphocyte (ctl) immune responses |
| US20130058974A1 (en) | 2011-09-06 | 2013-03-07 | Selecta Biosciences, Inc. | Antigen-specific induced tolerogenic dendritic cells to reduce cytotoxic t lymphocyte responses |
| US20140328922A1 (en) | 2013-05-03 | 2014-11-06 | Selecta Biosciences, Inc. | Local, concomitant administration of tolerogenic synthetic nanocarriers to reduce type i and type iv hypersensitivity |
| US20140356361A1 (en) | 2013-06-04 | 2014-12-04 | Selecta Biosciences, Inc. | Repeated administration of non-immunosuppressive antigen specific immunotherapeutics |
| US20150359865A1 (en) | 2014-06-17 | 2015-12-17 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers for t-cell-mediated autoimmune disease |
| US20150374815A1 (en) | 2014-06-25 | 2015-12-31 | Selecta Biosciences, Inc. | Methods and compositions for treatment with synthetic nanocarriers and immune checkpoint inhibitors |
| US20160067228A1 (en) | 2014-09-07 | 2016-03-10 | Selecta Biosciences, Inc. | Methods and compositions for attenuating anti-viral transfer vector immune responses |
| US20160128986A1 (en) | 2014-11-05 | 2016-05-12 | Selecta Biosciences, Inc. | Methods and compositions related to the use of low hlb surfactants in the production of synthetic nanocarriers comprising a rapalog |
| US20160220501A1 (en) | 2015-02-03 | 2016-08-04 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers to reduce immune responses to therapeutic proteins |
| US20170258927A1 (en) | 2016-03-11 | 2017-09-14 | Selecta Biosciences, Inc. | Formulations and doses of pegylated uricase |
-
2011
- 2011-11-04 US US13/289,211 patent/US9994443B2/en not_active Expired - Fee Related
- 2011-11-04 WO PCT/US2011/059350 patent/WO2012061717A1/en not_active Ceased
- 2011-11-04 EA EA201390660A patent/EA201390660A1/en unknown
- 2011-11-04 EP EP11838881.8A patent/EP2640190A4/en not_active Ceased
Patent Citations (337)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4021364A (en) | 1972-12-04 | 1977-05-03 | Prof. Dr. Peter Speiser | Microcapsules in the nanometric range and a method for their production |
| US3996355A (en) | 1975-01-02 | 1976-12-07 | American Home Products Corporation | Permanent suspension pharmaceutical dosage form |
| US4225581A (en) | 1975-03-20 | 1980-09-30 | Jorg Kreuter | Biological materials |
| US5912017A (en) | 1987-05-01 | 1999-06-15 | Massachusetts Institute Of Technology | Multiwall polymeric microspheres |
| US4950432A (en) | 1987-10-16 | 1990-08-21 | Board Of Regents, The University Of Texas System | Polyene microlide pre-liposomal powders |
| US6130082A (en) | 1988-05-05 | 2000-10-10 | American Cyanamid Company | Recombinant flagellin vaccines |
| US6699474B1 (en) | 1990-08-20 | 2004-03-02 | Erich Hugo Cerny | Vaccine and immunserum against drugs of abuse |
| US5389640A (en) | 1991-03-01 | 1995-02-14 | Minnesota Mining And Manufacturing Company | 1-substituted, 2-substituted 1H-imidazo[4,5-c]quinolin-4-amines |
| US6348462B1 (en) | 1991-03-01 | 2002-02-19 | 3M Innovative Properties Company | 1-substituted, 2-substituted 1H-imidazo[4,5-c]quinolin-4-amines |
| US5175296A (en) | 1991-03-01 | 1992-12-29 | Minnesota Mining And Manufacturing Company | Imidazo[4,5-c]quinolin-4-amines and processes for their preparation |
| US5977366A (en) | 1991-03-01 | 1999-11-02 | 3M Innovative Properties Company | 1-substituted, 2-substituted 1H-imidazo[4,5-c] quinolin-4-amines |
| US5605899A (en) | 1991-03-01 | 1997-02-25 | Minnesota Mining And Manufacturing Company | 1-substituted, 2-substituted 1H-imidazo[4,5-c]quinolin-4-amines |
| WO1992015582A1 (en) | 1991-03-01 | 1992-09-17 | Minnesota Mining And Manufacturing Company | 1-SUBSTITUTED, 2-SUBSTITUTED 1H-IMIDAZO[4,5-c]QUINOLIN-4-AMINES |
| EP0582581B1 (en) | 1991-03-01 | 1999-05-06 | Minnesota Mining And Manufacturing Company | 1-SUBSTITUTED, 2-SUBSTITUTED 1H-IMIDAZO[4,5-c]QUINOLIN-4-AMINES |
| US6465654B2 (en) | 1991-03-01 | 2002-10-15 | 3M Innovative Properties Company | Process for preparing 1-substituted, 2-substituted 1H-imidazo[4, 5-c]quinoline-4-amines |
| US5741909A (en) | 1991-03-01 | 1998-04-21 | Minnesota Mining And Manufacturing Company | 1-substituted, 2-substituted 1H-imidazo 4,5-C!quinolin-4-amines |
| EP0636031B1 (en) | 1992-04-16 | 1996-09-04 | Minnesota Mining And Manufacturing Company | Vaccine adjuvant |
| US6083505A (en) | 1992-04-16 | 2000-07-04 | 3M Innovative Properties Company | 1H-imidazo[4,5-C]quinolin-4-amines as vaccine adjuvants |
| US6365187B2 (en) | 1992-04-24 | 2002-04-02 | Brown University Research Foundation | Bioadhesive microspheres and their use as drug delivery and imaging systems |
| US6686472B2 (en) | 1992-08-28 | 2004-02-03 | 3M Innovative Properties Company | Process for preparing 1-substituted, 2-substituted 1-H-imidazo(4,5-c)quinolin-4-amines |
| US6608201B2 (en) | 1992-08-28 | 2003-08-19 | 3M Innovative Properties Company | Process for preparing 1-substituted, 2-substituted 1H-imidazo[4,5-c]quinolin-4-amines |
| US6790961B2 (en) | 1992-08-28 | 2004-09-14 | 3M Innovative Properties Company | Process for preparing 1-substituted, 2-substituted 1H-imidazo[4,5-C]quinolin-4-amines |
| US5871747A (en) | 1992-09-11 | 1999-02-16 | Institut Pasteur | Antigen-carrying microparticles and their use in the indication of humoral or cellular responses |
| US5928647A (en) | 1993-01-11 | 1999-07-27 | Dana-Farber Cancer Institute | Inducing cytotoxic T lymphocyte responses |
| US5395937A (en) | 1993-01-29 | 1995-03-07 | Minnesota Mining And Manufacturing Company | Process for preparing quinoline amines |
| US6565859B1 (en) | 1993-05-27 | 2003-05-20 | Novartis Ag | Galenical formulations |
| US5543158A (en) | 1993-07-23 | 1996-08-06 | Massachusetts Institute Of Technology | Biodegradable injectable nanoparticles |
| US5578325A (en) | 1993-07-23 | 1996-11-26 | Massachusetts Institute Of Technology | Nanoparticles and microparticles of non-linear hydrophilic-hydrophobic multiblock copolymers |
| US5762904A (en) | 1993-07-23 | 1998-06-09 | Massachusetts Institute Of Technology | Oral delivery of vaccines using polymerized liposomes |
| US5939100A (en) | 1993-11-01 | 1999-08-17 | Pharmacia And Upjohn Ab | Composition for drug delivery comprising nicotine or a derivative thereof and starch microspheres and method for the manufacturing thereof |
| US5663153A (en) | 1994-03-25 | 1997-09-02 | Isis Pharmaceuticals, Inc. | Immune stimulation by phosphorothioate oligonucleotide analogs |
| US6239116B1 (en) | 1994-07-15 | 2001-05-29 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules |
| US6207646B1 (en) | 1994-07-15 | 2001-03-27 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules |
| US6194388B1 (en) | 1994-07-15 | 2001-02-27 | The University Of Iowa Research Foundation | Immunomodulatory oligonucleotides |
| US6007845A (en) | 1994-07-22 | 1999-12-28 | Massachusetts Institute Of Technology | Nanoparticles and microparticles of non-linear hydrophilic-hydrophobic multiblock copolymers |
| US5876727A (en) | 1995-03-31 | 1999-03-02 | Immulogic Pharmaceutical Corporation | Hapten-carrier conjugates for use in drug-abuse therapy and methods for preparation of same |
| US6132723A (en) | 1995-06-07 | 2000-10-17 | Alberta Research Council | Immunogenic oligosaccharide compositions |
| WO1997047623A1 (en) | 1996-06-10 | 1997-12-18 | Cytos Pharmaceuticals Llc | Imidazole derivatives as protective agents in reperfusion injury and severe inflammatory responses |
| US6767702B2 (en) | 1996-07-29 | 2004-07-27 | Nanosphere, Inc. | Nanoparticles having oligonucleotides attached thereto and uses therefor |
| US7250499B2 (en) | 1996-07-29 | 2007-07-31 | Nanosphere Inc. | Nanoparticles having oligonucleotides attached thereto and uses therefor |
| US6043224A (en) | 1996-09-05 | 2000-03-28 | The Massachusetts Institute Of Technology | Compositions and methods for treatment of neurological disorders and neurodegenerative diseases |
| US20030035804A1 (en) | 1996-09-16 | 2003-02-20 | Beth Israel Deaconess Medical Center | Drug complex for treatment of metastatic prostate cancer |
| US20050233948A1 (en) | 1996-09-16 | 2005-10-20 | Beth Israel Deaconess Medical Center | Drug complex for treatment of metastatic prostate cancer |
| WO1998014216A2 (en) | 1996-09-30 | 1998-04-09 | Immulogic Pharmaceutical Corporation | Hapten-carrier conjugates for use in drug-abuse therapy and methods for preparation of same |
| US6696076B2 (en) | 1996-10-25 | 2004-02-24 | 3M Innovative Properties Company | Immune response modifier compounds for treatment of TH2 mediated and related diseases |
| EP0938315B1 (en) | 1996-10-25 | 2007-07-18 | Minnesota Mining And Manufacturing Company | Immune response modifier compounds for treatment of th2 mediated and related diseases |
| US6610319B2 (en) | 1996-10-25 | 2003-08-26 | 3M Innovative Properties Company | Immune response modifier compounds for treatment of TH2 mediated and related diseases |
| US6039969A (en) | 1996-10-25 | 2000-03-21 | 3M Innovative Properties Company | Immune response modifier compounds for treatment of TH2 mediated and related diseases |
| WO1998037919A1 (en) | 1997-02-28 | 1998-09-03 | University Of Iowa Research Foundation | USE OF NUCLEIC ACIDS CONTAINING UNMETHYLATED CpG DINUCLEOTIDE IN THE TREATMENT OF LPS-ASSOCIATED DISORDERS |
| WO1998040100A1 (en) | 1997-03-10 | 1998-09-17 | Ottawa Civic Loeb Research Institute | USE OF NUCLEIC ACIDS CONTAINING UNMETHYLATED CpG DINUCLEOTIDE AS AN ADJUVANT |
| US5989591A (en) | 1997-03-14 | 1999-11-23 | American Home Products Corporation | Rapamycin formulations for oral administration |
