US8034337B2 - Interleukin-1α antibodies - Google Patents

Interleukin-1α antibodies Download PDF

Info

Publication number
US8034337B2
US8034337B2 US12/455,458 US45545809A US8034337B2 US 8034337 B2 US8034337 B2 US 8034337B2 US 45545809 A US45545809 A US 45545809A US 8034337 B2 US8034337 B2 US 8034337B2
Authority
US
United States
Prior art keywords
human
cells
cell
mab
hil
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active, expires
Application number
US12/455,458
Other versions
US20090298096A1 (en
Inventor
John Simard
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Janssen Biotech Inc
Original Assignee
Xbiotech Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to US12/455,458 priority Critical patent/US8034337B2/en
Application filed by Xbiotech Inc filed Critical Xbiotech Inc
Assigned to XBIOTECH, INC. reassignment XBIOTECH, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: SIMARD, JOHN
Publication of US20090298096A1 publication Critical patent/US20090298096A1/en
Priority to US13/225,004 priority patent/US20120164665A1/en
Priority to US13/224,913 priority patent/US8388969B2/en
Priority to US13/224,943 priority patent/US8388956B2/en
Priority to US13/224,975 priority patent/US20120021512A1/en
Priority to US13/225,029 priority patent/US8962814B2/en
Application granted granted Critical
Publication of US8034337B2 publication Critical patent/US8034337B2/en
Priority to US13/762,453 priority patent/US8679489B2/en
Priority to US13/767,292 priority patent/US8784817B2/en
Priority to US14/177,892 priority patent/US8956831B2/en
Priority to US14/567,072 priority patent/US9181338B2/en
Priority to US14/877,964 priority patent/US9840558B2/en
Priority to US15/789,774 priority patent/US10899833B2/en
Assigned to JANSSEN BIOTECH, INC. reassignment JANSSEN BIOTECH, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: XBIOTECH INC.
Priority to US17/154,137 priority patent/US20210171623A1/en
Priority to US18/483,270 priority patent/US20240034781A1/en
Active legal-status Critical Current
Adjusted expiration legal-status Critical

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • C07K16/244Interleukins [IL]
    • C07K16/245IL-1
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/545IL-1
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/069Vascular Endothelial cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0693Tumour cells; Cancer cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/10Cells modified by introduction of foreign genetic material
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6863Cytokines, i.e. immune system proteins modifying a biological response such as cell growth proliferation or differentiation, e.g. TNF, CNF, GM-CSF, lymphotoxin, MIF or their receptors
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6863Cytokines, i.e. immune system proteins modifying a biological response such as cell growth proliferation or differentiation, e.g. TNF, CNF, GM-CSF, lymphotoxin, MIF or their receptors
    • G01N33/6869Interleukin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55522Cytokines; Lymphokines; Interferons
    • A61K2039/55527Interleukins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5412IL-6
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/10Immunoglobulins specific features characterized by their source of isolation or production
    • C07K2317/14Specific host cells or culture conditions, e.g. components, pH or temperature
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2330/00Production
    • C12N2330/50Biochemical production, i.e. in a transformed host cell
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/52Assays involving cytokines
    • G01N2333/54Interleukins [IL]
    • G01N2333/545IL-1

Definitions

  • the invention relates generally to the fields of immunology, inflammation, cancer, vascular disorders, and medicine. More particularly, the invention relates to antibodies (Abs) which specifically bind interleukin-1 ⁇ (IL-1 ⁇ ) and methods of using such Abs to treat, prevent, or detect a pathology associated with aberrant IL-1 ⁇ expression.
  • Abs antibodies which specifically bind interleukin-1 ⁇ (IL-1 ⁇ ) and methods of using such Abs to treat, prevent, or detect a pathology associated with aberrant IL-1 ⁇ expression.
  • IL-1 ⁇ is pro-inflammatory cytokine that plays a role in a number of different activities including inflammation, immune responses, tumor metastasis, and hematopoiesis.
  • IgG autoantibodies against IL-1 ⁇ occur naturally in the general human population and are thought to be beneficial in diseases such as atherosclerosis.
  • the invention is based on the development of fully human monoclonal Abs (mAbs) that include (i) an antigen-binding variable region that exhibits very high binding affinity for human IL-1 ⁇ and (ii) a constant region that is effective at both activating the complement system though C1q binding and binding to several different Fc receptors.
  • mAbs monoclonal Abs
  • the IL-1 ⁇ specific mAbs described herein was made by replacing the constant region of a human IgG4 mAb having a variable region specific for human IL-1 ⁇ with the constant region of a human IgG1 mAb.
  • the invention features a purified human IgG1 mAb that specifically binds to human IL-1 ⁇ , the mAb including a heavy chain covalently joined to a light chain.
  • the heavy chain can include the amino acid sequence of SEQ ID NO: 9 and the light chain can include the amino acid sequence of SEQ ID NO:11.
  • a set of isolated nucleic acids including a first nucleic acid encoding the heavy chain of a human IgG1 mAb that specifically binds to IL-1 ⁇ , and a second nucleic acid encoding the light chain of the human IgG1 mAb that specifically binds to human IL-1 ⁇ .
  • the first nucleic acid can encode the amino acid sequence of SEQ ID NO: 9 and the second nucleic acid can encode the amino acid sequence of SEQ ID NO:11.
  • the first nucleic acid can include the nucleotide sequence of SEQ ID NO: 10 and the second nucleic acid can include the nucleotide sequence of SEQ ID NO:12.
  • the invention features an expression vector including a nucleic acid encoding the amino acid sequence of SEQ ID NO: 9 or SEQ ID NO: 11.
  • Another feature of the invention is an isolated host cell (e.g. a mammalian cell such as a CHO cell) including set of isolated nucleic acids including a first nucleic acid encoding the heavy chain of a human IgG1 mAb that specifically binds to IL-1 ⁇ , and a second nucleic acid encoding the light chain of the human IgG1 mAb that specifically binds to human IL-1 ⁇ .
  • the heavy chain can include the amino acid sequence of SEQ ID NO: 9 and a light chain can include the amino acid sequence of SEQ ID NO:11.
  • the invention further features a method of killing a cell expressing human IL-1 ⁇ .
  • This method can include the step of contacting the cell with a purified human IgG1 mAb that specifically binds to human IL-1 ⁇ .
  • a method of inhibiting migration of a human cell through a basement membrane matrix is also within the invention.
  • This method can include the step of adding a purified mAb that specifically binds to human IL-1 ⁇ to a mixture including a basement membrane matrix and the human cell.
  • a method of inhibiting an IL-1 ⁇ -induced increase in ICAM-1 and/or E-selectin expression on the surface of a human endothelial cell can include the step of adding a purified mAb that specifically binds to human IL-1 ⁇ to a mixture including the endothelial cell and IL-1 ⁇ .
  • the invention additionally includes a method of tracking inflammation in a human subject previously subjected to the steps of: obtaining from the subject a first sample of peripheral blood mononuclear cells at a first time; contacting the first sample with a purified mAb that specifically binds to human IL-1 ⁇ ; and determining the percent of cells in the first sample that bind the monoclonal Ab.
  • This method can include the steps of: (a) obtaining from the subject a second sample of peripheral blood mononuclear cells at a second time; (b) contacting the second sample with the purified mAb that specifically binds to human IL-1 ⁇ ; (c) determining the percent of cells in the second sample that bind the monoclonal Ab; and (d) comparing the percent of cells in the first sample that bind the mAb to the percent of cells in the second sample that bind the monoclonal Ab.
  • the purified mAb can be a human IgG1 mAb including a heavy chain covalently joined to a light chain, e.g., wherein the heavy chain includes the amino acid sequence of SEQ ID NO: 9 and the light chain includes the amino acid sequence of SEQ ID NO:11.
  • Another method within the invention features the steps of: (a) enriching a biological sample obtained from a human subject using a filter to separate molecules according to molecular weight into a first fraction including intact IgG complexed with IL-1 ⁇ and second fraction including molecules less than 100 Kda; and (b) quantifying the amount of IL-1 ⁇ in the first fraction.
  • Yet another method within the invention features the steps of: (a) enriching a sample of plasma obtained from a human subject using a filter that separates molecules according to molecular weight into a first fraction including intact IgG complexed with IL-1 ⁇ and second fraction including molecule less than 100 Kda; (b) adding the first fraction to a substrate including immobilized anti-human IgG Abs under conditions that allow IgG in the first fraction to specifically bind the anti-human IgG Abs immobilized on the substrate; (c) washing the substrate to remove material in the first fraction that does not specifically bind the immobilized anti-human IgG Abs; (d) contacting the substrate washed in step (c) with an Ab that specifically binds human IL-1 ⁇ under conditions that allows the Ab that specifically binds human IL-1 ⁇ to specifically bind any human IL-1 ⁇ bound to the substrate; (e) washing the substrate to remove any of the Ab that specifically binds human IL-1 ⁇ that is not bound to the substrate; and (f) quantifying the amount of Ab
  • the specified ligand or Ab binds to its particular “target” and does not bind in a significant amount to other proteins present in the sample or to other proteins to which the ligand or Ab may come in contact in an organism.
  • a first molecule that “specifically binds” a second molecule has an equilibrium affinity constant greater than about 10 5 (e.g., 10 6 , 10 7 , 10 8 , 10 9 , 10 10 , 10 11 , and 10 12 or more) liters/mole for that second molecule.
  • purified means separated from components that naturally accompany such molecules.
  • an Ab or protein is purified when it is at least about 10% (e.g., 9%, 10%, 20%, 30% 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.9%, and 100%), by weight, free from the non-Ab proteins or other naturally-occurring organic molecules with which it is naturally associated. Purity can be measured by any appropriate method, e.g., column chromatography, polyacrylamide gel electrophoresis, or HPLC analysis. A chemically-synthesized protein or other recombinant protein produced in a cell type other than the cell type in which it naturally occurs is “purified.”
  • compositions and methods relating to fully human mAbs that include (i) an antigen-binding variable region that exhibits very high binding affinity for IL-1 ⁇ and (ii) a constant region that is effective at both activating the complement system though C1q binding and binding to several different Fc receptors.
  • compositions and methods that include (i) an antigen-binding variable region that exhibits very high binding affinity for IL-1 ⁇ and (ii) a constant region that is effective at both activating the complement system though C1q binding and binding to several different Fc receptors.
  • Immunological methods for example, assays for detection and localization of antigen-Ab complexes, immunoprecipitation, immunoblotting, and the like
  • methodology treatises such as Current Protocols in Immunology, Coligan et al., ed., John Wiley & Sons, New York.
  • Techniques of molecular biology are described in detail in treatises such as Molecular Cloning: A Laboratory Manual, 2nd ed., vol.
  • the invention features a fully human mAb that includes (i) an antigen-binding variable region that exhibits very high binding affinity for human IL-1 ⁇ and (ii) a constant region that is effective at both activating the complement system though C1q binding and binding to several different Fc receptors.
  • the human Ab is preferably an IgG1.
  • the Ka of the Ab is preferably at least 1 ⁇ 10 9 M ⁇ 1 or greater (e.g., greater than 9 ⁇ 10 10 M ⁇ 1 , 8 ⁇ 10 10 M ⁇ 1 , 7 ⁇ 10 10 M ⁇ 1 , 6 ⁇ 10 10 M ⁇ 1 , 5 ⁇ 10 10 M ⁇ 1 , 4 ⁇ 10 10 M ⁇ 1 , 3 ⁇ 10 10 M ⁇ 1 , 2 ⁇ 10 10 M ⁇ 1 , or 1 ⁇ 10 10 M ⁇ 1 ).
  • B lymphocytes which express Ig specific for human IL-1 ⁇ occur naturally in human beings
  • a presently preferred method for raising mAbs is to first isolate such a B lymphocyte from a subject and then immortalize it so that it can be continuously replicated in culture.
  • Subjects lacking large numbers of naturally occurring B lymphocytes which express Ig specific for human IL-1 ⁇ may be immunized with one or more human IL-1 ⁇ antigens to increase the number of such B lymphocytes.
  • Human mAbs are prepared by immortalizing a human Ab secreting cell (e.g., a human plasma cell). See, e.g., U.S. Pat. No. 4,634,664.
  • one or more human subjects are screened for the presence of such human IL-1 ⁇ -specific Ab in their blood.
  • Those subjects that express the desired Ab can then be used as B lymphocyte donors.
  • peripheral blood is obtained from a human donor that possesses B lymphocytes that express human IL-1 ⁇ -specific Ab.
  • B lymphocytes are then isolated from the blood sample, e.g., by cells sorting (e.g., fluorescence activated cell sorting, “FACS”; or magnetic bead cell sorting) to select B lymphocytes expressing human IL-1 ⁇ -specific Ig.
  • cells sorting e.g., fluorescence activated cell sorting, “FACS”; or magnetic bead cell sorting
  • the B lymphocytes within this population that express Ig specific for human IL-1 ⁇ can then be isolated by limiting dilution methods (e.g., cells in wells of a microtiter plate that are positive for Ig specific for human IL-1 ⁇ are selected and subcultured, and the process repeated until a desired clonal line can be isolated). See, e.g., Goding, Monoclonal Abs: Principles and Practice, pp. 59-103, Academic Press, 1986.
  • MAbs secreted by these clonal cell lines can be purified from the culture medium or a bodily fluid (e.g., ascites) by conventional Ig purification procedures such as salt cuts, size exclusion, ion exchange separation, and affinity chromatography.
  • heterologous expression systems to produce mAbs. See, e.g., the methods described in U.S. patent application Ser. No. 11/754,899.
  • the genes encoding an mAb specific for human IL-1 ⁇ might be cloned and introduced into an expression vector (e.g., a plasmid-based expression vector) for expression in a heterologous host cell (e.g., CHO cells, COS cells, myeloma cells, and E. coli cells).
  • a heterologous host cell e.g., CHO cells, COS cells, myeloma cells, and E. coli cells.
  • Igs include heavy (H) and light (L) chains in an H 2 L 2 configuration
  • the genes encoding each may be separately isolated and expressed in different vectors.
  • chimeric mAbs which are antigen-binding molecules having different portions derived from different animal species (e.g., variable region of a mouse Ig fused to the constant region of a human Ig), might be used in the invention.
  • Such chimeric Abs can be prepared by methods known in the art. E. G., Morrison et al., Proc. Nat'l. Acad. Sci. USA, 81:6851, 1984; Neuberger et al., Nature, 312:604, 1984; Takeda et al., Nature, 314:452, 1984.
  • Abs can be humanized by methods known in the art.
  • monoclonal Abs with a desired binding specificity can be commercially humanized or as described in U.S. Pat. Nos. 5,693,762; 5,530,101; or 5,585,089.
  • the mAbs described herein might be affinity matured to enhance or otherwise alter their binding specificity by known methods such as VH and VL domain shuffling (Marks et al. Bio/Technology 10:779-783, 1992), random mutagenesis of the hypervariable regions (HVRs) and/or framework residues (Barbas et al. Proc Nat. Acad. Sci. USA 91:3809-3813, 1994; Schier et al. Gene 169:147-155, 1995; Yelton et al. J. Immunol. 155:1994-2004, 1995; Jackson et al., J. Immunol. 154(7):3310-9, 1995; and Hawkins et al, J. Mol. Biol.
  • Amino acid sequence variants of an Ab may be prepared by introducing appropriate changes into the nucleotide sequence encoding the Ab.
  • modifications to nucleic acid sequences encoding mAbs might be altered (e.g., without changing the amino acid sequence of the mAb) for enhancing production of the mAb in certain expression systems (e.g., intron elimination and/or codon optimization for a given expression system).
  • the mAbs described herein can also be modified by conjugation to another protein (e.g., another mAb) or non-protein molecule.
  • a mAb might be conjugated to a water soluble polymer such as polyethylene glycol or a carbon nanotube (See, e.g., Kam et al., Proc. Natl. Acad. Sci. USA 102: 11600-11605, 2005). See, U.S. patent application Ser. No. 11/754,899.
  • a water soluble polymer such as polyethylene glycol or a carbon nanotube
  • the mAb compositions of the invention are at least 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 95, 96, 97, 98, 99, 99.9 or more percent by weight pure (excluding any excipients).
  • the mAb compositions of the invention might include only a single type of mAb (i.e., one produced from a single clonal B lymphocyte line) or might include a mixture of two or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10 or more) different types of mAbs.
  • the Ab compositions of the invention might also include other mAbs that specifically bind antigens other than human IL-1 ⁇ .
  • the human IL-1 ⁇ mAbs might be conjugated another molecule such as a cytotoxin or detectable label.
  • a human IL-1 ⁇ specific mAb might be conjugated with one or more cytotoxins to more effectively kill cells expressing IL-1 ⁇ .
  • Cytotoxins for use in the invention can be any cytotoxic agent (e.g., molecule that can kill a cell after contacting the cell) that can be conjugated to a human IL-1 ⁇ specific mAb.
  • cytotoxins include, without limitation, radionuclides (e.g., 35 S, 14 C, 32 P, 125 I, 131 I, 90 Y, 89 Zr, 201 Tl, 186 Re, 188 Re, 57 Cu, 213 Bi, and 211 At), conjugated radionuclides, and chemotherapeutic agents.
  • radionuclides e.g., 35 S, 14 C, 32 P, 125 I, 131 I, 90 Y, 89 Zr, 201 Tl, 186 Re, 188 Re, 57 Cu, 213 Bi, and 211 At
  • conjugated radionuclides e.g., chemotherapeutic agents.
  • cytotoxins include, but are not limited to, antimetabolites (e.g., 5-fluorouricil (5-FU), methotrexate (MTX), fludarabine, etc.), anti-microtubule agents (e.g., vincristine, vinblastine, colchicine, taxanes (such as paclitaxel and docetaxel), etc.), alkylating agents (e.g., cyclophasphamide, melphalan, bischloroethylnitrosurea (BCNU), etc.), platinum agents (e.g., cisplatin (also termed cDDP), carboplatin, oxaliplatin, JM-216, CI-973, etc.), anthracyclines (e.g., doxorubicin, daunorubicin, etc.), antibiotic agents (e.g., mitomycin-C), topoisomerase inhibitors (e.g., etoposide, tenoposide, and
  • the human IL-1 ⁇ specific mAb can also be conjugated to a detectable label.
  • detectable labels in the present invention include biotin or streptavidin, magnetic beads, fluorescent dyes (e.g., fluorescein isothiocyanate, texas red, rhodamine, green fluorescent protein, and the like), radiolabels (e.g., 3 H, 125 I, 35 S, 14 C, 32 P, 111 In, 97 Ru, 67 Ga, 68 Ga, or 72 As), radioopaque substances such as metals for radioimaging, paramagnetic agents for magnetic resonance imaging, enzymes (e.g., horseradish peroxidase, alkaline phosphatase and others commonly used in an ELISA), and colorimetric labels such as colloidal gold or colored glass or plastic (e.g., polystyrene, polypropylene, latex, etc.) beads.
  • fluorescent dyes e.g., fluorescein isothiocyanate,
  • radiolabels may be detected using photographic film or scintillation counters.
  • Fluorescent markers may also be used and can be detected using a photodetector to detect emitted illumination.
  • Enzymatic labels are typically detected by providing the enzyme with a substrate and detecting the reaction product produced by the action of the enzyme on the substrate, and colorimetric labels are detected by simply visualizing the colored label.
  • the present invention also encompasses nucleic acid molecules encoding fully human mAbs specific for human IL-1 ⁇ . Although the same nucleic acid molecule might encode both the heavy and light chains of a human IL-1 ⁇ -specific mAb, two different nucleic acid molecules, one encoding the heavy chain and the other encoding the light chain might also be used.
  • the amino acid sequences of three IgG1 mAbs specific for human IL-1 ⁇ are presented herein. See SEQ ID NOs: 1, 3, 5, 7, 9, and 11. Exemplary nucleic acid molecules encoding these amino acid sequences are also described herein. See SEQ ID NOs: 2, 4, 6, 8, 10, and 12. Any other suitable nucleic acid that encodes the amino acid sequences of the two described IgG1 mAbs or other mAbs within the invention might also be used.
  • the nucleic acid molecules of the invention might be incorporated into an expression vector in an orientation wherein such nucleic acid molecules are operatively linked to expression control sequences such as transcriptional and translational control sequences.
  • expression vectors include vectors derived from plasmids and vectors derived from viruses such as adenoviruses, adeno-associated viruses, and retroviruses.
  • the nucleic acid molecules encoding a light chain and a heavy chain might be incorporated into a single vector or different vectors.
  • the vectors of the invention might also include regulatory sequences such as promoters and/or enhancers (see, U.S. Pat. No. 5,168,062, U.S. Pat. No. 4,510,245 and U.S. Pat. No. 4,968,615), selectable markers, or sequences encoding affinity tags (for facilitating purification) or a detectable label.
  • the vectors of the invention can be introduced into a suitable host cell, e.g., a prokaryotic cell such as a bacteria or, preferably, a eukaryotic cell such as mammalian, plant, or yeast host cell.
  • a suitable host cell e.g., a prokaryotic cell such as a bacteria or, preferably, a eukaryotic cell such as mammalian, plant, or yeast host cell.
  • suitable host cell e.g., a prokaryotic cell such as a bacteria or, preferably, a eukaryotic cell such as mammalian, plant, or yeast host cell.
  • methods for introducing heterologous polynucleotides into host cells include use of viral vectors, electroporation, encapsulation of the polynucleotide(s) in liposomes, dextran-mediated transfection, calcium phosphate precipitation, polybrene-mediated transfection, protoplast fusion, Agrobacterium -mediated transformation,
  • Mammalian cell lines are presently preferred for expression of mAbs from vectors.
  • mammalian host cells include Chinese hamster ovary (CHO) cells (e.g., the DG44 CHO cell line), HeLa cells, baby hamster kidney (BHK) cells, African green monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), NS0 cells, SP2 cells, HEK-293T cells, 293 Freestyle cells, and NIH-3T3 cells.
  • the mAbs of the invention might also be expressed in transgenic animals or plants. See, e.g., U.S. Pat. Nos. 5,827,690; 5,756,687; 5,750,172; 5,741,957; 6,046,037; and 5,959,177.
  • the invention provides a method for detecting a human IL-1 ⁇ -expressing cell in a sample by contacting the cell with a human IL-1 ⁇ -specific mAb and detecting the mAb bound to the cell.
  • the invention also provides a method for killing a human IL-1 ⁇ -expressing cell by contacting the cell with a human IL-1 ⁇ -specific mAb. Such killing can be accomplished by complement-mediated killing, Ab-dependent cell-mediated cytotoxicity, or Ab-mediated delivery of a cytotoxin.
  • the Abs described herein have also been shown to be useful for other methods.
  • MABp1 has been to reduce IL-1 ⁇ induced ICAM1 and E-selectin expression on endothelial cells.
  • MABp1 has also been shown to be used in immunoassays for detecting and quantifying IL-1 ⁇ in a biological sample.
  • V-HC Variable region heavy chain
  • V-LC variable region light chain sequences were gene synthesized using amino acid sequence information provided in U.S. Pat. No. 5,959,085.
  • V-HC was PCR amplified introducing Hindlll/Clal sites upstream of the ATG start codon and a Nhel site at the 3′ end.
  • the human germline IgG1 constant region was PCR amplified modifying the two 5′ triplets encoding for the first two amino acids Ala-Ser to an Nhel site, and introducing a BamHI site at the 3′ end.
  • the human germline IgG1 constant region amino acid sequence corresponded to Swiss-Prot entry P01857, except for a K171Q and a V261L exchange.
  • the V-HC and constant IgG1-HC sequence were ligated using the Nhel site and cloned into pcDNA3 using Hindlll and BamHl sites.
  • the V-LC was PCR amplified introducing Hindlll/Clal sites upstream of the ATG start codon and a BsiWI site at the 3′ end.
  • the human constant Kappa-LC sequence was PCR amplified introducing a 5′ BsiWI site encoding an additional Arg and the first amino acids Thr, and a BamHI site at the 3′ end.
  • the human constant Kappa-LC amino acid sequence corresponded to Swiss-Prot entry P01834.
  • V-HC and constant Kappa-LC sequences were ligated using the BsiWI site and cloned into pcDNA3 using HindIII and BamHI sites.
  • the complete sequence encoding the NATHMAB-hIL-1a/IgG1 heavy chain was gene synthesized.
  • the V-HC sequence corresponded to the amino acid sequence described in U.S. Pat. No. 5,959,085.
  • the human constant IgG1-HC sequence corresponded to Swiss-Prot entry P01857.
  • the nucleotide sequence was codon optimized for expression in CHO cells. A Kozac sequence (gccacc) was added upstream of the start ATG.
  • the complete sequence encoding the NATHMAB-hIL-1a/Kappa light chain was gene synthesized.
  • the V-LC sequence corresponded to the amino acid sequence described in U.S. Pat. No. 5,959,085.
  • the human constant Kappa-LC sequence corresponded to Swiss-Prot entry P01834.
  • the nucleotide sequence was codon optimized for expression in CHO cells. A Kozac sequence (gccacc) was added upstream of ATG.
  • NATHMAB-IL-1 ⁇ was expressed and purified using a transient transfection method.
  • Cell culture supernatant or protein G affinity purified Ab was subjected to further analysis as described below.
  • Human embryonic kidney (HEK) 293T cells were cultured in DMEM containing 10% FCS, and transiently transfected using jetPEI reagent (Polyplus) according to manufacturer's protocol. Cells were seeded on 10 cm dishes (3 ⁇ 10 6 cells per 10 cm dish) 24 h prior to transfection to reach approximately 50% density at the time point of transfection.
  • NATHMAB-hIL1 ⁇ Neutralizing activity of NATHMAB-hIL1 ⁇ was tested in a bioassay using the murine EL4-6.1 subline which produces high levels of IL-2 when treated with murine or human IL-1 ⁇ (Zubler et al., J. Immunol. 134:3662-3668, 1985).
  • the indicated concentrations of NATHMAB-hIL-1 ⁇ (eluate) were incubated for 30 min at 37° C. with various concentrations of recombinant hIL-1 ⁇ (eBioscience) in a final volume of 100 ⁇ l/well in a 96-well culture plate (flat bottomed). Each point was carried out in triplicate and in culture medium (DMEM, 5% FCS).
  • NATHMAB-hIL-1 ⁇ effectively neutralized IL-2 secretion by EL-4 cells induced by membrane-bound hIL-1 ⁇ .
  • NATHMAB-hIL-1 ⁇ was tested for neutralization of murine IL-1 ⁇ .
  • NATHMAB-hIL-1 ⁇ Indicated amounts of NATHMAB-hIL-1 ⁇ supernatant were incubated with recombinant human (h) or murine (m) IL-1 ⁇ (eBioscience). The supernatant containing the Ab neutralized human, but not murine, IL-1 ⁇ .
  • PBMC peripheral blood mononuclear cells isolated from the buffy coat by standard Ficoll Paque preparation
  • E effector cells
  • THP1 cells were used as the targets (T).
  • the assay was carried out in 96-well plates with each point in triplicate. After 1 ⁇ 10 4 targets that were incubated with different concentration of MABp1 for 15 mins, effector cells were added in an ET ratio of 25:1 and 50:1 to 1 ⁇ 10 4 targets and incubated for another 4 hours.
  • % specific lysis (mean experimental release-mean spontaneous release without antibody) ⁇ 100/(mean maximal release from targets-mean spontaneous release from targets)
  • A. untreated PBMC were used as effector cells.
  • B. rhIL-2-treated PBMC were used as effector cells. In both cases, increasing concentrations (1.25 to 20 ug/ml) of MABp1 resulted in increased target cell killing (up to about 90%) at both ET ratios.
  • the binding affinity of purified MABp1 was determined using surface plasmon resonanace (SPR) on a BIAcore 2000 instrument (GE Health Sciences).
  • SPR surface plasmon resonanace
  • a mouse monoclonal anti-human IgG (Fc) Ab was covalently immobilized on the flow cells of a CM5 sensor chip using a human Ab capture kit and amine coupling kit (GE Health Sciences). Immobilization levels of 8000-14000 RU would typically be achieved.
  • three start-up cycles with HBS-EP running buffer (GE Health Sciences) and two start-up cycles with MABp1 were run to stabilize the CM5 surface and to remove any non-covalently bound Ab.
  • MABp1 Ab was diluted into HBS-EP running buffer to a final concentration of 1 ⁇ g/mL and immobilized to 700 RU on one flow cell of the CM5 sensor chip.
  • Carrier-free human IL-1A cytokine (eBioscience, #34-8019) was serially diluted in HBS-EP running buffer over a test range from 100 nM to 0.05 nM. Flow rate was 30 ⁇ l/min. Dissociation data for each cytokine dilution was recorded for 15 minutes.
  • the CM5 surface was regenerated after each cycle using a single injection of 3 M MgCl 2 for 25 seconds at a flow rate of 30 ⁇ l/min. BiaEvaluation software and a Langmuir binding model was used to fit the data.
  • the K D for MABp1 was determined to be less than 2.0 ⁇ 10 10 M.
  • MABp1 Inhibits Tumor Cell Invasion of a basement Membrane Matrix
  • Matrigel (BD), a basement membrane matrix, was thawed at 4° C. overnight and the dilute (5 mg/ml to 1 mg/ml) in serum free cold cell culture media. 100 ul of the diluted matrigel was placed into the upper chambers of a 24-well transwell (Costar) and the transwell was incubated at 37° C. for at least 4 to 5 h for gelling.
  • Tumor cells (MDA-MB-231 and THP-1) were harvested from tissue culture flasks by Trypsin/EDTA, washed with culture media, and resuspended in medium containing 1% FBS at a density of 1 ⁇ 10 6 cells/ml.
  • the gelled matrigel was gently washed with warmed serum free-culture media, and 100 ul of the cell suspension was added in each well.
  • the lower chamber of the transwell was filled with 600 ul of culture media, and the plates was incubated at 37° C. for 12 to 24 h.
  • the cells that did not invade the matrigel were gently scraped off the top of each transwell with a cotton swab.
  • the transwells were then removed from the 24-well plates and stained with crystal violet after fixing the invaded cells with 70% ethanol or methanol.
  • the invaded cells were counted under a light microscope.
  • the percent of cells invading the matrigel was significantly inhibited in the presence of MABp1.
  • Human umbilical vein endothelial cells (HUVEC) (BD Biosciences) were seeded to 24-well plates at 5 ⁇ 10 5 per well in 1 mL of M-200 medium supplemented with low-serum growth supplement (Invitrogen). Cells were allowed to settle for 3-4 hours. Medium was aspirated and a fresh 1 mL of M-200 was added per well. MABp1 was added directly to cells @ 4.26 ⁇ g/mL, co-incubated for 15 minutes at room temperature, and then recombinant human IL-1 ⁇ (rhIL1A, eBioscience) was added to a final concentration of 40 pg/mL. Positive control wells received the addition of IL-1 ⁇ only.
  • rhIL1A human IL-1 ⁇
  • HUVEC cells in the absence of IL-1 ⁇ or the absence of MABp1 served as negative controls. After 17-20 hours incubation at 37° C., 5% CO 2 , cells were lifted from the plates by a non-enzymatic treatment for 20 minutes using CellStripper reagent (Cellgro Mediatech) and then immediately assayed for CD54 (ICAM-1) expression using standard flow cytometry protocols.
  • Staining buffer comprised Dulbecco's PBS supplemented with 2% heat-inactivated fetal bovine serum.
  • MABp1 Blocks Increase in E-Selectin Expression in Endothelial Cells
  • HUVEC cells in 6-well plates were co-cultured overnight with 5 ⁇ 10 6 GPI-IL1A DG44 cells in M-200 medium, either alone, in the presence of 10 ⁇ g/mL MABp1, or in the presence of 10 ⁇ g/mL D5 isotype control Ab.
  • HUVEC monolayers were washed extensively with Dulbecco's PBS and then lifted by non-enzymatic treatment for 20 minutes with CellStripper reagent (Cellgro Mediatech) and then immediately assayed for CD62E (E-selectin) expression using standard flow-cytometry protocols.
  • Staining buffer comprised Dulbecco's PBS supplemented with 2% heat-inactivated fetal bovine serum.
  • PE-conjugated mouse anti-human CD62E mAb eBioscience, clone P2H3
  • a PE-conjugated mouse IgG1k isotype control eBiocience, clone P3
  • Two washes in staining buffer were subsequently performed and then samples were acquired on a FACSCalibur flow cytometer (BD Biosciences). Upregulated E-selectin expression on the surface of HUVEC cells induced by membranous GPI-IL-1 ⁇ was neutralized by MABp1 to baseline levels exhibited by unstimulated HUVEC cells.
  • the MRC-5 cell line derived from fetal human lung fibroblasts, was obtained from the ATCC collection (CCL-171).
  • the IL-1 neutralizing potency of MABp1 was assayed by measuring IL-1A induced release of IL-6 from MRC-5 cells.
  • MRC-5 cells were seeded at 5 ⁇ 10 3 per well to a 96-well plate in 100 microliters of DMEM complete medium. Cells were cultured overnight at 37° C. in a humidified 5% CO 2 incubator. Confluent MRC-5 cells were subsequently cultured another 24 hours with 20 pg/mL of recombinant human IL-1A (rhIL1A, eBioscience) either alone or in the presence of increasing concentrations of MABp1.
  • Negative control cells were not stimulated with rhIL1A. After the 24 hours, supernatants were collected and assayed for IL-6 release using and IL-6 ELISA kit from eBioscience.
  • the IC 50 or concentration of MABp1 required to inhibit 50% of the maximal IL-6 release, was in the range of 0.001-0.01 ⁇ g/mL.
  • MABp 1 Identifies IL-1a+ Cells
  • erythrocytes were then lysed (BD Biosciences PharmLyse solution) at room temperature for 15 minutes, centrifuged at 300 ⁇ g for 5 minutes, and aspirated. Sample pellets were washed three times with 1 mL Hank's balanced salt solution (HBSS) containing 2% heat-inactivated fetal bovine serum. Sample was resuspended in 0.3 mL HBSS+2% FBS and data was acquired on a FACSCalibur flow cytometer and analyzed using CellQuest software. Flow cytometric analysis of human PBMC using MABp1 showed that only 0.2% of PBMC were positive for IL-1 ⁇ .
  • HBSS Hank's balanced salt solution
  • Flow cytometric analysis (as in Example 11) of human PBMC using MABp1 showed a 3.6-fold increase in the percent of PBMC positive for IL-1 ⁇ + in a subject with a sub-clinical infection compared to a normal control.
  • an increase in the percent of PBMC positive for IL-1 ⁇ + in a subject with an inflamed wisdom tooth, an increase in the percent of PBMC positive for IL-1 ⁇ + .
  • a substantial decrease in the number of IL-1 ⁇ + PBMC was observed from 14 to 45 days after removal of the wisdom tooth.
  • IL-1 ⁇ In general, very low levels of IL-1 ⁇ are present in the plasma of human subjects. Because these levels are often beyond the detection threshold of conventional immunoassays, an ELISA with improved sensitivity was developed.
  • exogenous anti-IL-1 ⁇ Ab e.g., MABp1
  • a biological sample being tested e.g., human plasma
  • the latter step can often be omitted.
  • the sample with IL-1a-Ab complexes is then applied to a filter (Amicon centrifugal device) with a molecular weight cutoff of about 100 kDa to separate the IL-1 ⁇ -Ab complexes from molecules in the sample less than the molecular weight cutoff. In one experiment, this resulted in a 50-fold concentration.
  • the processed sample (and dilutions thereof) was then added to wells of a microtiter plate coated with an anti-human IgG capture Ab (2 ug/ml mouse anti-human IgG, Fc-specific, Southern Biotech product code #9042-01). After allowing time to bind the IL-1 ⁇ -Ab complexes in the sample, the wells were washed to remove non-binding material.
  • a labeled anti-human IL-1 ⁇ secondary Ab was then added to the wells (0.2 ug/ml biotin-conjugated monoclonal mouse anti-human IL-1A Ab, clone CRM6, eBioscience catalog #13-7017). After allowing time to bind the IL-1 ⁇ in the wells, the plate was washed and the amount of labeled anti-human IL-1 ⁇ in each well was quantified as an indication of the concentration of IL-1 ⁇ in the sample being tested.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Biotechnology (AREA)
  • Cell Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Zoology (AREA)
  • Microbiology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Wood Science & Technology (AREA)
  • Urology & Nephrology (AREA)
  • Biophysics (AREA)
  • Hematology (AREA)
  • General Engineering & Computer Science (AREA)
  • General Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Analytical Chemistry (AREA)
  • Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Vascular Medicine (AREA)
  • Oncology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Mycology (AREA)

Abstract

Fully human monoclonal Abs includes (i) an antigen-binding variable region that exhibits very high binding affinity for IL-1α and (ii) a constant region that is effective at both activating the complement system though C1q binding and binding to several different Fc receptors.

Description

CROSS-REFERENCE TO RELATED APPLICATIONS
The present application claims the priority of U.S. provisional patent application Ser. Nos. 61/057,586; 61/121,391; and 61/178,350 filed on May 30, 2008; Dec. 10, 2008; and May 14, 2009, respectively.
STATEMENT AS TO FEDERALLY SPONSORED RESEARCH
Not applicable.
FIELD OF THE INVENTION
The invention relates generally to the fields of immunology, inflammation, cancer, vascular disorders, and medicine. More particularly, the invention relates to antibodies (Abs) which specifically bind interleukin-1α(IL-1α) and methods of using such Abs to treat, prevent, or detect a pathology associated with aberrant IL-1α expression.
BACKGROUND
IL-1α is pro-inflammatory cytokine that plays a role in a number of different activities including inflammation, immune responses, tumor metastasis, and hematopoiesis. IgG autoantibodies against IL-1α occur naturally in the general human population and are thought to be beneficial in diseases such as atherosclerosis.
SUMMARY
The invention is based on the development of fully human monoclonal Abs (mAbs) that include (i) an antigen-binding variable region that exhibits very high binding affinity for human IL-1α and (ii) a constant region that is effective at both activating the complement system though C1q binding and binding to several different Fc receptors. The IL-1α specific mAbs described herein was made by replacing the constant region of a human IgG4 mAb having a variable region specific for human IL-1α with the constant region of a human IgG1 mAb.
Accordingly, the invention features a purified human IgG1 mAb that specifically binds to human IL-1α, the mAb including a heavy chain covalently joined to a light chain. The heavy chain can include the amino acid sequence of SEQ ID NO: 9 and the light chain can include the amino acid sequence of SEQ ID NO:11.
Also within the invention is a set of isolated nucleic acids including a first nucleic acid encoding the heavy chain of a human IgG1 mAb that specifically binds to IL-1α, and a second nucleic acid encoding the light chain of the human IgG1 mAb that specifically binds to human IL-1α. The first nucleic acid can encode the amino acid sequence of SEQ ID NO: 9 and the second nucleic acid can encode the amino acid sequence of SEQ ID NO:11. The first nucleic acid can include the nucleotide sequence of SEQ ID NO: 10 and the second nucleic acid can include the nucleotide sequence of SEQ ID NO:12.
In another aspect, the invention features an expression vector including a nucleic acid encoding the amino acid sequence of SEQ ID NO: 9 or SEQ ID NO: 11.
Another feature of the invention is an isolated host cell (e.g. a mammalian cell such as a CHO cell) including set of isolated nucleic acids including a first nucleic acid encoding the heavy chain of a human IgG1 mAb that specifically binds to IL-1α, and a second nucleic acid encoding the light chain of the human IgG1 mAb that specifically binds to human IL-1α. The heavy chain can include the amino acid sequence of SEQ ID NO: 9 and a light chain can include the amino acid sequence of SEQ ID NO:11.
The invention further features a method of killing a cell expressing human IL-1α. This method can include the step of contacting the cell with a purified human IgG1 mAb that specifically binds to human IL-1α.
A method of inhibiting migration of a human cell through a basement membrane matrix is also within the invention. This method can include the step of adding a purified mAb that specifically binds to human IL-1α to a mixture including a basement membrane matrix and the human cell.
Further within the invention is a method of inhibiting an IL-1α-induced increase in ICAM-1 and/or E-selectin expression on the surface of a human endothelial cell. This method can include the step of adding a purified mAb that specifically binds to human IL-1α to a mixture including the endothelial cell and IL-1α.
The invention additionally includes a method of tracking inflammation in a human subject previously subjected to the steps of: obtaining from the subject a first sample of peripheral blood mononuclear cells at a first time; contacting the first sample with a purified mAb that specifically binds to human IL-1α; and determining the percent of cells in the first sample that bind the monoclonal Ab.
This method can include the steps of: (a) obtaining from the subject a second sample of peripheral blood mononuclear cells at a second time; (b) contacting the second sample with the purified mAb that specifically binds to human IL-1α; (c) determining the percent of cells in the second sample that bind the monoclonal Ab; and (d) comparing the percent of cells in the first sample that bind the mAb to the percent of cells in the second sample that bind the monoclonal Ab.
In the foregoing methods, the purified mAb can be a human IgG1 mAb including a heavy chain covalently joined to a light chain, e.g., wherein the heavy chain includes the amino acid sequence of SEQ ID NO: 9 and the light chain includes the amino acid sequence of SEQ ID NO:11.
Another method within the invention features the steps of: (a) enriching a biological sample obtained from a human subject using a filter to separate molecules according to molecular weight into a first fraction including intact IgG complexed with IL-1α and second fraction including molecules less than 100 Kda; and (b) quantifying the amount of IL-1α in the first fraction.
Yet another method within the invention features the steps of: (a) enriching a sample of plasma obtained from a human subject using a filter that separates molecules according to molecular weight into a first fraction including intact IgG complexed with IL-1α and second fraction including molecule less than 100 Kda; (b) adding the first fraction to a substrate including immobilized anti-human IgG Abs under conditions that allow IgG in the first fraction to specifically bind the anti-human IgG Abs immobilized on the substrate; (c) washing the substrate to remove material in the first fraction that does not specifically bind the immobilized anti-human IgG Abs; (d) contacting the substrate washed in step (c) with an Ab that specifically binds human IL-1α under conditions that allows the Ab that specifically binds human IL-1α to specifically bind any human IL-1α bound to the substrate; (e) washing the substrate to remove any of the Ab that specifically binds human IL-1α that is not bound to the substrate; and (f) quantifying the amount of Ab that specifically binds human IL-1α remaining bound to the substrate after step (e).
Unless otherwise defined, all technical terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Commonly understood definitions of biological terms can be found in Rieger et al., Glossary of Genetics: Classical and Molecular, 5th edition, Springer-Verlag: New York, 1991; and Lewin, Genes V, Oxford University Press: New York, 1994.
The term “specifically binds”, as used herein, when referring to a polypeptide (including Abs) or receptor, refers to a binding reaction which is determinative of the presence of the protein or polypeptide or receptor in a heterogeneous population of proteins and other biologics. Thus, under designated conditions (e.g. immunoassay conditions in the case of an Ab), the specified ligand or Ab binds to its particular “target” and does not bind in a significant amount to other proteins present in the sample or to other proteins to which the ligand or Ab may come in contact in an organism. Generally, a first molecule that “specifically binds” a second molecule has an equilibrium affinity constant greater than about 105 (e.g., 106, 107, 108, 109, 1010, 1011, and 1012 or more) liters/mole for that second molecule.
When referring to a protein molecule such as an Ab, “purified” means separated from components that naturally accompany such molecules. Typically, an Ab or protein is purified when it is at least about 10% (e.g., 9%, 10%, 20%, 30% 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.9%, and 100%), by weight, free from the non-Ab proteins or other naturally-occurring organic molecules with which it is naturally associated. Purity can be measured by any appropriate method, e.g., column chromatography, polyacrylamide gel electrophoresis, or HPLC analysis. A chemically-synthesized protein or other recombinant protein produced in a cell type other than the cell type in which it naturally occurs is “purified.”
Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below. All publications mentioned herein are incorporated by reference in their entirety. In the case of conflict, the present specification, including definitions will control. In addition, the particular embodiments discussed below are illustrative only and not intended to be limiting.
DETAILED DESCRIPTION
The invention encompasses compositions and methods relating to fully human mAbs that include (i) an antigen-binding variable region that exhibits very high binding affinity for IL-1α and (ii) a constant region that is effective at both activating the complement system though C1q binding and binding to several different Fc receptors. The below described preferred embodiments illustrate adaptation of these compositions and methods. Nonetheless, from the description of these embodiments, other aspects of the invention can be made and/or practiced based on the description provided below.
Methods involving conventional immunological and molecular biological techniques are described herein. Immunological methods (for example, assays for detection and localization of antigen-Ab complexes, immunoprecipitation, immunoblotting, and the like) are generally known in the art and described in methodology treatises such as Current Protocols in Immunology, Coligan et al., ed., John Wiley & Sons, New York. Techniques of molecular biology are described in detail in treatises such as Molecular Cloning: A Laboratory Manual, 2nd ed., vol. 1-3, Sambrook et al., ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 2001; and Current Protocols in Molecular Biology, Ausubel et al., ed., Greene Publishing and Wiley-Interscience, New York. Ab methods are described in Handbook of Therapeutic Abs, Dubel, S., ed., Wiley-VCH, 2007. Cell culture techniques are generally known in the art and are described in detail in methodology treatises such as Culture of Animal Cells: A Manual of Basic Technique, 4th edition, by R Ian Freshney, Wiley-Liss, Hoboken, N.J., 2000; and General Techniques of Cell Culture, by Maureen A Harrison and Ian F Rae, Cambridge University Press, Cambridge, UK, 1994. Methods of protein purification are discussed in Guide to Protein Purification: Methods in Enzymology, Vol. 182, Deutscher M P, ed., Academic Press, San Diego, Calif., 1990.
In one aspect, the invention features a fully human mAb that includes (i) an antigen-binding variable region that exhibits very high binding affinity for human IL-1α and (ii) a constant region that is effective at both activating the complement system though C1q binding and binding to several different Fc receptors. The human Ab is preferably an IgG1. The Ka of the Ab is preferably at least 1×109 M−1 or greater (e.g., greater than 9×1010 M−1, 8×1010 M−1, 7×1010 M−1, 6×1010 M−1, 5×1010 M−1, 4×1010 M−1, 3×1010 M−1, 2×1010 M−1, or 1×1010 M−1).
Because B lymphocytes which express Ig specific for human IL-1α occur naturally in human beings, a presently preferred method for raising mAbs is to first isolate such a B lymphocyte from a subject and then immortalize it so that it can be continuously replicated in culture. Subjects lacking large numbers of naturally occurring B lymphocytes which express Ig specific for human IL-1α may be immunized with one or more human IL-1α antigens to increase the number of such B lymphocytes. Human mAbs are prepared by immortalizing a human Ab secreting cell (e.g., a human plasma cell). See, e.g., U.S. Pat. No. 4,634,664.
In an exemplary method, one or more (e.g., 5, 10, 25, 50, 100, 1000, or more) human subjects (e.g., subjects not previously administered a human IL-1α vaccine) are screened for the presence of such human IL-1α-specific Ab in their blood. Those subjects that express the desired Ab can then be used as B lymphocyte donors. In one possible method, peripheral blood is obtained from a human donor that possesses B lymphocytes that express human IL-1α-specific Ab. Such B lymphocytes are then isolated from the blood sample, e.g., by cells sorting (e.g., fluorescence activated cell sorting, “FACS”; or magnetic bead cell sorting) to select B lymphocytes expressing human IL-1α-specific Ig. These cells can then be immortalized by viral transformation (e.g., using EBV) or by fusion to another immortalized cell such as a human myeloma according to known techniques. The B lymphocytes within this population that express Ig specific for human IL-1α can then be isolated by limiting dilution methods (e.g., cells in wells of a microtiter plate that are positive for Ig specific for human IL-1α are selected and subcultured, and the process repeated until a desired clonal line can be isolated). See, e.g., Goding, Monoclonal Abs: Principles and Practice, pp. 59-103, Academic Press, 1986. Those clonal cell lines that express Ig having at least nanomolar or picomolar binding affinities for human IL-1α are preferred. MAbs secreted by these clonal cell lines can be purified from the culture medium or a bodily fluid (e.g., ascites) by conventional Ig purification procedures such as salt cuts, size exclusion, ion exchange separation, and affinity chromatography.
Although immortalized B lymphocytes might be used in in vitro cultures to directly produce mAbs, in certain cases it might be desirable to use heterologous expression systems to produce mAbs. See, e.g., the methods described in U.S. patent application Ser. No. 11/754,899. For example, the genes encoding an mAb specific for human IL-1α might be cloned and introduced into an expression vector (e.g., a plasmid-based expression vector) for expression in a heterologous host cell (e.g., CHO cells, COS cells, myeloma cells, and E. coli cells). Because Igs include heavy (H) and light (L) chains in an H2L2 configuration, the genes encoding each may be separately isolated and expressed in different vectors.
Although generally less preferred, chimeric mAbs (e.g., “humanized” mAbs), which are antigen-binding molecules having different portions derived from different animal species (e.g., variable region of a mouse Ig fused to the constant region of a human Ig), might be used in the invention. Such chimeric Abs can be prepared by methods known in the art. E. G., Morrison et al., Proc. Nat'l. Acad. Sci. USA, 81:6851, 1984; Neuberger et al., Nature, 312:604, 1984; Takeda et al., Nature, 314:452, 1984. Similarly, Abs can be humanized by methods known in the art. For example, monoclonal Abs with a desired binding specificity can be commercially humanized or as described in U.S. Pat. Nos. 5,693,762; 5,530,101; or 5,585,089.
The mAbs described herein might be affinity matured to enhance or otherwise alter their binding specificity by known methods such as VH and VL domain shuffling (Marks et al. Bio/Technology 10:779-783, 1992), random mutagenesis of the hypervariable regions (HVRs) and/or framework residues (Barbas et al. Proc Nat. Acad. Sci. USA 91:3809-3813, 1994; Schier et al. Gene 169:147-155, 1995; Yelton et al. J. Immunol. 155:1994-2004, 1995; Jackson et al., J. Immunol. 154(7):3310-9, 1995; and Hawkins et al, J. Mol. Biol. 226:889-896, 1992. Amino acid sequence variants of an Ab may be prepared by introducing appropriate changes into the nucleotide sequence encoding the Ab. In addition, modifications to nucleic acid sequences encoding mAbs might be altered (e.g., without changing the amino acid sequence of the mAb) for enhancing production of the mAb in certain expression systems (e.g., intron elimination and/or codon optimization for a given expression system). The mAbs described herein can also be modified by conjugation to another protein (e.g., another mAb) or non-protein molecule. For example, a mAb might be conjugated to a water soluble polymer such as polyethylene glycol or a carbon nanotube (See, e.g., Kam et al., Proc. Natl. Acad. Sci. USA 102: 11600-11605, 2005). See, U.S. patent application Ser. No. 11/754,899.
Preferably, to ensure that high titers of human IL-1α-specific mAb can be administered to a subject with minimal adverse effects, the mAb compositions of the invention are at least 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 95, 96, 97, 98, 99, 99.9 or more percent by weight pure (excluding any excipients). The mAb compositions of the invention might include only a single type of mAb (i.e., one produced from a single clonal B lymphocyte line) or might include a mixture of two or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10 or more) different types of mAbs. In addition to human IL-1α mAbs, the Ab compositions of the invention might also include other mAbs that specifically bind antigens other than human IL-1α.
To modify or enhance their function, the human IL-1α mAbs might be conjugated another molecule such as a cytotoxin or detectable label. A human IL-1α specific mAb might be conjugated with one or more cytotoxins to more effectively kill cells expressing IL-1α. Cytotoxins for use in the invention can be any cytotoxic agent (e.g., molecule that can kill a cell after contacting the cell) that can be conjugated to a human IL-1α specific mAb. Examples of cytotoxins include, without limitation, radionuclides (e.g., 35S, 14C, 32P, 125I, 131I, 90Y, 89Zr, 201Tl, 186Re, 188Re, 57Cu, 213Bi, and 211At), conjugated radionuclides, and chemotherapeutic agents. Further examples of cytotoxins include, but are not limited to, antimetabolites (e.g., 5-fluorouricil (5-FU), methotrexate (MTX), fludarabine, etc.), anti-microtubule agents (e.g., vincristine, vinblastine, colchicine, taxanes (such as paclitaxel and docetaxel), etc.), alkylating agents (e.g., cyclophasphamide, melphalan, bischloroethylnitrosurea (BCNU), etc.), platinum agents (e.g., cisplatin (also termed cDDP), carboplatin, oxaliplatin, JM-216, CI-973, etc.), anthracyclines (e.g., doxorubicin, daunorubicin, etc.), antibiotic agents (e.g., mitomycin-C), topoisomerase inhibitors (e.g., etoposide, tenoposide, and camptothecins), or other cytotoxic agents such as ricin, diptheria toxin (DT), Pseudomonas exotoxin (PE) A, PE40, abrin, saporin, pokeweed viral protein, ethidium bromide, glucocorticoid, anthrax toxin and others. See, e.g., U.S. Pat. No. 5,932,188.
The human IL-1α specific mAb can also be conjugated to a detectable label. Useful detectable labels in the present invention include biotin or streptavidin, magnetic beads, fluorescent dyes (e.g., fluorescein isothiocyanate, texas red, rhodamine, green fluorescent protein, and the like), radiolabels (e.g., 3H, 125I, 35S, 14C, 32P, 111In, 97Ru, 67Ga, 68Ga, or 72As), radioopaque substances such as metals for radioimaging, paramagnetic agents for magnetic resonance imaging, enzymes (e.g., horseradish peroxidase, alkaline phosphatase and others commonly used in an ELISA), and colorimetric labels such as colloidal gold or colored glass or plastic (e.g., polystyrene, polypropylene, latex, etc.) beads. Means of detecting such labels are well known to those of skill in the art. Thus, for example, radiolabels may be detected using photographic film or scintillation counters. Fluorescent markers may also be used and can be detected using a photodetector to detect emitted illumination. Enzymatic labels are typically detected by providing the enzyme with a substrate and detecting the reaction product produced by the action of the enzyme on the substrate, and colorimetric labels are detected by simply visualizing the colored label.
The present invention also encompasses nucleic acid molecules encoding fully human mAbs specific for human IL-1α. Although the same nucleic acid molecule might encode both the heavy and light chains of a human IL-1α-specific mAb, two different nucleic acid molecules, one encoding the heavy chain and the other encoding the light chain might also be used. The amino acid sequences of three IgG1 mAbs specific for human IL-1α are presented herein. See SEQ ID NOs: 1, 3, 5, 7, 9, and 11. Exemplary nucleic acid molecules encoding these amino acid sequences are also described herein. See SEQ ID NOs: 2, 4, 6, 8, 10, and 12. Any other suitable nucleic acid that encodes the amino acid sequences of the two described IgG1 mAbs or other mAbs within the invention might also be used.
For production of mAbs, the nucleic acid molecules of the invention might be incorporated into an expression vector in an orientation wherein such nucleic acid molecules are operatively linked to expression control sequences such as transcriptional and translational control sequences. Examples of expression vectors include vectors derived from plasmids and vectors derived from viruses such as adenoviruses, adeno-associated viruses, and retroviruses. The nucleic acid molecules encoding a light chain and a heavy chain might be incorporated into a single vector or different vectors. The vectors of the invention might also include regulatory sequences such as promoters and/or enhancers (see, U.S. Pat. No. 5,168,062, U.S. Pat. No. 4,510,245 and U.S. Pat. No. 4,968,615), selectable markers, or sequences encoding affinity tags (for facilitating purification) or a detectable label.
For production of mAbs, the vectors of the invention can be introduced into a suitable host cell, e.g., a prokaryotic cell such as a bacteria or, preferably, a eukaryotic cell such as mammalian, plant, or yeast host cell. Examples of methods for introducing heterologous polynucleotides into host cells include use of viral vectors, electroporation, encapsulation of the polynucleotide(s) in liposomes, dextran-mediated transfection, calcium phosphate precipitation, polybrene-mediated transfection, protoplast fusion, Agrobacterium-mediated transformation, biolistic transformation, and direct microinjection of the DNA into nuclei. Mammalian cell lines are presently preferred for expression of mAbs from vectors. Examples of mammalian host cells include Chinese hamster ovary (CHO) cells (e.g., the DG44 CHO cell line), HeLa cells, baby hamster kidney (BHK) cells, African green monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), NS0 cells, SP2 cells, HEK-293T cells, 293 Freestyle cells, and NIH-3T3 cells. The mAbs of the invention might also be expressed in transgenic animals or plants. See, e.g., U.S. Pat. Nos. 5,827,690; 5,756,687; 5,750,172; 5,741,957; 6,046,037; and 5,959,177.
The invention provides a method for detecting a human IL-1α-expressing cell in a sample by contacting the cell with a human IL-1α-specific mAb and detecting the mAb bound to the cell. The invention also provides a method for killing a human IL-1α-expressing cell by contacting the cell with a human IL-1α-specific mAb. Such killing can be accomplished by complement-mediated killing, Ab-dependent cell-mediated cytotoxicity, or Ab-mediated delivery of a cytotoxin. The Abs described herein have also been shown to be useful for other methods. For example, MABp1 has been to reduce IL-1α induced ICAM1 and E-selectin expression on endothelial cells. MABp1 has also been shown to be used in immunoassays for detecting and quantifying IL-1α in a biological sample.
EXAMPLES Example 1 Cloning of Anti-hIL-1α IgG1 and Kappa Chains
Variable region heavy chain (V-HC) and variable region light chain (V-LC) sequences were gene synthesized using amino acid sequence information provided in U.S. Pat. No. 5,959,085. V-HC was PCR amplified introducing Hindlll/Clal sites upstream of the ATG start codon and a Nhel site at the 3′ end. The human germline IgG1 constant region (including exons and introns) was PCR amplified modifying the two 5′ triplets encoding for the first two amino acids Ala-Ser to an Nhel site, and introducing a BamHI site at the 3′ end. The human germline IgG1 constant region amino acid sequence corresponded to Swiss-Prot entry P01857, except for a K171Q and a V261L exchange. The V-HC and constant IgG1-HC sequence were ligated using the Nhel site and cloned into pcDNA3 using Hindlll and BamHl sites.
>hIL-1a-IgG1-HC
(SEQ ID NO:1)
MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCTASGFTFSM
FGVHWVRQAPGKGLEWVAAVSYDGSNKYYAESVKGRFTISRDNSKNILFL
QMDSLRLEDTAVYYCARGRPKVVIPAPLAHWGQGTLVTFSSASTKGPSVF
PLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC
PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN
WYVDGVEVHNAQTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK
ALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSD
IALEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVKDSRWQQGNVFSCS
VMHEALHNHYTQKSLSLSPGK
>hIL-1a-IgG1-HC
(SEQ ID NO:2)
atggagttcgggctgagttgggtgttcctggtggctctgctgcggggcgt
gcagtgccaggtgcagctggtggagagtgggggtggcgtggtgcagcctg
gccggtctctgcgcctgtcttgcactgcctccggttttaccttttctatg
tttggtgtgcactgggtgcgccaggctcccggcaagggactggaatgggt
ggccgccgtgagttacgacgggtccaacaaatattacgctgagagcgtga
aaggcagattcaccatcagcagagataattccaagaatattctgttcctg
cagatggacagtctgagactggaggacactgctgtgtactactgcgctcg
tggacgccctaaggtggtcatccccgcccccctggcacattggggccagg
gaactctggtgaccttttctagcgctagcaccaagggcccatcggtcttc
cccctggcaccctcctccaagagcacctctgggggcacagcggccctggg
ctgcctggtcaaggactacttccccgaaccggtgacggtgtcgtggaact
caggcgccctgaccagcggcgtccacaccttcccggctgtcctacagtcc
tcaggactctactccctcagcagcgtagtgaccgtgccctccagcagctt
gggcacccagacctacatctgcaacgtgaatcacaagcccagcaacacca
aggtggacaagaaagttgagcccaaatcttgtgacaaaactcacacatgc
ccaccgtgcccagcacctgaactcctggggggaccgtcagtcttcctctt
ccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtca
catgcgtggtggtggacgtgagccacgaagaccctgaggtcaagttcaac
tggtacgtggacggcgtggaggtgcataatgcccagacaaagccgcggga
ggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgc
accaggactggctgaatggcaaggagtacaagtgcaaggtctccaacaaa
gccctcccagcccccatcgagaaaaccatctccaaagccaaagggcagcc
ccgagaaccacaggtgtacaccctgcccccatcccgggatgagctgacca
agaaccaggtcagcctgacctgcctggtcaaaggcttctatcccagcgac
atcgccctggagtgggagagcaatgggcagccggagaacaactacaagac
cacgcctcccgtgctggactccgacggctccttcttcctctacagcaagc
tcaccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctcc
gtgatgcatgaggctctgcacaaccactacacgcagaagagcctctcctt
aagtccgggaaaataa
The V-LC was PCR amplified introducing Hindlll/Clal sites upstream of the ATG start codon and a BsiWI site at the 3′ end. The human constant Kappa-LC sequence was PCR amplified introducing a 5′ BsiWI site encoding an additional Arg and the first amino acids Thr, and a BamHI site at the 3′ end. The human constant Kappa-LC amino acid sequence corresponded to Swiss-Prot entry P01834. V-HC and constant Kappa-LC sequences were ligated using the BsiWI site and cloned into pcDNA3 using HindIII and BamHI sites.
>hIL-1a-K-LC
[SEQ ID NO:3]
MDMRVPAQLLGLLLLWFPGSRCDIQMTQSPSSVSASVGDRVTITCRASQG
ISSWLAWYQQKPGKAPKLLIYEASNLETGVPSRFSGSGSGSDFTLTISSL
QPEDFATYYCQQTSSFLLSFGGGTKVEHRTVAAPSVFIFPPSDEQLKSGT
ASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>hIL-1a-K-LC
[SEQ ID NO:4]
atggacatgcgcgtgcccgcccagctgctggggctgctgctgctgtggtt
ccctggatctaggtgcgacattcagatgacccagtcccccagctcagtgt
cagcctccgtgggcgacagagtgacaatcacctgccgcgcctctcaggga
atctctagttggctggcctggtaccagcagaagcctggaaaggcccccaa
gctgctgatctatgaagcctccaacctggagaccggcgtgccctctcgct
tcagcggctcaggctcaggcagtgattttactctgaccatcagctccctg
cagccagaggatttcgctacttactactgccagcagacctcttccttcct
gctgtccttcgggggaggcacaaaggtggagcaccgtacggtggctgcac
catctgtcttcatcttcccgccatctgatgagcagttgaaatctggaact
gcctctgttgtgtgcctgctgaataacttctatcccagagaggccaaagt
acagtggaaggtggataacgccctccaatcgggtaactcccaggagagtg
tcacagagcaggacagcaaggacagcacctacagcctcagcagcaccctg
acgctgagcaaagcagactacgagaaacacaaagtctacgcctgcgaagt
cacccatcagggcctgagttcaccggtgacaaagagcttcaacaggggag
agtgttag
Example 2 Generation of NATHMAB-hIL-1a IgG1 and Kappa Chain
The complete sequence encoding the NATHMAB-hIL-1a/IgG1 heavy chain was gene synthesized. The V-HC sequence corresponded to the amino acid sequence described in U.S. Pat. No. 5,959,085. The human constant IgG1-HC sequence corresponded to Swiss-Prot entry P01857. The nucleotide sequence was codon optimized for expression in CHO cells. A Kozac sequence (gccacc) was added upstream of the start ATG.
>NATHMAB-hIL-1A-IGG1-HC
[SEQ ID NO:5]
MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCTASGFTFSM
FGVHWVRQAPGKGLEWVAAVSYDGSNKYYAESVKGRFTISRDNSKNILFL
QMDSLRLEDTAVYYCARGRPKVVIPAPLAHWGQGTLVTFSSASTKGPSVF
PLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC
PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN
WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK
ALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSD
IAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
VMHEALHNHYTQKSLSLSPGK
>NATHMAB-hIL-1A-IGG1-HC
[SEQ ID NO:6]
gccaccatggagtttggtctgtcctgggtgttcttggtggctctgctgag
gggggtgcagtgccaggtccagctggtggagtctggtgggggagtggtgc
agcctgggagatctctgcggctgtcttgcactgcctctggtttcactttc
tctatgtttggtgtgcattgggtcaggcaagcaccaggcaaaggactcga
gtgggtcgcagctgtgagctatgacgggtctaacaaatattacgctgagt
ctgtcaagggtaggtttaccatcagccgggataattccaaaaatatcctg
ttcctgcaaatggactctctgaggctggaagatactgcagtctactattg
tgcaagggggaggccaaaggtggtgatccccgctcccctcgctcactggg
gacagggaaccctggtgactttcagctctgctagcaccaagggccctagc
gtgttcccattggctccttcctccaaatctacttctggaggcaccgccgc
cctgggatgtctcgtgaaagattattttcctgagcccgtcaccgtgagct
ggaacagcggcgccctgactagcggcgtgcacacctttcccgcagtgctg
caatctagcgggctgtactccctgagctctgtcgtgaccgtgccctccag
cagcctcggaactcagacctacatctgcaatgtcaatcataaaccctcta
ataccaaagtcgataagaaggtcgaacctaaatcttgcgataaaacccat
acctgccccccttgcccagcacccgaactgctgggcggtccctctgtgtt
tctgttcccccccaaacccaaagataccctgatgatctctaggacccccg
aggtcacttgtgtcgtggtggatgtgtcccacgaagatccagaagtcaaa
ttcaactggtatgtggacggggtcgaagtgcacaacgcaaagaccaagcc
tagggaggaacagtataatagcacatatagggtggtcagcgtcctgaccg
tcctgcatcaggactggctgaatggcaaagaatataagtgtaaagtgtcc
aacaaggccctgccagccccaatcgaaaagacaatctctaaagccaaggg
gcaaccccgggaacctcaggtctatacactgccaccctctcgggatgaac
tgaccaagaatcaggtgagcctgacatgtcttgtgaagggtttttatccc
tccgacattgccgtggagtgggagagcaatggacaaccagaaaataacta
caaaaccacaccccctgtgctggactccgatggttccttcttcctctact
ctaagctgacagtggataagtctaggtggcagcaggggaatgtgttctcc
tgctctgtgatgcacgaggcactgcacaatcattatacacaaaagtctct
gtctctgtctccaggaaagtaa
The complete sequence encoding the NATHMAB-hIL-1a/Kappa light chain was gene synthesized. The V-LC sequence corresponded to the amino acid sequence described in U.S. Pat. No. 5,959,085. The human constant Kappa-LC sequence corresponded to Swiss-Prot entry P01834. The nucleotide sequence was codon optimized for expression in CHO cells. A Kozac sequence (gccacc) was added upstream of ATG.
>NATHMAB-hIL-1A-K-LC
[SEQ ID NO:7]
MDMRVPAQLLGLLLLWFPGSRCDIQMTQSPSSVSASVGDRVTITCRASQG
ISSWLAWYQQKPGKAPKLLIYEASNLETGVPSRFSGSGSGSDFTLTISSL
QPEDFATYYCQQTSSFLLSFGGGTKVEHTVAAPSVFIFPPSDEQLKSGTA
SVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
NATHMAB-hIL-1A-K-LC
[SEQ ID NO:8]
gccaccatggacatgcgcgttcctgcccagctcctcggactgctgctgct
ttggttcccaggctcccggtgtgatattcagatgacacagtctccctcct
ccgtatctgcatccgtgggcgacagggtcacaatcacttgtagggccagc
caggggatctctagttggctcgcatggtaccaacaaaagccaggtaaggc
tccgaaactgctcatttacgaagctagtaacctcgaaacaggcgtgccaa
gccggtttagcggctccggttccggttctgacttcaccctcactatttcc
tccctgcaacctgaggattttgccacatattactgtcagcaaacttcttc
ttttctgctctcctttggtgggggaactaaggtggagcacacagtggccg
cccccagcgtctttatcttccccccaagcgatgaacagctgaagtcaggg
accgccagcgtggtctgcctgctcaataatttttaccctcgcgaggctaa
ggtccaatggaaagtggataacgccctccagagcggtaactctcaggagt
ctgtcacagagcaagacagcaaggatagcacctattccctctccagcacc
ctgacactgtctaaggccgactacgagaaacacaaagtgtacgcttgtga
ggtgactcaccagggactgagtagccctgtgacaaaatctttcaataggg
gagaatgctga
Example 3 Expression of NATHMAB-IL1-a (IgG1/k Subtype)
NATHMAB-IL-1α was expressed and purified using a transient transfection method. Cell culture supernatant or protein G affinity purified Ab was subjected to further analysis as described below. Human embryonic kidney (HEK) 293T cells were cultured in DMEM containing 10% FCS, and transiently transfected using jetPEI reagent (Polyplus) according to manufacturer's protocol. Cells were seeded on 10 cm dishes (3×106 cells per 10 cm dish) 24 h prior to transfection to reach approximately 50% density at the time point of transfection. 5 μg per dish of pcDNA3-anti-hIL-1α-IgG1-HC and a 2-fold molar excess of pcDNA3-anti-hIL-1α-Kappa were used for transfection. After recovery, medium was changed to DMEM containing 2% FCS (10 ml per dish) and Ab was collected for 5 to 6 days. The supernatant was collected, filtered, pH adjusted to 7.5-8, and stored at 4° C. until further use.
Part of the supernatant (250 ml) was incubated with protein G sepharose (GE Healthcare) for 3 h at 4° C. on a rotation wheel. Then, the protein G sepharose was loaded onto a gravity flow column and washed with PBS. Ab was eluted in 1 ml fractions using 100 mM glycine/150 mM NaCl into 100 μl Tris (pH 8), followed by dialysis with PBS containing 10% glycerol. The total protein concentration of each fraction was measured using the BCA Protein Detection Kit (Pierce). Correct size of heavy and light chains, and of the assembled native Ab was confirmed by SDS-PAGE.
Supernatant containing NATHMAB-hIL-1α purified Ab and Triton X-100 cell lysates of producer HEK 293T cells were tested for antigen binding in a radioimmunoassay (RIA) using 125I-hIL-1α. Binding was assayed by absorption to protein G. All samples bound 125I-hIL-1α with highest activity in the eluate. Binding of purified NATHMAB-hIL-1α in a concentration of 0.012% (half-max activity in RIA) to 125I-hIL-1α was used for measuring the affinity coefficient. The Ka of NATHMAB-hIL-1α under these conditions was 3.03×1010 M−1. Back calculation revealed an estimated concentration of approximately 30 μg/ml active anti-hIL-1α-IgG in the purified eluate.
Neutralizing activity of NATHMAB-hIL1α was tested in a bioassay using the murine EL4-6.1 subline which produces high levels of IL-2 when treated with murine or human IL-1α (Zubler et al., J. Immunol. 134:3662-3668, 1985). The indicated concentrations of NATHMAB-hIL-1α (eluate) were incubated for 30 min at 37° C. with various concentrations of recombinant hIL-1α (eBioscience) in a final volume of 100 μl/well in a 96-well culture plate (flat bottomed). Each point was carried out in triplicate and in culture medium (DMEM, 5% FCS). To each well were added 100 μl of a suspension of EL4-6.1 cells (5×105 cells/ml) in culture medium containing 0.2 μg/ml ionomycin. After incubation for 24 h at 37° C. in a 5% CO2 incubator, cell free supernatants were harvested and assayed for IL-2 concentrations using a commercially available ELISA (R&D Systems). The results showed that NATHMAB-IL-1α effectively neutralized hIL-1α-induced IL-2 secretion by EL-4 cells.
To test for neutralization of membrane-bound hIL-1α, the same EL-4 cell-based assay as described above was used with following modifications. Different concentrations of NATHMAB-hIL-1α (eluate) were incubated with various numbers of human activated monocytes. For monocyte preparation, PBMC were isolated from buffy coat using Ficoll-Paque centrifugation. Monocytes were allowed to adhere for 1.5 h at 37° C. in RPMI on plastic dishes. Non-adherent lymphocytes were washed away to yield a nearly pure monocyte culture. Monocytes were cultured in RPMI containing Gln, Pyr, and 10% FCS for 24 h with LPS (1 μg/ml) at 37° C. in a 5% CO2 incubator. Cells were detached with PBS/2 mM EDTA, carefully scraped from plates, and transferred into Falcon tubes. Cells were washed twice with PBS, resuspended in PBS/1% PFA and fixed for 10 min at 20° C. Cells were washed with glycine buffer (150 mM glycine, 75 mM NaCl, pH 7.4), then with culture medium and counted. The results showed that NATHMAB-hIL-1α effectively neutralized IL-2 secretion by EL-4 cells induced by membrane-bound hIL-1α. In an experiment similar to that described above, NATHMAB-hIL-1α was tested for neutralization of murine IL-1α. Indicated amounts of NATHMAB-hIL-1α supernatant were incubated with recombinant human (h) or murine (m) IL-1α (eBioscience). The supernatant containing the Ab neutralized human, but not murine, IL-1α.
Example 4 Ab-Mediated Killing of Cancer Cells
Human peripheral blood mononuclear cells (PBMC) isolated from the buffy coat by standard Ficoll Paque preparation were incubated in either RPMI-1640 CM or RPMI-1640-CM containing rhIL-2 (30 ng/ml, ebioscience) at 37° C. and 5% CO2 overnight and used as effector cells (E). THP1 cells were used as the targets (T). The assay was carried out in 96-well plates with each point in triplicate. After 1×104 targets that were incubated with different concentration of MABp1 for 15 mins, effector cells were added in an ET ratio of 25:1 and 50:1 to 1×104 targets and incubated for another 4 hours. 75 ul of assay volume were transferred to a new 96-well plate and cytotoxicity was assayed using the LDH cytotoxicity detection kit (Roche) according to manufacturer's protocol. % specific lysis=(mean experimental release-mean spontaneous release without antibody)×100/(mean maximal release from targets-mean spontaneous release from targets) A. untreated PBMC were used as effector cells. B. rhIL-2-treated PBMC were used as effector cells. In both cases, increasing concentrations (1.25 to 20 ug/ml) of MABp1 resulted in increased target cell killing (up to about 90%) at both ET ratios.
Example 5 Human Anti-IL1α Specific mAb Sequences
The complete sequence encoding for another human anti-hIL-1aIgG1/Kappa light chain specific for human IL1α (MABp1) was synthesized and expressed as described above. In the nucleic acids encoding the heavy and light chains, a Kozac sequence (gccacc) was added upstream of the start ATG.
Heavy Chain
[SEQ ID NO:9]
MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCTASGFTFSM
FGVHWVRQAPGKGLEWVAAVSYDGSNKYYAESVKGRFTISRDNSKNILFL
QMDSLRLEDTAVYYCARGRPKVVIPAPLAHWGQGTLVTFSSASTKGPSVF
PLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTC
PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN
WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK
ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSD
IAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
VMHEALHNHYTQKSLSLSPGK
[SEQ ID NO:10]
gccaccatggagtttggtctgtcctgggtgttcttggtggctctgctgag
gggggtgcagtgccaggtccagctggtggagtctggtgggggagtggtgc
agcctgggagatctctgcggctgtcttgcactgcctctggtttcactttc
tctatgtttggtgtgcattgggtcaggcaagcaccaggcaaaggactcga
gtgggtcgcagctgtgagctatgacgggtctaacaaatattacgctgagt
ctgtcaagggtaggtttaccatcagccgggataattccaaaaatatcctg
ttcctgcaaatggactctctgaggctggaagatactgcagtctactattg
tgcaagggggaggccaaaggtggtgatccccgctcccctcgctcactggg
gacagggaaccctggtgactttcagctctgctagcaccaagggccctagc
gtgttcccattggctccttcctccaaatctacttctggaggcaccgccgc
cctgggatgtctcgtgaaagattattttcctgagcccgtcaccgtgagct
ggaacagcggcgccctgactagcggcgtgcacacctttcccgcagtgctg
caatctagcgggctgtactccctgagctctgtcgtgaccgtgccctccag
cagcctcggaactcagacctacatctgcaatgtcaatcataaaccctcta
ataccaaagtcgataagagggtcgaacctaaatcttgcgataaaacccat
acctgccccccttgcccagcacccgaactgctgggcggtccctctgtgtt
tctgttcccccccaaacccaaagataccctgatgatctctaggacccccg
aggtcacttgtgtcgtggtggatgtgtcccacgaagatccagaagtcaaa
ttcaactggtatgtggacggggtcgaagtgcacaacgcaaagaccaagcc
tagggaggaacagtataatagcacatatagggtggtcagcgtcctgaccg
tcctgcatcaggactggctgaatggcaaagaatataagtgtaaagtgtcc
aacaaggccctgccagccccaatcgaaaagacaatctctaaagccaaggg
gcaaccccgggaacctcaggtctatacactgccaccctctcgggaggaaa
tgaccaagaatcaggtgagcctgacatgtcttgtgaagggtttttatccc
tccgacattgccgtggagtgggagagcaatggacaaccagaaaataacta
caaaaccacaccccctgtgctggactccgatggttccttcttcctctact
ctaagctgacagtggataagtctaggtggcagcaggggaatgtgttctcc
tgctctgtgatgcacgaggcactgcacaatcattatacacaaaagtctct
gtctctgtctccaggaaagtaa