| US6585980B1 (en) | 1997-04-11 | 2003-07-01 | The University Of Toronto | Flagellin gene, FlaC of Campylobacter |
| US6387397B1 (en) | 1997-04-18 | 2002-05-14 | Massachusetts Institute Of Technology | Polymerized liposomes targeted to M cells and useful for oral or mucosal drug delivery |
| US6060082A (en) | 1997-04-18 | 2000-05-09 | Massachusetts Institute Of Technology | Polymerized liposomes targeted to M cells and useful for oral or mucosal drug delivery |
| WO1998052581A1 (en) | 1997-05-20 | 1998-11-26 | Ottawa Civic Hospital Loeb Research Institute | Vectors and methods for immunization or therapeutic protocols |
| US5985325A (en) | 1997-06-13 | 1999-11-16 | American Home Products Corporation | Rapamycin formulations for oral administration |
| US6288040B1 (en) | 1997-10-17 | 2001-09-11 | Dss Drug Delivery Service Gesellschaft Zur Forderung Der Foshung In Phamazeutischer Technologi Und Biopharmazie Mbh | Medicament excipient particles for tissue-specific application of a medicament |
| US6329381B1 (en) | 1997-11-28 | 2001-12-11 | Sumitomo Pharmaceuticals Company, Limited | Heterocyclic compounds |
| US6254890B1 (en) | 1997-12-12 | 2001-07-03 | Massachusetts Institute Of Technology | Sub-100nm biodegradable polymer spheres capable of transporting and releasing nucleic acids |
| US6197229B1 (en) | 1997-12-12 | 2001-03-06 | Massachusetts Institute Of Technology | Method for high supercoiled DNA content microspheres |
| US6218371B1 (en) | 1998-04-03 | 2001-04-17 | University Of Iowa Research Foundation | Methods and products for stimulating the immune system using immunotherapeutic oligonucleotides and cytokines |
| WO1999056755A1 (en) | 1998-05-06 | 1999-11-11 | University Of Iowa Research Foundation | Methods for the prevention and treatment of parasitic infections and related diseases using cpg oligonucleotides |
| US6656469B1 (en) | 1998-05-29 | 2003-12-02 | Independent Pharmaceutica Ab | Nicotine immunogen |
| WO1999061054A1 (en) | 1998-05-29 | 1999-12-02 | Independent Pharmaceutica Ab | Nicotine immunogen |
| US20030009029A1 (en) | 1998-06-18 | 2003-01-09 | Merck Patent Gmbh | Catalytic titanium (IV) oxide, mediated geminal symmetric dialkylation of carboxamides |
| US6693086B1 (en) | 1998-06-25 | 2004-02-17 | National Jewish Medical And Research Center | Systemic immune activation method using nucleic acid-lipid complexes |
| US6811975B2 (en) | 1998-07-14 | 2004-11-02 | Isis Pharmaceuticals, Inc. | Phosphorothioate oligonucleotides having modified internucleoside linkages |
| WO2000006123A1 (en) | 1998-07-29 | 2000-02-10 | Chiron Corporation | Microparticles with adsorbent surfaces, methods of making same, and uses thereof |
| US6723429B2 (en) | 1998-08-28 | 2004-04-20 | Celanese Ventures Gmbh | Method for preparing smooth-surface spherical microparticles completely or partially made of at least one water-insoluble linear polysaccharide and microparticles produced according to this method |
| US20040141958A1 (en) | 1998-10-05 | 2004-07-22 | M&E Biotech A/S | Novel methods for therapeutic vaccination |
| US7357936B1 (en) | 1998-10-16 | 2008-04-15 | Smithkline Beecham Biologicals, Sa | Adjuvant systems and vaccines |
| US20080026000A1 (en) | 1998-12-01 | 2008-01-31 | Nabi Biopharmaceuticals | Hapten-carrier conjugates for treating and preventing nicotine addiction |
| US7247502B2 (en) | 1998-12-01 | 2007-07-24 | Nabi Biopharmaceuticals | Hapten-carrier conjugates for treating and preventing nicotine addiction |
| US6232082B1 (en) | 1998-12-01 | 2001-05-15 | Nabi | Hapten-carrier conjugates for treating and preventing nicotine addiction |
| US7776620B2 (en) | 1998-12-01 | 2010-08-17 | Nabi Biopharmaceuticals | Hapten-carrier conjugates for treating and preventing nicotine addiction |
| US6518031B2 (en) | 1998-12-01 | 2003-02-11 | Nabi | Hapten-carrier conjugates for treating and preventing nicotine addiction |
| US6773891B2 (en) | 1998-12-01 | 2004-08-10 | Nabi Biopharmaceuticals, Inc. | Hapten-carrier conjugates for treating and preventing nicotine addiction |
| US6486168B1 (en) | 1999-01-08 | 2002-11-26 | 3M Innovative Properties Company | Formulations and methods for treatment of mucosal associated conditions with an immune response modifier |
| EP1140091B1 (en) | 1999-01-08 | 2005-09-21 | 3M Innovative Properties Company | Formulations comprising imiquimod or other immune response modifiers for treating cervical dysplasia |
| US6245776B1 (en) | 1999-01-08 | 2001-06-12 | 3M Innovative Properties Company | Formulations and methods for treatment of mucosal associated conditions with an immune response modifier |
| US6558951B1 (en) | 1999-02-11 | 2003-05-06 | 3M Innovative Properties Company | Maturation of dendritic cells with immune response modifying compounds |
| WO2000050075A2 (en) | 1999-02-26 | 2000-08-31 | Chiron S.P.A. | Enhancement of bactericidal activity of neisseria antigens with oligonucleotides containing cg motifs |
| US6605299B2 (en) | 1999-04-23 | 2003-08-12 | Alza Corporation | Releasable linkage and compositions containing same |
| US7238368B2 (en) | 1999-04-23 | 2007-07-03 | Alza Corporation | Releasable linkage and compositions containing same |
| US6849270B2 (en) | 1999-04-23 | 2005-02-01 | Alza Corporation | Releasable linkage and compositions containing same |
| US7390780B2 (en) | 1999-04-23 | 2008-06-24 | Alza Corporation | Gene delivery mediated by liposome-DNA complex with cleavable peg surface modification |
| US6800296B1 (en) | 1999-05-19 | 2004-10-05 | Massachusetts Institute Of Technology | Modification of surfaces using biological recognition events |
| US6800624B2 (en) | 1999-06-10 | 2004-10-05 | 3M Innovative Properties Company | Sulfonamide and sulfamide substituted imidazoquinolines |
| EP1221955B9 (en) | 1999-09-25 | 2005-11-30 | University Of Iowa Research Foundation | Immunostimulatory nucleic acids |
| US7223398B1 (en) | 1999-11-15 | 2007-05-29 | Dynavax Technologies Corporation | Immunomodulatory compositions containing an immunostimulatory sequence linked to antigen and methods of use thereof |
| US6569463B2 (en) | 1999-11-23 | 2003-05-27 | Lipocine, Inc. | Solid carriers for improved delivery of hydrophobic active ingredients in pharmaceutical compositions |
| WO2001068103A2 (en) | 2000-03-10 | 2001-09-20 | Dynavax Technologies Corporation | Treatment of herpes infection using immunomodulatory polynucleotide sequences |
| US7250403B2 (en) | 2000-03-10 | 2007-07-31 | Dynavax Technologies Corporation | Biodegradable immunomodulatory formulations and methods for use thereof |
| US6747156B2 (en) | 2000-03-21 | 2004-06-08 | Independent Pharmaceutica Ab | Method of producing 6-substituted (s)-nicotine derivatives and intermediate compounds |
| US7192725B2 (en) | 2000-05-19 | 2007-03-20 | University Of Toronto | Flagellin gene, flaC of Campylobacter |
| US6610713B2 (en) | 2000-05-23 | 2003-08-26 | North Shore - Long Island Jewish Research Institute | Inhibition of inflammatory cytokine production by cholinergic agonists and vagus nerve stimulation |
| US7262286B2 (en) | 2000-09-26 | 2007-08-28 | Idera Pharmaceuticals, Inc. | Modulation of immunostimulatory activity of immunostimulatory oligonucleotide analogs by positional chemical changes |
| US20080145441A1 (en) | 2000-10-16 | 2008-06-19 | Midatech Limited | Nanoparticles |
| US7132475B2 (en) | 2000-10-19 | 2006-11-07 | Ecole Polytechnique Federale De Lausanne | Block copolymers for multifunctional self-assembled systems |
| US20060142202A1 (en) | 2000-12-08 | 2006-06-29 | 3M Innovative Properties Company | Compositions and methods for targeted delivery of immune response modifiers |
| US20080207550A1 (en) | 2000-12-27 | 2008-08-28 | Fearon Karen L | Immunomodulatory polynucleotides and methods of using the same |
| US7097837B2 (en) | 2001-02-19 | 2006-08-29 | Pharmexa A/S | Synthetic vaccine agents |
| US20030133988A1 (en) | 2001-08-07 | 2003-07-17 | Fearon Karen L. | Immunomodulatory compositions, formulations, and methods for use thereof |
| US20030054042A1 (en) | 2001-09-14 | 2003-03-20 | Elaine Liversidge | Stabilization of chemical compounds using nanoparticulate formulations |
| US7037523B2 (en) | 2001-11-02 | 2006-05-02 | Wockhardt Limited | Controlled release compositions for macrolide antimicrobial agents |
| US20030165478A1 (en) | 2002-02-14 | 2003-09-04 | Sokoll Kenneth K. | Stabilized synthetic immunogen delivery system |
| US7501134B2 (en) | 2002-02-20 | 2009-03-10 | Novartis Vaccines And Diagnostics, Inc. | Microparticles with adsorbed polypeptide-containing molecules |
| US20050089524A1 (en) | 2002-03-01 | 2005-04-28 | Sanderson Sam D. | Compositions and compounds for use as molecular adjuvant for a nicotine vaccine |
| WO2003086280A2 (en) | 2002-04-04 | 2003-10-23 | Coley Pharmaceutical Gmbh | Immunostimulatory g,u-containing oligoribonucleotides |
| US20040022840A1 (en) | 2002-04-12 | 2004-02-05 | Nagy Jon O. | Nanoparticle vaccines |
| US7285289B2 (en) | 2002-04-12 | 2007-10-23 | Nagy Jon O | Nanoparticle vaccines |
| US7375234B2 (en) | 2002-05-30 | 2008-05-20 | The Scripps Research Institute | Copper-catalysed ligation of azides and acetylenes |
| US20050281845A1 (en) | 2002-07-18 | 2005-12-22 | Cytos Biotechnology Ag | Hapten-carrier conjugates and uses thereof |
| US7452541B2 (en) | 2002-07-18 | 2008-11-18 | Cytos Biotechnology Ag | Hapten-carrier conjugates and uses thereof |
| WO2004009116A2 (en) | 2002-07-18 | 2004-01-29 | Cytos Biotechnology Ag | Hapten-carrier conjugates comprising virus like particles and uses thereof |