Light Chain
[SEQ ID NO:11]
MDMRVPAQLLGLLLLWFPGSRCDIQMTQSPSSVSASVGDRVTITCRASQG
ISSWLAWYQQKPGKAPKLLIYEASNLETGVPSRFSGSGSGSDFTLTISSL
QPEDFATYYCQQTSSFLLSFGGGTKVEHKRTVAAPSVFIFPPSDEQLKSG
TASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST
LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
[SEQ ID NO:12]
gccaccatggacatgcgcgttcctgcccagctcctcggactgctgctgct
ttggttcccaggctcccggtgtgatattcagatgacacagtctccctcct
ccgtatctgcatccgtgggcgacagggtcacaatcacttgtagggccagc
caggggatctctagttggctcgcatggtaccaacaaaagccaggtaaggc
tccgaaactgctcatttacgaagctagtaacctcgaaacaggcgtgccaa
gccggtttagcggctccggttccggttctgacttcaccctcactatttcc
tccctgcaacctgaggattttgccacatattactgtcagcaaacttcttc
ttttctgctctcctttggtggaggaactaaggtggagcacaagcggacag
ttgctgctcctagcgtctttatcttccctccaagcgatgaacagctgaag
tcagggaccgccagcgtggtctgcctgctcaataatttttaccctcgcga
ggctaaggtccaatggaaagtggataacgccctccagagcggtaactctc
aggagtctgtcacagagcaagacagcaaggatagcacctattccctctcc
agcaccctgacactgtctaaggccgactacgagaaacacaaagtgtacgc
ttgtgaggtgactcaccagggactgagtagccctgtgacaaaatctttca
ataggggagaatgctga
Example 6 MABp1 Binding Affinity
The binding affinity of purified MABp1 was determined using surface plasmon resonanace (SPR) on a BIAcore 2000 instrument (GE Health Sciences). A mouse monoclonal anti-human IgG (Fc) Ab was covalently immobilized on the flow cells of a CM5 sensor chip using a human Ab capture kit and amine coupling kit (GE Health Sciences). Immobilization levels of 8000-14000 RU would typically be achieved. After immobilization of the mouse anti-human IgG (Fc) capture Ab, three start-up cycles with HBS-EP running buffer (GE Health Sciences) and two start-up cycles with MABp1 were run to stabilize the CM5 surface and to remove any non-covalently bound Ab. For analysis, MABp1 Ab was diluted into HBS-EP running buffer to a final concentration of 1 μg/mL and immobilized to 700 RU on one flow cell of the CM5 sensor chip. Carrier-free human IL-1A cytokine (eBioscience, #34-8019) was serially diluted in HBS-EP running buffer over a test range from 100 nM to 0.05 nM. Flow rate was 30 μl/min. Dissociation data for each cytokine dilution was recorded for 15 minutes. The CM5 surface was regenerated after each cycle using a single injection of 3 M MgCl2 for 25 seconds at a flow rate of 30 μl/min. BiaEvaluation software and a Langmuir binding model was used to fit the data. The KD for MABp1 was determined to be less than 2.0×1010 M.
Example 7 MABp1 Inhibits Tumor Cell Invasion of a Basement Membrane Matrix
Matrigel (BD), a basement membrane matrix, was thawed at 4° C. overnight and the dilute (5 mg/ml to 1 mg/ml) in serum free cold cell culture media. 100 ul of the diluted matrigel was placed into the upper chambers of a 24-well transwell (Costar) and the transwell was incubated at 37° C. for at least 4 to 5 h for gelling. Tumor cells (MDA-MB-231 and THP-1) were harvested from tissue culture flasks by Trypsin/EDTA, washed with culture media, and resuspended in medium containing 1% FBS at a density of 1×106 cells/ml. The gelled matrigel was gently washed with warmed serum free-culture media, and 100 ul of the cell suspension was added in each well. The lower chamber of the transwell was filled with 600 ul of culture media, and the plates was incubated at 37° C. for 12 to 24 h. The cells that did not invade the matrigel were gently scraped off the top of each transwell with a cotton swab. The transwells were then removed from the 24-well plates and stained with crystal violet after fixing the invaded cells with 70% ethanol or methanol. The invaded cells were counted under a light microscope. The percent of cells invading the matrigel was significantly inhibited in the presence of MABp1.
Example 8 MABp1 Blocks Increase in ICAM1 Expression in Endothelial Cells
Human umbilical vein endothelial cells (HUVEC) (BD Biosciences) were seeded to 24-well plates at 5×105 per well in 1 mL of M-200 medium supplemented with low-serum growth supplement (Invitrogen). Cells were allowed to settle for 3-4 hours. Medium was aspirated and a fresh 1 mL of M-200 was added per well. MABp1 was added directly to cells @ 4.26 μg/mL, co-incubated for 15 minutes at room temperature, and then recombinant human IL-1α (rhIL1A, eBioscience) was added to a final concentration of 40 pg/mL. Positive control wells received the addition of IL-1α only. HUVEC cells in the absence of IL-1α or the absence of MABp1 served as negative controls. After 17-20 hours incubation at 37° C., 5% CO2, cells were lifted from the plates by a non-enzymatic treatment for 20 minutes using CellStripper reagent (Cellgro Mediatech) and then immediately assayed for CD54 (ICAM-1) expression using standard flow cytometry protocols. Staining buffer comprised Dulbecco's PBS supplemented with 2% heat-inactivated fetal bovine serum. PE-conjugated mouse anti-human CD54 (ICAM-1) mAb (eBioscience, clone HA58) or a PE-conjugated mouse IgG1k isotype control (eBiocience, #12-4714) were used per manufacturer's instructions to stain HUVEC cells in a 100 microliter staining volume for 20 minutes in the dark at room temperature. Two washes in staining buffer were subsequently performed and then samples were acquired on a FACSCalibur flow cytometer (BD Biosciences). Among several independent experiments (n=5) the upregulation of ICAM-1 adhesion molecules induced by rhIL1A on the surface of HUVEC cells was neutralized by MABp1 to baseline levels exhibited by the unstimulated HUVEC cells.
Example 9 MABp1 Blocks Increase in E-Selectin Expression in Endothelial Cells
Similar to its effects on ICAM-1 induction, MABp1-mediated neutralization of induction of CD62E (E-selectin) on HUVEC cells was also observed. This effect was most pronounced when HUVEC cells were stimulated not by soluble rhIL-1α but by membranous IL-1α anchored by glycosyl-phosphatidylinositol to the surface of DG44 CHO cells (GPI-IL1A cells). In this experiment, confluent cultures of HUVEC cells in 6-well plates were co-cultured overnight with 5×106 GPI-IL1A DG44 cells in M-200 medium, either alone, in the presence of 10 μg/mL MABp1, or in the presence of 10 μg/mL D5 isotype control Ab. After 17-20 hours, HUVEC monolayers were washed extensively with Dulbecco's PBS and then lifted by non-enzymatic treatment for 20 minutes with CellStripper reagent (Cellgro Mediatech) and then immediately assayed for CD62E (E-selectin) expression using standard flow-cytometry protocols. Staining buffer comprised Dulbecco's PBS supplemented with 2% heat-inactivated fetal bovine serum. PE-conjugated mouse anti-human CD62E mAb (eBioscience, clone P2H3) or a PE-conjugated mouse IgG1k isotype control (eBiocience, clone P3) were used per manufacturer's instructions to stain HUVEC cells in a 100 microliter staining volume for 20 minutes in the dark at room temperature. Two washes in staining buffer were subsequently performed and then samples were acquired on a FACSCalibur flow cytometer (BD Biosciences). Upregulated E-selectin expression on the surface of HUVEC cells induced by membranous GPI-IL-1α was neutralized by MABp1 to baseline levels exhibited by unstimulated HUVEC cells.
Example 10 MRC-5 Bioassay for MABp1 Potency (Neutralization of rhIL1A)
The MRC-5 cell line, derived from fetal human lung fibroblasts, was obtained from the ATCC collection (CCL-171). The IL-1 neutralizing potency of MABp1 was assayed by measuring IL-1A induced release of IL-6 from MRC-5 cells. MRC-5 cells were seeded at 5×103 per well to a 96-well plate in 100 microliters of DMEM complete medium. Cells were cultured overnight at 37° C. in a humidified 5% CO2 incubator. Confluent MRC-5 cells were subsequently cultured another 24 hours with 20 pg/mL of recombinant human IL-1A (rhIL1A, eBioscience) either alone or in the presence of increasing concentrations of MABp1. Negative control cells were not stimulated with rhIL1A. After the 24 hours, supernatants were collected and assayed for IL-6 release using and IL-6 ELISA kit from eBioscience. The IC50, or concentration of MABp1 required to inhibit 50% of the maximal IL-6 release, was in the range of 0.001-0.01 μg/mL.
Example 11 MABp 1 Identifies IL-1a+ Cells
One hundred microliters of sodium heparin anti-coagulated whole blood was aliquoted to polystyrene FACS tubes. Samples were incubated at room temperature for 15 minutes with 1 mg of human IgG (protein-A purified) plus 2 ml of heat-inactivated fetal bovine serum to block Fc receptors. Primary Abs were then added to the sample: Either 1 mg of Alexa-488 labeled MABp1, 1 mg of FITC-labeled monoclonal anti-membrane human IL1A Ab (FAB200F, R&D Systems), or 1 mg of a murine isotype control (IC002F, R&D Systems). Primary Abs were incubated with sample for 30 minutes at room temperature in the dark. Sample erythrocytes were then lysed (BD Biosciences PharmLyse solution) at room temperature for 15 minutes, centrifuged at 300×g for 5 minutes, and aspirated. Sample pellets were washed three times with 1 mL Hank's balanced salt solution (HBSS) containing 2% heat-inactivated fetal bovine serum. Sample was resuspended in 0.3 mL HBSS+2% FBS and data was acquired on a FACSCalibur flow cytometer and analyzed using CellQuest software. Flow cytometric analysis of human PBMC using MABp1 showed that only 0.2% of PBMC were positive for IL-1α.
Example 12 MABp1 for Detecting and Tracking Infections and Inflammation
Flow cytometric analysis (as in Example 11) of human PBMC using MABp1 showed a 3.6-fold increase in the percent of PBMC positive for IL-1α+ in a subject with a sub-clinical infection compared to a normal control. Similarly, in a subject with an inflamed wisdom tooth, an increase in the percent of PBMC positive for IL-1α+. A substantial decrease in the number of IL-1α+ PBMC was observed from 14 to 45 days after removal of the wisdom tooth.
Example 13 Immunoassay for Detecting and/or Quantifying IL-1α
In general, very low levels of IL-1α are present in the plasma of human subjects. Because these levels are often beyond the detection threshold of conventional immunoassays, an ELISA with improved sensitivity was developed. In this ELISA, exogenous anti-IL-1α Ab (e.g., MABp1) can be added to a biological sample being tested (e.g., human plasma) under conditions that allow the Ab to bind IL-1α in the sample. Because, it was observed that almost all IL-1α in human plasma samples exists already bound to endogenous anti-IL-1α Ab, the latter step can often be omitted. The sample with IL-1a-Ab complexes is then applied to a filter (Amicon centrifugal device) with a molecular weight cutoff of about 100 kDa to separate the IL-1α-Ab complexes from molecules in the sample less than the molecular weight cutoff. In one experiment, this resulted in a 50-fold concentration. The processed sample (and dilutions thereof) was then added to wells of a microtiter plate coated with an anti-human IgG capture Ab (2 ug/ml mouse anti-human IgG, Fc-specific, Southern Biotech product code #9042-01). After allowing time to bind the IL-1α-Ab complexes in the sample, the wells were washed to remove non-binding material. A labeled anti-human IL-1α secondary Ab was then added to the wells (0.2 ug/ml biotin-conjugated monoclonal mouse anti-human IL-1A Ab, clone CRM6, eBioscience catalog #13-7017). After allowing time to bind the IL-1α in the wells, the plate was washed and the amount of labeled anti-human IL-1α in each well was quantified as an indication of the concentration of IL-1α in the sample being tested.
Other Embodiments
It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.

Claims (1)

1. A purified human IgG1 monoclonal antibody that specifically binds to human interleukin-1 alpha, the monoclonal antibody comprising a heavy chain covalently joined to a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 9 and the light chain comprises the amino acid sequence of SEQ ID NO:11.
US12/455,458 2008-05-30 2009-06-01 Interleukin-1α antibodies Active 2030-01-12 US8034337B2 (en)

Priority Applications (14)

Application Number Priority Date Filing Date Title
US12/455,458 US8034337B2 (en) 2008-05-30 2009-06-01 Interleukin-1α antibodies
US13/225,029 US8962814B2 (en) 2008-05-30 2011-09-02 Interleukin-1α antibodies and methods of use
US13/224,943 US8388956B2 (en) 2008-05-30 2011-09-02 Interleukin-1 alpha antibodies and methods of use
US13/224,913 US8388969B2 (en) 2008-05-30 2011-09-02 Interleukin-1 alpha antibodies and methods of use
US13/225,004 US20120164665A1 (en) 2008-05-30 2011-09-02 Interleukin-1 Alpha Antibodies and Methods of Use
US13/224,975 US20120021512A1 (en) 2008-05-30 2011-09-02 Interleukin-1 Alpha Antibodies and Methods of Use
US13/762,453 US8679489B2 (en) 2008-05-30 2013-02-08 Inhibiting cell migration
US13/767,292 US8784817B2 (en) 2008-05-30 2013-02-14 Method for killing IL-1 alpha expressing cells
US14/177,892 US8956831B2 (en) 2008-05-30 2014-02-11 Nucleic acids encoding a human monoclonal antibody that specifically binds to IL-1α
US14/567,072 US9181338B2 (en) 2008-05-30 2014-12-11 Human antibody specific for IL-1alpha
US14/877,964 US9840558B2 (en) 2008-05-30 2015-10-08 Human antibody specific for interleukin-1alpha
US15/789,774 US10899833B2 (en) 2008-05-30 2017-10-20 Human antibody specific for interleukin-1 alpha
US17/154,137 US20210171623A1 (en) 2008-05-30 2021-01-21 Human antibody specific for interleukin-1alpha
US18/483,270 US20240034781A1 (en) 2008-05-30 2023-10-09 Human antibody specific for interleukin-1alpha

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US5758608P 2008-05-30 2008-05-30
US12139108P 2008-12-10 2008-12-10
US17835009P 2009-05-14 2009-05-14
US12/455,458 US8034337B2 (en) 2008-05-30 2009-06-01 Interleukin-1α antibodies

Related Child Applications (5)

Application Number Title Priority Date Filing Date
US13/225,004 Division US20120164665A1 (en) 2008-05-30 2011-09-02 Interleukin-1 Alpha Antibodies and Methods of Use
US13/224,913 Division US8388969B2 (en) 2008-05-30 2011-09-02 Interleukin-1 alpha antibodies and methods of use
US13/225,029 Division US8962814B2 (en) 2008-05-30 2011-09-02 Interleukin-1α antibodies and methods of use
US13/224,943 Division US8388956B2 (en) 2008-05-30 2011-09-02 Interleukin-1 alpha antibodies and methods of use
US13/224,975 Division US20120021512A1 (en) 2008-05-30 2011-09-02 Interleukin-1 Alpha Antibodies and Methods of Use

Publications (2)

Publication Number Publication Date
US20090298096A1 US20090298096A1 (en) 2009-12-03
US8034337B2 true US8034337B2 (en) 2011-10-11

Family

ID=41380314

Family Applications (14)

Application Number Title Priority Date Filing Date
US12/455,458 Active 2030-01-12 US8034337B2 (en) 2008-05-30 2009-06-01 Interleukin-1α antibodies
US13/224,943 Active US8388956B2 (en) 2008-05-30 2011-09-02 Interleukin-1 alpha antibodies and methods of use
US13/224,913 Active US8388969B2 (en) 2008-05-30 2011-09-02 Interleukin-1 alpha antibodies and methods of use
US13/225,004 Abandoned US20120164665A1 (en) 2008-05-30 2011-09-02 Interleukin-1 Alpha Antibodies and Methods of Use
US13/224,975 Abandoned US20120021512A1 (en) 2008-05-30 2011-09-02 Interleukin-1 Alpha Antibodies and Methods of Use
US13/225,029 Active 2030-03-17 US8962814B2 (en) 2008-05-30 2011-09-02 Interleukin-1α antibodies and methods of use
US13/762,453 Active US8679489B2 (en) 2008-05-30 2013-02-08 Inhibiting cell migration
US13/767,292 Active US8784817B2 (en) 2008-05-30 2013-02-14 Method for killing IL-1 alpha expressing cells
US14/177,892 Active US8956831B2 (en) 2008-05-30 2014-02-11 Nucleic acids encoding a human monoclonal antibody that specifically binds to IL-1α
US14/567,072 Active US9181338B2 (en) 2008-05-30 2014-12-11 Human antibody specific for IL-1alpha
US14/877,964 Active 2029-08-23 US9840558B2 (en) 2008-05-30 2015-10-08 Human antibody specific for interleukin-1alpha
US15/789,774 Active 2029-07-06 US10899833B2 (en) 2008-05-30 2017-10-20 Human antibody specific for interleukin-1 alpha
US17/154,137 Abandoned US20210171623A1 (en) 2008-05-30 2021-01-21 Human antibody specific for interleukin-1alpha
US18/483,270 Pending US20240034781A1 (en) 2008-05-30 2023-10-09 Human antibody specific for interleukin-1alpha

Family Applications After (13)

Application Number Title Priority Date Filing Date
US13/224,943 Active US8388956B2 (en) 2008-05-30 2011-09-02 Interleukin-1 alpha antibodies and methods of use
US13/224,913 Active US8388969B2 (en) 2008-05-30 2011-09-02 Interleukin-1 alpha antibodies and methods of use
US13/225,004 Abandoned US20120164665A1 (en) 2008-05-30 2011-09-02 Interleukin-1 Alpha Antibodies and Methods of Use
US13/224,975 Abandoned US20120021512A1 (en) 2008-05-30 2011-09-02 Interleukin-1 Alpha Antibodies and Methods of Use
US13/225,029 Active 2030-03-17 US8962814B2 (en) 2008-05-30 2011-09-02 Interleukin-1α antibodies and methods of use
US13/762,453 Active US8679489B2 (en) 2008-05-30 2013-02-08 Inhibiting cell migration
US13/767,292 Active US8784817B2 (en) 2008-05-30 2013-02-14 Method for killing IL-1 alpha expressing cells
US14/177,892 Active US8956831B2 (en) 2008-05-30 2014-02-11 Nucleic acids encoding a human monoclonal antibody that specifically binds to IL-1α
US14/567,072 Active US9181338B2 (en) 2008-05-30 2014-12-11 Human antibody specific for IL-1alpha
US14/877,964 Active 2029-08-23 US9840558B2 (en) 2008-05-30 2015-10-08 Human antibody specific for interleukin-1alpha
US15/789,774 Active 2029-07-06 US10899833B2 (en) 2008-05-30 2017-10-20 Human antibody specific for interleukin-1 alpha
US17/154,137 Abandoned US20210171623A1 (en) 2008-05-30 2021-01-21 Human antibody specific for interleukin-1alpha
US18/483,270 Pending US20240034781A1 (en) 2008-05-30 2023-10-09 Human antibody specific for interleukin-1alpha

Country Status (23)

Country Link
US (14) US8034337B2 (en)
EP (3) EP3705135A1 (en)
JP (5) JP5670318B2 (en)
KR (3) KR20150127300A (en)
CN (4) CN102112154B (en)
AU (1) AU2009255670B2 (en)
BR (1) BRPI0909610B1 (en)
CA (2) CA2726345C (en)
CO (1) CO6351749A2 (en)
DK (1) DK2285409T3 (en)
ES (2) ES2797126T3 (en)
HU (1) HUE029003T2 (en)
IL (5) IL209576A (en)
MX (1) MX2010012963A (en)
MY (1) MY154067A (en)
NZ (1) NZ590033A (en)
PH (1) PH12014501773B1 (en)
PL (2) PL3085773T3 (en)
PT (1) PT2285409T (en)
RU (2) RU2498998C2 (en)
SI (1) SI2285409T1 (en)
WO (1) WO2009148575A1 (en)
ZA (1) ZA201009224B (en)