| US20040059094A1 (en) | 2002-07-18 | 2004-03-25 | Bachmann Martin F. | Hapten-carrier conjugates and uses thereof |
| US7427629B2 (en) | 2002-08-15 | 2008-09-23 | 3M Innovative Properties Company | Immunostimulatory compositions and methods of stimulating an immune response |
| WO2004022594A2 (en) | 2002-09-06 | 2004-03-18 | Cytos Biotechnology Ag | Immune modulatory compounds and methods |
| US7276489B2 (en) | 2002-10-24 | 2007-10-02 | Idera Pharmaceuticals, Inc. | Modulation of immunostimulatory properties of oligonucleotide-based compounds by optimal presentation of 5′ ends |
| US20040109894A1 (en) | 2002-12-09 | 2004-06-10 | Adi Shefer | PH triggered targeted controlled release systems for the delivery of pharmaceutical active ingredients |
| WO2004053104A2 (en) | 2002-12-11 | 2004-06-24 | Coley Pharmaceutical Group, Inc. | 5’ cpg nucleic acids and methods of use |
| WO2004058179A2 (en) | 2002-12-23 | 2004-07-15 | Dynavax Technologies Corporation | Immunostimulatory sequence oligonucleotides and methods of using the same |
| US7387271B2 (en) | 2002-12-30 | 2008-06-17 | 3M Innovative Properties Company | Immunostimulatory combinations |
| US7375180B2 (en) | 2003-02-13 | 2008-05-20 | 3M Innovative Properties Company | Methods and compositions related to IRM compounds and Toll-like receptor 8 |
| US7517520B2 (en) | 2003-03-26 | 2009-04-14 | Cytos Biotechnology Ag | Packaging of immunostimulatory oligonucleotides into virus-like particles: method of preparation and use |
| US20040258698A1 (en) | 2003-04-10 | 2004-12-23 | Wightman Paul D. | Delivery of immune response modifier compounds |
| US20050107322A1 (en) | 2003-04-30 | 2005-05-19 | O'hagan Derek | Compositions for inducing immune responses |
| US7727969B2 (en) | 2003-06-06 | 2010-06-01 | Massachusetts Institute Of Technology | Controlled release nanoparticle having bound oligonucleotide for targeted delivery |
| US20050037075A1 (en) | 2003-06-06 | 2005-02-17 | Farokhzad Omid C. | Targeted delivery of controlled release polymer systems |
| US7550441B2 (en) | 2003-06-06 | 2009-06-23 | Massachusetts Institute Of Technology | Controlled release polymer nanoparticle containing bound nucleic acid ligand for targeting |
| US20040247680A1 (en) | 2003-06-06 | 2004-12-09 | Farokhzad Omid C. | Targeted delivery of controlled release polymer systems |
| US7363076B2 (en) | 2003-06-09 | 2008-04-22 | Palo Alto Investors | Treatment of conditions through modulation of the autonomic nervous system |
| US7149574B2 (en) | 2003-06-09 | 2006-12-12 | Palo Alto Investors | Treatment of conditions through electrical modulation of the autonomic nervous system |
| US20050079152A1 (en) | 2003-06-17 | 2005-04-14 | Bot Adrian Ian | Methods of elicit, enhance and sustain immune responses against MHC class I-restricted epitopes, for prophylactic or therapeutic purposes |
| US20050042298A1 (en) | 2003-08-20 | 2005-02-24 | Pardridge William M. | Immunonanoparticles |
| US20070014807A1 (en) | 2003-09-03 | 2007-01-18 | Maida Anthony E Iii | Multiplex vaccine |
| US20050192248A1 (en) | 2003-10-08 | 2005-09-01 | Nyu Medical Center | Use of synthetic glycolipids as universal adjuvants for vaccines against cancer and infectious diseases |
| US20060234912A1 (en) | 2003-10-08 | 2006-10-19 | Wang Yu T | Methods for modulating neuronal responses |
| WO2005042018A2 (en) | 2003-10-30 | 2005-05-12 | Coley Pharmaceutical Gmbh | C-class oligonucleotide analogs with enhanced immunostimulatory potency |
| US20050239734A1 (en) | 2003-10-30 | 2005-10-27 | Coley Pharmaceutical Gmbh | C-class oligonucleotide analogs with enhanced immunostimulatory potency |
| US20070116768A1 (en) | 2003-12-09 | 2007-05-24 | Michael Chorny | Sustained release preparations composed of biocompatible complex microparticles |
| WO2005058282A1 (en) | 2003-12-18 | 2005-06-30 | Korea United Pharm, Inc | Double pellet formulation of proton pump inhibitors and clarithromycin for the treatment of gastrointestinal ulcer, and method for producing the same |
| US20070264481A1 (en) | 2003-12-19 | 2007-11-15 | Desimone Joseph M | Isolated and fixed micro and nano structures and methods thereof |
| WO2005097993A2 (en) | 2004-02-19 | 2005-10-20 | Coley Pharmaceutical Group, Inc. | Immunostimulatory viral rna oligonucleotides |
| WO2005110013A2 (en) | 2004-04-09 | 2005-11-24 | 3M Innovative Properties Company | Methods, compositions, and preparations for delivery of immune response modifiers |
| US20070166384A1 (en) | 2004-04-09 | 2007-07-19 | Zarraga Isidro Angelo E | Methods , composition and preparations for delivery of immune response modifiers |
| EP1752141A1 (en) | 2004-04-29 | 2007-02-14 | Instituto Cientifico Y Tecnologico De Navarra, S.A. | Immune response stimulating composition comprising nanoparticles based on a methyl vinyl ether-maleic acid copolymer |
| US20060002852A1 (en) | 2004-07-01 | 2006-01-05 | Yale University | Targeted and high density drug loaded polymeric materials |
| US20060045868A1 (en) | 2004-08-25 | 2006-03-02 | Aegis Therapeutics Llc | Absorption enhancers for drug administration |
| WO2006031878A2 (en) | 2004-09-14 | 2006-03-23 | Novartis Vaccines And Diagnostics Inc. | Imidazoquinoline compounds |
| CN1692943A (en) | 2004-09-17 | 2005-11-09 | 四川大学 | Preparation and Application of CpG DNA Molecular Anti-infection Immune Preparation |
| US20090104268A1 (en) | 2004-10-01 | 2009-04-23 | Midatech Limited | Nanoparticles Comprising Antigens and Adjuvants, and Immunogenic Structures |
| US20090004118A1 (en) | 2004-10-07 | 2009-01-01 | Shuming Nie | Multifunctional Nanoparticle Conjugates And Their Use |
| US7566703B2 (en) | 2004-10-20 | 2009-07-28 | Coley Pharmaceutical Group, Inc. | Semi-soft C-class immunostimulatory oligonucleotides |
| WO2006135434A2 (en) | 2004-10-20 | 2006-12-21 | Coley Pharmaceutical Group, Inc. | Semi-soft c-class immunostimulatory oligonucleotides |
| US20080268063A1 (en) | 2004-11-04 | 2008-10-30 | Sangyong Jon | Coated Controlled Release Polymer Particles as Efficient Oral Delivery Vehicles for Biopharmaceuticals |
| WO2007001448A2 (en) | 2004-11-04 | 2007-01-04 | Massachusetts Institute Of Technology | Coated controlled release polymer particles as efficient oral delivery vehicles for biopharmaceuticals |
| US20060111271A1 (en) | 2004-11-24 | 2006-05-25 | Cerny Erich H | Active and passive immunization against pharmacologically active hapten molecules using a synthetic carrier compound composed of similar elements |
| US20060241076A1 (en) | 2005-04-26 | 2006-10-26 | Coley Pharmaceutical Gmbh | Modified oligoribonucleotide analogs with enhanced immunostimulatory activity |
| US20090297609A1 (en) | 2005-07-06 | 2009-12-03 | Shoichet Molly S | Method of Biomolecule Immobilization On Polymers Using Click-Type Chemistry |
| WO2007003054A1 (en) | 2005-07-06 | 2007-01-11 | Shoichet Molly S | Method of biomolecule immobilization on polymers using click-type chemistry |
| US20070020620A1 (en) | 2005-07-14 | 2007-01-25 | Finn M G | Compositions and methods for coupling a plurality of compounds to a scaffold |
| US20090181402A1 (en) | 2005-07-14 | 2009-07-16 | The Scripps Research Institute | Compositions and methods for coupling a plurality of compounds to a scaffold |
| US20080306050A1 (en) | 2005-08-19 | 2008-12-11 | Array Biopharma Inc. | Aminodiazepines as Toll-Like Receptor Modulators |
| US20080234251A1 (en) | 2005-08-19 | 2008-09-25 | Array Biopharma Inc. | 8-Substituted Benzoazepines as Toll-Like Receptor Modulators |
| WO2007040840A2 (en) | 2005-08-19 | 2007-04-12 | Array Biopharma Inc. | Aminodiazepines as toll-like receptor modulators |
| US20090324551A1 (en) | 2005-08-22 | 2009-12-31 | The Regents Of The University Of California Office Of Technology Transfer | Tlr agonists |
| WO2007062107A2 (en) | 2005-11-25 | 2007-05-31 | Coley Pharmaceutical Gmbh | Immunostimulatory oligoribonucleotides |
| US20070184068A1 (en) | 2005-12-14 | 2007-08-09 | Cytos Biotechnology Ag | Immunostimulatory nucleic acid packaged particles for the treatment of hypersensitivity |
| US20090298710A1 (en) | 2005-12-15 | 2009-12-03 | Farokhzad Omid C | System for Screening Particles |
| WO2007070682A2 (en) | 2005-12-15 | 2007-06-21 | Massachusetts Institute Of Technology | System for screening particles |
| US7842312B2 (en) | 2005-12-29 | 2010-11-30 | Cordis Corporation | Polymeric compositions comprising therapeutic agents in crystalline phases, and methods of forming the same |
| US20110027368A1 (en) | 2005-12-29 | 2011-02-03 | Robert Burgermeister | Polymeric compositions comprising therapeutic agents in crystalline phases, and methods of forming the same |
| US20090011009A1 (en) | 2006-01-23 | 2009-01-08 | Yissum Research Development Company Of The Hebrew University Of Jerusalem | Microspheres comprising nanocapsules containing a lipophilic drug |
| US20100166876A1 (en) | 2006-02-10 | 2010-07-01 | Biocompatibles Uk Limited | Loading of hydrophobic drugs into hydrophilic polymer delivery systems |
| US20080031899A1 (en) | 2006-02-21 | 2008-02-07 | Reddy Sai T | Nanoparticles for immunotherapy |
| US20090169636A1 (en) | 2006-02-24 | 2009-07-02 | Derek O' Hagan | Microparticles containing biodegradable polymer and cationic polysaccharide for use in immunogenic compositions |
| WO2007109810A2 (en) | 2006-03-23 | 2007-09-27 | Novartis Ag | Methods for the preparation of imidazole-containing compounds |
| WO2008105773A2 (en) | 2006-03-31 | 2008-09-04 | Massachusetts Institute Of Technology | System for targeted delivery of therapeutic agents |