Cited By (435)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110311547A1 (en) * 2010-06-18 2011-12-22 Xbiotech, Inc. Arthritis Treatment
US8664367B2 (en) 2010-05-14 2014-03-04 Abbvie, Inc. IL-I binding proteins
CN104684929A (en) * 2012-10-04 2015-06-03 埃克斯生物科技公司 Treatment of vascular disease and its complications
US10149682B2 (en) 2010-09-30 2018-12-11 Ethicon Llc Stapling system including an actuation system
US10149680B2 (en) 2013-04-16 2018-12-11 Ethicon Llc Surgical instrument comprising a gap setting system
US10159483B2 (en) 2015-02-27 2018-12-25 Ethicon Llc Surgical apparatus configured to track an end-of-life parameter
US10172616B2 (en) 2006-09-29 2019-01-08 Ethicon Llc Surgical staple cartridge
US10172620B2 (en) 2015-09-30 2019-01-08 Ethicon Llc Compressible adjuncts with bonding nodes
US10180463B2 (en) 2015-02-27 2019-01-15 Ethicon Llc Surgical apparatus configured to assess whether a performance parameter of the surgical apparatus is within an acceptable performance band
US10188385B2 (en) 2014-12-18 2019-01-29 Ethicon Llc Surgical instrument system comprising lockable systems
US10201364B2 (en) 2014-03-26 2019-02-12 Ethicon Llc Surgical instrument comprising a rotatable shaft
US10201363B2 (en) 2006-01-31 2019-02-12 Ethicon Llc Motor-driven surgical instrument
US10201349B2 (en) 2013-08-23 2019-02-12 Ethicon Llc End effector detection and firing rate modulation systems for surgical instruments
US10206677B2 (en) 2014-09-26 2019-02-19 Ethicon Llc Surgical staple and driver arrangements for staple cartridges
US10206678B2 (en) 2006-10-03 2019-02-19 Ethicon Llc Surgical stapling instrument with lockout features to prevent advancement of a firing assembly unless an unfired surgical staple cartridge is operably mounted in an end effector portion of the instrument
US10206605B2 (en) 2015-03-06 2019-02-19 Ethicon Llc Time dependent evaluation of sensor data to determine stability, creep, and viscoelastic elements of measures
US10206676B2 (en) 2008-02-14 2019-02-19 Ethicon Llc Surgical cutting and fastening instrument
US10211586B2 (en) 2017-06-28 2019-02-19 Ethicon Llc Surgical shaft assemblies with watertight housings
US10213262B2 (en) 2006-03-23 2019-02-26 Ethicon Llc Manipulatable surgical systems with selectively articulatable fastening device
US10213201B2 (en) 2015-03-31 2019-02-26 Ethicon Llc Stapling end effector configured to compensate for an uneven gap between a first jaw and a second jaw
US10226249B2 (en) 2013-03-01 2019-03-12 Ethicon Llc Articulatable surgical instruments with conductive pathways for signal communication
US10231794B2 (en) 2011-05-27 2019-03-19 Ethicon Llc Surgical stapling instruments with rotatable staple deployment arrangements
US10238386B2 (en) 2015-09-23 2019-03-26 Ethicon Llc Surgical stapler having motor control based on an electrical parameter related to a motor current
US10238391B2 (en) 2013-03-14 2019-03-26 Ethicon Llc Drive train control arrangements for modular surgical instruments
US10245032B2 (en) 2005-08-31 2019-04-02 Ethicon Llc Staple cartridges for forming staples having differing formed staple heights
US10245033B2 (en) 2015-03-06 2019-04-02 Ethicon Llc Surgical instrument comprising a lockable battery housing
US10245030B2 (en) 2016-02-09 2019-04-02 Ethicon Llc Surgical instruments with tensioning arrangements for cable driven articulation systems
US10245035B2 (en) 2005-08-31 2019-04-02 Ethicon Llc Stapling assembly configured to produce different formed staple heights
US10245027B2 (en) 2014-12-18 2019-04-02 Ethicon Llc Surgical instrument with an anvil that is selectively movable about a discrete non-movable axis relative to a staple cartridge
US10258418B2 (en) 2017-06-29 2019-04-16 Ethicon Llc System for controlling articulation forces
US10258330B2 (en) 2010-09-30 2019-04-16 Ethicon Llc End effector including an implantable arrangement
US10258331B2 (en) 2016-02-12 2019-04-16 Ethicon Llc Mechanisms for compensating for drivetrain failure in powered surgical instruments
US10258333B2 (en) 2012-06-28 2019-04-16 Ethicon Llc Surgical fastening apparatus with a rotary end effector drive shaft for selective engagement with a motorized drive system
US10265068B2 (en) 2015-12-30 2019-04-23 Ethicon Llc Surgical instruments with separable motors and motor control circuits
US10265074B2 (en) 2010-09-30 2019-04-23 Ethicon Llc Implantable layers for surgical stapling devices
US10271849B2 (en) 2015-09-30 2019-04-30 Ethicon Llc Woven constructs with interlocked standing fibers
US10271846B2 (en) 2005-08-31 2019-04-30 Ethicon Llc Staple cartridge for use with a surgical stapler
US10278780B2 (en) 2007-01-10 2019-05-07 Ethicon Llc Surgical instrument for use with robotic system
US10278702B2 (en) 2004-07-28 2019-05-07 Ethicon Llc Stapling system comprising a firing bar and a lockout
US10293100B2 (en) 2004-07-28 2019-05-21 Ethicon Llc Surgical stapling instrument having a medical substance dispenser
US10292704B2 (en) 2015-12-30 2019-05-21 Ethicon Llc Mechanisms for compensating for battery pack failure in powered surgical instruments
US10299787B2 (en) 2007-06-04 2019-05-28 Ethicon Llc Stapling system comprising rotary inputs
US10299792B2 (en) 2014-04-16 2019-05-28 Ethicon Llc Fastener cartridge comprising non-uniform fasteners
US10299878B2 (en) 2015-09-25 2019-05-28 Ethicon Llc Implantable adjunct systems for determining adjunct skew
US10307163B2 (en) 2008-02-14 2019-06-04 Ethicon Llc Detachable motor powered surgical instrument
US10307170B2 (en) 2017-06-20 2019-06-04 Ethicon Llc Method for closed loop control of motor velocity of a surgical stapling and cutting instrument
US10314589B2 (en) 2006-06-27 2019-06-11 Ethicon Llc Surgical instrument including a shifting assembly
USD851762S1 (en) 2017-06-28 2019-06-18 Ethicon Llc Anvil
US10327769B2 (en) 2015-09-23 2019-06-25 Ethicon Llc Surgical stapler having motor control based on a drive system component
US10327767B2 (en) 2017-06-20 2019-06-25 Ethicon Llc Control of motor velocity of a surgical stapling and cutting instrument based on angle of articulation
US10335148B2 (en) 2010-09-30 2019-07-02 Ethicon Llc Staple cartridge including a tissue thickness compensator for a surgical stapler
US10335145B2 (en) 2016-04-15 2019-07-02 Ethicon Llc Modular surgical instrument with configurable operating mode
USD854151S1 (en) 2017-06-28 2019-07-16 Ethicon Llc Surgical instrument shaft
US10357247B2 (en) 2016-04-15 2019-07-23 Ethicon Llc Surgical instrument with multiple program responses during a firing motion
US10363037B2 (en) 2016-04-18 2019-07-30 Ethicon Llc Surgical instrument system comprising a magnetic lockout
US10363031B2 (en) 2010-09-30 2019-07-30 Ethicon Llc Tissue thickness compensators for surgical staplers
US10363036B2 (en) 2015-09-23 2019-07-30 Ethicon Llc Surgical stapler having force-based motor control
US10368865B2 (en) 2015-12-30 2019-08-06 Ethicon Llc Mechanisms for compensating for drivetrain failure in powered surgical instruments
US10368864B2 (en) 2017-06-20 2019-08-06 Ethicon Llc Systems and methods for controlling displaying motor velocity for a surgical instrument
US10376263B2 (en) 2016-04-01 2019-08-13 Ethicon Llc Anvil modification members for surgical staplers
US10390841B2 (en) 2017-06-20 2019-08-27 Ethicon Llc Control of motor velocity of a surgical stapling and cutting instrument based on angle of articulation
US10398434B2 (en) 2017-06-29 2019-09-03 Ethicon Llc Closed loop velocity control of closure member for robotic surgical instrument
US10398433B2 (en) 2007-03-28 2019-09-03 Ethicon Llc Laparoscopic clamp load measuring devices
US10405859B2 (en) 2016-04-15 2019-09-10 Ethicon Llc Surgical instrument with adjustable stop/start control during a firing motion
US10413294B2 (en) 2012-06-28 2019-09-17 Ethicon Llc Shaft assembly arrangements for surgical instruments
US10420549B2 (en) 2008-09-23 2019-09-24 Ethicon Llc Motorized surgical instrument
US10420550B2 (en) 2009-02-06 2019-09-24 Ethicon Llc Motor driven surgical fastener device with switching system configured to prevent firing initiation until activated
US10426471B2 (en) 2016-12-21 2019-10-01 Ethicon Llc Surgical instrument with multiple failure response modes
US10426481B2 (en) 2014-02-24 2019-10-01 Ethicon Llc Implantable layer assemblies
US10426467B2 (en) 2016-04-15 2019-10-01 Ethicon Llc Surgical instrument with detection sensors
US10426463B2 (en) 2006-01-31 2019-10-01 Ehticon LLC Surgical instrument having a feedback system
US10441285B2 (en) 2012-03-28 2019-10-15 Ethicon Llc Tissue thickness compensator comprising tissue ingrowth features
US10441279B2 (en) 2015-03-06 2019-10-15 Ethicon Llc Multiple level thresholds to modify operation of powered surgical instruments
US10448950B2 (en) 2016-12-21 2019-10-22 Ethicon Llc Surgical staplers with independently actuatable closing and firing systems
US10448948B2 (en) 2016-02-12 2019-10-22 Ethicon Llc Mechanisms for compensating for drivetrain failure in powered surgical instruments
US10456137B2 (en) 2016-04-15 2019-10-29 Ethicon Llc Staple formation detection mechanisms
US10463370B2 (en) 2008-02-14 2019-11-05 Ethicon Llc Motorized surgical instrument
US10485539B2 (en) 2006-01-31 2019-11-26 Ethicon Llc Surgical instrument with firing lockout
US10485536B2 (en) 2010-09-30 2019-11-26 Ethicon Llc Tissue stapler having an anti-microbial agent
US10485543B2 (en) 2016-12-21 2019-11-26 Ethicon Llc Anvil having a knife slot width
US10492783B2 (en) 2016-04-15 2019-12-03 Ethicon, Llc Surgical instrument with improved stop/start control during a firing motion
US10492785B2 (en) 2016-12-21 2019-12-03 Ethicon Llc Shaft assembly comprising a lockout
USD869655S1 (en) 2017-06-28 2019-12-10 Ethicon Llc Surgical fastener cartridge
US10499914B2 (en) 2016-12-21 2019-12-10 Ethicon Llc Staple forming pocket arrangements
US10517596B2 (en) 2016-12-21 2019-12-31 Ethicon Llc Articulatable surgical instruments with articulation stroke amplification features
US10517590B2 (en) 2007-01-10 2019-12-31 Ethicon Llc Powered surgical instrument having a transmission system
US10517594B2 (en) 2014-10-29 2019-12-31 Ethicon Llc Cartridge assemblies for surgical staplers
US10524790B2 (en) 2011-05-27 2020-01-07 Ethicon Llc Robotically-controlled surgical stapling devices that produce formed staples having different lengths
US10524787B2 (en) 2015-03-06 2020-01-07 Ethicon Llc Powered surgical instrument with parameter-based firing rate
US10531887B2 (en) 2015-03-06 2020-01-14 Ethicon Llc Powered surgical instrument including speed display
US10537325B2 (en) 2016-12-21 2020-01-21 Ethicon Llc Staple forming pocket arrangement to accommodate different types of staples
US10568626B2 (en) 2016-12-21 2020-02-25 Ethicon Llc Surgical instruments with jaw opening features for increasing a jaw opening distance
US10568625B2 (en) 2016-12-21 2020-02-25 Ethicon Llc Staple cartridges and arrangements of staples and staple cavities therein
US10568652B2 (en) 2006-09-29 2020-02-25 Ethicon Llc Surgical staples having attached drivers of different heights and stapling instruments for deploying the same
US10575868B2 (en) 2013-03-01 2020-03-03 Ethicon Llc Surgical instrument with coupler assembly
US10588632B2 (en) 2016-12-21 2020-03-17 Ethicon Llc Surgical end effectors and firing members thereof
US10588623B2 (en) 2010-09-30 2020-03-17 Ethicon Llc Adhesive film laminate
US10588626B2 (en) 2014-03-26 2020-03-17 Ethicon Llc Surgical instrument displaying subsequent step of use
US10588633B2 (en) 2017-06-28 2020-03-17 Ethicon Llc Surgical instruments with open and closable jaws and axially movable firing member that is initially parked in close proximity to the jaws prior to firing
USD879808S1 (en) 2017-06-20 2020-03-31 Ethicon Llc Display panel with graphical user interface
USD879809S1 (en) 2017-06-20 2020-03-31 Ethicon Llc Display panel with changeable graphical user interface
US10617418B2 (en) 2015-08-17 2020-04-14 Ethicon Llc Implantable layers for a surgical instrument
US10617413B2 (en) 2016-04-01 2020-04-14 Ethicon Llc Closure system arrangements for surgical cutting and stapling devices with separate and distinct firing shafts
US10617412B2 (en) 2015-03-06 2020-04-14 Ethicon Llc System for detecting the mis-insertion of a staple cartridge into a surgical stapler
US10617417B2 (en) 2014-11-06 2020-04-14 Ethicon Llc Staple cartridge comprising a releasable adjunct material
US10617416B2 (en) 2013-03-14 2020-04-14 Ethicon Llc Control systems for surgical instruments
US10624633B2 (en) 2017-06-20 2020-04-21 Ethicon Llc Systems and methods for controlling motor velocity of a surgical stapling and cutting instrument
US10624861B2 (en) 2010-09-30 2020-04-21 Ethicon Llc Tissue thickness compensator configured to redistribute compressive forces
US10631859B2 (en) 2017-06-27 2020-04-28 Ethicon Llc Articulation systems for surgical instruments
US10639115B2 (en) 2012-06-28 2020-05-05 Ethicon Llc Surgical end effectors having angled tissue-contacting surfaces
US10646220B2 (en) 2017-06-20 2020-05-12 Ethicon Llc Systems and methods for controlling displacement member velocity for a surgical instrument
US10660640B2 (en) 2008-02-14 2020-05-26 Ethicon Llc Motorized surgical cutting and fastening instrument
US10667808B2 (en) 2012-03-28 2020-06-02 Ethicon Llc Staple cartridge comprising an absorbable adjunct
US10667809B2 (en) 2016-12-21 2020-06-02 Ethicon Llc Staple cartridge and staple cartridge channel comprising windows defined therein
US10675028B2 (en) 2006-01-31 2020-06-09 Ethicon Llc Powered surgical instruments with firing system lockout arrangements
US10682142B2 (en) 2008-02-14 2020-06-16 Ethicon Llc Surgical stapling apparatus including an articulation system
US10682134B2 (en) 2017-12-21 2020-06-16 Ethicon Llc Continuous use self-propelled stapling instrument
US10687806B2 (en) 2015-03-06 2020-06-23 Ethicon Llc Adaptive tissue compression techniques to adjust closure rates for multiple tissue types
US10687813B2 (en) 2017-12-15 2020-06-23 Ethicon Llc Adapters with firing stroke sensing arrangements for use in connection with electromechanical surgical instruments
US10695062B2 (en) 2010-10-01 2020-06-30 Ethicon Llc Surgical instrument including a retractable firing member
US10695058B2 (en) 2014-12-18 2020-06-30 Ethicon Llc Surgical instrument systems comprising an articulatable end effector and means for adjusting the firing stroke of a firing member
US10695063B2 (en) 2012-02-13 2020-06-30 Ethicon Llc Surgical cutting and fastening instrument with apparatus for determining cartridge and firing motion status
US10702267B2 (en) 2007-03-15 2020-07-07 Ethicon Llc Surgical stapling instrument having a releasable buttress material
USD890784S1 (en) 2017-06-20 2020-07-21 Ethicon Llc Display panel with changeable graphical user interface
US10716614B2 (en) 2017-06-28 2020-07-21 Ethicon Llc Surgical shaft assemblies with slip ring assemblies with increased contact pressure
US10716565B2 (en) 2017-12-19 2020-07-21 Ethicon Llc Surgical instruments with dual articulation drivers
US10729501B2 (en) 2017-09-29 2020-08-04 Ethicon Llc Systems and methods for language selection of a surgical instrument
US10729509B2 (en) 2017-12-19 2020-08-04 Ethicon Llc Surgical instrument comprising closure and firing locking mechanism
US10736636B2 (en) 2014-12-10 2020-08-11 Ethicon Llc Articulatable surgical instrument system
US10736630B2 (en) 2014-10-13 2020-08-11 Ethicon Llc Staple cartridge
US10736628B2 (en) 2008-09-23 2020-08-11 Ethicon Llc Motor-driven surgical cutting instrument
US10743875B2 (en) 2017-12-15 2020-08-18 Ethicon Llc Surgical end effectors with jaw stiffener arrangements configured to permit monitoring of firing member
US10743870B2 (en) 2008-02-14 2020-08-18 Ethicon Llc Surgical stapling apparatus with interlockable firing system
US10743874B2 (en) 2017-12-15 2020-08-18 Ethicon Llc Sealed adapters for use with electromechanical surgical instruments
US10743849B2 (en) 2006-01-31 2020-08-18 Ethicon Llc Stapling system including an articulation system
US10743873B2 (en) 2014-12-18 2020-08-18 Ethicon Llc Drive arrangements for articulatable surgical instruments
US10743872B2 (en) 2017-09-29 2020-08-18 Ethicon Llc System and methods for controlling a display of a surgical instrument
US10743851B2 (en) 2008-02-14 2020-08-18 Ethicon Llc Interchangeable tools for surgical instruments
US10751076B2 (en) 2009-12-24 2020-08-25 Ethicon Llc Motor-driven surgical cutting instrument with electric actuator directional control assembly
US10758230B2 (en) 2016-12-21 2020-09-01 Ethicon Llc Surgical instrument with primary and safety processors
US10758229B2 (en) 2016-12-21 2020-09-01 Ethicon Llc Surgical instrument comprising improved jaw control
WO2020176738A1 (en) 2019-02-28 2020-09-03 Janssen Biotech, Inc. Anti-il-alpha antibody for the treatment of hidradenitis suppurativa
WO2020176730A1 (en) 2019-02-27 2020-09-03 Janssen Biotech, Inc. Antibody formulation
US10765429B2 (en) 2017-09-29 2020-09-08 Ethicon Llc Systems and methods for providing alerts according to the operational state of a surgical instrument
US10765427B2 (en) 2017-06-28 2020-09-08 Ethicon Llc Method for articulating a surgical instrument
US10765425B2 (en) 2008-09-23 2020-09-08 Ethicon Llc Robotically-controlled motorized surgical instrument with an end effector
US10772625B2 (en) 2015-03-06 2020-09-15 Ethicon Llc Signal and power communication system positioned on a rotatable shaft
US10772629B2 (en) 2017-06-27 2020-09-15 Ethicon Llc Surgical anvil arrangements
US10779821B2 (en) 2018-08-20 2020-09-22 Ethicon Llc Surgical stapler anvils with tissue stop features configured to avoid tissue pinch
US10779825B2 (en) 2017-12-15 2020-09-22 Ethicon Llc Adapters with end effector position sensing and control arrangements for use in connection with electromechanical surgical instruments
US10779820B2 (en) 2017-06-20 2020-09-22 Ethicon Llc Systems and methods for controlling motor speed according to user input for a surgical instrument
US10779824B2 (en) 2017-06-28 2020-09-22 Ethicon Llc Surgical instrument comprising an articulation system lockable by a closure system
US10780539B2 (en) 2011-05-27 2020-09-22 Ethicon Llc Stapling instrument for use with a robotic system
US10779826B2 (en) 2017-12-15 2020-09-22 Ethicon Llc Methods of operating surgical end effectors
US10779903B2 (en) 2017-10-31 2020-09-22 Ethicon Llc Positive shaft rotation lock activated by jaw closure
US10796471B2 (en) 2017-09-29 2020-10-06 Ethicon Llc Systems and methods of displaying a knife position for a surgical instrument
US10806448B2 (en) 2014-12-18 2020-10-20 Ethicon Llc Surgical instrument assembly comprising a flexible articulation system
US10806449B2 (en) 2005-11-09 2020-10-20 Ethicon Llc End effectors for surgical staplers
US10813639B2 (en) 2017-06-20 2020-10-27 Ethicon Llc Closed loop feedback control of motor velocity of a surgical stapling and cutting instrument based on system conditions
US10828028B2 (en) 2016-04-15 2020-11-10 Ethicon Llc Surgical instrument with multiple program responses during a firing motion
US10828033B2 (en) 2017-12-15 2020-11-10 Ethicon Llc Handheld electromechanical surgical instruments with improved motor control arrangements for positioning components of an adapter coupled thereto
US10835330B2 (en) 2017-12-19 2020-11-17 Ethicon Llc Method for determining the position of a rotatable jaw of a surgical instrument attachment assembly
US10842492B2 (en) 2018-08-20 2020-11-24 Ethicon Llc Powered articulatable surgical instruments with clutching and locking arrangements for linking an articulation drive system to a firing drive system
US10842491B2 (en) 2006-01-31 2020-11-24 Ethicon Llc Surgical system with an actuation console
US10842490B2 (en) 2017-10-31 2020-11-24 Ethicon Llc Cartridge body design with force reduction based on firing completion
US10856869B2 (en) 2017-06-27 2020-12-08 Ethicon Llc Surgical anvil arrangements
US10856870B2 (en) 2018-08-20 2020-12-08 Ethicon Llc Switching arrangements for motor powered articulatable surgical instruments
US10863986B2 (en) 2015-09-23 2020-12-15 Ethicon Llc Surgical stapler having downstream current-based motor control
US10869666B2 (en) 2017-12-15 2020-12-22 Ethicon Llc Adapters with control systems for controlling multiple motors of an electromechanical surgical instrument
USD906355S1 (en) 2017-06-28 2020-12-29 Ethicon Llc Display screen or portion thereof with a graphical user interface for a surgical instrument
EP3582813A4 (en) * 2017-02-16 2020-12-30 XBiotech, Inc TREATMENT OF HIDRADENITIS SUPPURATIVA
US10881396B2 (en) 2017-06-20 2021-01-05 Ethicon Llc Surgical instrument with variable duration trigger arrangement
US10881399B2 (en) 2017-06-20 2021-01-05 Ethicon Llc Techniques for adaptive control of motor velocity of a surgical stapling and cutting instrument
USD907648S1 (en) 2017-09-29 2021-01-12 Ethicon Llc Display screen or portion thereof with animated graphical user interface
USD907647S1 (en) 2017-09-29 2021-01-12 Ethicon Llc Display screen or portion thereof with animated graphical user interface
US10888321B2 (en) 2017-06-20 2021-01-12 Ethicon Llc Systems and methods for controlling velocity of a displacement member of a surgical stapling and cutting instrument
US10898183B2 (en) 2017-06-29 2021-01-26 Ethicon Llc Robotic surgical instrument with closed loop feedback techniques for advancement of closure member during firing
US10903685B2 (en) 2017-06-28 2021-01-26 Ethicon Llc Surgical shaft assemblies with slip ring assemblies forming capacitive channels
US10905418B2 (en) 2014-10-16 2021-02-02 Ethicon Llc Staple cartridge comprising a tissue thickness compensator
US10905423B2 (en) 2014-09-05 2021-02-02 Ethicon Llc Smart cartridge wake up operation and data retention
US10912559B2 (en) 2018-08-20 2021-02-09 Ethicon Llc Reinforced deformable anvil tip for surgical stapler anvil
US10912575B2 (en) 2007-01-11 2021-02-09 Ethicon Llc Surgical stapling device having supports for a flexible drive mechanism
US10918380B2 (en) 2006-01-31 2021-02-16 Ethicon Llc Surgical instrument system including a control system
USD910847S1 (en) 2017-12-19 2021-02-16 Ethicon Llc Surgical instrument assembly
US10932778B2 (en) 2008-10-10 2021-03-02 Ethicon Llc Powered surgical cutting and stapling apparatus with manually retractable firing system
US10932772B2 (en) 2017-06-29 2021-03-02 Ethicon Llc Methods for closed loop velocity control for robotic surgical instrument
US10945728B2 (en) 2014-12-18 2021-03-16 Ethicon Llc Locking arrangements for detachable shaft assemblies with articulatable surgical end effectors
US10945731B2 (en) 2010-09-30 2021-03-16 Ethicon Llc Tissue thickness compensator comprising controlled release and expansion
US10959725B2 (en) 2012-06-15 2021-03-30 Ethicon Llc Articulatable surgical instrument comprising a firing drive
USD914878S1 (en) 2018-08-20 2021-03-30 Ethicon Llc Surgical instrument anvil
US10966718B2 (en) 2017-12-15 2021-04-06 Ethicon Llc Dynamic clamping assemblies with improved wear characteristics for use in connection with electromechanical surgical instruments
US10980537B2 (en) 2017-06-20 2021-04-20 Ethicon Llc Closed loop feedback control of motor velocity of a surgical stapling and cutting instrument based on measured time over a specified number of shaft rotations
US10980539B2 (en) 2015-09-30 2021-04-20 Ethicon Llc Implantable adjunct comprising bonded layers
US10987102B2 (en) 2010-09-30 2021-04-27 Ethicon Llc Tissue thickness compensator comprising a plurality of layers
USD917500S1 (en) 2017-09-29 2021-04-27 Ethicon Llc Display screen or portion thereof with graphical user interface
US10993716B2 (en) 2017-06-27 2021-05-04 Ethicon Llc Surgical anvil arrangements
US11007022B2 (en) 2017-06-29 2021-05-18 Ethicon Llc Closed loop velocity control techniques based on sensed tissue parameters for robotic surgical instrument
US11006951B2 (en) 2007-01-10 2021-05-18 Ethicon Llc Surgical instrument with wireless communication between control unit and sensor transponders
US11007004B2 (en) 2012-06-28 2021-05-18 Ethicon Llc Powered multi-axial articulable electrosurgical device with external dissection features
US11006955B2 (en) 2017-12-15 2021-05-18 Ethicon Llc End effectors with positive jaw opening features for use with adapters for electromechanical surgical instruments
US11013511B2 (en) 2007-06-22 2021-05-25 Ethicon Llc Surgical stapling instrument with an articulatable end effector
US11020115B2 (en) 2014-02-12 2021-06-01 Cilag Gmbh International Deliverable surgical instrument
US11020112B2 (en) 2017-12-19 2021-06-01 Ethicon Llc Surgical tools configured for interchangeable use with different controller interfaces
US20210171623A1 (en) * 2008-05-30 2021-06-10 Janssen Biotech, Inc. Human antibody specific for interleukin-1alpha
US11033267B2 (en) 2017-12-15 2021-06-15 Ethicon Llc Systems and methods of controlling a clamping member firing rate of a surgical instrument
US11039834B2 (en) 2018-08-20 2021-06-22 Cilag Gmbh International Surgical stapler anvils with staple directing protrusions and tissue stability features
US11039836B2 (en) 2007-01-11 2021-06-22 Cilag Gmbh International Staple cartridge for use with a surgical stapling instrument
US11045270B2 (en) 2017-12-19 2021-06-29 Cilag Gmbh International Robotic attachment comprising exterior drive actuator
US11045192B2 (en) 2018-08-20 2021-06-29 Cilag Gmbh International Fabricating techniques for surgical stapler anvils
US11051813B2 (en) 2006-01-31 2021-07-06 Cilag Gmbh International Powered surgical instruments with firing system lockout arrangements
US11051807B2 (en) 2019-06-28 2021-07-06 Cilag Gmbh International Packaging assembly including a particulate trap
US11071543B2 (en) 2017-12-15 2021-07-27 Cilag Gmbh International Surgical end effectors with clamping assemblies configured to increase jaw aperture ranges
US11071554B2 (en) 2017-06-20 2021-07-27 Cilag Gmbh International Closed loop feedback control of motor velocity of a surgical stapling and cutting instrument based on magnitude of velocity error measurements
US11071545B2 (en) 2014-09-05 2021-07-27 Cilag Gmbh International Smart cartridge wake up operation and data retention
US11076853B2 (en) 2017-12-21 2021-08-03 Cilag Gmbh International Systems and methods of displaying a knife position during transection for a surgical instrument
US11083458B2 (en) 2018-08-20 2021-08-10 Cilag Gmbh International Powered surgical instruments with clutching arrangements to convert linear drive motions to rotary drive motions
US11090046B2 (en) 2017-06-20 2021-08-17 Cilag Gmbh International Systems and methods for controlling displacement member motion of a surgical stapling and cutting instrument
US11090075B2 (en) 2017-10-30 2021-08-17 Cilag Gmbh International Articulation features for surgical end effector
US11133106B2 (en) 2013-08-23 2021-09-28 Cilag Gmbh International Surgical instrument assembly comprising a retraction assembly
US11129615B2 (en) 2009-02-05 2021-09-28 Cilag Gmbh International Surgical stapling system
US11129680B2 (en) 2017-12-21 2021-09-28 Cilag Gmbh International Surgical instrument comprising a projector
US11134944B2 (en) 2017-10-30 2021-10-05 Cilag Gmbh International Surgical stapler knife motion controls
US11134942B2 (en) 2016-12-21 2021-10-05 Cilag Gmbh International Surgical stapling instruments and staple-forming anvils
US11141153B2 (en) 2014-10-29 2021-10-12 Cilag Gmbh International Staple cartridges comprising driver arrangements
US11147551B2 (en) 2019-03-25 2021-10-19 Cilag Gmbh International Firing drive arrangements for surgical systems
US11147553B2 (en) 2019-03-25 2021-10-19 Cilag Gmbh International Firing drive arrangements for surgical systems
WO2021211924A1 (en) 2020-04-16 2021-10-21 Janssen Biotech, Inc. Treatment of atopic dermatitis
WO2021211927A1 (en) 2020-04-16 2021-10-21 Janssen Biotech, Inc. Treatment of hidradenitis suppurativa
US11154301B2 (en) 2015-02-27 2021-10-26 Cilag Gmbh International Modular stapling assembly
US11172929B2 (en) 2019-03-25 2021-11-16 Cilag Gmbh International Articulation drive arrangements for surgical systems
US11179150B2 (en) 2016-04-15 2021-11-23 Cilag Gmbh International Systems and methods for controlling a surgical stapling and cutting instrument
US11191831B2 (en) 2011-04-01 2021-12-07 Janssen Biotech, Inc. Treatment of psychiatric conditions
US11197670B2 (en) 2017-12-15 2021-12-14 Cilag Gmbh International Surgical end effectors with pivotal jaws configured to touch at their respective distal ends when fully closed
US11197671B2 (en) 2012-06-28 2021-12-14 Cilag Gmbh International Stapling assembly comprising a lockout
US11202633B2 (en) 2014-09-26 2021-12-21 Cilag Gmbh International Surgical stapling buttresses and adjunct materials
US11207065B2 (en) 2018-08-20 2021-12-28 Cilag Gmbh International Method for fabricating surgical stapler anvils
US11207064B2 (en) 2011-05-27 2021-12-28 Cilag Gmbh International Automated end effector component reloading system for use with a robotic system
US11213293B2 (en) 2016-02-09 2022-01-04 Cilag Gmbh International Articulatable surgical instruments with single articulation link arrangements
US11219455B2 (en) 2019-06-28 2022-01-11 Cilag Gmbh International Surgical instrument including a lockout key
US11224497B2 (en) 2019-06-28 2022-01-18 Cilag Gmbh International Surgical systems with multiple RFID tags
US11224428B2 (en) 2016-12-21 2022-01-18 Cilag Gmbh International Surgical stapling systems
US11224427B2 (en) 2006-01-31 2022-01-18 Cilag Gmbh International Surgical stapling system including a console and retraction assembly
US11224423B2 (en) 2015-03-06 2022-01-18 Cilag Gmbh International Smart sensors with local signal processing
US11224426B2 (en) 2016-02-12 2022-01-18 Cilag Gmbh International Mechanisms for compensating for drivetrain failure in powered surgical instruments
US11229437B2 (en) 2019-06-28 2022-01-25 Cilag Gmbh International Method for authenticating the compatibility of a staple cartridge with a surgical instrument
US11234698B2 (en) 2019-12-19 2022-02-01 Cilag Gmbh International Stapling system comprising a clamp lockout and a firing lockout
US11241230B2 (en) 2012-06-28 2022-02-08 Cilag Gmbh International Clip applier tool for use with a robotic surgical system
US11246678B2 (en) 2019-06-28 2022-02-15 Cilag Gmbh International Surgical stapling system having a frangible RFID tag
US11246590B2 (en) 2005-08-31 2022-02-15 Cilag Gmbh International Staple cartridge including staple drivers having different unfired heights
US11246592B2 (en) 2017-06-28 2022-02-15 Cilag Gmbh International Surgical instrument comprising an articulation system lockable to a frame
US11253254B2 (en) 2019-04-30 2022-02-22 Cilag Gmbh International Shaft rotation actuator on a surgical instrument
US11253256B2 (en) 2018-08-20 2022-02-22 Cilag Gmbh International Articulatable motor powered surgical instruments with dedicated articulation motor arrangements
US11259805B2 (en) 2017-06-28 2022-03-01 Cilag Gmbh International Surgical instrument comprising firing member supports
US11259803B2 (en) 2019-06-28 2022-03-01 Cilag Gmbh International Surgical stapling system having an information encryption protocol
US11259799B2 (en) 2014-03-26 2022-03-01 Cilag Gmbh International Interface systems for use with surgical instruments
US11266409B2 (en) 2014-04-16 2022-03-08 Cilag Gmbh International Fastener cartridge comprising a sled including longitudinally-staggered ramps
US11266405B2 (en) 2017-06-27 2022-03-08 Cilag Gmbh International Surgical anvil manufacturing methods
US11272927B2 (en) 2008-02-15 2022-03-15 Cilag Gmbh International Layer arrangements for surgical staple cartridges
US11278279B2 (en) 2006-01-31 2022-03-22 Cilag Gmbh International Surgical instrument assembly
US11284898B2 (en) 2014-09-18 2022-03-29 Cilag Gmbh International Surgical instrument including a deployable knife
US11291451B2 (en) 2019-06-28 2022-04-05 Cilag Gmbh International Surgical instrument with battery compatibility verification functionality
US11291447B2 (en) 2019-12-19 2022-04-05 Cilag Gmbh International Stapling instrument comprising independent jaw closing and staple firing systems
US11291449B2 (en) 2009-12-24 2022-04-05 Cilag Gmbh International Surgical cutting instrument that analyzes tissue thickness
US11291440B2 (en) 2018-08-20 2022-04-05 Cilag Gmbh International Method for operating a powered articulatable surgical instrument
US11291441B2 (en) 2007-01-10 2022-04-05 Cilag Gmbh International Surgical instrument with wireless communication between control unit and remote sensor
US11298125B2 (en) 2010-09-30 2022-04-12 Cilag Gmbh International Tissue stapler having a thickness compensator
US11298127B2 (en) 2019-06-28 2022-04-12 Cilag GmbH Interational Surgical stapling system having a lockout mechanism for an incompatible cartridge
US11298132B2 (en) 2019-06-28 2022-04-12 Cilag GmbH Inlernational Staple cartridge including a honeycomb extension
US11304695B2 (en) 2017-08-03 2022-04-19 Cilag Gmbh International Surgical system shaft interconnection
US11304696B2 (en) 2019-12-19 2022-04-19 Cilag Gmbh International Surgical instrument comprising a powered articulation system
US11311294B2 (en) 2014-09-05 2022-04-26 Cilag Gmbh International Powered medical device including measurement of closure state of jaws
US11311290B2 (en) 2017-12-21 2022-04-26 Cilag Gmbh International Surgical instrument comprising an end effector dampener
US11317913B2 (en) 2016-12-21 2022-05-03 Cilag Gmbh International Lockout arrangements for surgical end effectors and replaceable tool assemblies
US11317917B2 (en) 2016-04-18 2022-05-03 Cilag Gmbh International Surgical stapling system comprising a lockable firing assembly
US11324501B2 (en) 2018-08-20 2022-05-10 Cilag Gmbh International Surgical stapling devices with improved closure members
US11324503B2 (en) 2017-06-27 2022-05-10 Cilag Gmbh International Surgical firing member arrangements
US11350928B2 (en) 2016-04-18 2022-06-07 Cilag Gmbh International Surgical instrument comprising a tissue thickness lockout and speed control system
US11376098B2 (en) 2019-06-28 2022-07-05 Cilag Gmbh International Surgical instrument system comprising an RFID system
US11382627B2 (en) 2014-04-16 2022-07-12 Cilag Gmbh International Surgical stapling assembly comprising a firing member including a lateral extension
US11382638B2 (en) 2017-06-20 2022-07-12 Cilag Gmbh International Closed loop feedback control of motor velocity of a surgical stapling and cutting instrument based on measured time over a specified displacement distance
US11399837B2 (en) 2019-06-28 2022-08-02 Cilag Gmbh International Mechanisms for motor control adjustments of a motorized surgical instrument
US11399829B2 (en) 2017-09-29 2022-08-02 Cilag Gmbh International Systems and methods of initiating a power shutdown mode for a surgical instrument
US11419606B2 (en) 2016-12-21 2022-08-23 Cilag Gmbh International Shaft assembly comprising a clutch configured to adapt the output of a rotary firing member to two different systems
US11426167B2 (en) 2019-06-28 2022-08-30 Cilag Gmbh International Mechanisms for proper anvil attachment surgical stapling head assembly
US11426251B2 (en) 2019-04-30 2022-08-30 Cilag Gmbh International Articulation directional lights on a surgical instrument
US11432816B2 (en) 2019-04-30 2022-09-06 Cilag Gmbh International Articulation pin for a surgical instrument
US11446029B2 (en) 2019-12-19 2022-09-20 Cilag Gmbh International Staple cartridge comprising projections extending from a curved deck surface
US11452526B2 (en) 2020-10-29 2022-09-27 Cilag Gmbh International Surgical instrument comprising a staged voltage regulation start-up system
US11452528B2 (en) 2019-04-30 2022-09-27 Cilag Gmbh International Articulation actuators for a surgical instrument
US11464513B2 (en) 2012-06-28 2022-10-11 Cilag Gmbh International Surgical instrument system including replaceable end effectors
US11464512B2 (en) 2019-12-19 2022-10-11 Cilag Gmbh International Staple cartridge comprising a curved deck surface
US11464601B2 (en) 2019-06-28 2022-10-11 Cilag Gmbh International Surgical instrument comprising an RFID system for tracking a movable component
USD966512S1 (en) 2020-06-02 2022-10-11 Cilag Gmbh International Staple cartridge
US11471157B2 (en) 2019-04-30 2022-10-18 Cilag Gmbh International Articulation control mapping for a surgical instrument
US11471155B2 (en) 2017-08-03 2022-10-18 Cilag Gmbh International Surgical system bailout
USD967421S1 (en) 2020-06-02 2022-10-18 Cilag Gmbh International Staple cartridge
US11478247B2 (en) 2010-07-30 2022-10-25 Cilag Gmbh International Tissue acquisition arrangements and methods for surgical stapling devices
US11478241B2 (en) 2019-06-28 2022-10-25 Cilag Gmbh International Staple cartridge including projections
US11484312B2 (en) 2005-08-31 2022-11-01 Cilag Gmbh International Staple cartridge comprising a staple driver arrangement
US11497492B2 (en) 2019-06-28 2022-11-15 Cilag Gmbh International Surgical instrument including an articulation lock
US11497488B2 (en) 2014-03-26 2022-11-15 Cilag Gmbh International Systems and methods for controlling a segmented circuit
US11504116B2 (en) 2011-04-29 2022-11-22 Cilag Gmbh International Layer of material for a surgical end effector
US11504122B2 (en) 2019-12-19 2022-11-22 Cilag Gmbh International Surgical instrument comprising a nested firing member
US11517390B2 (en) 2020-10-29 2022-12-06 Cilag Gmbh International Surgical instrument comprising a limited travel switch
US11517325B2 (en) 2017-06-20 2022-12-06 Cilag Gmbh International Closed loop feedback control of motor velocity of a surgical stapling and cutting instrument based on measured displacement distance traveled over a specified time interval
US11523821B2 (en) 2014-09-26 2022-12-13 Cilag Gmbh International Method for creating a flexible staple line
US11523823B2 (en) 2016-02-09 2022-12-13 Cilag Gmbh International Surgical instruments with non-symmetrical articulation arrangements
US11523822B2 (en) 2019-06-28 2022-12-13 Cilag Gmbh International Battery pack including a circuit interrupter
US11529137B2 (en) 2019-12-19 2022-12-20 Cilag Gmbh International Staple cartridge comprising driver retention members
US11529139B2 (en) 2019-12-19 2022-12-20 Cilag Gmbh International Motor driven surgical instrument
US11534259B2 (en) 2020-10-29 2022-12-27 Cilag Gmbh International Surgical instrument comprising an articulation indicator
USD974560S1 (en) 2020-06-02 2023-01-03 Cilag Gmbh International Staple cartridge
USD975278S1 (en) 2020-06-02 2023-01-10 Cilag Gmbh International Staple cartridge
USD975851S1 (en) 2020-06-02 2023-01-17 Cilag Gmbh International Staple cartridge
USD975850S1 (en) 2020-06-02 2023-01-17 Cilag Gmbh International Staple cartridge
US11553971B2 (en) 2019-06-28 2023-01-17 Cilag Gmbh International Surgical RFID assemblies for display and communication
US11559304B2 (en) 2019-12-19 2023-01-24 Cilag Gmbh International Surgical instrument comprising a rapid closure mechanism
USD976401S1 (en) 2020-06-02 2023-01-24 Cilag Gmbh International Staple cartridge
US11564682B2 (en) 2007-06-04 2023-01-31 Cilag Gmbh International Surgical stapler device
US11564686B2 (en) 2017-06-28 2023-01-31 Cilag Gmbh International Surgical shaft assemblies with flexible interfaces
US11571215B2 (en) 2010-09-30 2023-02-07 Cilag Gmbh International Layer of material for a surgical end effector
US11576672B2 (en) 2019-12-19 2023-02-14 Cilag Gmbh International Surgical instrument comprising a closure system including a closure member and an opening member driven by a drive screw
USD980425S1 (en) 2020-10-29 2023-03-07 Cilag Gmbh International Surgical instrument assembly
US11607219B2 (en) 2019-12-19 2023-03-21 Cilag Gmbh International Staple cartridge comprising a detachable tissue cutting knife
US11607239B2 (en) 2016-04-15 2023-03-21 Cilag Gmbh International Systems and methods for controlling a surgical stapling and cutting instrument
US11617577B2 (en) 2020-10-29 2023-04-04 Cilag Gmbh International Surgical instrument comprising a sensor configured to sense whether an articulation drive of the surgical instrument is actuatable
US11622763B2 (en) 2013-04-16 2023-04-11 Cilag Gmbh International Stapling assembly comprising a shiftable drive
US11622766B2 (en) 2012-06-28 2023-04-11 Cilag Gmbh International Empty clip cartridge lockout
US11627959B2 (en) 2019-06-28 2023-04-18 Cilag Gmbh International Surgical instruments including manual and powered system lockouts
US11627960B2 (en) 2020-12-02 2023-04-18 Cilag Gmbh International Powered surgical instruments with smart reload with separately attachable exteriorly mounted wiring connections
US11638587B2 (en) 2019-06-28 2023-05-02 Cilag Gmbh International RFID identification systems for surgical instruments
US11638582B2 (en) 2020-07-28 2023-05-02 Cilag Gmbh International Surgical instruments with torsion spine drive arrangements
US11648009B2 (en) 2019-04-30 2023-05-16 Cilag Gmbh International Rotatable jaw tip for a surgical instrument
US11648005B2 (en) 2008-09-23 2023-05-16 Cilag Gmbh International Robotically-controlled motorized surgical instrument with an end effector
US11653914B2 (en) 2017-06-20 2023-05-23 Cilag Gmbh International Systems and methods for controlling motor velocity of a surgical stapling and cutting instrument according to articulation angle of end effector
US11653915B2 (en) 2020-12-02 2023-05-23 Cilag Gmbh International Surgical instruments with sled location detection and adjustment features
US11653920B2 (en) 2020-12-02 2023-05-23 Cilag Gmbh International Powered surgical instruments with communication interfaces through sterile barrier
US11660163B2 (en) 2019-06-28 2023-05-30 Cilag Gmbh International Surgical system with RFID tags for updating motor assembly parameters
US11678877B2 (en) 2014-12-18 2023-06-20 Cilag Gmbh International Surgical instrument including a flexible support configured to support a flexible firing member
US11678882B2 (en) 2020-12-02 2023-06-20 Cilag Gmbh International Surgical instruments with interactive features to remedy incidental sled movements
US11684434B2 (en) 2019-06-28 2023-06-27 Cilag Gmbh International Surgical RFID assemblies for instrument operational setting control
US11696757B2 (en) 2021-02-26 2023-07-11 Cilag Gmbh International Monitoring of internal systems to detect and track cartridge motion status
US11696761B2 (en) 2019-03-25 2023-07-11 Cilag Gmbh International Firing drive arrangements for surgical systems
US11701113B2 (en) 2021-02-26 2023-07-18 Cilag Gmbh International Stapling instrument comprising a separate power antenna and a data transfer antenna
US11701111B2 (en) 2019-12-19 2023-07-18 Cilag Gmbh International Method for operating a surgical stapling instrument
US11717289B2 (en) 2020-10-29 2023-08-08 Cilag Gmbh International Surgical instrument comprising an indicator which indicates that an articulation drive is actuatable
US11717294B2 (en) 2014-04-16 2023-08-08 Cilag Gmbh International End effector arrangements comprising indicators
US11717291B2 (en) 2021-03-22 2023-08-08 Cilag Gmbh International Staple cartridge comprising staples configured to apply different tissue compression
US11723657B2 (en) 2021-02-26 2023-08-15 Cilag Gmbh International Adjustable communication based on available bandwidth and power capacity
US11723658B2 (en) 2021-03-22 2023-08-15 Cilag Gmbh International Staple cartridge comprising a firing lockout
US11723662B2 (en) 2021-05-28 2023-08-15 Cilag Gmbh International Stapling instrument comprising an articulation control display
US11730473B2 (en) 2021-02-26 2023-08-22 Cilag Gmbh International Monitoring of manufacturing life-cycle
US11737751B2 (en) 2020-12-02 2023-08-29 Cilag Gmbh International Devices and methods of managing energy dissipated within sterile barriers of surgical instrument housings
US11737749B2 (en) 2021-03-22 2023-08-29 Cilag Gmbh International Surgical stapling instrument comprising a retraction system
US11744581B2 (en) 2020-12-02 2023-09-05 Cilag Gmbh International Powered surgical instruments with multi-phase tissue treatment
US11744603B2 (en) 2021-03-24 2023-09-05 Cilag Gmbh International Multi-axis pivot joints for surgical instruments and methods for manufacturing same
US11744583B2 (en) 2021-02-26 2023-09-05 Cilag Gmbh International Distal communication array to tune frequency of RF systems
US11749877B2 (en) 2021-02-26 2023-09-05 Cilag Gmbh International Stapling instrument comprising a signal antenna
US11751869B2 (en) 2021-02-26 2023-09-12 Cilag Gmbh International Monitoring of multiple sensors over time to detect moving characteristics of tissue
US11759202B2 (en) 2021-03-22 2023-09-19 Cilag Gmbh International Staple cartridge comprising an implantable layer
US11766260B2 (en) 2016-12-21 2023-09-26 Cilag Gmbh International Methods of stapling tissue
US11766259B2 (en) 2016-12-21 2023-09-26 Cilag Gmbh International Method of deforming staples from two different types of staple cartridges with the same surgical stapling instrument
US11771419B2 (en) 2019-06-28 2023-10-03 Cilag Gmbh International Packaging for a replaceable component of a surgical stapling system
US11779330B2 (en) 2020-10-29 2023-10-10 Cilag Gmbh International Surgical instrument comprising a jaw alignment system
US11786243B2 (en) 2021-03-24 2023-10-17 Cilag Gmbh International Firing members having flexible portions for adapting to a load during a surgical firing stroke
US11786239B2 (en) 2021-03-24 2023-10-17 Cilag Gmbh International Surgical instrument articulation joint arrangements comprising multiple moving linkage features
US11793514B2 (en) 2021-02-26 2023-10-24 Cilag Gmbh International Staple cartridge comprising sensor array which may be embedded in cartridge body
US11793516B2 (en) 2021-03-24 2023-10-24 Cilag Gmbh International Surgical staple cartridge comprising longitudinal support beam
US11793522B2 (en) 2015-09-30 2023-10-24 Cilag Gmbh International Staple cartridge assembly including a compressible adjunct
US11795217B2 (en) 2018-06-29 2023-10-24 Cedars-Sinai Medical Center Interleukin-1 inhibition for combination treatment of pancreatic cancer cachexia
US11793518B2 (en) 2006-01-31 2023-10-24 Cilag Gmbh International Powered surgical instruments with firing system lockout arrangements
US11806011B2 (en) 2021-03-22 2023-11-07 Cilag Gmbh International Stapling instrument comprising tissue compression systems
US11812964B2 (en) 2021-02-26 2023-11-14 Cilag Gmbh International Staple cartridge comprising a power management circuit
US11826012B2 (en) 2021-03-22 2023-11-28 Cilag Gmbh International Stapling instrument comprising a pulsed motor-driven firing rack
US11826048B2 (en) 2017-06-28 2023-11-28 Cilag Gmbh International Surgical instrument comprising selectively actuatable rotatable couplers
US11826042B2 (en) 2021-03-22 2023-11-28 Cilag Gmbh International Surgical instrument comprising a firing drive including a selectable leverage mechanism
US11826132B2 (en) 2015-03-06 2023-11-28 Cilag Gmbh International Time dependent evaluation of sensor data to determine stability, creep, and viscoelastic elements of measures
US11832816B2 (en) 2021-03-24 2023-12-05 Cilag Gmbh International Surgical stapling assembly comprising nonplanar staples and planar staples
US11844518B2 (en) 2020-10-29 2023-12-19 Cilag Gmbh International Method for operating a surgical instrument
US11844520B2 (en) 2019-12-19 2023-12-19 Cilag Gmbh International Staple cartridge comprising driver retention members
US11849945B2 (en) 2021-03-24 2023-12-26 Cilag Gmbh International Rotary-driven surgical stapling assembly comprising eccentrically driven firing member
US11849952B2 (en) 2010-09-30 2023-12-26 Cilag Gmbh International Staple cartridge comprising staples positioned within a compressible portion thereof
US11849941B2 (en) 2007-06-29 2023-12-26 Cilag Gmbh International Staple cartridge having staple cavities extending at a transverse angle relative to a longitudinal cartridge axis
US11849944B2 (en) 2021-03-24 2023-12-26 Cilag Gmbh International Drivers for fastener cartridge assemblies having rotary drive screws
US11849943B2 (en) 2020-12-02 2023-12-26 Cilag Gmbh International Surgical instrument with cartridge release mechanisms
US11857183B2 (en) 2021-03-24 2024-01-02 Cilag Gmbh International Stapling assembly components having metal substrates and plastic bodies
US11877745B2 (en) 2021-10-18 2024-01-23 Cilag Gmbh International Surgical stapling assembly having longitudinally-repeating staple leg clusters
USD1013170S1 (en) 2020-10-29 2024-01-30 Cilag Gmbh International Surgical instrument assembly
US11883026B2 (en) 2014-04-16 2024-01-30 Cilag Gmbh International Fastener cartridge assemblies and staple retainer cover arrangements
US11890012B2 (en) 2004-07-28 2024-02-06 Cilag Gmbh International Staple cartridge comprising cartridge body and attached support
US11890010B2 (en) 2020-12-02 2024-02-06 Cllag GmbH International Dual-sided reinforced reload for surgical instruments
US11896219B2 (en) 2021-03-24 2024-02-13 Cilag Gmbh International Mating features between drivers and underside of a cartridge deck
US11896217B2 (en) 2020-10-29 2024-02-13 Cilag Gmbh International Surgical instrument comprising an articulation lock
US11896218B2 (en) 2021-03-24 2024-02-13 Cilag Gmbh International Method of using a powered stapling device
US11903582B2 (en) 2021-03-24 2024-02-20 Cilag Gmbh International Leveraging surfaces for cartridge installation
US11903581B2 (en) 2019-04-30 2024-02-20 Cilag Gmbh International Methods for stapling tissue using a surgical instrument
US11911032B2 (en) 2019-12-19 2024-02-27 Cilag Gmbh International Staple cartridge comprising a seating cam
US11925349B2 (en) 2021-02-26 2024-03-12 Cilag Gmbh International Adjustment to transfer parameters to improve available power
US11931033B2 (en) 2019-12-19 2024-03-19 Cilag Gmbh International Staple cartridge comprising a latch lockout
US11932688B2 (en) 2010-08-23 2024-03-19 Xbiotech Inc. Treatment for neoplastic diseases
US11931025B2 (en) 2020-10-29 2024-03-19 Cilag Gmbh International Surgical instrument comprising a releasable closure drive lock
US11937816B2 (en) 2021-10-28 2024-03-26 Cilag Gmbh International Electrical lead arrangements for surgical instruments
US11944300B2 (en) 2017-08-03 2024-04-02 Cilag Gmbh International Method for operating a surgical system bailout
US11944296B2 (en) 2020-12-02 2024-04-02 Cilag Gmbh International Powered surgical instruments with external connectors
US11944336B2 (en) 2021-03-24 2024-04-02 Cilag Gmbh International Joint arrangements for multi-planar alignment and support of operational drive shafts in articulatable surgical instruments
US11950779B2 (en) 2021-02-26 2024-04-09 Cilag Gmbh International Method of powering and communicating with a staple cartridge
US11950777B2 (en) 2021-02-26 2024-04-09 Cilag Gmbh International Staple cartridge comprising an information access control system
US11957337B2 (en) 2021-10-18 2024-04-16 Cilag Gmbh International Surgical stapling assembly with offset ramped drive surfaces
US11974742B2 (en) 2017-08-03 2024-05-07 Cilag Gmbh International Surgical system comprising an articulation bailout
US11980366B2 (en) 2006-10-03 2024-05-14 Cilag Gmbh International Surgical instrument
US11980362B2 (en) 2021-02-26 2024-05-14 Cilag Gmbh International Surgical instrument system comprising a power transfer coil
US11980363B2 (en) 2021-10-18 2024-05-14 Cilag Gmbh International Row-to-row staple array variations
US11986183B2 (en) 2008-02-14 2024-05-21 Cilag Gmbh International Surgical cutting and fastening instrument comprising a plurality of sensors to measure an electrical parameter
US11998198B2 (en) 2004-07-28 2024-06-04 Cilag Gmbh International Surgical stapling instrument incorporating a two-piece E-beam firing mechanism
US12004740B2 (en) 2019-06-28 2024-06-11 Cilag Gmbh International Surgical stapling system having an information decryption protocol
US12004745B2 (en) 2016-12-21 2024-06-11 Cilag Gmbh International Surgical instrument system comprising an end effector lockout and a firing assembly lockout
US12035913B2 (en) 2019-12-19 2024-07-16 Cilag Gmbh International Staple cartridge comprising a deployable knife
US12053175B2 (en) 2020-10-29 2024-08-06 Cilag Gmbh International Surgical instrument comprising a stowed closure actuator stop
US12089841B2 (en) 2021-10-28 2024-09-17 Cilag CmbH International Staple cartridge identification systems
US12102323B2 (en) 2021-03-24 2024-10-01 Cilag Gmbh International Rotary-driven surgical stapling assembly comprising a floatable component
US12108951B2 (en) 2021-02-26 2024-10-08 Cilag Gmbh International Staple cartridge comprising a sensing array and a temperature control system
US12171507B2 (en) 2016-08-16 2024-12-24 Cilag Gmbh International Surgical tool with manual control of end effector jaws
US12213666B2 (en) 2010-09-30 2025-02-04 Cilag Gmbh International Tissue thickness compensator comprising layers
US12232723B2 (en) 2014-03-26 2025-02-25 Cilag Gmbh International Systems and methods for controlling a segmented circuit
US12239317B2 (en) 2021-10-18 2025-03-04 Cilag Gmbh International Anvil comprising an arrangement of forming pockets proximal to tissue stop
US12245764B2 (en) 2016-12-21 2025-03-11 Cilag Gmbh International Shaft assembly comprising a lockout
US12262888B2 (en) 2018-08-20 2025-04-01 Cilag Gmbh International Surgical instruments with progressive jaw closure arrangements
US12274442B2 (en) 2016-12-21 2025-04-15 Cilag Gmbh International Surgical staple cartridge alignment features
US12324580B2 (en) 2021-02-26 2025-06-10 Cilag Gmbh International Method of powering and communicating with a staple cartridge
US12336705B2 (en) 2017-12-21 2025-06-24 Cilag Gmbh International Continuous use self-propelled stapling instrument
US12383267B2 (en) 2012-06-28 2025-08-12 Cilag Gmbh International Robotically powered surgical device with manually-actuatable reversing system
US12432790B2 (en) 2021-10-28 2025-09-30 Cilag Gmbh International Method and device for transmitting UART communications over a security short range wireless communication
US12471982B2 (en) 2020-12-02 2025-11-18 Cilag Gmbh International Method for tissue treatment by surgical instrument
US12490980B2 (en) 2017-06-20 2025-12-09 Cilag Gmbh International Surgical instrument having controllable articulation velocity
US12533127B2 (en) 2017-06-28 2026-01-27 Cilag Gmbh International Articulatable surgical instruments with movable jaws located in close proximity to an articulation axis