| CA2649149A1 (en) | 2006-04-11 | 2007-10-25 | Koko Kosmetikvertrieb Gmbh & Co. Kg | Nanoparticle containing nicotine and/or cotinine, dispersions, and use thereof |
| WO2007118653A2 (en) | 2006-04-11 | 2007-10-25 | Koko Kosmetikvertrieb Gmbh & Co. Kg | Nanoparticle containing nicotine and/or cotinine, dispersions and use thereof |
| US20090297614A1 (en) | 2006-04-13 | 2009-12-03 | Thomas William Rademacher | Nanoparticles for providing immune responses against infectious agents |
| US20090238797A1 (en) | 2006-05-12 | 2009-09-24 | Cytos Biotechnology Ag | Nicotine-carrier vaccine formulation |
| WO2007131972A1 (en) | 2006-05-12 | 2007-11-22 | Cytos Biotechnology Ag | Nicotine-carrier vaccine formulation |
| US8367113B2 (en) | 2006-05-15 | 2013-02-05 | Massachusetts Institute Of Technology | Polymers for functional particles |
| US20100323199A1 (en) | 2006-05-15 | 2010-12-23 | Massachusetts Institute Of Technology | Polymers for functional particles |
| US20080081074A1 (en) | 2006-05-15 | 2008-04-03 | Massachusetts Institute Of Technology | Polymers for functional particles |
| WO2007133807A2 (en) | 2006-05-15 | 2007-11-22 | Massachusetts Institute Of Technology | Polymers for functional particles |
| WO2007137117A2 (en) | 2006-05-17 | 2007-11-29 | Massachusetts Institute Of Technology | Aptamer-directed drug delivery |
| US20110052697A1 (en) | 2006-05-17 | 2011-03-03 | Gwangju Institute Of Science & Technology | Aptamer-Directed Drug Delivery |
| US20080014281A1 (en) | 2006-06-16 | 2008-01-17 | Florida Atlantic University | Chitin Micro-Particles As An Adjuvant |
| WO2007149802A2 (en) | 2006-06-19 | 2007-12-27 | 3M Innovative Properties Company | Formulation for delivery of immune response modifiers |
| WO2007150030A2 (en) | 2006-06-23 | 2007-12-27 | Massachusetts Institute Of Technology | Microfluidic synthesis of organic nanoparticles |
| US20080050450A1 (en) | 2006-06-26 | 2008-02-28 | Mutual Pharmaceutical Company, Inc. | Active Agent Formulations, Methods of Making, and Methods of Use |
| WO2008019142A2 (en) | 2006-08-04 | 2008-02-14 | Massachusetts Institute Of Technology | Oligonucleotide systems for targeted intracellular delivery |
| US20080171059A1 (en) | 2006-08-07 | 2008-07-17 | Shanshan Wu Howland | Methods and compositions for increased priming of t-cells through cross-presentation of exogenous antigens |
| US20100172993A1 (en) | 2006-08-11 | 2010-07-08 | Amarjit Singh | Particles for delivery of active ingredients, process of making and compositions thereof |
| WO2008033432A2 (en) | 2006-09-12 | 2008-03-20 | Coley Pharmaceutical Group, Inc. | Immune modulation by chemically modified ribonucleosides and oligoribonucleotides |
| WO2008147456A2 (en) | 2006-11-20 | 2008-12-04 | Massachusetts Institute Of Technology | Drug delivery systems using fc fragments |
| US20080213377A1 (en) | 2006-12-08 | 2008-09-04 | Bhatia Sangeeta N | Delivery of Nanoparticles and/or Agents to Cells |
| US20100143453A1 (en) | 2006-12-11 | 2010-06-10 | Raymond Michel Schiffelers | Anti-inflammatory compounds containing compositions for treatment of cancer |
| WO2008079924A1 (en) | 2006-12-22 | 2008-07-03 | 3M Innovative Properties Company | Immune response modifier compositions and methods |
| WO2008093173A1 (en) | 2007-01-31 | 2008-08-07 | Chongxi Yu | Positively charged water-soluble prodrugs of 1h-imidazo[4, 5-c]quinolin-4-amines and related compounds with very high skin penetration rates |
| WO2008115319A2 (en) | 2007-02-07 | 2008-09-25 | Regents Of The University Of California | Conjugates of synthetic tlr agonists and uses therefor |
| WO2008115641A2 (en) | 2007-02-15 | 2008-09-25 | Yale University | Modular nanoparticles for adaptable vaccines |
| WO2008124639A2 (en) | 2007-04-04 | 2008-10-16 | Massachusetts Institute Of Technology | Poly (amino acid) targeting moieties |
| WO2008124634A1 (en) | 2007-04-04 | 2008-10-16 | Massachusetts Institute Of Technology | Polymer-encapsulated reverse micelles |
| US20090074828A1 (en) | 2007-04-04 | 2009-03-19 | Massachusetts Institute Of Technology | Poly(amino acid) targeting moieties |
| WO2008124632A1 (en) | 2007-04-04 | 2008-10-16 | Massachusetts Institute Of Technology | Amphiphilic compound assisted nanoparticles for targeted delivery |
| US20100203142A1 (en) | 2007-04-04 | 2010-08-12 | Massachusetts Institute Of Technology | Amphiphilic compound assisted nanoparticles for targeted delivery |
| WO2008127532A1 (en) | 2007-04-12 | 2008-10-23 | Emory University | Novel strategies for delivery of active agents using micelles and particles |
| US20100104653A1 (en) | 2007-08-16 | 2010-04-29 | Abbott Cardiovascular Systems Inc. | Nanoparticle-Coated Medical Devices And Formulations For Treating Vascular Disease |
| US20090325292A1 (en) | 2007-08-24 | 2009-12-31 | Board Of Trustees Of Michigan State University | Functional polyglycolide nanoparticles derived from unimolecular micelles |
| WO2009027971A2 (en) | 2007-08-27 | 2009-03-05 | H2Q Water Industries Ltd. | Antimicrobial polymers |
| US20090130210A1 (en) | 2007-09-11 | 2009-05-21 | Raheja Praveen | Pharmaceutical compositions of sirolimus |
| WO2009038685A1 (en) | 2007-09-18 | 2009-03-26 | The Scripps Research Institute | Ligands for copper-catalyzed azide-alkyne cycloaddition reactions |
| WO2009051837A2 (en) | 2007-10-12 | 2009-04-23 | Massachusetts Institute Of Technology | Vaccine nanotechnology |
| US20100233251A1 (en) | 2007-10-12 | 2010-09-16 | Massachusetts Institute of Technology Massachusetts | Vaccine Nanotechnology |
| WO2009076158A1 (en) | 2007-12-07 | 2009-06-18 | Novartis Ag | Compositions for inducing immune responses |
| US20110014281A1 (en) | 2007-12-19 | 2011-01-20 | Julian Aleksov | Drug delivery system for administration of poorly water soluble pharmaceutically active substances |
| WO2009109428A2 (en) | 2008-02-01 | 2009-09-11 | Alpha-O Peptides Ag | Self-assembling peptide nanoparticles useful as vaccines |
| WO2009111588A1 (en) | 2008-03-04 | 2009-09-11 | Liquidia Technologies, Inc. | Immunomodulator particles and methods of treating |
| US20100323019A1 (en) | 2008-06-03 | 2010-12-23 | Abbott Cardiovascular Systems Inc. | Microparticles for the treatment of disease |
| US20090297621A1 (en) | 2008-06-03 | 2009-12-03 | Abbott Cardiovascular Systems Inc. | Microparticles For The Treatment Of Disease |
| US20100068285A1 (en) | 2008-06-16 | 2010-03-18 | Zale Stephen E | Drug Loaded Polymeric Nanoparticles and Methods of Making and Using Same |
| WO2009158687A1 (en) | 2008-06-26 | 2009-12-30 | Anterios, Inc. | Dermal delivery |
| WO2010003009A2 (en) | 2008-07-01 | 2010-01-07 | Emory University | Synergistic induction of humoral and cellular immunity by combinatorial activation of toll-like receptors |
| WO2010017330A1 (en) | 2008-08-06 | 2010-02-11 | Novartis Ag | Microparticles for use in immunogenic compositions |
| US20100075995A1 (en) | 2008-08-11 | 2010-03-25 | Smithkline Beecham Corporation | Compounds |
| WO2010018132A1 (en) | 2008-08-11 | 2010-02-18 | Smithkline Beecham Corporation | Compounds |
| WO2010018133A1 (en) | 2008-08-11 | 2010-02-18 | Smithkline Beecham Corporation | Purine derivatives for use in the treatment of allergic, inflammatory and infectious diseases |
| WO2010018130A1 (en) | 2008-08-11 | 2010-02-18 | Smithkline Beecham Corporation | Purine derivatives for use in the treatment of allergic, inflammatory and infectious diseases |
| WO2010018131A1 (en) | 2008-08-11 | 2010-02-18 | Smithkline Beecham Corporation | Purine derivatives for use in the treatment of allergic, inflammatory and infectious diseases |
| WO2010037566A1 (en) | 2008-10-02 | 2010-04-08 | Capsulution Pharma Ag | Improved nanoparticulate compositions of poorly soluble compounds |
| US20100129439A1 (en) | 2008-10-12 | 2010-05-27 | Frank Alexis | Adjuvant Incorporation in Immunonanotherapeutics |
| US20100129392A1 (en) * | 2008-10-12 | 2010-05-27 | Jinjun Shi | Targeting of Antigen Presenting Cells with Immunonanotherapeutics |
| US20100092425A1 (en) * | 2008-10-12 | 2010-04-15 | Von Andrian Ulrich | Nicotine Immunonanotherapeutics |
| WO2010042870A1 (en) | 2008-10-12 | 2010-04-15 | Massachusetts Institute Of Technology | Adjuvant incorporation in immunonanotherapeutics |
| US20100098770A1 (en) | 2008-10-16 | 2010-04-22 | Manikandan Ramalingam | Sirolimus pharmaceutical formulations |
| WO2010054215A1 (en) | 2008-11-06 | 2010-05-14 | Ventirx Pharmaceuticals, Inc. | Methods of synthesis of benzazepine derivatives |
| US20100233231A1 (en) | 2009-03-10 | 2010-09-16 | Roger Labrecque | Use of cryogenic processing to obtain a substantially-thickened formulation |
| WO2010115046A2 (en) | 2009-04-01 | 2010-10-07 | University Of Miami | Vaccine compositions and methods of use thereof |
| WO2010123569A2 (en) | 2009-04-21 | 2010-10-28 | Selecta Biosciences, Inc. | Immunonanotherapeutics providing a th1-biased response |
| US20110223201A1 (en) | 2009-04-21 | 2011-09-15 | Selecta Biosciences, Inc. | Immunonanotherapeutics Providing a Th1-Biased Response |
| WO2010128303A1 (en) | 2009-05-08 | 2010-11-11 | Hybrid Biosystems Limited | Multi- valent adjuvant display |
| US20100316724A1 (en) | 2009-05-12 | 2010-12-16 | Innovata Limited | Composition |
| WO2010138192A2 (en) | 2009-05-27 | 2010-12-02 | Selecta Biosciences, Inc. | Nanocarriers possessing components with different rates of release |
| US20140193453A1 (en) | 2009-05-27 | 2014-07-10 | Selecta Biosciences, Inc. | Immunomodulatory agent-polymeric compounds |
| US20110027217A1 (en) | 2009-05-27 | 2011-02-03 | Selecta Biosciences, Inc. | Immunomodulatory agent-polymeric compounds |
| WO2010138194A2 (en) | 2009-05-27 | 2010-12-02 | Selecta Biosciences, Inc. | Immunomodulatory agent-polymeric compounds |
| US9006254B2 (en) | 2009-05-27 | 2015-04-14 | Selecta Biosciences, Inc. | Immunomodulatory agent-polymeric compounds |
| US20140242173A1 (en) | 2009-05-27 | 2014-08-28 | Selecta Biosciences, Inc. | Targeted synthetic nanocarriers with ph sensitive release of immunomodulatory agents |
| US20100303850A1 (en) | 2009-05-27 | 2010-12-02 | Selecta Biosciences, Inc. | Nanocarriers possessing components with different rates of release |
| US8629151B2 (en) | 2009-05-27 | 2014-01-14 | Selecta Biosciences, Inc. | Immunomodulatory agent-polymeric compounds |
| US20110020388A1 (en) | 2009-05-27 | 2011-01-27 | Selecta Biosciences, Inc. | Targeted synthetic nanocarriers with ph sensitive release of immunomodulatory agents |
| US20140030344A1 (en) | 2009-05-27 | 2014-01-30 | Selecta Biosciences, Inc. | Targeted synthetic nanocarriers with ph sensitive release of immunostimulatory agents |
| US20150328300A1 (en) | 2009-05-27 | 2015-11-19 | Selecta Biosciences, Inc. | Immunomodulatory agent-polymeric compounds |
| WO2010146606A1 (en) | 2009-06-19 | 2010-12-23 | Sun Pharma Advanced Research Company Ltd., | Nanodispersion of a drug and process for its preparation |
| US20110110965A1 (en) | 2009-08-26 | 2011-05-12 | Selecta Biosciences, Inc. | Compositions that induce t cell help |
| US20110171248A1 (en) | 2010-01-08 | 2011-07-14 | Selecta Biosciences, Inc. | Synthetic virus-like particles conjugated to human papillomavirus capsid peptides for use as vaccines |
| US20110272836A1 (en) | 2010-04-12 | 2011-11-10 | Selecta Biosciences, Inc. | Eccentric vessels |
| US20110262491A1 (en) | 2010-04-12 | 2011-10-27 | Selecta Biosciences, Inc. | Emulsions and methods of making nanocarriers |
| US9066978B2 (en) | 2010-05-26 | 2015-06-30 | Selecta Biosciences, Inc. | Dose selection of adjuvanted synthetic nanocarriers |
| US20110293700A1 (en) * | 2010-05-26 | 2011-12-01 | Selecta Biosciences, Inc. | Nanocarrier compositions with uncoupled adjuvant |
| WO2011150240A1 (en) | 2010-05-26 | 2011-12-01 | Selecta Biosciences, Inc. | Nanocarrier compositions with uncoupled adjuvant |
| US20110293723A1 (en) | 2010-05-26 | 2011-12-01 | Selecta Biosciences, Inc. | Synthetic nanocarrier combination vaccines |
| US9764031B2 (en) | 2010-05-26 | 2017-09-19 | Selecta Biosciences, Inc. | Dose selection of adjuvanted synthetic nanocarriers |
| US20110293701A1 (en) | 2010-05-26 | 2011-12-01 | Selecta Biosciences, Inc. | Multivalent synthetic nanocarrier vaccines |
| US20120027806A1 (en) | 2010-05-26 | 2012-02-02 | Selecta Biosciences, Inc. | Dose selection of adjuvanted synthetic nanocarriers |
| US20150328309A1 (en) | 2010-05-26 | 2015-11-19 | Selecta Biosciences, Inc. | Dose selection of adjuvanted synthetic nanocarriers |
| US20120058154A1 (en) | 2010-08-20 | 2012-03-08 | Selecta Biosciences, Inc. | Synthetic nanocarrier vaccines comprising peptides obtained or derived from human influenza a virus m2e |
| US20120058153A1 (en) | 2010-08-20 | 2012-03-08 | Selecta Biosciences, Inc. | Synthetic nanocarrier vaccines comprising proteins obtained or derived from human influenza a virus hemagglutinin |
| US20120064110A1 (en) | 2010-08-20 | 2012-03-15 | Selecta Biosciences, Inc. | Synthetic nanocarrier vaccines comprising peptides obtained or derived from human influenza a virus hemagglutinin |
| US20120070493A1 (en) | 2010-08-23 | 2012-03-22 | Selecta Biosciences, Inc. | Targeted multi-epitope dosage forms for induction of an immune response to antigens |
| US20120171229A1 (en) | 2010-12-30 | 2012-07-05 | Selecta Biosciences, Inc. | Synthetic nanocarriers with reactive groups that release biologically active agents |
| US20120244222A1 (en) | 2011-03-25 | 2012-09-27 | Selecta Biosciences, Inc. | Osmotic mediated release synthetic nanocarriers |
| US20120276157A1 (en) | 2011-04-29 | 2012-11-01 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers to reduce antibody responses |
| US20120294888A1 (en) | 2011-04-29 | 2012-11-22 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers for allergy therapy |
| US20150320870A1 (en) | 2011-04-29 | 2015-11-12 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers for inducing regulatory b cells |
| US20150320728A1 (en) | 2011-04-29 | 2015-11-12 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers to reduce antibody responses |
| US20120301498A1 (en) | 2011-04-29 | 2012-11-29 | Selecta Biosciences, Inc. | Controlled release of immunosuppressants from synthetic nanocarriers |
| US20120276133A1 (en) | 2011-04-29 | 2012-11-01 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers for inducing regulatory b cells |
| US20120276156A1 (en) | 2011-04-29 | 2012-11-01 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarrier compositions with transplantable graft antigens and methods of use |
| US20160279234A1 (en) | 2011-04-29 | 2016-09-29 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers for allergy therapy |
| US20160256401A1 (en) | 2011-04-29 | 2016-09-08 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers to reduce immune responses to therapeutic proteins |
| US20160243253A1 (en) | 2011-04-29 | 2016-08-25 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers |
| US9295718B2 (en) | 2011-04-29 | 2016-03-29 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers to reduce immune responses to therapeutic proteins |
| US9289476B2 (en) | 2011-04-29 | 2016-03-22 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers for allergy therapy |
| US9289477B2 (en) | 2011-04-29 | 2016-03-22 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers to reduce cytotoxic T lymphocyte responses |
| US9265815B2 (en) | 2011-04-29 | 2016-02-23 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers |
| US20160030555A1 (en) | 2011-04-29 | 2016-02-04 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers for generating cd8+ regulatory t cells |
| US20120301510A1 (en) | 2011-04-29 | 2012-11-29 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers coupled to cd1d-restricted antigens and methods of use |
| US20160030554A1 (en) | 2011-04-29 | 2016-02-04 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers for allergy therapy |
| US20150320856A1 (en) | 2011-04-29 | 2015-11-12 | Selecta Biosciences, Inc. | Controlled release of immunosuppressants from synthetic nanocarriers |
| US20120276109A1 (en) | 2011-04-29 | 2012-11-01 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers to reduce immune responses to therapeutic proteins |
| US8652487B2 (en) | 2011-04-29 | 2014-02-18 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers for inducing regulatory B cells |
| US20120276134A1 (en) | 2011-04-29 | 2012-11-01 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers for antigen-specific deletion of t effector cells |
| US20140199340A1 (en) | 2011-04-29 | 2014-07-17 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers for inducing regulatory b cells |
| US20120276158A1 (en) | 2011-04-29 | 2012-11-01 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers to reduce cytotoxic t lymphocyte responses |
| US20160022650A1 (en) | 2011-04-29 | 2016-01-28 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers to reduce cytotoxic t lymphocyte responses |
| US20150335762A1 (en) | 2011-04-29 | 2015-11-26 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers to reduce immune responses to therapeutic proteins |
| US20120276155A1 (en) | 2011-04-29 | 2012-11-01 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers for generating cd8+ regulatory t cells |
| US20150328333A1 (en) | 2011-04-29 | 2015-11-19 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers |
| US20120276159A1 (en) | 2011-04-29 | 2012-11-01 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers |
| US20150320884A1 (en) | 2011-04-29 | 2015-11-12 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers for antigen-specific deletion of t effector cells |
| US20120276160A1 (en) | 2011-04-29 | 2012-11-01 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers for regulating innate immune responses |
| US20130039954A1 (en) | 2011-07-29 | 2013-02-14 | Selecta Biosciences, Inc. | Control of antibody responses to synthetic nanocarriers |
| US20130028857A1 (en) | 2011-07-29 | 2013-01-31 | Selecta Biosciences, Inc. | Synthetic nanocarriers comprising polymers comprising multiple immunomodulatory agents |
| US20130028941A1 (en) | 2011-07-29 | 2013-01-31 | Selecta Biosciences, Inc. | Synthetic nanocarriers that generate humoral and cytotoxic t lymphocyte (ctl) immune responses |
| US20130058978A1 (en) | 2011-09-06 | 2013-03-07 | Selecta Biosciences, Inc. | Induced tolerogenic dendritic cells for inducing regulatory b cells |
| US20130058963A1 (en) | 2011-09-06 | 2013-03-07 | Selecta Biosciences, Inc. | Induced tolerogenic dendritic cells for generating cd8+ regulatory t cells |
| US20130058902A1 (en) | 2011-09-06 | 2013-03-07 | Selecta Biosciences, Inc. | Dendritic cell subsets for generating induced tolerogenic dendritic cells and related compositions and methods |
| US20130058970A1 (en) | 2011-09-06 | 2013-03-07 | Selecta Biosciences, Inc. | Induced tolerogenic dendritic cells to reduce systemic inflammatory cytokines |
| US20130058901A1 (en) | 2011-09-06 | 2013-03-07 | Selecta Biosciences, Inc. | Transplantable graft-specific induced tolerogenic dendritic cells and methods of use |