Families Citing this family (36)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN101253409A (en) 2005-08-02 2008-08-27 埃克斯生物科技公司 Diagnosis, treatment and prevention of vascular diseases using IL-1 alpha autoantibodies
JP2009537507A (en) * 2006-05-15 2009-10-29 エクスバイオテク インコーポレーティッド IL-1α immunization to induce autoantibodies that are protective against atherosclerosis
US20110008282A1 (en) * 2006-05-15 2011-01-13 Xbiotech, Inc. IL-1alpha immunization induces autoantibodies protective against atherosclerosis
ES2374845T3 (en) * 2006-05-22 2012-02-22 Xbiotech, Inc CANCER TREATMENT WITH ANTI-IL-1 ANTIBODIES.
CA2737056C (en) * 2008-09-12 2018-10-30 Xbiotech Inc. Targeting pathogenic monocytes
AU2015271978B2 (en) * 2010-08-23 2017-10-26 Xbiotech Inc. Treatment for neoplastic diseases
CN103442733A (en) * 2011-04-01 2013-12-11 埃克斯生物科技公司 Treatment of Dermatological Conditions
CN102296050B (en) * 2011-05-30 2013-04-03 苏州大学 Anti-human IL-1alpha monoclonal antibody and application thereof
US10466160B2 (en) 2011-08-01 2019-11-05 Celsee Diagnostics, Inc. System and method for retrieving and analyzing particles
ES2797448T3 (en) 2011-08-01 2020-12-02 Bio Rad Laboratories Cell capture system
PT2750709T (en) * 2011-09-23 2018-11-22 Xbiotech Inc CAKEXIA TREATMENT
CN102636655B (en) * 2012-05-10 2014-07-23 苏州大学附属第一医院 Fluorescence in-situ micro-lymphocytotoxicity detection method and kit
US9545441B2 (en) 2012-09-18 2017-01-17 Xbiotech, Inc. Treatment of diabetes
EP2903643A4 (en) * 2012-10-04 2016-06-15 Xbiotech Inc TREATMENT OF PSYCHIATRIC DISORDERS
US9752181B2 (en) 2013-01-26 2017-09-05 Denovo Sciences, Inc. System and method for capturing and analyzing cells
US9707562B2 (en) 2013-03-13 2017-07-18 Denovo Sciences, Inc. System for capturing and analyzing cells
US10391490B2 (en) 2013-05-31 2019-08-27 Celsee Diagnostics, Inc. System and method for isolating and analyzing cells
US10278120B2 (en) * 2014-01-16 2019-04-30 Industry-University Cooperation Foundation Hanyang University Method for controlling small cell and apparatus for same
RU2556816C1 (en) * 2014-03-12 2015-07-20 Открытое акционерное общество "Фармацевтический импорт, экспорт" (ОАО "Фармимэкс") Strain of cells of chinese hamster ovaries - producer of recombinant antibody against tumour necrosis factor alpha of human being
US20160099559A1 (en) * 2014-10-01 2016-04-07 Continental Automotive Systems, Inc. Overcurrent protection for an automotive instrument cluster
CN105573555B (en) * 2016-01-28 2018-06-29 京东方科技集团股份有限公司 A kind of pressure touch structure, touch-control display panel, display device
CN111295245B (en) 2017-08-29 2021-03-16 伯乐实验室有限公司 Systems and methods for isolating and analyzing cells
JP2019043215A (en) 2017-08-30 2019-03-22 いすゞ自動車株式会社 Steering device
MX2020011295A (en) * 2018-04-24 2020-11-18 Janssen Biotech Inc Treatment of atopic dermatitis.
US10633693B1 (en) 2019-04-16 2020-04-28 Celsee Diagnostics, Inc. System and method for leakage control in a particle capture system
CN113874034A (en) * 2019-05-03 2021-12-31 苏黎世大学 Treatment of cerebral ischemia reperfusion injury
JP7413408B2 (en) 2019-05-07 2024-01-15 バイオ-ラッド ラボラトリーズ インコーポレイテッド Systems and methods for automated single cell processing
US11273439B2 (en) 2019-05-07 2022-03-15 Bio-Rad Laboratories, Inc. System and method for target material retrieval from microwells
GB201907540D0 (en) * 2019-05-29 2019-07-10 Univ Of Lancaster Improvements relating to electronic memory devices
CN111471655B (en) * 2020-03-19 2023-07-07 湖州正熙医学检验实验室有限公司 Anti-human IL12/23 stable transgenic cell strain and construction method and application thereof
CA3095675A1 (en) 2020-10-07 2022-04-07 Xbiotech Inc. True human antibody specific for interleukin 1 alpha (il-1a)
CA3095679A1 (en) * 2020-10-07 2022-04-07 Xbiotech Inc. True human antibody specific for interleuken 1 alpha (il-1a)
CA3095676A1 (en) 2020-10-07 2022-04-07 Xbiotech Inc. True human antibody specific for interleukin 1 alpha (il-1a)
CA3095740A1 (en) * 2020-10-07 2022-04-07 Xbiotech Inc. True human antibody specific for interleukin alpha (il-1a)
WO2024065083A1 (en) * 2022-09-26 2024-04-04 成都优洛生物科技有限公司 METHOD FOR TESTING IN-VIVO DRUG EFFICACY OF IL-1α ANTIBODY IN NON-MURINE MAMMALS
CN117957250A (en) * 2022-12-20 2024-04-30 成都优洛生物科技有限公司 An antibody or antigen-binding fragment targeting IL-1α and its application

Citations (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4634664A (en) 1982-01-22 1987-01-06 Sandoz Ltd. Process for the production of human mono-clonal antibodies
WO1990006371A1 (en) 1988-12-08 1990-06-14 Commissariat A L'energie Atomique ANTI-INTERLEUKINE 1α AND 1β MONOCLONAL ANTIBODIES, METHOD FOR PRODUCING THE SAME AND APPLICATIONS OF SAID ANTIBODIES TO THE DETECTION OF INTERLEUKINES 1α AND 1β AND TO THERAPY
US4965198A (en) 1985-12-24 1990-10-23 Konica Corporation Monoclonal antibody and method of manufacturing hybridoma producing the same
US5034316A (en) 1987-03-30 1991-07-23 The Regents Of The University Of California In vitro human monoclonal IgG rheumatoid factor autoantibody
US5168062A (en) 1985-01-30 1992-12-01 University Of Iowa Research Foundation Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence
US5231024A (en) 1986-09-13 1993-07-27 Basf Aktiengesellschaft Monoclonal antibodies against human tumor necrosis factor (tnf), and use thereof
WO1996035719A1 (en) 1995-05-12 1996-11-14 The National Blood Authority Transeptithelial transport of molecular species
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5654407A (en) 1993-03-05 1997-08-05 Bayer Corporation Human anti-TNF antibodies
US5792838A (en) 1991-10-28 1998-08-11 Glaxo Wellcome Inc. Method for stabilizing immunoglobulin compositions
US5795967A (en) 1984-07-05 1998-08-18 Genentech, Inc. Tumor necrosis factor antagonists and their use
US5932188A (en) 1992-10-14 1999-08-03 Sterling Winthrop Inc. Therapeutic and diagnostic imaging compositions and methods
US5959085A (en) 1993-11-23 1999-09-28 Schering Corporation Human monoclonal antibodies against human cytokines and methods of making and using such antibodies
US6090382A (en) 1996-02-09 2000-07-18 Basf Aktiengesellschaft Human antibodies that bind human TNFα
US6140470A (en) 1995-06-30 2000-10-31 Yale University Human monoclonal anti-tumor antibodies
US20030026806A1 (en) 2000-10-27 2003-02-06 Amgen Inc. Antibodies and other selective IL-1 binding agents that allow binding to IL-1 receptor but not activation thereof
US20030040617A9 (en) 1999-03-12 2003-02-27 Rosen Craig A. Nucleic acids, proteins and antibodies
US20030232054A1 (en) 2000-01-25 2003-12-18 Tang Y. Tom Novel nucleic acids and polypeptides
US20040185514A1 (en) 1998-07-03 2004-09-23 Athera Biotechnologies Ab Method of diagnosing cadiovascular disease
WO2004100987A2 (en) 2003-05-06 2004-11-25 Regeneron Pharmaceuticals, Inc. Methods of using il-1 antagonists to treat neointimal hyperplasia
US20050054019A1 (en) 2003-08-04 2005-03-10 Michaud Neil R. Antibodies to c-Met
US20050147603A1 (en) 2003-12-24 2005-07-07 Smith Henry J. Autoantibodies utilized as carrier agents for pharmaceutical compounds used in tumor imaging and cancer treatment
US20060159775A1 (en) 2004-02-03 2006-07-20 Mcgrath Michael S Chlorite in the treatment of neurodegenerative disease
WO2007015128A1 (en) 2005-08-02 2007-02-08 Xbiotech Inc. DIAGNOSIS, TREATMENT, AND PREVENTION OF VASCULAR DISORDERS USING IL-1α AUTOANTIBODIES
US20070071675A1 (en) 2005-08-19 2007-03-29 Chengbin Wu Dual variable domain immunoglobulin and uses thereof
WO2007039552A1 (en) 2005-09-28 2007-04-12 Cytos Biotechnology Ag Interleukin-1 conjugates and uses thereof
WO2007132338A2 (en) 2006-05-15 2007-11-22 Xbiotech Inc. IL-1α IMMUNIZATION INDUCES AUTOANTIBODIES PROTECTIVE AGAINST ATHEROSCLEROSIS
WO2007135546A2 (en) 2006-05-22 2007-11-29 Xbiotech Inc. TREATMENT OF CANCER WITH ANTI-IL-1α ANTIBODIES
US20080050310A1 (en) 2006-05-30 2008-02-28 Genentech, Inc. Antibodies and immunoconjugates and uses therefor
US20090298096A1 (en) 2008-05-30 2009-12-03 Xbiotech, Inc. Interleukin-1 alpha ABS and methods of use
WO2010030979A2 (en) 2008-09-12 2010-03-18 Xbiotech, Inc. Targeting pathogenic monocytes

Family Cites Families (44)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4510245A (en) 1982-11-18 1985-04-09 Chiron Corporation Adenovirus promoter system
US4968615A (en) 1985-12-18 1990-11-06 Ciba-Geigy Corporation Deoxyribonucleic acid segment from a virus
DK590387A (en) 1986-11-13 1988-05-14 Otsuka Pharma Co Ltd ANTIBODIES AGAINST INTERLEUKIN-1
US5750172A (en) 1987-06-23 1998-05-12 Pharming B.V. Transgenic non human mammal milk
US4968607A (en) 1987-11-25 1990-11-06 Immunex Corporation Interleukin-1 receptors
US20040101528A1 (en) * 1988-02-25 2004-05-27 Dower Steven K. Type I IL-1 receptors
US5407431A (en) 1989-07-11 1995-04-18 Med-Design Inc. Intravenous catheter insertion device with retractable needle
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US5633076A (en) 1989-12-01 1997-05-27 Pharming Bv Method of producing a transgenic bovine or transgenic bovine embryo
DK0804070T3 (en) 1993-03-09 2000-08-07 Genzyme Corp Method for isolating proteins from milk
EP0659766A1 (en) 1993-11-23 1995-06-28 Schering-Plough Human monoclonal antibodies against human cytokines and methods of making and using such antibodies
US5827690A (en) 1993-12-20 1998-10-27 Genzyme Transgenics Corporatiion Transgenic production of antibodies in milk
US6046037A (en) 1994-12-30 2000-04-04 Hiatt; Andrew C. Method for producing immunoglobulins containing protection proteins in plants and their use
AU3395900A (en) * 1999-03-12 2000-10-04 Human Genome Sciences, Inc. Human lung cancer associated gene sequences and polypeptides
CA2796140A1 (en) * 1999-03-25 2000-09-28 Jochen Salfeld Human antibodies that bind human il-12 and methods for producing
US6617135B1 (en) * 1999-08-09 2003-09-09 Emd Lexigen Research Center Corp. Multiple cytokine protein complexes
DE19943790C2 (en) 1999-09-13 2001-11-15 Ericsson Telefon Ab L M Method and device for determining a synchronization error in a network node
US6399857B1 (en) * 1999-09-22 2002-06-04 Paradigm Genetics, Inc. Modified nucleotide sequence encoding a LexA DNA binding domain optimized for arabidopsis species
US6380129B1 (en) 1999-11-02 2002-04-30 Richard J. Kraemer Enhanced materials for treatment of contamination
US6623736B2 (en) 2000-05-02 2003-09-23 Edward L. Tobinick Interleukin antagonists for the treatment of neurological, retinal and muscular disorders
AU2007202323C1 (en) 2000-06-29 2012-04-12 Abbvie Inc. Dual specificity antibodies and methods of making and using
US20040086507A1 (en) 2000-10-19 2004-05-06 Kenya Shitara Antibody inhibiting vplf activity
US7595378B2 (en) * 2001-06-13 2009-09-29 Genmab A/S Human monoclonal antibodies to epidermal growth factor receptor (EGFR)
AR036833A1 (en) * 2001-10-18 2004-10-06 Bayer Corp HUMAN ANTIBODIES THAT JOIN MN AND HAVE NEUTRALIZING ACTIVITY OF CELLULAR ADHESION.
US7273888B2 (en) 2001-11-16 2007-09-25 Als Therapy Development Foundation, Inc. Use of difluoromethylornithine (DFMO) for the treatment of amyotrophic lateral sclerosis
CA2476166C (en) * 2002-02-14 2011-11-15 Immunomedics, Inc. Anti-cd20 antibodies and fusion proteins thereof and methods of use
JP4450644B2 (en) 2003-03-03 2010-04-14 日本化薬株式会社 Pharmaceutical preparations containing AMFs as active ingredients
US20070025961A1 (en) * 2003-06-03 2007-02-01 Kenzo Bamba Composition for stabilizing survival of transplanted hematopoietic stem cell, kit for obtaining the composition, method of stabilizing survival of transplanted hematopoietic stem cell, human monoclonal antibody or human polyclonal antibody and method of producing the same, gene encoding human monoclonal antibody and transf
KR100493102B1 (en) 2003-06-30 2005-06-02 삼성전자주식회사 Hinge device for portable terminal with sub housing stopper
WO2006001967A2 (en) 2004-05-25 2006-01-05 Sloan-Kettering Institute For Cancer Research Migrastatin analogs in the treatment of cancer
US20050276807A1 (en) 2004-06-15 2005-12-15 Advanced Biotherapy, Inc. Treatment of acne
US7718674B2 (en) 2004-09-27 2010-05-18 Bridge Pharma, Inc. Methods of relieving neuropathic pain with the S-isomer of 2-{2[N-(2-indanyl)-N-phenylamino]ethyl}piperidine
CA2591148A1 (en) 2004-12-09 2006-06-15 Centocor, Inc. Anti-integrin immunoconjugates, methods and uses
US20090215992A1 (en) 2005-08-19 2009-08-27 Chengbin Wu Dual variable domain immunoglobulin and uses thereof
JP2009531295A (en) * 2006-02-22 2009-09-03 ユニバーシティ オブ チューリッヒ Methods for treating autoimmune or demyelinating diseases
BRPI0709977A2 (en) 2006-04-14 2011-08-02 Novartis Ag Use of IL-1 Antibodies for the Treatment of Ophthalmic Disorders
US8945564B2 (en) * 2006-04-21 2015-02-03 Novartis Ag Antagonist anti-CD40 antibody pharmaceutical compositions
CA2664738C (en) * 2006-09-29 2017-03-07 Oncomed Pharmaceuticals, Inc. Compositions and methods for diagnosing and treating cancer
WO2008082651A2 (en) 2006-12-29 2008-07-10 Abbott Laboratories Dual-specific il-1a/ il-1b antibodies
US20090250345A1 (en) * 2008-04-03 2009-10-08 Protea Biosciences, Inc. Microfluidic electroelution devices & processes
EP3632444A3 (en) 2008-04-15 2020-08-26 SARcode Bioscience Inc. Topical lfa-1 antagonists for use in localized treatment of immune related disorders
SG172855A1 (en) 2009-01-29 2011-08-29 Abbott Lab Il-1 binding proteins
CN102655880A (en) 2009-10-15 2012-09-05 雅培制药有限公司 IL-1 binding proteins
US9724409B2 (en) 2011-04-01 2017-08-08 Xbiotech, Inc. Treatment of inflammatory skin disease

Patent Citations (35)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4634664A (en) 1982-01-22 1987-01-06 Sandoz Ltd. Process for the production of human mono-clonal antibodies
US5795967A (en) 1984-07-05 1998-08-18 Genentech, Inc. Tumor necrosis factor antagonists and their use
US5168062A (en) 1985-01-30 1992-12-01 University Of Iowa Research Foundation Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence
US4965198A (en) 1985-12-24 1990-10-23 Konica Corporation Monoclonal antibody and method of manufacturing hybridoma producing the same
US5231024A (en) 1986-09-13 1993-07-27 Basf Aktiengesellschaft Monoclonal antibodies against human tumor necrosis factor (tnf), and use thereof
US5034316A (en) 1987-03-30 1991-07-23 The Regents Of The University Of California In vitro human monoclonal IgG rheumatoid factor autoantibody
WO1990006371A1 (en) 1988-12-08 1990-06-14 Commissariat A L'energie Atomique ANTI-INTERLEUKINE 1α AND 1β MONOCLONAL ANTIBODIES, METHOD FOR PRODUCING THE SAME AND APPLICATIONS OF SAID ANTIBODIES TO THE DETECTION OF INTERLEUKINES 1α AND 1β AND TO THERAPY
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5693762A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Humanized immunoglobulins
US5792838A (en) 1991-10-28 1998-08-11 Glaxo Wellcome Inc. Method for stabilizing immunoglobulin compositions
US5932188A (en) 1992-10-14 1999-08-03 Sterling Winthrop Inc. Therapeutic and diagnostic imaging compositions and methods
US5654407A (en) 1993-03-05 1997-08-05 Bayer Corporation Human anti-TNF antibodies
US5959085A (en) 1993-11-23 1999-09-28 Schering Corporation Human monoclonal antibodies against human cytokines and methods of making and using such antibodies
WO1996035719A1 (en) 1995-05-12 1996-11-14 The National Blood Authority Transeptithelial transport of molecular species
US6140470A (en) 1995-06-30 2000-10-31 Yale University Human monoclonal anti-tumor antibodies
US6090382A (en) 1996-02-09 2000-07-18 Basf Aktiengesellschaft Human antibodies that bind human TNFα
US20040185514A1 (en) 1998-07-03 2004-09-23 Athera Biotechnologies Ab Method of diagnosing cadiovascular disease
US20030040617A9 (en) 1999-03-12 2003-02-27 Rosen Craig A. Nucleic acids, proteins and antibodies
US20030232054A1 (en) 2000-01-25 2003-12-18 Tang Y. Tom Novel nucleic acids and polypeptides
US20030026806A1 (en) 2000-10-27 2003-02-06 Amgen Inc. Antibodies and other selective IL-1 binding agents that allow binding to IL-1 receptor but not activation thereof
WO2004100987A2 (en) 2003-05-06 2004-11-25 Regeneron Pharmaceuticals, Inc. Methods of using il-1 antagonists to treat neointimal hyperplasia
US20050054019A1 (en) 2003-08-04 2005-03-10 Michaud Neil R. Antibodies to c-Met
US20050147603A1 (en) 2003-12-24 2005-07-07 Smith Henry J. Autoantibodies utilized as carrier agents for pharmaceutical compounds used in tumor imaging and cancer treatment
US20060159775A1 (en) 2004-02-03 2006-07-20 Mcgrath Michael S Chlorite in the treatment of neurodegenerative disease
US20090123415A1 (en) 2005-08-02 2009-05-14 Xbiotech, Inc. Diagnosis, treatment, and prevention of vascular disorders using il-1 autoantibodies
WO2007015128A1 (en) 2005-08-02 2007-02-08 Xbiotech Inc. DIAGNOSIS, TREATMENT, AND PREVENTION OF VASCULAR DISORDERS USING IL-1α AUTOANTIBODIES
US20070071675A1 (en) 2005-08-19 2007-03-29 Chengbin Wu Dual variable domain immunoglobulin and uses thereof
WO2007039552A1 (en) 2005-09-28 2007-04-12 Cytos Biotechnology Ag Interleukin-1 conjugates and uses thereof
WO2007132338A2 (en) 2006-05-15 2007-11-22 Xbiotech Inc. IL-1α IMMUNIZATION INDUCES AUTOANTIBODIES PROTECTIVE AGAINST ATHEROSCLEROSIS
WO2007135546A2 (en) 2006-05-22 2007-11-29 Xbiotech Inc. TREATMENT OF CANCER WITH ANTI-IL-1α ANTIBODIES
US20100040574A1 (en) 2006-05-22 2010-02-18 Xbiotech Inc. TREATMENT OF CANCER WITH ANTI-IL-1alpha ANTIBODIES
US20080050310A1 (en) 2006-05-30 2008-02-28 Genentech, Inc. Antibodies and immunoconjugates and uses therefor
US20090298096A1 (en) 2008-05-30 2009-12-03 Xbiotech, Inc. Interleukin-1 alpha ABS and methods of use
WO2010030979A2 (en) 2008-09-12 2010-03-18 Xbiotech, Inc. Targeting pathogenic monocytes
US20100068212A1 (en) 2008-09-12 2010-03-18 Xbiotech, Inc. Targeting pathogenic monocytes

Non-Patent Citations (49)

* Cited by examiner, † Cited by third party
Title
Apte, Ron N., et al., Effects of micro-environment- and malignant cell-derived interleukin-1 in carcinogenesis, tumour invasiveness and tumour-host interactions, European Journal of Cancer, 2006, vol. 42:751-759.
Bendtzen, Klaus et al., Detection of Autoantibodies to Cytokines, Molecular Biotechnology, 2000, vol. 14.
Bendtzen, Klaus et al., High-Avidity Autoantibodies to Cytokines, Trends Immunology Today, May 1998, vol. 19, No. 5 209.
Braddock, M. et al., Therapeutic potential of targeting IL-1 and IL-18 in inflammation, Expert Opin. Biol. Ther., 2004, vol. 4, No. 6:8476-860.
Clinton Steven K. et al., Interleukin-1 gene expression in rabbit vascular tissue in vivo, American Journal of Pathology, Apr. 1991, vol. 138, No. 4:1005-1014.
Dardik, Alan et al., Shear stress-stimulated endothelial cells induce smooth muscle cell chemotaxis via platelet-derived growth factor-BB and interleukin-1alpha, Journal of Vascular Surgergy, Feb. 2005, vol. 41:321-331.
Dinarello, Charles A. et al., Anticytokine strategies in the treatment of the systemic inflammatory response syndrome, The Journal of the American Medical Association, Apr. 1993, vol. 269, No. 14:1829-1835.
Dinarello, Charles A., Biologic basis for interleukin-1 in disease, BLOOD, Mar. 1996, vol. 87, No. 6:2095-2147.
Dinarello, Charles A., Modalities for reducing interleukin 1 activity in disease, TiPS, May 1993, vol. 14:155-159.
Dinarello, Charles A., The role of interleukin-1 in disease, The New England Journal of Medicine, 1993, vol. 328, No. 2:106-113.
Dinarello, Charles A., Therapeutic strategies to reduce IL-1 activity in treating local and system inflammation, Current Opinion in Pharmacology, 2004, vol. 4:378-385.
Eugui et al. Proc. Natl. Acad. Sc. USA., 1990, vol. 87, pp. 1305-1309. *
Garrone, P. et al., Generation and characterization of a human monoclonal autoantibody that acts as a high affinity interleukin-1 alpha specific inhibitor, Molecular Immunology, 1996, vol. 33. No. 78:649-658.
GenBank entry AY510107.1, Homosapiens 9F11 monoclonal IgM antibody light chain mRNA, complete cds, 2005 (retrieved from the Internet on Apr. 23, 2010, .
GenBank entry AY510107.1, Homosapiens 9F11 monoclonal IgM antibody light chain mRNA, complete cds, 2005 (retrieved from the Internet on Apr. 23, 2010, <http://www.ncbi.nlm.nih.gov/nuccore/41388185>.
Griffiths, Andrew D. et al., Human anti-self antibodies with high specificity from phage display libraries, the EMBO Journal, 1993, vol. 12, No. 2:725-734.
Hansen, M. B. et al., Sex- and age-dependency of IgG auto-antibodies against IL-1alpha in healthy humans, European Journal of Clinical Investigation, 1994, vol. 24:212:218.
Horai, R. et al., Production of mice deficient in genes for interleukin (IL)-1alpha, IL-1beta, IL-1alpha/beta, and IL-1 receptor antagonist shows that IL-1beta is crucial in turpentine-induced fever development and glucocorticoid secretion, J. Exp. Med, 1998, vol. 187, No. 9:1463-1475.
Immunobiology, Janeway et al., The immune system in health and disease, 3rd edition, 1997, section 3.4 and figure 3.4. *
Ito, R. et al., Interleukin 1alpha acts as an autocrine growth stimulator for human gastric carcinoma cells, Cancer Research, Sep. 1993, vol. 53:4102-4106.
Jouvenne, P. et al., High levels of neutralizing autoantibodies against IL-1alpha are associated with a better prognosis in chronic polyarthritis: a follow-up study, Scand. J. Immunol., 1997, vol. 46:413-418.
Kanai, T. et al., Extracorporeal elimination of TNF-alpha-producing CD14 dull CD16+ monocytes in leukocytapheresis therapy for ulcerative colitis, Inflamm Bowel Dis, Mar. 2007, vol. 13, No. 3:284-290.
Kasahara, T. et al., Preparation and characterization of polyclonal and monoclonal antibodies against human interleukin 1 alpha (IL 1alpha), The Journal of Immunology, Mar. 1987, vol. 138, No. 6:1804-1812.
Larrick, James W. et al., Prospects for the therapeutic use of human monoclonal antibodies, Journal of Biological Response Modifiers, 1986, vol. 5:379-393.
Lindqvist, E. et al., Prognostic laboratory markers of joint damage in rheumatoid arthritis, Ann Rheum Dis, 2005, vol. 64:196-201.
Mariotti, Massimo et al., Interleukin 1 alpha is a marker of endothelial cellular senescent, Immunity & Ageing, Apr. 2006:1-6.
McHale, Julie F. et al., TNF-alpha and IL- sequentially induce endothelial ICAM-1 and VCAM-1 expression in MRL/Ipr lupus-prone mice, The American Association of Immunologists, 1999, vol. 163:3993-4000.
Merhi-Soussi, F. et al., Interleukin-1 plays a major role in vascular inflammation and atherosclerosis in male apoliprotein E-knockout mice, Cardiovacular Research, 2006, vol. 66:583-593.
Miossec, R, Anti-interleukin 1alpha autoantibodies, Ann Rheum Dis, 2002, vol. 61:577-579.
Niki, Yasuo et al., Membrane-associated IL-1 contributes to Chronic Synovitis and cartilage destruction in human IL-1alpha transgenic mice, The Journal of Immunology, 2004:577-584.
Ogushi, F. et al., Autoantibodies to IL-1alpha in sera from rapidly progressive idiopathic pulmonary fibrosis, The Journal of Medical Investigation, 2001, vol. 48:181-189.
Ross, C. et al., Increased in vivo antibody activity against interferon alpha, interleuking-1alpha, and interleukin-6 after high-dose Ig therapy, Blood, Sep. 1997, vol. 90, No. 6:2376-2380.
Ross, Christian, et al., High avidity IFN-neutralizing antibodies in pharmaceutically prepared human IgG, J. Clin. Invest., May 1995, vol. 95:1974-1978.
Sandborg, Christy L. et al., Modulation of IL-1alpha, IL-1 beta, and 25K Mr Non-IL-1 activity released by human mononuclear cells, Journal of Leukocyte Biology, 1989, vol. 46:417-427.
Satoh, H. et al., Characterization of anti-IL-1alpha autoantibodies in the sera from healthy humans, Immunopharmacology, 1994, vol. 27:107-118.
Saurat, Jean-Hilaire, et al., Anti-interleukin-1alpoha autoantibodies in humans: Characterization, isotype distribution, and receptor-binding inhibition-Higher frequency in Schnitzler's syndrome (urticaria and macroglobulinemia), J. Allergy Clin. Immunol., Aug. 1991, vol. 88, No. 2:243-256.
Shirakawa, F. et al., Autocrine stimulation of interleukin 1alpha in the growth of adult human T-cell leukemia cells, Cancer Rsearch, Mar. 1089, vol. 49:1143-1147.
Sunahara, N. et al., Differential determination of recombinant hum interleukin-1 alpha and its deamidated derivative by two sandwhich enzyme immunoassays using monoclonal antibodies. Comparison with a polyclonal antibody-based competitive enzyme immunoassay., J Immunol Methods, 1989, vol. 119:75-82 (Abstract only).
Suzuki, Hiroshi et al., Demonstration of Neutralizing Autoantibodies against II-1alpha IN sera from patients with rheumatoid arthritis, The Journal of Immunology, Oct. 1, 1990, vol. 145, No. 7:2140-2146.
Svenson, M. et al., Antibody to granulocyte-macrophage colony-stimulating factor is a dominant anti-cytokine activity in human IgG preparations, Blood, Mar. 1998, vol. 91, No. 6:2054-2061.
Svenson, M. et al., Binding of Cytokines to Pharmaceutically Prepared Human Immunoglobulin, J. Clin. Invest., Nov. 1993, vol. 92:2533-2539.
Svenson, M. et al., Cytokine vaccination: neutralising IL-1alpha autoantibodies induced by immunisation with homologous IL-1alpha, Journal of immunological methods, 2000:1-8.
Svenson, M. et al., Distribution and characterization of autoantibodies to interleukin 1 alpha in normal human sera, Scand. J. Immunol., 1990, vol. 32:695-701.
Svenson, M. et al., Effects of human anti-IL-1alpha autoantibodies on receptor binding and biological activities of IL-1 alpha, CYTOKINE, Mar. 1992, vol. 4, No. 2:125-133.
Svenson, M. et al., IgG Autoantibodies against Interleuking 1alpha in sera of normal individuals, Scand. J. Immunol., 1989, vol. 29:489-492.
Von Der Thusen, Jan H., et al., Interleukins in atherosclerosis: Molecular pathways and therapeutic potential, Pharmacol Rev, 2003, vol. 55, No. 1:133-166.
Waehre et al., Increased expression of interleukin-1 in coronary artery disease with downregulatory effects of HMG-CoA reductase inhibitors, <<circ.ahajournals.org>>, downloaded on Jan. 15, 2008:1966-1972.
Waehre et al., Increased expression of interleukin-1 in coronary artery disease with downregulatory effects of HMG-CoA reductase inhibitors, >, downloaded on Jan. 15, 2008:1966-1972.
Wake, R. et al., Gender differences in ischemic heart disease, Recent Patents on Cardiovascular Drug Discovery, 2009, vol. 4:234-240.