| US20130058977A1 (en) | 2011-09-06 | 2013-03-07 | Selecta Biosciences, Inc. | Compositions and methods related to induced tolerogenic dendritic cells externally loaded with mhc class i-restricted epitopes |
| US20130058975A1 (en) | 2011-09-06 | 2013-03-07 | Selecta Biosciences, Inc. | Antigen-specific induced tolerogenic dendritic cells to reduce antibody responses |
| US20130058974A1 (en) | 2011-09-06 | 2013-03-07 | Selecta Biosciences, Inc. | Antigen-specific induced tolerogenic dendritic cells to reduce cytotoxic t lymphocyte responses |
| US20130058976A1 (en) | 2011-09-06 | 2013-03-07 | Selecta Biosciences, Inc. | Allergen-specific induced tolerogenic dendritic cells for allergy therapy |
| US20130058894A1 (en) | 2011-09-06 | 2013-03-07 | Selecta Biosciences, Inc. | Therapeutic protein-specific induced tolerogenic dendritic cells and methods of use |
| US20130059009A1 (en) | 2011-09-06 | 2013-03-07 | Selecta Biosciences, Inc. | Compositions and methods for producing antigen-specific induced tolerogenic dendritic cells with synthetic nanocarriers |
| US20140328922A1 (en) | 2013-05-03 | 2014-11-06 | Selecta Biosciences, Inc. | Local, concomitant administration of tolerogenic synthetic nanocarriers to reduce type i and type iv hypersensitivity |
| US20140328921A1 (en) | 2013-05-03 | 2014-11-06 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers to reduce or prevent anaphylaxis in response to a non-allergenic antigen |
| US20140328923A1 (en) | 2013-05-03 | 2014-11-06 | Selecta Biosciences, Inc. | Dosing combinations for reducing undesired humoral immune responses |
| US20140328854A1 (en) | 2013-05-03 | 2014-11-06 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers and therapeutic macromolecules for reduced or enhanced pharmacodynamic effects |
| US20140328924A1 (en) | 2013-05-03 | 2014-11-06 | Selecta Biosciences, Inc. | Delivery of immunosuppressants having a specified pharmacodynamic effective-life and antigen for the induction of immune tolerance |
| US20140356361A1 (en) | 2013-06-04 | 2014-12-04 | Selecta Biosciences, Inc. | Repeated administration of non-immunosuppressive antigen specific immunotherapeutics |
| US20150359865A1 (en) | 2014-06-17 | 2015-12-17 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers for t-cell-mediated autoimmune disease |
| US20150374815A1 (en) | 2014-06-25 | 2015-12-31 | Selecta Biosciences, Inc. | Methods and compositions for treatment with synthetic nanocarriers and immune checkpoint inhibitors |
| US20160074532A1 (en) | 2014-09-07 | 2016-03-17 | Selecta Biosciences, Inc. | Methods and compositions for attenuating gene editing anti-viral transfer vector immune responses |
| US20160074427A1 (en) | 2014-09-07 | 2016-03-17 | Selecta Biosciences, Inc. | Methods and compositions for attenuating gene expression modulating anti-viral transfer vector immune responses |
| US20160074372A1 (en) | 2014-09-07 | 2016-03-17 | Selecta Biosciences, Inc. | Methods and compositions for attenuating exon skipping anti-viral transfer vector immune responses |
| US20160074531A1 (en) | 2014-09-07 | 2016-03-17 | Selecta Biosciences, Inc. | Methods and compositions for attenuating gene therapy anti-viral transfer vector immune responses |
| US20160067228A1 (en) | 2014-09-07 | 2016-03-10 | Selecta Biosciences, Inc. | Methods and compositions for attenuating anti-viral transfer vector immune responses |
| US20160128986A1 (en) | 2014-11-05 | 2016-05-12 | Selecta Biosciences, Inc. | Methods and compositions related to the use of low hlb surfactants in the production of synthetic nanocarriers comprising a rapalog |
| US20160128987A1 (en) | 2014-11-05 | 2016-05-12 | Selecta Biosciences, Inc. | Methods and compositions related to synthetic nanocarriers with rapamycin in a stable, super-saturated state |
| US20160220501A1 (en) | 2015-02-03 | 2016-08-04 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers to reduce immune responses to therapeutic proteins |
| US20170258927A1 (en) | 2016-03-11 | 2017-09-14 | Selecta Biosciences, Inc. | Formulations and doses of pegylated uricase |
Non-Patent Citations (126)
| Title |
|---|
| [No Author Listed] R 848 Vanguard Medica phase change II, Europe. Highbeam Business. R & D Focus Drug News. Mar. 6, 2000. http://business.highbeam.com/436989/article-1G1-59732297/r-848-vanguard-medica-phase-change-ii-europe [last Accessed Feb. 16, 2011]. 1 page. |
| [No Author Listed] S-28463. Drugs Future. 1999;24(6):622-7. |
| Abad et al., Comparison of a Monoclonal Antibody-Based Enzyme-Linked Immunosorbent Assay and Gas Chromatography for the Determination of Nicotine in Cigarette Smoke Condensates. Anal Chem. 1993;65:3227-31. |
| Aliferis et al., Living polypeptides. Biomacromolecules. Sep.-Oct. 2004;5(5):1653-6. |
| Allison, The mode of action of immunological adjuvants. Dev Biol Stand. 1998;92:3-11. |
| Amsberry et al., Amine prodrugs which utilize hydroxy amide lactonization. I. A potential redox-sensitive amide prodrug. Pharm Res. Mar. 1991;8(3):323-30. |
| Anderson et al., Immunization to nicotine with a peptide-based vaccine composed of a conformationally biased agonist of C5a as a molecular adjuvant. Int Immunopharmacol. Jan. 2003;3(1):137-46. |
| Bachmann et al., Chapter 19. Virus-like Particles: Combining Innate and Adaptive Immunity for Effective Vaccination. Novel Vaccination Strategies. 2004:415-32. |
| Badiee et al., Coencapsulation of CpG oligodeoxynucleotides with recombinant Leishmania major stress-inducible protein 1 in liposome enhances immune response and protection against leishmaniasis in immunized BALB/c mice. Clin Vaccine Immunol. Apr. 2008;15(4):668-74. Epub Jan. 30, 2008. |
| Bauer et al., Human TLR9 confers responsiveness to bacterial DNA via species-specific CpG motif recognition. Proc Natl Acad Sci U S A. Jul. 31, 2001;98(16):9237-42. Epub Jul. 24, 2001. |
| Bjercke et al., Comparison of monoclonal and polyclonal antibodies to continine in nonisotopic and isotopic immunoassays. J Immunol Meth. 1987;96:239-46. |
| Black et al., Advances in the design and delivery of peptide subunit vaccines with a focus on toll-like receptor agonists. Expert Rev Vaccines. Feb. 2010;9(2):157-73. |
| Borchardt et al., Stereopopulation control. 3. Facilitation of intramolecular conjugate addition of the carboxyl group. J Am Chem Soc. Dec. 27, 1972;94(26):9175-82. |
| Bourquin et al., Targeting CpG oligonucleotides to the lymph node by nanoparticles elicits efficient antitumoral immunity. J Immunol. Sep. 1, 2008;181(5):2990-8. |
| Buter et al., Synthesis of Macrocyclic sulfides using cesium thiolates: 1,4,8,11-tetrathiacyclotetradecane. Organic Synthesis. 1993;8:592. 5 pages. |
| Carpino et al., Reductive Lactonization of strategically methylated quinone propionic acid esters and amides. J Org Chem. 1989;54:3303-10. |
| Carrot et al., Two general methods for the synthesis of Thiol-Functional Polycaprolactones. Macromolecules. 1999;32:5264-9. |
| Castro et al., Nicotine Antibodies: Comparison of Ligand Specificities of Antibodies Produced against Two Nicotine Conjugates. Eur Biochem. 1980;104:331-40. |
| Castro et al., Nicotine Antibody Production: Comparison of two nicotine conjugates in different animal species. Biochem Biophys Res Comm. 1975;67(2):583-9. |
| Castro et al., Nicotine enzyme immunoassay. Res Commun Chem Pathol Pharmacol. Mar. 1986;51(3):393-404. |
| Cerny et al., Anti-nicotine abuse vaccines in the pipeline: an update. Expert Opin Investig Drugs. May 2008;17(5):691-6. |
| Cerritelli et al., PEG-SS-PPS: reduction-sensitive disulfide block copolymer vesicles for intracellular drug delivery. Biomacromolecules. Jun. 2007;8(6):1966-72. Epub May 12, 2007. |
| Chan et al., Preparation and characterization of immunogens for antibody production against metanephrine and normetanephrine. J Immunol Methods. Aug. 1, 2002;266(1-2):143-54. |
| Chan et al.,Synthesis and immunological characterization of toll-like receptor 7 agonistic conjugates. Bioconjug Chem. Jun. 2009;20(6):1194-200. |
| Chinen et al., Basic and clinical immunology. J Allergy Clin Immunol. Aug. 2005;116(2):411-8. |
| Chu et al., CpG oligodeoxynucleotides act as adjuvants that switch on T helper 1 (Thl) immunity. J Exp Med. Nov. 17, 1997;186(10):1623-31. |
| Connor et al., Ex vivo evaluation of anti-EpCAM immunocytokine huKS-1L2 in ovarian cancer. J Immunother. 2004;27(3):211-19. |
| Cornuz et al., A vaccine against nicotine for smoking cessation: a randomized controlled trial. PLoS One. Jun. 25, 2008;3(6):e2547. |
| Cruz et al., The influence of PEG chain length and targeting moiety on antibody-mediated delivery of nanoparticle vaccines to human dendritic cells. Biomaterials. Oct. 2011;32(28):6791-803. Epub Jul. 2, 2011. E-pub version. |
| Czarniecki, Small molecule modulators of toll-like receptors. J Med Chem. Nov. 13, 2008;51(21):6621-6. doi: 10.1021/jm800957k. Epub Oct. 2, 2008. |
| Davis et al., CpG DNA is a potent enhancer of specific immunity in mice immunized with recombinant hepatitis B surface antigen. J Immunol. Jan. 15, 1998;160(2):870-6. |
| De Gregorio et al., Alum adjuvanticity: unraveling a century old mystery. Eur J Immunol. Aug. 2008;38(8):2068-71. |
| Delemarre et al., Repopulation of macrophages in popliteal lymph nodes of mice after liposome-mediated depletion. J Leukoc Biol. 1990;47(3):251-7. |
| Diwan et al., Dose sparing of CpG oligodeoxynucleotide vaccine adjuvants by nanoparticle delivery. Curr Drug Deliv. Oct. 2004;1(4):405-12. |
| Diwan et al., Enhancement of immune responses by co-delivery of a CpG oligodeoxynucleotide and tetanus toxoid in biodegradable nanospheres. J Control Release. Dec. 13, 2002;85(1-3):247-62. |
| Dockrell et al., Imiquimod and resiquimod as novel immunomodulators. J Antimicrob Chemother. Dec. 2001;48(6):751-5. |
| Extended European Search Report dated Apr. 13, 2016 in connection with EP 11838881.8. |
| Feuillet et al., Involvement of Toll-like receptor 5 in the recognition of flagellated bacteria. Proc Natl Acad Sci U S A. Aug. 15, 2006;103(33):12487-92. Epub Aug. 4, 2006. |
| Fife et al., Highly Efficient intramolecular nucleophilic reactions. The cyclization of p-nitrophenyl N-(2-mercaptophenyl)-N-methylcarbamate and phenyl N-(2-Aminophenyl)-N-methylcarbamate. JACS. 1975;97:5878-82. |
| Fukuyama et al., 2,4 Dinitrobenzenesulfonamides: A Simple and Practical Method for the Preparation of a Variety of Secondary Amines and Diamines. Tetrahedron Letters. 1997;38(33):5831-4. |
| Gant et al., Semiquinone anion radicals formed by the reaction of quinones with glutathione or amino acids. FEBS Lett. Jun. 9, 1986;201(2):296-300. |
| Gao et al., In vivo molecular and cellular imaging with quantum dots. Curr Op Biotechnol. 2005;16:63-72. |
| Garçon et al., Boosting vaccine power. Sci Am. Oct. 2009;301(4):72-9. |
| Gomes et al., Cyclization-activated prodrugs. Molecules. Nov. 12, 2007;12(11):2484-506. |
| Gratton et al., The effect of particle design on cellular internalization pathways. Proc Natl Acad Sci U S A. Aug. 19, 2008;105(33):11613-8. Epub Aug. 12, 2008. |
| Greenwald et al., Drug delivery systems based on trimethyl lock lactonization: poly(ethylene glycol) prodrugs of amino-containing compounds. J Med Chem. Feb. 10, 2000;43(3):475-87. |
| Haas et al., Sequence independent interferon-alpha induction by multimerized phosphodiester DNA depends on spatial regulation of Toll-like receptor-9 activation in plasmacytoid dendritic cells. Immunology. Feb. 2009;126(2):290-8. Epub Nov. 15, 2008. |
| Haddadi, Delivery of rapamycin by PLGA nanoparticles enhances its suppressive activity on dendritic cells. J Biomed Mat Res A. 2007;84A(4):885-98. |
| Hammerbeck et al., Administration of a dual toll-like receptor 7 and toll-like receptor 8 agonist protects against influenza in rats. Antiviral Res. Jan. 2007;73(1):1-11. Epub Aug. 18, 2006. |
| Hatsukami et al., Safety and immunogenicity of a nicotine conjugate vaccine in current smokers. Clin Pharmacol Ther. Nov. 2005;78(5):456-67. |
| Hattermann et al., The Toll-like receptor 7/8-ligand resiquimod (R-848) primes human neutrophils for leukotriene B4, prostaglandin E2 and platelet-activating factor biosynthesis. FASEB J. May 2007;21(7):1575-85. Epub Jan. 30, 2007. |
| Heeg et al., Structural requirements for uptake and recognition of CpG oligonucleotides. Int J Med Microbiol. Jan. 2008;298(1-2):33-8. Epub Aug. 13, 2007. |
| Heil et al., Species-specific recognition of single-stranded RNA via toll-like receptor 7 and 8. Science. Mar. 5, 2004;303(5663):1526-9. Epub Feb. 19, 2004. |
| Hemmi et al., A Toll-like receptor recognizes bacterial DNA. Nature. Dec. 7, 2000;408(6813):740-5. |
| Hermanson, Bioconjugate Techniques 2nd Edition. Academic Press. 2008. 1233 pages. |
| Hieda et al., Active Immunization Alters the Plasma Nicotine Concentration in Rats. J Pharmacol Exp Therapeutics. 1997;283:1076-81. |
| Hieda et al., Immunization of rats reduces nicotine distribution to brain. Psychopharmacology. 1999;143:150-7. |
| Hieda et al., Vaccination against nicotine during continued nicotine administration in rats: immunogenicity of the vaccine and effects on nicotine distribution to brain. Int J Immunopharmacol. Oct. 2000;22(10):809-19. |
| Hruby et al., Poly (ethylene oxide)-coated polymide nanoparticles deradable by glutathione. Colloid Polym Sci. 2007;285:569-74. |
| Hutchins et al., Facile intramolecular nucleophilic attack by alkoxide ions on ethyl and p-nitrophenyl carbamates. J Am Chem Soc. May 30, 1973;95(11):3786-90. |
| Hutchins et al., Fast Intramolecular Nucleophilic attack by phenoxide ion on carbamate ester groups. JACS. 1973;95:2282-6. |
| International Preliminary Report on Patentability for PCT/US2011/059350 dated May 16, 2013. |
| International Search Report and Written Opinion for PCT/US2011/059350 dated Mar. 13, 2012. |
| Iwasaki et al., Cell-specific delivery of polymeric nanoparticles to carbohydrate-tagging cells. Biomacromolecules. Oct. 2007;8(10):3162-8. Epub Sep. 21, 2007. |
| Jennings et al., Immunodrugs: therapeutic VLP-based vaccines for chronic diseases. Annu Rev Pharmacol Toxicol. 2009;49:303-26. |
| Jurk et al., Human TLR7 or TLR8 independently confer responsiveness to the antiviral compound R-848. Nat Immunol. Jun. 2002;3(6):499. |
| Kamber et al., Organocatalytic ring-opening polymerization. Chem Rev. Dec. 2007;107(12):5813-40. Epub Nov. 8, 2007. |
| Keyler et al., Enhanced immunogenicity of a bivalent nicotine vaccine. Int Immunopharmacol. Nov. 2008;8(11):1589-94. Epub Jul. 24, 2008. |
| Kimura et al., Binding of oligoguanylate to scavenger receptors is required for oligonucleotides to augment NK cell activity and induce IFN. J Biochem. Nov. 1994;116(5):991-4. |
| King et al., Stereopopulation Control. 7. Rate Enhancement in the Lactonization of 3-(o-Hydroxyphenyl) propionic Acids: Dependence on the Size of Aromatic Ring Substituents. J Am Chem Soc. 1983;105:2752-60. |
| Klein, Probing the interactions of proteins and nanoparticles. Proc Natl Acad Sci U S A. Feb. 13, 2007;104(7):2029-30. Epub Feb. 6, 2007. |
| Krieg et al., CpG motifs in bacterial DNA trigger direct B-cell activation. Nature. 1995;374(6522):546-9. |
| Kwon et al., Pseudopoly(amino acids): A study of the synthesis and characterization of poly(acyl-hydroxyproline-esters). Macromolecules. 1989;22:3250-5. |
| Langone et al., Nicotine and its metabolites. Radioinununoassays for nicotine and cotinine. Biochem. 1973;12(24):5025-30. |
| Langone et al., Radioimmunoassay of Nicotine, Cotinine, and y-(3-Pyridyl)- y-oxo-N-methylbutyramide. Met Enzymol. 1982;84:628-40. |
| Lazarev et al., Organic Oxides and Peroxides. Harmful substances in industry. Chemistry. 1976;1:474-5. |
| Le Pera et al., Highly specific N-monomethylation of primary aromatic amines. Tetrahedron. 2006;62:6100-6. |
| Lee et al., Polyketal microparticles: a new delivery vehicle for superoxide dismutase. Bioconjug Chem. Jan.-Feb. 2007;18(1):4-7. |
| Lee et al., Synthesis of 3-(2-aminoethylthio)propyl glycosides. Carbohydr Res. Oct. 1974;37(1):193-201. |
| Liang et al., Activation of human B cells by phosphorothioate oligodeoxynucleotides. J Clin Invest. Sep. 1, 1996;98(5):1119-29. |
| Lindblad, Aluminium compounds for use in vaccines. Immunol Cell Biol. Oct. 2004;82(5):497-505. |
| Lipford et al., Bacterial DNA as immune cell activator. Trends Microbiol. Dec. 1998;6(12):496-500. |
| Lipford et al., CpG-containing synthetic oligonucleotides promote B and cytotoxic T cell responses to protein antigen: a new class of vaccine adjuvants. Eur J Immunol. Sep. 1997;27(9):2340-4. |
| Lloyd, Disulphide reduction in lysosomes. The role of cysteine. Biochem J. Jul. 1, 1986;237(1):271-2. |
| Lönnberg, Solid-phase synthesis of oligonucleotide conjugates useful for delivery and targeting of potential nucleic acid therapeutics. Bioconjug Chem. Jun. 2009;20(6):1065-94. |
| Malin et al., Passive immunization against nicotine prevents nicotine alleviation of nicotine abstinence syndrome. Pharmacol Biochem Behay. Jan. 2001;68(1):87-92. |
| Malyala et al., Enhancing the therapeutic efficacy of CpG oligonucleotides using biodegradable microparticles. Adv Drug Deliv Rev. Mar. 28, 2009;61(3):218-25. Epub Jan. 11, 2009. |
| Malyala et al., The potency of the adjuvant, CpG oligos, is enhanced by encapsulation in PLG microparticles. J Pharm Sci. Mar. 2008;97(3):1155-64. |
| Manolova et al., Nanoparticles target distinct dendritic cell populations according to their size. Eur J Immunol. 2008;38:1404-13. |
| Maurer et al., A therapeutic vaccine for nicotine dependence: preclinical efficacy, and Phase I safety and immunogenicity. Eur J Immunol. Jul. 2005;35(7):2031-40. |
| McSorley et al., Bacterial flagellin is an effective adjuvant for CD4+ T cells in vivo. J Immunol. Oct. 1, 2002;169(7):3914-9. |
| Meldal et al., Cu-catalyzed azide-alkyne cycloaddition. Chem Rev. Aug. 2008;108(8):2952-3015. |
| Michiels et al., Patent exemption for clinical trials: current status of the Bolar-type provisions in Europe. Life Sciences Intellectual Property Review 2008. Lavoix. www.worldipreview.com. 2008:68-70. |
| Milstien et al., Rate acceleration by stereopopulation control: models for enzyme action. Proc Natl Acad Sci U S A. Nov. 1970;67(3):1143-7. |
| Milstien et al., Stereopopulation control. I. Rate enhancement in the lactonizations of 0-hydroxyhydrocinnamic acids. J Am Chem Soc. Dec. 27, 1972;94(26):9158-65. |
| Nickerson et al., Studies on quinone-thioethers. I. Mechanism of formation and properties of thiodione. Biochemistry. May-Jun. 1963;2:537-43. Biochemistry. May-Jun. 1963;2:537-43. |
| Ondachi et al., Synthesis and regioselective substitution of C-6 alkoxy derivatives of (S)-nicotine. Tetrehed Lett. Nov. 13, 2007;49(3):569-72. DOI: 1.1016/J.Tetlet.2007.11.041. |
| Paolicelli et al., Surface-modified PLGA-based nanoparticles that can efficiently associate and deliver virus-like particles. Nanomedicine (Lond). Aug. 2010;5(6):843-53. |
| Papot et al., Design of selectively activated anticancer prodrugs: elimination and cyclization strategies. Curr Med Chem Anticancer Agents. Mar. 2002;2(2):155-85. |