Cited By (1035)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12029423B2 (en) 2004-07-28 2024-07-09 Cilag Gmbh International Surgical stapling instrument comprising a staple cartridge
US11882987B2 (en) 2004-07-28 2024-01-30 Cilag Gmbh International Articulating surgical stapling instrument incorporating a two-piece E-beam firing mechanism
US10278702B2 (en) 2004-07-28 2019-05-07 Ethicon Llc Stapling system comprising a firing bar and a lockout
US11890012B2 (en) 2004-07-28 2024-02-06 Cilag Gmbh International Staple cartridge comprising cartridge body and attached support
US10293100B2 (en) 2004-07-28 2019-05-21 Ethicon Llc Surgical stapling instrument having a medical substance dispenser
US11896225B2 (en) 2004-07-28 2024-02-13 Cilag Gmbh International Staple cartridge comprising a pan
US10292707B2 (en) 2004-07-28 2019-05-21 Ethicon Llc Articulating surgical stapling instrument incorporating a firing mechanism
US10314590B2 (en) 2004-07-28 2019-06-11 Ethicon Llc Articulating surgical stapling instrument incorporating a two-piece e-beam firing mechanism
US10799240B2 (en) 2004-07-28 2020-10-13 Ethicon Llc Surgical instrument comprising a staple firing lockout
US10383634B2 (en) 2004-07-28 2019-08-20 Ethicon Llc Stapling system incorporating a firing lockout
US11684365B2 (en) 2004-07-28 2023-06-27 Cilag Gmbh International Replaceable staple cartridges for surgical instruments
US11963679B2 (en) 2004-07-28 2024-04-23 Cilag Gmbh International Articulating surgical stapling instrument incorporating a two-piece E-beam firing mechanism
US11812960B2 (en) 2004-07-28 2023-11-14 Cilag Gmbh International Method of segmenting the operation of a surgical stapling instrument
US10485547B2 (en) 2004-07-28 2019-11-26 Ethicon Llc Surgical staple cartridges
US10716563B2 (en) 2004-07-28 2020-07-21 Ethicon Llc Stapling system comprising an instrument assembly including a lockout
US11998198B2 (en) 2004-07-28 2024-06-04 Cilag Gmbh International Surgical stapling instrument incorporating a two-piece E-beam firing mechanism
US11135352B2 (en) 2004-07-28 2021-10-05 Cilag Gmbh International End effector including a gradually releasable medical adjunct
US11116502B2 (en) 2004-07-28 2021-09-14 Cilag Gmbh International Surgical stapling instrument incorporating a two-piece firing mechanism
US10568629B2 (en) 2004-07-28 2020-02-25 Ethicon Llc Articulating surgical stapling instrument
US10687817B2 (en) 2004-07-28 2020-06-23 Ethicon Llc Stapling device comprising a firing member lockout
US12011165B2 (en) 2004-07-28 2024-06-18 Cilag Gmbh International Surgical stapling instrument comprising replaceable staple cartridge
US11083456B2 (en) 2004-07-28 2021-08-10 Cilag Gmbh International Articulating surgical instrument incorporating a two-piece firing mechanism
US11771425B2 (en) 2005-08-31 2023-10-03 Cilag Gmbh International Stapling assembly for forming staples to different formed heights
US10245035B2 (en) 2005-08-31 2019-04-02 Ethicon Llc Stapling assembly configured to produce different formed staple heights
US11793512B2 (en) 2005-08-31 2023-10-24 Cilag Gmbh International Staple cartridges for forming staples having differing formed staple heights
US10278697B2 (en) 2005-08-31 2019-05-07 Ethicon Llc Staple cartridge comprising a staple driver arrangement
US11730474B2 (en) 2005-08-31 2023-08-22 Cilag Gmbh International Fastener cartridge assembly comprising a movable cartridge and a staple driver arrangement
US10271845B2 (en) 2005-08-31 2019-04-30 Ethicon Llc Fastener cartridge assembly comprising a cam and driver arrangement
US10271846B2 (en) 2005-08-31 2019-04-30 Ethicon Llc Staple cartridge for use with a surgical stapler
US11090045B2 (en) 2005-08-31 2021-08-17 Cilag Gmbh International Staple cartridges for forming staples having differing formed staple heights
US11399828B2 (en) 2005-08-31 2022-08-02 Cilag Gmbh International Fastener cartridge assembly comprising a fixed anvil and different staple heights
US11134947B2 (en) 2005-08-31 2021-10-05 Cilag Gmbh International Fastener cartridge assembly comprising a camming sled with variable cam arrangements
US11484312B2 (en) 2005-08-31 2022-11-01 Cilag Gmbh International Staple cartridge comprising a staple driver arrangement
US10245032B2 (en) 2005-08-31 2019-04-02 Ethicon Llc Staple cartridges for forming staples having differing formed staple heights
US10729436B2 (en) 2005-08-31 2020-08-04 Ethicon Llc Robotically-controlled surgical stapling devices that produce formed staples having different lengths
US11839375B2 (en) 2005-08-31 2023-12-12 Cilag Gmbh International Fastener cartridge assembly comprising an anvil and different staple heights
US10463369B2 (en) 2005-08-31 2019-11-05 Ethicon Llc Disposable end effector for use with a surgical instrument
US11484311B2 (en) 2005-08-31 2022-11-01 Cilag Gmbh International Staple cartridge comprising a staple driver arrangement
US11172927B2 (en) 2005-08-31 2021-11-16 Cilag Gmbh International Staple cartridges for forming staples having differing formed staple heights
US11179153B2 (en) 2005-08-31 2021-11-23 Cilag Gmbh International Staple cartridges for forming staples having differing formed staple heights
US10420553B2 (en) 2005-08-31 2019-09-24 Ethicon Llc Staple cartridge comprising a staple driver arrangement
US10932774B2 (en) 2005-08-31 2021-03-02 Ethicon Llc Surgical end effector for forming staples to different heights
US11246590B2 (en) 2005-08-31 2022-02-15 Cilag Gmbh International Staple cartridge including staple drivers having different unfired heights
US11576673B2 (en) 2005-08-31 2023-02-14 Cilag Gmbh International Stapling assembly for forming staples to different heights
US10321909B2 (en) 2005-08-31 2019-06-18 Ethicon Llc Staple cartridge comprising a staple including deformable members
US10869664B2 (en) 2005-08-31 2020-12-22 Ethicon Llc End effector for use with a surgical stapling instrument
US11272928B2 (en) 2005-08-31 2022-03-15 Cilag GmbH Intemational Staple cartridges for forming staples having differing formed staple heights
US10842488B2 (en) 2005-08-31 2020-11-24 Ethicon Llc Fastener cartridge assembly comprising a fixed anvil and different staple heights
US10842489B2 (en) 2005-08-31 2020-11-24 Ethicon Llc Fastener cartridge assembly comprising a cam and driver arrangement
US10806449B2 (en) 2005-11-09 2020-10-20 Ethicon Llc End effectors for surgical staplers
US10993713B2 (en) 2005-11-09 2021-05-04 Ethicon Llc Surgical instruments
US11793511B2 (en) 2005-11-09 2023-10-24 Cilag Gmbh International Surgical instruments
US11103269B2 (en) 2006-01-31 2021-08-31 Cilag Gmbh International Motor-driven surgical cutting and fastening instrument with tactile position feedback
US10653417B2 (en) 2006-01-31 2020-05-19 Ethicon Llc Surgical instrument
US11883020B2 (en) 2006-01-31 2024-01-30 Cilag Gmbh International Surgical instrument having a feedback system
US10893853B2 (en) 2006-01-31 2021-01-19 Ethicon Llc Stapling assembly including motor drive systems
US11890008B2 (en) 2006-01-31 2024-02-06 Cilag Gmbh International Surgical instrument with firing lockout
US11890029B2 (en) 2006-01-31 2024-02-06 Cilag Gmbh International Motor-driven surgical cutting and fastening instrument
US10842491B2 (en) 2006-01-31 2020-11-24 Ethicon Llc Surgical system with an actuation console
US10806479B2 (en) 2006-01-31 2020-10-20 Ethicon Llc Motor-driven surgical cutting and fastening instrument with tactile position feedback
US10918380B2 (en) 2006-01-31 2021-02-16 Ethicon Llc Surgical instrument system including a control system
US10299817B2 (en) 2006-01-31 2019-05-28 Ethicon Llc Motor-driven fastening assembly
US11944299B2 (en) 2006-01-31 2024-04-02 Cilag Gmbh International Surgical instrument having force feedback capabilities
US10952728B2 (en) 2006-01-31 2021-03-23 Ethicon Llc Powered surgical instruments with firing system lockout arrangements
US11278279B2 (en) 2006-01-31 2022-03-22 Cilag Gmbh International Surgical instrument assembly
US10743849B2 (en) 2006-01-31 2020-08-18 Ethicon Llc Stapling system including an articulation system
US10278722B2 (en) 2006-01-31 2019-05-07 Ethicon Llc Motor-driven surgical cutting and fastening instrument
US10959722B2 (en) 2006-01-31 2021-03-30 Ethicon Llc Surgical instrument for deploying fasteners by way of rotational motion
US10709468B2 (en) 2006-01-31 2020-07-14 Ethicon Llc Motor-driven surgical cutting and fastening instrument
US11648024B2 (en) 2006-01-31 2023-05-16 Cilag Gmbh International Motor-driven surgical cutting and fastening instrument with position feedback
US11224454B2 (en) 2006-01-31 2022-01-18 Cilag Gmbh International Motor-driven surgical cutting and fastening instrument with tactile position feedback
US10201363B2 (en) 2006-01-31 2019-02-12 Ethicon Llc Motor-driven surgical instrument
US10993717B2 (en) 2006-01-31 2021-05-04 Ethicon Llc Surgical stapling system comprising a control system
US11000275B2 (en) 2006-01-31 2021-05-11 Ethicon Llc Surgical instrument
US11801051B2 (en) 2006-01-31 2023-10-31 Cilag Gmbh International Accessing data stored in a memory of a surgical instrument
US10675028B2 (en) 2006-01-31 2020-06-09 Ethicon Llc Powered surgical instruments with firing system lockout arrangements
US10653435B2 (en) 2006-01-31 2020-05-19 Ethicon Llc Motor-driven surgical cutting and fastening instrument with tactile position feedback
US11648008B2 (en) 2006-01-31 2023-05-16 Cilag Gmbh International Surgical instrument having force feedback capabilities
US11020113B2 (en) 2006-01-31 2021-06-01 Cilag Gmbh International Surgical instrument having force feedback capabilities
US11793518B2 (en) 2006-01-31 2023-10-24 Cilag Gmbh International Powered surgical instruments with firing system lockout arrangements
US11051813B2 (en) 2006-01-31 2021-07-06 Cilag Gmbh International Powered surgical instruments with firing system lockout arrangements
US11051811B2 (en) 2006-01-31 2021-07-06 Ethicon Llc End effector for use with a surgical instrument
US11224427B2 (en) 2006-01-31 2022-01-18 Cilag Gmbh International Surgical stapling system including a console and retraction assembly
US11058420B2 (en) 2006-01-31 2021-07-13 Cilag Gmbh International Surgical stapling apparatus comprising a lockout system
US12161329B2 (en) 2006-01-31 2024-12-10 Cilag Gmbh International Surgical systems comprising a control circuit including a timer
US12433584B2 (en) 2006-01-31 2025-10-07 Cilag Gmbh International Robotically-controlled end effector
US11364046B2 (en) 2006-01-31 2022-06-21 Cilag Gmbh International Motor-driven surgical cutting and fastening instrument with tactile position feedback
US11612393B2 (en) 2006-01-31 2023-03-28 Cilag Gmbh International Robotically-controlled end effector
US11246616B2 (en) 2006-01-31 2022-02-15 Cilag Gmbh International Motor-driven surgical cutting and fastening instrument with tactile position feedback
US11350916B2 (en) 2006-01-31 2022-06-07 Cilag Gmbh International Endoscopic surgical instrument with a handle that can articulate with respect to the shaft
US10485539B2 (en) 2006-01-31 2019-11-26 Ethicon Llc Surgical instrument with firing lockout
US10463383B2 (en) 2006-01-31 2019-11-05 Ethicon Llc Stapling instrument including a sensing system
US10463384B2 (en) 2006-01-31 2019-11-05 Ethicon Llc Stapling assembly
US11166717B2 (en) 2006-01-31 2021-11-09 Cilag Gmbh International Surgical instrument with firing lockout
US11660110B2 (en) 2006-01-31 2023-05-30 Cilag Gmbh International Motor-driven surgical cutting and fastening instrument with tactile position feedback
US10426463B2 (en) 2006-01-31 2019-10-01 Ehticon LLC Surgical instrument having a feedback system
US12171508B2 (en) 2006-03-23 2024-12-24 Cilag Gmbh International Robotically-controlled surgical instrument with selectively articulatable end effector
US10213262B2 (en) 2006-03-23 2019-02-26 Ethicon Llc Manipulatable surgical systems with selectively articulatable fastening device
US10420560B2 (en) 2006-06-27 2019-09-24 Ethicon Llc Manually driven surgical cutting and fastening instrument
US11272938B2 (en) 2006-06-27 2022-03-15 Cilag Gmbh International Surgical instrument including dedicated firing and retraction assemblies
US10314589B2 (en) 2006-06-27 2019-06-11 Ethicon Llc Surgical instrument including a shifting assembly
US10172616B2 (en) 2006-09-29 2019-01-08 Ethicon Llc Surgical staple cartridge
US10595862B2 (en) 2006-09-29 2020-03-24 Ethicon Llc Staple cartridge including a compressible member
US11622785B2 (en) 2006-09-29 2023-04-11 Cilag Gmbh International Surgical staples having attached drivers and stapling instruments for deploying the same
US10448952B2 (en) 2006-09-29 2019-10-22 Ethicon Llc End effector for use with a surgical fastening instrument
US10568652B2 (en) 2006-09-29 2020-02-25 Ethicon Llc Surgical staples having attached drivers of different heights and stapling instruments for deploying the same
US11571231B2 (en) 2006-09-29 2023-02-07 Cilag Gmbh International Staple cartridge having a driver for driving multiple staples
US10206678B2 (en) 2006-10-03 2019-02-19 Ethicon Llc Surgical stapling instrument with lockout features to prevent advancement of a firing assembly unless an unfired surgical staple cartridge is operably mounted in an end effector portion of the instrument
US12178434B2 (en) 2006-10-03 2024-12-31 Cilag Gmbh International Surgical stapling system including control circuit to monitor clamping pressure
US11980366B2 (en) 2006-10-03 2024-05-14 Cilag Gmbh International Surgical instrument
US11877748B2 (en) 2006-10-03 2024-01-23 Cilag Gmbh International Robotically-driven surgical instrument with E-beam driver
US10342541B2 (en) 2006-10-03 2019-07-09 Ethicon Llc Surgical instruments with E-beam driver and rotary drive arrangements
US11382626B2 (en) 2006-10-03 2022-07-12 Cilag Gmbh International Surgical system including a knife bar supported for rotational and axial travel
US11064998B2 (en) 2007-01-10 2021-07-20 Cilag Gmbh International Surgical instrument with wireless communication between a control unit of a robotic system and remote sensor
US11166720B2 (en) 2007-01-10 2021-11-09 Cilag Gmbh International Surgical instrument including a control module for assessing an end effector
US11006951B2 (en) 2007-01-10 2021-05-18 Ethicon Llc Surgical instrument with wireless communication between control unit and sensor transponders
US12004743B2 (en) 2007-01-10 2024-06-11 Cilag Gmbh International Staple cartridge comprising a sloped wall
US10517682B2 (en) 2007-01-10 2019-12-31 Ethicon Llc Surgical instrument with wireless communication between control unit and remote sensor
US11134943B2 (en) 2007-01-10 2021-10-05 Cilag Gmbh International Powered surgical instrument including a control unit and sensor
US10517590B2 (en) 2007-01-10 2019-12-31 Ethicon Llc Powered surgical instrument having a transmission system
US11291441B2 (en) 2007-01-10 2022-04-05 Cilag Gmbh International Surgical instrument with wireless communication between control unit and remote sensor
US10433918B2 (en) 2007-01-10 2019-10-08 Ethicon Llc Surgical instrument system configured to evaluate the load applied to a firing member at the initiation of a firing stroke
US11666332B2 (en) 2007-01-10 2023-06-06 Cilag Gmbh International Surgical instrument comprising a control circuit configured to adjust the operation of a motor
US10952727B2 (en) 2007-01-10 2021-03-23 Ethicon Llc Surgical instrument for assessing the state of a staple cartridge
US10278780B2 (en) 2007-01-10 2019-05-07 Ethicon Llc Surgical instrument for use with robotic system
US11844521B2 (en) 2007-01-10 2023-12-19 Cilag Gmbh International Surgical instrument for use with a robotic system
US11931032B2 (en) 2007-01-10 2024-03-19 Cilag Gmbh International Surgical instrument with wireless communication between a control unit of a robotic system and remote sensor
US11350929B2 (en) 2007-01-10 2022-06-07 Cilag Gmbh International Surgical instrument with wireless communication between control unit and sensor transponders
US10945729B2 (en) 2007-01-10 2021-03-16 Ethicon Llc Interlock and surgical instrument including same
US10918386B2 (en) 2007-01-10 2021-02-16 Ethicon Llc Interlock and surgical instrument including same
US11937814B2 (en) 2007-01-10 2024-03-26 Cilag Gmbh International Surgical instrument for use with a robotic system
US11918211B2 (en) 2007-01-10 2024-03-05 Cilag Gmbh International Surgical stapling instrument for use with a robotic system
US11000277B2 (en) 2007-01-10 2021-05-11 Ethicon Llc Surgical instrument with wireless communication between control unit and remote sensor
US10751138B2 (en) 2007-01-10 2020-08-25 Ethicon Llc Surgical instrument for use with a robotic system
US11771426B2 (en) 2007-01-10 2023-10-03 Cilag Gmbh International Surgical instrument with wireless communication
US11812961B2 (en) 2007-01-10 2023-11-14 Cilag Gmbh International Surgical instrument including a motor control system
US12082806B2 (en) 2007-01-10 2024-09-10 Cilag Gmbh International Surgical instrument with wireless communication between control unit and sensor transponders
US11849947B2 (en) 2007-01-10 2023-12-26 Cilag Gmbh International Surgical system including a control circuit and a passively-powered transponder
US11839352B2 (en) 2007-01-11 2023-12-12 Cilag Gmbh International Surgical stapling device with an end effector
US11039836B2 (en) 2007-01-11 2021-06-22 Cilag Gmbh International Staple cartridge for use with a surgical stapling instrument
US10912575B2 (en) 2007-01-11 2021-02-09 Ethicon Llc Surgical stapling device having supports for a flexible drive mechanism
US11337693B2 (en) 2007-03-15 2022-05-24 Cilag Gmbh International Surgical stapling instrument having a releasable buttress material
US10702267B2 (en) 2007-03-15 2020-07-07 Ethicon Llc Surgical stapling instrument having a releasable buttress material
US10398433B2 (en) 2007-03-28 2019-09-03 Ethicon Llc Laparoscopic clamp load measuring devices
US11559302B2 (en) 2007-06-04 2023-01-24 Cilag Gmbh International Surgical instrument including a firing member movable at different speeds
US11857181B2 (en) 2007-06-04 2024-01-02 Cilag Gmbh International Robotically-controlled shaft based rotary drive systems for surgical instruments
US10368863B2 (en) 2007-06-04 2019-08-06 Ethicon Llc Robotically-controlled shaft based rotary drive systems for surgical instruments
US11154298B2 (en) 2007-06-04 2021-10-26 Cilag Gmbh International Stapling system for use with a robotic surgical system
US11672531B2 (en) 2007-06-04 2023-06-13 Cilag Gmbh International Rotary drive systems for surgical instruments
US11992208B2 (en) 2007-06-04 2024-05-28 Cilag Gmbh International Rotary drive systems for surgical instruments
US10363033B2 (en) 2007-06-04 2019-07-30 Ethicon Llc Robotically-controlled surgical instruments
US10327765B2 (en) 2007-06-04 2019-06-25 Ethicon Llc Drive systems for surgical instruments
US11911028B2 (en) 2007-06-04 2024-02-27 Cilag Gmbh International Surgical instruments for use with a robotic surgical system
US12035906B2 (en) 2007-06-04 2024-07-16 Cilag Gmbh International Surgical instrument including a handle system for advancing a cutting member
US11134938B2 (en) 2007-06-04 2021-10-05 Cilag Gmbh International Robotically-controlled shaft based rotary drive systems for surgical instruments
US10299787B2 (en) 2007-06-04 2019-05-28 Ethicon Llc Stapling system comprising rotary inputs
US11564682B2 (en) 2007-06-04 2023-01-31 Cilag Gmbh International Surgical stapler device
US11147549B2 (en) 2007-06-04 2021-10-19 Cilag Gmbh International Stapling instrument including a firing system and a closure system
US11648006B2 (en) 2007-06-04 2023-05-16 Cilag Gmbh International Robotically-controlled shaft based rotary drive systems for surgical instruments
US12023024B2 (en) 2007-06-04 2024-07-02 Cilag Gmbh International Robotically-controlled shaft based rotary drive systems for surgical instruments
US11998200B2 (en) 2007-06-22 2024-06-04 Cilag Gmbh International Surgical stapling instrument with an articulatable end effector
US11013511B2 (en) 2007-06-22 2021-05-25 Ethicon Llc Surgical stapling instrument with an articulatable end effector
US11849941B2 (en) 2007-06-29 2023-12-26 Cilag Gmbh International Staple cartridge having staple cavities extending at a transverse angle relative to a longitudinal cartridge axis
US12023025B2 (en) 2007-06-29 2024-07-02 Cilag Gmbh International Surgical stapling instrument having a releasable buttress material
US11925346B2 (en) 2007-06-29 2024-03-12 Cilag Gmbh International Surgical staple cartridge including tissue supporting surfaces
US10765432B2 (en) 2008-02-14 2020-09-08 Ethicon Llc Surgical device including a control system
US10905427B2 (en) 2008-02-14 2021-02-02 Ethicon Llc Surgical System
US10888330B2 (en) 2008-02-14 2021-01-12 Ethicon Llc Surgical system
US10542974B2 (en) 2008-02-14 2020-01-28 Ethicon Llc Surgical instrument including a control system
US11571212B2 (en) 2008-02-14 2023-02-07 Cilag Gmbh International Surgical stapling system including an impedance sensor
US10888329B2 (en) 2008-02-14 2021-01-12 Ethicon Llc Detachable motor powered surgical instrument
US11717285B2 (en) 2008-02-14 2023-08-08 Cilag Gmbh International Surgical cutting and fastening instrument having RF electrodes
US10238385B2 (en) 2008-02-14 2019-03-26 Ethicon Llc Surgical instrument system for evaluating tissue impedance
US11464514B2 (en) 2008-02-14 2022-10-11 Cilag Gmbh International Motorized surgical stapling system including a sensing array
US11446034B2 (en) 2008-02-14 2022-09-20 Cilag Gmbh International Surgical stapling assembly comprising first and second actuation systems configured to perform different functions
US10925605B2 (en) 2008-02-14 2021-02-23 Ethicon Llc Surgical stapling system
US12213671B2 (en) 2008-02-14 2025-02-04 Cilag Gmbh International Motorized system having a plurality of power sources
US10779822B2 (en) 2008-02-14 2020-09-22 Ethicon Llc System including a surgical cutting and fastening instrument
US10238387B2 (en) 2008-02-14 2019-03-26 Ethicon Llc Surgical instrument comprising a control system
US10806450B2 (en) 2008-02-14 2020-10-20 Ethicon Llc Surgical cutting and fastening instrument having a control system
US10682142B2 (en) 2008-02-14 2020-06-16 Ethicon Llc Surgical stapling apparatus including an articulation system
US10743851B2 (en) 2008-02-14 2020-08-18 Ethicon Llc Interchangeable tools for surgical instruments
US10682141B2 (en) 2008-02-14 2020-06-16 Ethicon Llc Surgical device including a control system
US10206676B2 (en) 2008-02-14 2019-02-19 Ethicon Llc Surgical cutting and fastening instrument
US10307163B2 (en) 2008-02-14 2019-06-04 Ethicon Llc Detachable motor powered surgical instrument
US11998206B2 (en) 2008-02-14 2024-06-04 Cilag Gmbh International Detachable motor powered surgical instrument
US10898194B2 (en) 2008-02-14 2021-01-26 Ethicon Llc Detachable motor powered surgical instrument
US10743870B2 (en) 2008-02-14 2020-08-18 Ethicon Llc Surgical stapling apparatus with interlockable firing system
US10639036B2 (en) 2008-02-14 2020-05-05 Ethicon Llc Robotically-controlled motorized surgical cutting and fastening instrument
US10265067B2 (en) 2008-02-14 2019-04-23 Ethicon Llc Surgical instrument including a regulator and a control system
US10470763B2 (en) 2008-02-14 2019-11-12 Ethicon Llc Surgical cutting and fastening instrument including a sensing system
US11801047B2 (en) 2008-02-14 2023-10-31 Cilag Gmbh International Surgical stapling system comprising a control circuit configured to selectively monitor tissue impedance and adjust control of a motor
US10905426B2 (en) 2008-02-14 2021-02-02 Ethicon Llc Detachable motor powered surgical instrument
US10463370B2 (en) 2008-02-14 2019-11-05 Ethicon Llc Motorized surgical instrument
US11638583B2 (en) 2008-02-14 2023-05-02 Cilag Gmbh International Motorized surgical system having a plurality of power sources
US10874396B2 (en) 2008-02-14 2020-12-29 Ethicon Llc Stapling instrument for use with a surgical robot
US11612395B2 (en) 2008-02-14 2023-03-28 Cilag Gmbh International Surgical system including a control system having an RFID tag reader
US10660640B2 (en) 2008-02-14 2020-05-26 Ethicon Llc Motorized surgical cutting and fastening instrument
US11484307B2 (en) 2008-02-14 2022-11-01 Cilag Gmbh International Loading unit coupleable to a surgical stapling system
US10716568B2 (en) 2008-02-14 2020-07-21 Ethicon Llc Surgical stapling apparatus with control features operable with one hand
US10722232B2 (en) 2008-02-14 2020-07-28 Ethicon Llc Surgical instrument for use with different cartridges
US10898195B2 (en) 2008-02-14 2021-01-26 Ethicon Llc Detachable motor powered surgical instrument
US11986183B2 (en) 2008-02-14 2024-05-21 Cilag Gmbh International Surgical cutting and fastening instrument comprising a plurality of sensors to measure an electrical parameter
US10390823B2 (en) 2008-02-15 2019-08-27 Ethicon Llc End effector comprising an adjunct
US11998194B2 (en) 2008-02-15 2024-06-04 Cilag Gmbh International Surgical stapling assembly comprising an adjunct applicator
US11154297B2 (en) 2008-02-15 2021-10-26 Cilag Gmbh International Layer arrangements for surgical staple cartridges
US10856866B2 (en) 2008-02-15 2020-12-08 Ethicon Llc Surgical end effector having buttress retention features
US11058418B2 (en) 2008-02-15 2021-07-13 Cilag Gmbh International Surgical end effector having buttress retention features
US11272927B2 (en) 2008-02-15 2022-03-15 Cilag Gmbh International Layer arrangements for surgical staple cartridges
US20210171623A1 (en) * 2008-05-30 2021-06-10 Janssen Biotech, Inc. Human antibody specific for interleukin-1alpha
US10485537B2 (en) 2008-09-23 2019-11-26 Ethicon Llc Motorized surgical instrument
US12029415B2 (en) 2008-09-23 2024-07-09 Cilag Gmbh International Motor-driven surgical cutting instrument
US10898184B2 (en) 2008-09-23 2021-01-26 Ethicon Llc Motor-driven surgical cutting instrument
US11406380B2 (en) 2008-09-23 2022-08-09 Cilag Gmbh International Motorized surgical instrument
US11648005B2 (en) 2008-09-23 2023-05-16 Cilag Gmbh International Robotically-controlled motorized surgical instrument with an end effector
US10456133B2 (en) 2008-09-23 2019-10-29 Ethicon Llc Motorized surgical instrument
US11045189B2 (en) 2008-09-23 2021-06-29 Cilag Gmbh International Robotically-controlled motorized surgical instrument with an end effector
US10980535B2 (en) 2008-09-23 2021-04-20 Ethicon Llc Motorized surgical instrument with an end effector
US11812954B2 (en) 2008-09-23 2023-11-14 Cilag Gmbh International Robotically-controlled motorized surgical instrument with an end effector
US10736628B2 (en) 2008-09-23 2020-08-11 Ethicon Llc Motor-driven surgical cutting instrument
US10420549B2 (en) 2008-09-23 2019-09-24 Ethicon Llc Motorized surgical instrument
US11871923B2 (en) 2008-09-23 2024-01-16 Cilag Gmbh International Motorized surgical instrument
US11517304B2 (en) 2008-09-23 2022-12-06 Cilag Gmbh International Motor-driven surgical cutting instrument
US11684361B2 (en) 2008-09-23 2023-06-27 Cilag Gmbh International Motor-driven surgical cutting instrument
US10765425B2 (en) 2008-09-23 2020-09-08 Ethicon Llc Robotically-controlled motorized surgical instrument with an end effector
US11103241B2 (en) 2008-09-23 2021-08-31 Cilag Gmbh International Motor-driven surgical cutting instrument
US11617575B2 (en) 2008-09-23 2023-04-04 Cilag Gmbh International Motor-driven surgical cutting instrument
US11617576B2 (en) 2008-09-23 2023-04-04 Cilag Gmbh International Motor-driven surgical cutting instrument
US10932778B2 (en) 2008-10-10 2021-03-02 Ethicon Llc Powered surgical cutting and stapling apparatus with manually retractable firing system
US11793521B2 (en) 2008-10-10 2023-10-24 Cilag Gmbh International Powered surgical cutting and stapling apparatus with manually retractable firing system
US11583279B2 (en) 2008-10-10 2023-02-21 Cilag Gmbh International Powered surgical cutting and stapling apparatus with manually retractable firing system
US11730477B2 (en) 2008-10-10 2023-08-22 Cilag Gmbh International Powered surgical system with manually retractable firing system
US11129615B2 (en) 2009-02-05 2021-09-28 Cilag Gmbh International Surgical stapling system
US10420550B2 (en) 2009-02-06 2019-09-24 Ethicon Llc Motor driven surgical fastener device with switching system configured to prevent firing initiation until activated
US10751076B2 (en) 2009-12-24 2020-08-25 Ethicon Llc Motor-driven surgical cutting instrument with electric actuator directional control assembly
US11291449B2 (en) 2009-12-24 2022-04-05 Cilag Gmbh International Surgical cutting instrument that analyzes tissue thickness
US12207835B2 (en) 2009-12-24 2025-01-28 Cilag Gmbh International Motor-driven surgical cutting instrument with electric actuator directional control assembly
US9303085B2 (en) 2010-05-14 2016-04-05 Abbvie Inc. IL-1 binding proteins
US9447184B2 (en) 2010-05-14 2016-09-20 Abbvie Inc. IL-1 binding proteins
US9447183B2 (en) 2010-05-14 2016-09-20 Abbvie Inc. IL-1 binding proteins
US9441038B2 (en) 2010-05-14 2016-09-13 Abbvie Inc. IL-1 binding proteins
US9409986B2 (en) 2010-05-14 2016-08-09 Abbvie Inc. IL-1 binding proteins
US8664367B2 (en) 2010-05-14 2014-03-04 Abbvie, Inc. IL-I binding proteins
US20110311547A1 (en) * 2010-06-18 2011-12-22 Xbiotech, Inc. Arthritis Treatment
US11390672B2 (en) 2010-06-18 2022-07-19 Janssen Biotech, Inc. Arthritis treatment
US12116405B2 (en) 2010-06-18 2024-10-15 Xbiotech Inc. Arthritis treatment