| Pentel et al., A nicotine conjugate vaccine reduces nicotine distribution to brain and attenuates its behavioral and cardiovascular effects in rats. Pharmacol Biochem Behav. Jan. 1, 2000;65(1):191-8. |
| Pockros, Current Status of Immunomodulatory Therapies in HCV Infection. Current Hepatitis Reports. 2004;3:16-22. |
| Richardson, The Synthesis and Chemistry of Certain 2-Substituted 5,6-Dihydroimidazo-, -oxazolo-, and -thiazolo[ij]quinolines. 1963;28:2581-7. |
| Rissing et al., The Thiol-ene Reaction for the Synthesis of Multifunctional Branched. Organosilanes. Organometallics. 2008;27:5394-7. E-pub Sep. 11, 2008. |
| Robbins et al., Fabricated Nanoparticles with Cross Validation Using a Humanized Mouse Model. Nanomed Nanotech Biol Med. 2015. Accepted manuscript. doi: 10.1016/j.nano.2014.11.010. 36 pages. |
| Roman et al., Immunostimulatory DNA sequences function as T helper-1-promoting adjuvants. Nat Med. Aug. 1997;3(8):849-54. |
| Rostovtsev et al., A stepwise huisgen cycloaddition process: copper(I)-catalyzed regioselective "ligation" of azides and terminal alkynes. Angew Chem Int Ed Engl. Jul. 15, 2002;41(14):2596-9. |
| Saito et al., Drug delivery strategy utilizing conjugation via reversible disulfide linkages: role and site of cellular reducing activities. Adv Drug Deliv Rev. Feb. 10, 2003;55(2):199-215. |
| Seeman et al., Preparation of hydroxyalkyl-substituted nicotinoids. J Org Chem. 1986;51:1548-51. |
| Skwarczynski et al., Polyacrylate dendrimer nanoparticles: a self-adjuvanting vaccine delivery system. Angew Chem Int Ed Engl. Aug. 2, 2010;49(33):5742-5. |
| Sonehara et al., Hexamer palindromic oligonucleotides with 5′-Cg-3′ motif(s) induce production of interferon. J Interferon Cytokine Res. Oct. 1996;16(10):799-803. |
| Strable et al., Chemical modification of viruses and virus-like particles. Curr Top Microbiol Immunol. 2009;327:1-21. |
| Thorek et al., Comparative analysis of nanoparticle-antibody conjugations: carbodiimide versus click chemistry. Mol Imaging. Jul.-Aug. 2009;8(4):221-9. |
| Tomai et al., Resiquimod and other immune response modifiers as vaccine adjuvants. Expert Rev Vaccines. Oct. 2007;6(5):835-47. |
| Tong et al., Ring-opening polymerization-mediated controlled formulation of polylactide-drug nanoparticles. J Am Chem Soc. Apr. 8, 2009;131(13):4744-54. E-pub Mar. 12, 2009. |
| Verma et al., Surface-structure-regulated cell-membrane penetration by monolayer-protected nanoparticles. Nat Mater. Jul. 2008;7(7):588-95. Epub May 25, 2008. |
| Vollmer et al., Characterization of three CpG oligodeoxynucleotide classes with distinct immunostimulatory activities. Eur J Immunol. Jan. 2004;34(1):251-62. |
| Wang et al., Synthesis of a Novel Esterase-Sensitive Cyclic Prodrug System for Peptides That Utilizes a "Trimethyl Lock"-Facilitated Lactonization Reaction. J Org Chem. 1997;62:1363-7. |
| Wang et al., Synthesis of a Novel Esterase-Sensitive Cyclic Prodrug System for Peptides That Utilizes a "Trimethyl Lock"—Facilitated Lactonization Reaction. J Org Chem. 1997;62:1363-7. |
| Wong SS, Chemistry of Protein Conjugation and Cross-linking, CRC Press Publishers, Boca Raton, 1991. |
| Wriggers et al. Control of protein functional dynamics by peptide linkers. Biopolymers. 2005;80(6):736-46. |
| Wu et al., A novel chitosan CpG nanoparticle regulates cellular and humoral immunity of mice.Biomed Environ Sci. Apr. 2006;19(2):87-95. |
| Wu et al., Resiquimod: a new immune response modifier with potential as a vaccine adjuvant for Th1 immune responses. Antiviral Res. Nov. 2004;64(2):79-83. |
| Wu et al., Synthesis of glycoconjugate vaccines for Candida albicans using novel linker methodology. J Org Chem. Sep. 2, 2005;70(18):7381-8. |
| Yu et al., Potent CpG oligonucleotides containing phosphodiester linkages: in vitro and in vivo immunostimulatory properties. Biochem Biophys Res Commun. Sep. 13, 2002;297(1):83-90. |
| Zhou et al., Preparation of poly(L-serine ester): a structural analog of conventional poly(L-serine). Macromolecules. 1990;23(14):3399-406. |
| Zwiorek et al., Delivery by cationic gelatin nanoparticles strongly increases the immunostimulatory effects of CpG oligonucleotides. Pharm Res. Mar. 2008;25(3):551-62. Epub Oct. 3, 2007. |
Cited By (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11717569B2 (en) | 2011-04-29 | 2023-08-08 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers |
| US11779641B2 (en) | 2011-04-29 | 2023-10-10 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers for allergy therapy |
| US11235057B2 (en) | 2011-04-29 | 2022-02-01 | Selecta Biosciences, Inc. | Methods for providing polymeric synthetic nanocarriers for generating antigen-specific tolerance immune responses |
| US10420835B2 (en) | 2011-04-29 | 2019-09-24 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers for antigen-specific deletion of T effector cells |
| US10441651B2 (en) | 2011-04-29 | 2019-10-15 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers for generating CD8+ regulatory T cells |
| US10933129B2 (en) | 2011-07-29 | 2021-03-02 | Selecta Biosciences, Inc. | Methods for administering synthetic nanocarriers that generate humoral and cytotoxic T lymphocyte responses |
| US10434088B2 (en) | 2013-05-03 | 2019-10-08 | Selecta Biosciences, Inc. | Methods related to administering immunosuppressants and therapeutic macromolecules at a reduced pharmacodynamically effective dose |
| US10668053B2 (en) | 2013-05-03 | 2020-06-02 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers to reduce or prevent anaphylaxis in response to a non-allergenic antigen |
| US10357482B2 (en) | 2013-05-03 | 2019-07-23 | Selecta Biosciences, Inc. | Methods providing a therapeutic macromolecule and synthetic nanocarriers comprising immunosuppressant locally and concomitantly to reduce both type I and type IV hypersensitivity |
| US11298342B2 (en) | 2013-05-03 | 2022-04-12 | Selecta Biosciences, Inc. | Methods providing a therapeutic macromolecule and synthetic nanocarriers comprising immunosuppressant locally and concomitantly to reduce both type I and type IV hypersensitivity |
| US10357483B2 (en) | 2013-05-03 | 2019-07-23 | Selecta Biosciences, Inc. | Methods comprising dosing combinations for reducing undesired humoral immune responses |
| US10335395B2 (en) | 2013-05-03 | 2019-07-02 | Selecta Biosciences, Inc. | Methods of administering immunosuppressants having a specified pharmacodynamic effective life and therapeutic macromolecules for the induction of immune tolerance |
| US12472167B2 (en) | 2013-05-03 | 2025-11-18 | Cartesian Therapeutics, Inc. | Methods providing a therapeutic macromolecule and synthetic nanocarriers comprising immunosuppressant locally and concomitantly to reduce both Type 1 and Type IV hypersensitivity |
| US12508249B2 (en) | 2013-05-03 | 2025-12-30 | Cartesian Therapeutics Inc. | Methods related to administering immunosuppressants and non-allergenic antigens to reduce or prevent anaphylaxis |
| US11633422B2 (en) | 2014-09-07 | 2023-04-25 | Selecta Biosciences, Inc. | Methods and compositions for attenuating anti-viral transfer vector immune responses |
| US11426451B2 (en) | 2017-03-11 | 2022-08-30 | Selecta Biosciences, Inc. | Methods and compositions related to combined treatment with antiinflammatories and synthetic nanocarriers comprising an immunosuppressant |
| US12194078B2 (en) | 2017-03-11 | 2025-01-14 | Cartesian Therapeutics, Inc. | Methods and compositions related to combined treatment with anti-inflammatories and synthetic nanocarriers comprising an immunosuppressant |
Also Published As
| Publication number | Publication date |
|---|---|
| EP2640190A1 (en) | 2013-09-25 |
| EA201390660A1 (en) | 2013-11-29 |
| WO2012061717A1 (en) | 2012-05-10 |
| EP2640190A4 (en) | 2016-05-11 |
| US20120114677A1 (en) | 2012-05-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9994443B2 (en) | Modified nicotinic compounds and related methods | |
| US9764031B2 (en) | Dose selection of adjuvanted synthetic nanocarriers | |
| US20230139671A1 (en) | Osmotic mediated release synthetic nanocarriers | |
| US20120171229A1 (en) | Synthetic nanocarriers with reactive groups that release biologically active agents | |
| WO2011085231A2 (en) | Synthetic virus-like particles conjugated to human papillomavirus capsid peptides for use as vaccines | |
| AU2011291519A1 (en) | Synthetic nanocarrier vaccines comprising proteins obtained or derived from human influenza A virus hemagglutinin |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: SELECTA BIOSCIENCES, INC., MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:ZEPP, CHARLES;GAO, YUN;SIGNING DATES FROM 20111206 TO 20111207;REEL/FRAME:027578/0482 |
|
| FEPP | Fee payment procedure |
Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.) |
|
| STCF | Information on status: patent grant |
Free format text: PATENTED CASE |
|
| FEPP | Fee payment procedure |
Free format text: MAINTENANCE FEE REMINDER MAILED (ORIGINAL EVENT CODE: REM.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY |
|
| LAPS | Lapse for failure to pay maintenance fees |
Free format text: PATENT EXPIRED FOR FAILURE TO PAY MAINTENANCE FEES (ORIGINAL EVENT CODE: EXP.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY |
|
| STCH | Information on status: patent discontinuation |
Free format text: PATENT EXPIRED DUE TO NONPAYMENT OF MAINTENANCE FEES UNDER 37 CFR 1.362 |
|
| FP | Lapsed due to failure to pay maintenance fee |
Effective date: 20220612 |













