US11478247B2 (en) 2010-07-30 2022-10-25 Cilag Gmbh International Tissue acquisition arrangements and methods for surgical stapling devices
US11932688B2 (en) 2010-08-23 2024-03-19 Xbiotech Inc. Treatment for neoplastic diseases
US10835251B2 (en) 2010-09-30 2020-11-17 Ethicon Llc Surgical instrument assembly including an end effector configurable in different positions
US10149682B2 (en) 2010-09-30 2018-12-11 Ethicon Llc Stapling system including an actuation system
US11812965B2 (en) 2010-09-30 2023-11-14 Cilag Gmbh International Layer of material for a surgical end effector
US10335148B2 (en) 2010-09-30 2019-07-02 Ethicon Llc Staple cartridge including a tissue thickness compensator for a surgical stapler
US11406377B2 (en) 2010-09-30 2022-08-09 Cilag Gmbh International Adhesive film laminate
US11583277B2 (en) 2010-09-30 2023-02-21 Cilag Gmbh International Layer of material for a surgical end effector
US11857187B2 (en) 2010-09-30 2024-01-02 Cilag Gmbh International Tissue thickness compensator comprising controlled release and expansion
US10888328B2 (en) 2010-09-30 2021-01-12 Ethicon Llc Surgical end effector
US11883025B2 (en) 2010-09-30 2024-01-30 Cilag Gmbh International Tissue thickness compensator comprising a plurality of layers
US10398436B2 (en) 2010-09-30 2019-09-03 Ethicon Llc Staple cartridge comprising staples positioned within a compressible portion thereof
US11298125B2 (en) 2010-09-30 2022-04-12 Cilag Gmbh International Tissue stapler having a thickness compensator
US11540824B2 (en) 2010-09-30 2023-01-03 Cilag Gmbh International Tissue thickness compensator
US10743877B2 (en) 2010-09-30 2020-08-18 Ethicon Llc Surgical stapler with floating anvil
US11737754B2 (en) 2010-09-30 2023-08-29 Cilag Gmbh International Surgical stapler with floating anvil
US10588623B2 (en) 2010-09-30 2020-03-17 Ethicon Llc Adhesive film laminate
US11957795B2 (en) 2010-09-30 2024-04-16 Cilag Gmbh International Tissue thickness compensator configured to redistribute compressive forces
US11083452B2 (en) 2010-09-30 2021-08-10 Cilag Gmbh International Staple cartridge including a tissue thickness compensator
US10869669B2 (en) 2010-09-30 2020-12-22 Ethicon Llc Surgical instrument assembly
US11849952B2 (en) 2010-09-30 2023-12-26 Cilag Gmbh International Staple cartridge comprising staples positioned within a compressible portion thereof
US10624861B2 (en) 2010-09-30 2020-04-21 Ethicon Llc Tissue thickness compensator configured to redistribute compressive forces
US10945731B2 (en) 2010-09-30 2021-03-16 Ethicon Llc Tissue thickness compensator comprising controlled release and expansion
US10363031B2 (en) 2010-09-30 2019-07-30 Ethicon Llc Tissue thickness compensators for surgical staplers
US10898193B2 (en) 2010-09-30 2021-01-26 Ethicon Llc End effector for use with a surgical instrument
US10335150B2 (en) 2010-09-30 2019-07-02 Ethicon Llc Staple cartridge comprising an implantable layer
US10548600B2 (en) 2010-09-30 2020-02-04 Ethicon Llc Multiple thickness implantable layers for surgical stapling devices
US11944292B2 (en) 2010-09-30 2024-04-02 Cilag Gmbh International Anvil layer attached to a proximal end of an end effector
US12453557B2 (en) 2010-09-30 2025-10-28 Cilag Gmbh International Layer of material for a surgical end effector
US12178432B2 (en) 2010-09-30 2024-12-31 Cilag Gmbh International Tissue thickness compensator comprising laterally offset layers
US10258330B2 (en) 2010-09-30 2019-04-16 Ethicon Llc End effector including an implantable arrangement
US11559496B2 (en) 2010-09-30 2023-01-24 Cilag Gmbh International Tissue thickness compensator configured to redistribute compressive forces
US10182819B2 (en) 2010-09-30 2019-01-22 Ethicon Llc Implantable layer assemblies
US10265072B2 (en) 2010-09-30 2019-04-23 Ethicon Llc Surgical stapling system comprising an end effector including an implantable layer
US12213666B2 (en) 2010-09-30 2025-02-04 Cilag Gmbh International Tissue thickness compensator comprising layers
US11395651B2 (en) 2010-09-30 2022-07-26 Cilag Gmbh International Adhesive film laminate
US11925354B2 (en) 2010-09-30 2024-03-12 Cilag Gmbh International Staple cartridge comprising staples positioned within a compressible portion thereof
US11911027B2 (en) 2010-09-30 2024-02-27 Cilag Gmbh International Adhesive film laminate
US11672536B2 (en) 2010-09-30 2023-06-13 Cilag Gmbh International Layer of material for a surgical end effector
US10258332B2 (en) 2010-09-30 2019-04-16 Ethicon Llc Stapling system comprising an adjunct and a flowable adhesive
US10463372B2 (en) 2010-09-30 2019-11-05 Ethicon Llc Staple cartridge comprising multiple regions
US10485536B2 (en) 2010-09-30 2019-11-26 Ethicon Llc Tissue stapler having an anti-microbial agent
US11602340B2 (en) 2010-09-30 2023-03-14 Cilag Gmbh International Adhesive film laminate
US11154296B2 (en) 2010-09-30 2021-10-26 Cilag Gmbh International Anvil layer attached to a proximal end of an end effector
US11850310B2 (en) 2010-09-30 2023-12-26 Cilag Gmbh International Staple cartridge including an adjunct
US10265074B2 (en) 2010-09-30 2019-04-23 Ethicon Llc Implantable layers for surgical stapling devices
US11684360B2 (en) 2010-09-30 2023-06-27 Cilag Gmbh International Staple cartridge comprising a variable thickness compressible portion
US11571215B2 (en) 2010-09-30 2023-02-07 Cilag Gmbh International Layer of material for a surgical end effector
US10987102B2 (en) 2010-09-30 2021-04-27 Ethicon Llc Tissue thickness compensator comprising a plurality of layers
US11529142B2 (en) 2010-10-01 2022-12-20 Cilag Gmbh International Surgical instrument having a power control circuit
US10695062B2 (en) 2010-10-01 2020-06-30 Ethicon Llc Surgical instrument including a retractable firing member
US12440213B2 (en) 2010-10-01 2025-10-14 Cilag Gmbh International Surgical instrument having a power control circuit
US11191831B2 (en) 2011-04-01 2021-12-07 Janssen Biotech, Inc. Treatment of psychiatric conditions
US11504116B2 (en) 2011-04-29 2022-11-22 Cilag Gmbh International Layer of material for a surgical end effector
US10335151B2 (en) 2011-05-27 2019-07-02 Ethicon Llc Robotically-driven surgical instrument
US11207064B2 (en) 2011-05-27 2021-12-28 Cilag Gmbh International Automated end effector component reloading system for use with a robotic system
US10780539B2 (en) 2011-05-27 2020-09-22 Ethicon Llc Stapling instrument for use with a robotic system
US12239316B2 (en) 2011-05-27 2025-03-04 Cilag Gmbh International Automated end effector component reloading system for use with a robotic system
US10485546B2 (en) 2011-05-27 2019-11-26 Ethicon Llc Robotically-driven surgical assembly
US10736634B2 (en) 2011-05-27 2020-08-11 Ethicon Llc Robotically-driven surgical instrument including a drive system
US12256930B2 (en) 2011-05-27 2025-03-25 Cilag Gmbh International Robotically-driven surgical instrument with E-beam driver
US11583278B2 (en) 2011-05-27 2023-02-21 Cilag Gmbh International Surgical stapling system having multi-direction articulation
US10524790B2 (en) 2011-05-27 2020-01-07 Ethicon Llc Robotically-controlled surgical stapling devices that produce formed staples having different lengths
US10420561B2 (en) 2011-05-27 2019-09-24 Ethicon Llc Robotically-driven surgical instrument
US10980534B2 (en) 2011-05-27 2021-04-20 Ethicon Llc Robotically-controlled motorized surgical instrument with an end effector
US12290261B2 (en) 2011-05-27 2025-05-06 Cilag Gmbh International Robotically-driven surgical instrument with E-beam driver
US11129616B2 (en) 2011-05-27 2021-09-28 Cilag Gmbh International Surgical stapling system
US11612394B2 (en) 2011-05-27 2023-03-28 Cilag Gmbh International Automated end effector component reloading system for use with a robotic system
US10617420B2 (en) 2011-05-27 2020-04-14 Ethicon Llc Surgical system comprising drive systems
US10231794B2 (en) 2011-05-27 2019-03-19 Ethicon Llc Surgical stapling instruments with rotatable staple deployment arrangements
US11266410B2 (en) 2011-05-27 2022-03-08 Cilag Gmbh International Surgical device for use with a robotic system
US11439470B2 (en) 2011-05-27 2022-09-13 Cilag Gmbh International Robotically-controlled surgical instrument with selectively articulatable end effector
US10383633B2 (en) 2011-05-27 2019-08-20 Ethicon Llc Robotically-driven surgical assembly
US12059154B2 (en) 2011-05-27 2024-08-13 Cilag Gmbh International Surgical instrument with detachable motor control unit
US10813641B2 (en) 2011-05-27 2020-10-27 Ethicon Llc Robotically-driven surgical instrument
US12521116B2 (en) 2011-05-27 2026-01-13 Cilag Gmbh International Robotically-driven surgical instrument with e-beam driver
US10426478B2 (en) 2011-05-27 2019-10-01 Ethicon Llc Surgical stapling systems
US11918208B2 (en) 2011-05-27 2024-03-05 Cilag Gmbh International Robotically-controlled shaft based rotary drive systems for surgical instruments
US11974747B2 (en) 2011-05-27 2024-05-07 Cilag Gmbh International Surgical stapling instruments with rotatable staple deployment arrangements
US10695063B2 (en) 2012-02-13 2020-06-30 Ethicon Llc Surgical cutting and fastening instrument with apparatus for determining cartridge and firing motion status
US11406378B2 (en) 2012-03-28 2022-08-09 Cilag Gmbh International Staple cartridge comprising a compressible tissue thickness compensator
US11793509B2 (en) 2012-03-28 2023-10-24 Cilag Gmbh International Staple cartridge including an implantable layer
US12121234B2 (en) 2012-03-28 2024-10-22 Cilag Gmbh International Staple cartridge assembly comprising a compensator
US10667808B2 (en) 2012-03-28 2020-06-02 Ethicon Llc Staple cartridge comprising an absorbable adjunct
US10441285B2 (en) 2012-03-28 2019-10-15 Ethicon Llc Tissue thickness compensator comprising tissue ingrowth features
US11918220B2 (en) 2012-03-28 2024-03-05 Cilag Gmbh International Tissue thickness compensator comprising tissue ingrowth features
US11707273B2 (en) 2012-06-15 2023-07-25 Cilag Gmbh International Articulatable surgical instrument comprising a firing drive
US10959725B2 (en) 2012-06-15 2021-03-30 Ethicon Llc Articulatable surgical instrument comprising a firing drive
US11534162B2 (en) 2012-06-28 2022-12-27 Cilag GmbH Inlernational Robotically powered surgical device with manually-actuatable reversing system
US11857189B2 (en) 2012-06-28 2024-01-02 Cilag Gmbh International Surgical instrument including first and second articulation joints
US11602346B2 (en) 2012-06-28 2023-03-14 Cilag Gmbh International Robotically powered surgical device with manually-actuatable reversing system
US10874391B2 (en) 2012-06-28 2020-12-29 Ethicon Llc Surgical instrument system including replaceable end effectors
US11007004B2 (en) 2012-06-28 2021-05-18 Ethicon Llc Powered multi-axial articulable electrosurgical device with external dissection features
US10485541B2 (en) 2012-06-28 2019-11-26 Ethicon Llc Robotically powered surgical device with manually-actuatable reversing system
US11083457B2 (en) 2012-06-28 2021-08-10 Cilag Gmbh International Surgical instrument system including replaceable end effectors
US11278284B2 (en) 2012-06-28 2022-03-22 Cilag Gmbh International Rotary drive arrangements for surgical instruments
US11241230B2 (en) 2012-06-28 2022-02-08 Cilag Gmbh International Clip applier tool for use with a robotic surgical system
US10383630B2 (en) 2012-06-28 2019-08-20 Ethicon Llc Surgical stapling device with rotary driven firing member
US11058423B2 (en) 2012-06-28 2021-07-13 Cilag Gmbh International Stapling system including first and second closure systems for use with a surgical robot
US11464513B2 (en) 2012-06-28 2022-10-11 Cilag Gmbh International Surgical instrument system including replaceable end effectors
US11510671B2 (en) 2012-06-28 2022-11-29 Cilag Gmbh International Firing system lockout arrangements for surgical instruments
US11197671B2 (en) 2012-06-28 2021-12-14 Cilag Gmbh International Stapling assembly comprising a lockout
US11918213B2 (en) 2012-06-28 2024-03-05 Cilag Gmbh International Surgical stapler including couplers for attaching a shaft to an end effector
US11202631B2 (en) 2012-06-28 2021-12-21 Cilag Gmbh International Stapling assembly comprising a firing lockout
US10687812B2 (en) 2012-06-28 2020-06-23 Ethicon Llc Surgical instrument system including replaceable end effectors
US11141155B2 (en) 2012-06-28 2021-10-12 Cilag Gmbh International Drive system for surgical tool
US11806013B2 (en) 2012-06-28 2023-11-07 Cilag Gmbh International Firing system arrangements for surgical instruments
US11622766B2 (en) 2012-06-28 2023-04-11 Cilag Gmbh International Empty clip cartridge lockout
US10413294B2 (en) 2012-06-28 2019-09-17 Ethicon Llc Shaft assembly arrangements for surgical instruments
US12369911B2 (en) 2012-06-28 2025-07-29 Cilag Gmbh International Firing system lockout arrangements for surgical instruments
US11039837B2 (en) 2012-06-28 2021-06-22 Cilag Gmbh International Firing system lockout arrangements for surgical instruments
US12343013B2 (en) 2012-06-28 2025-07-01 Cilag Gmbh International Interconnected joint segments forming drive tube for stapling assembly
US10639115B2 (en) 2012-06-28 2020-05-05 Ethicon Llc Surgical end effectors having angled tissue-contacting surfaces
US11154299B2 (en) 2012-06-28 2021-10-26 Cilag Gmbh International Stapling assembly comprising a firing lockout
US10932775B2 (en) 2012-06-28 2021-03-02 Ethicon Llc Firing system lockout arrangements for surgical instruments
US10258333B2 (en) 2012-06-28 2019-04-16 Ethicon Llc Surgical fastening apparatus with a rotary end effector drive shaft for selective engagement with a motorized drive system
US11779420B2 (en) 2012-06-28 2023-10-10 Cilag Gmbh International Robotic surgical attachments having manually-actuated retraction assemblies
US11540829B2 (en) 2012-06-28 2023-01-03 Cilag Gmbh International Surgical instrument system including replaceable end effectors
US11141156B2 (en) 2012-06-28 2021-10-12 Cilag Gmbh International Surgical stapling assembly comprising flexible output shaft
US12383267B2 (en) 2012-06-28 2025-08-12 Cilag Gmbh International Robotically powered surgical device with manually-actuatable reversing system
US11109860B2 (en) 2012-06-28 2021-09-07 Cilag Gmbh International Surgical end effectors for use with hand-held and robotically-controlled rotary powered surgical systems
US10420555B2 (en) 2012-06-28 2019-09-24 Ethicon Llc Hand held rotary powered surgical instruments with end effectors that are articulatable about multiple axes
US11373755B2 (en) 2012-08-23 2022-06-28 Cilag Gmbh International Surgical device drive system including a ratchet mechanism
CN104684929A (en) * 2012-10-04 2015-06-03 埃克斯生物科技公司 Treatment of vascular disease and its complications
US11529138B2 (en) 2013-03-01 2022-12-20 Cilag Gmbh International Powered surgical instrument including a rotary drive screw
US10226249B2 (en) 2013-03-01 2019-03-12 Ethicon Llc Articulatable surgical instruments with conductive pathways for signal communication
US11246618B2 (en) 2013-03-01 2022-02-15 Cilag Gmbh International Surgical instrument soft stop
US11957345B2 (en) 2013-03-01 2024-04-16 Cilag Gmbh International Articulatable surgical instruments with conductive pathways for signal communication
US12433627B2 (en) 2013-03-01 2025-10-07 Cilag Gmbh International Surgical instrument soft stop
US10285695B2 (en) 2013-03-01 2019-05-14 Ethicon Llc Articulatable surgical instruments with conductive pathways
US10575868B2 (en) 2013-03-01 2020-03-03 Ethicon Llc Surgical instrument with coupler assembly
US10238391B2 (en) 2013-03-14 2019-03-26 Ethicon Llc Drive train control arrangements for modular surgical instruments
US10893867B2 (en) 2013-03-14 2021-01-19 Ethicon Llc Drive train control arrangements for modular surgical instruments
US11266406B2 (en) 2013-03-14 2022-03-08 Cilag Gmbh International Control systems for surgical instruments
US10617416B2 (en) 2013-03-14 2020-04-14 Ethicon Llc Control systems for surgical instruments
US10470762B2 (en) 2013-03-14 2019-11-12 Ethicon Llc Multi-function motor for a surgical instrument
US11992214B2 (en) 2013-03-14 2024-05-28 Cilag Gmbh International Control systems for surgical instruments
US11395652B2 (en) 2013-04-16 2022-07-26 Cilag Gmbh International Powered surgical stapler
US11564679B2 (en) 2013-04-16 2023-01-31 Cilag Gmbh International Powered surgical stapler
US11406381B2 (en) 2013-04-16 2022-08-09 Cilag Gmbh International Powered surgical stapler
US12161320B2 (en) 2013-04-16 2024-12-10 Cilag Gmbh International Powered surgical stapler
US10149680B2 (en) 2013-04-16 2018-12-11 Ethicon Llc Surgical instrument comprising a gap setting system
US10405857B2 (en) 2013-04-16 2019-09-10 Ethicon Llc Powered linear surgical stapler
US10702266B2 (en) 2013-04-16 2020-07-07 Ethicon Llc Surgical instrument system
US12178429B2 (en) 2013-04-16 2024-12-31 Cilag Gmbh International Surgical instruments having modular end effector selectively coupleable to housing assembly
US11690615B2 (en) 2013-04-16 2023-07-04 Cilag Gmbh International Surgical system including an electric motor and a surgical instrument
US11622763B2 (en) 2013-04-16 2023-04-11 Cilag Gmbh International Stapling assembly comprising a shiftable drive
US11638581B2 (en) 2013-04-16 2023-05-02 Cilag Gmbh International Powered surgical stapler
US10888318B2 (en) 2013-04-16 2021-01-12 Ethicon Llc Powered surgical stapler
US11633183B2 (en) 2013-04-16 2023-04-25 Cilag International GmbH Stapling assembly comprising a retraction drive
US11133106B2 (en) 2013-08-23 2021-09-28 Cilag Gmbh International Surgical instrument assembly comprising a retraction assembly
US10441281B2 (en) 2013-08-23 2019-10-15 Ethicon Llc surgical instrument including securing and aligning features
US10869665B2 (en) 2013-08-23 2020-12-22 Ethicon Llc Surgical instrument system including a control system
US12053176B2 (en) 2013-08-23 2024-08-06 Cilag Gmbh International End effector detention systems for surgical instruments
US11026680B2 (en) 2013-08-23 2021-06-08 Cilag Gmbh International Surgical instrument configured to operate in different states
US10898190B2 (en) 2013-08-23 2021-01-26 Ethicon Llc Secondary battery arrangements for powered surgical instruments
US10624634B2 (en) 2013-08-23 2020-04-21 Ethicon Llc Firing trigger lockout arrangements for surgical instruments
US11918209B2 (en) 2013-08-23 2024-03-05 Cilag Gmbh International Torque optimization for surgical instruments
US10828032B2 (en) 2013-08-23 2020-11-10 Ethicon Llc End effector detection systems for surgical instruments
US11109858B2 (en) 2013-08-23 2021-09-07 Cilag Gmbh International Surgical instrument including a display which displays the position of a firing element
US11000274B2 (en) 2013-08-23 2021-05-11 Ethicon Llc Powered surgical instrument
US11504119B2 (en) 2013-08-23 2022-11-22 Cilag Gmbh International Surgical instrument including an electronic firing lockout
US10201349B2 (en) 2013-08-23 2019-02-12 Ethicon Llc End effector detection and firing rate modulation systems for surgical instruments
US11376001B2 (en) 2013-08-23 2022-07-05 Cilag Gmbh International Surgical stapling device with rotary multi-turn retraction mechanism
US11701110B2 (en) 2013-08-23 2023-07-18 Cilag Gmbh International Surgical instrument including a drive assembly movable in a non-motorized mode of operation
US11134940B2 (en) 2013-08-23 2021-10-05 Cilag Gmbh International Surgical instrument including a variable speed firing member
US11389160B2 (en) 2013-08-23 2022-07-19 Cilag Gmbh International Surgical system comprising a display
US11020115B2 (en) 2014-02-12 2021-06-01 Cilag Gmbh International Deliverable surgical instrument
US10426481B2 (en) 2014-02-24 2019-10-01 Ethicon Llc Implantable layer assemblies
US11497488B2 (en) 2014-03-26 2022-11-15 Cilag Gmbh International Systems and methods for controlling a segmented circuit
US12285166B2 (en) 2014-03-26 2025-04-29 Cilag Gmbh International Feedback algorithms for manual bailout systems for surgical instruments
US11259799B2 (en) 2014-03-26 2022-03-01 Cilag Gmbh International Interface systems for use with surgical instruments
US10201364B2 (en) 2014-03-26 2019-02-12 Ethicon Llc Surgical instrument comprising a rotatable shaft
US12232723B2 (en) 2014-03-26 2025-02-25 Cilag Gmbh International Systems and methods for controlling a segmented circuit
US12023023B2 (en) 2014-03-26 2024-07-02 Cilag Gmbh International Interface systems for use with surgical instruments
US12023022B2 (en) 2014-03-26 2024-07-02 Cilag Gmbh International Systems and methods for controlling a segmented circuit
US10588626B2 (en) 2014-03-26 2020-03-17 Ethicon Llc Surgical instrument displaying subsequent step of use
US10863981B2 (en) 2014-03-26 2020-12-15 Ethicon Llc Interface systems for use with surgical instruments
US10898185B2 (en) 2014-03-26 2021-01-26 Ethicon Llc Surgical instrument power management through sleep and wake up control
US11963678B2 (en) 2014-04-16 2024-04-23 Cilag Gmbh International Fastener cartridges including extensions having different configurations
US12256931B2 (en) 2014-04-16 2025-03-25 Cilag Gmbh International Fastener cartridges including extensions having different configurations
US12465363B2 (en) 2014-04-16 2025-11-11 Cilag Gmbh International Fastener cartridges including extensions having different configurations
US11185330B2 (en) 2014-04-16 2021-11-30 Cilag Gmbh International Fastener cartridge assemblies and staple retainer cover arrangements
US11266409B2 (en) 2014-04-16 2022-03-08 Cilag Gmbh International Fastener cartridge comprising a sled including longitudinally-staggered ramps
US11883026B2 (en) 2014-04-16 2024-01-30 Cilag Gmbh International Fastener cartridge assemblies and staple retainer cover arrangements
US12324585B2 (en) 2014-04-16 2025-06-10 Cilag Gmbh International Fastener cartridges including extensions having different configurations
US10299792B2 (en) 2014-04-16 2019-05-28 Ethicon Llc Fastener cartridge comprising non-uniform fasteners
US12089849B2 (en) 2014-04-16 2024-09-17 Cilag Gmbh International Staple cartridges including a projection
US11918222B2 (en) 2014-04-16 2024-03-05 Cilag Gmbh International Stapling assembly having firing member viewing windows
US10327776B2 (en) 2014-04-16 2019-06-25 Ethicon Llc Surgical stapling buttresses and adjunct materials
US12285171B2 (en) 2014-04-16 2025-04-29 Cilag Gmbh International Fastener cartridges including extensions having different configurations
US10561422B2 (en) 2014-04-16 2020-02-18 Ethicon Llc Fastener cartridge comprising deployable tissue engaging members
US11717294B2 (en) 2014-04-16 2023-08-08 Cilag Gmbh International End effector arrangements comprising indicators
US11298134B2 (en) 2014-04-16 2022-04-12 Cilag Gmbh International Fastener cartridge comprising non-uniform fasteners
US11596406B2 (en) 2014-04-16 2023-03-07 Cilag Gmbh International Fastener cartridges including extensions having different configurations
US11925353B2 (en) 2014-04-16 2024-03-12 Cilag Gmbh International Surgical stapling instrument comprising internal passage between stapling cartridge and elongate channel
US10542988B2 (en) 2014-04-16 2020-01-28 Ethicon Llc End effector comprising an anvil including projections extending therefrom
US10470768B2 (en) 2014-04-16 2019-11-12 Ethicon Llc Fastener cartridge including a layer attached thereto
US11944307B2 (en) 2014-04-16 2024-04-02 Cilag Gmbh International Surgical stapling system including jaw windows
US12274445B2 (en) 2014-04-16 2025-04-15 Cilag Gmbh International Fastener cartridges including extensions having different configurations
US12527575B2 (en) 2014-04-16 2026-01-20 Cilag Gmbh International Fastener cartridges including extensions having different configurations
US11382625B2 (en) 2014-04-16 2022-07-12 Cilag Gmbh International Fastener cartridge comprising non-uniform fasteners
US11382627B2 (en) 2014-04-16 2022-07-12 Cilag Gmbh International Surgical stapling assembly comprising a firing member including a lateral extension
US11517315B2 (en) 2014-04-16 2022-12-06 Cilag Gmbh International Fastener cartridges including extensions having different configurations
US11974746B2 (en) 2014-04-16 2024-05-07 Cilag Gmbh International Anvil for use with a surgical stapling assembly
US11311294B2 (en) 2014-09-05 2022-04-26 Cilag Gmbh International Powered medical device including measurement of closure state of jaws
US11406386B2 (en) 2014-09-05 2022-08-09 Cilag Gmbh International End effector including magnetic and impedance sensors
US11076854B2 (en) 2014-09-05 2021-08-03 Cilag Gmbh International Smart cartridge wake up operation and data retention
US12336709B2 (en) 2014-09-05 2025-06-24 Cilag Gmbh International Smart cartridge wake up operation and data retention
US10905423B2 (en) 2014-09-05 2021-02-02 Ethicon Llc Smart cartridge wake up operation and data retention
US11717297B2 (en) 2014-09-05 2023-08-08 Cilag Gmbh International Smart cartridge wake up operation and data retention
US12414768B2 (en) 2014-09-05 2025-09-16 Cilag Gmbh International Staple cartridge electrical contacts
US11071545B2 (en) 2014-09-05 2021-07-27 Cilag Gmbh International Smart cartridge wake up operation and data retention
US12042147B2 (en) 2014-09-05 2024-07-23 Cllag GmbH International Smart cartridge wake up operation and data retention
US11389162B2 (en) 2014-09-05 2022-07-19 Cilag Gmbh International Smart cartridge wake up operation and data retention
US11653918B2 (en) 2014-09-05 2023-05-23 Cilag Gmbh International Local display of tissue parameter stabilization
US12076017B2 (en) 2014-09-18 2024-09-03 Cilag Gmbh International Surgical instrument including a deployable knife
US11284898B2 (en) 2014-09-18 2022-03-29 Cilag Gmbh International Surgical instrument including a deployable knife
US10426477B2 (en) 2014-09-26 2019-10-01 Ethicon Llc Staple cartridge assembly including a ramp
US11202633B2 (en) 2014-09-26 2021-12-21 Cilag Gmbh International Surgical stapling buttresses and adjunct materials
US10751053B2 (en) 2014-09-26 2020-08-25 Ethicon Llc Fastener cartridges for applying expandable fastener lines
US11523821B2 (en) 2014-09-26 2022-12-13 Cilag Gmbh International Method for creating a flexible staple line
US10206677B2 (en) 2014-09-26 2019-02-19 Ethicon Llc Surgical staple and driver arrangements for staple cartridges
US12383259B2 (en) 2014-09-26 2025-08-12 Cilag Gmbh International Method for creating a flexible staple line
US10327764B2 (en) 2014-09-26 2019-06-25 Ethicon Llc Method for creating a flexible staple line
US12016564B2 (en) 2014-09-26 2024-06-25 Cilag Gmbh International Circular fastener cartridges for applying radially expandable fastener lines
US10426476B2 (en) 2014-09-26 2019-10-01 Ethicon Llc Circular fastener cartridges for applying radially expandable fastener lines
US10736630B2 (en) 2014-10-13 2020-08-11 Ethicon Llc Staple cartridge
US10905418B2 (en) 2014-10-16 2021-02-02 Ethicon Llc Staple cartridge comprising a tissue thickness compensator
US11918210B2 (en) 2014-10-16 2024-03-05 Cilag Gmbh International Staple cartridge comprising a cartridge body including a plurality of wells
US12004741B2 (en) 2014-10-16 2024-06-11 Cilag Gmbh International Staple cartridge comprising a tissue thickness compensator
US11931031B2 (en) 2014-10-16 2024-03-19 Cilag Gmbh International Staple cartridge comprising a deck including an upper surface and a lower surface
US11185325B2 (en) 2014-10-16 2021-11-30 Cilag Gmbh International End effector including different tissue gaps
US11701114B2 (en) 2014-10-16 2023-07-18 Cilag Gmbh International Staple cartridge
US11457918B2 (en) 2014-10-29 2022-10-04 Cilag Gmbh International Cartridge assemblies for surgical staplers
US11141153B2 (en) 2014-10-29 2021-10-12 Cilag Gmbh International Staple cartridges comprising driver arrangements
US11241229B2 (en) 2014-10-29 2022-02-08 Cilag Gmbh International Staple cartridges comprising driver arrangements
US11931038B2 (en) 2014-10-29 2024-03-19 Cilag Gmbh International Cartridge assemblies for surgical staplers
US11864760B2 (en) 2014-10-29 2024-01-09 Cilag Gmbh International Staple cartridges comprising driver arrangements
US10517594B2 (en) 2014-10-29 2019-12-31 Ethicon Llc Cartridge assemblies for surgical staplers
US10617417B2 (en) 2014-11-06 2020-04-14 Ethicon Llc Staple cartridge comprising a releasable adjunct material
US11337698B2 (en) 2014-11-06 2022-05-24 Cilag Gmbh International Staple cartridge comprising a releasable adjunct material
US11382628B2 (en) 2014-12-10 2022-07-12 Cilag Gmbh International Articulatable surgical instrument system
US12114859B2 (en) 2014-12-10 2024-10-15 Cilag Gmbh International Articulatable surgical instrument system
US10736636B2 (en) 2014-12-10 2020-08-11 Ethicon Llc Articulatable surgical instrument system
US11571207B2 (en) 2014-12-18 2023-02-07 Cilag Gmbh International Surgical system including lateral supports for a flexible drive member
US11517311B2 (en) 2014-12-18 2022-12-06 Cilag Gmbh International Surgical instrument systems comprising an articulatable end effector and means for adjusting the firing stroke of a firing member
US11553911B2 (en) 2014-12-18 2023-01-17 Cilag Gmbh International Surgical instrument assembly comprising a flexible articulation system
US12108950B2 (en) 2014-12-18 2024-10-08 Cilag Gmbh International Surgical instrument assembly comprising a flexible articulation system
US11547403B2 (en) 2014-12-18 2023-01-10 Cilag Gmbh International Surgical instrument having a laminate firing actuator and lateral buckling supports
US11547404B2 (en) 2014-12-18 2023-01-10 Cilag Gmbh International Surgical instrument assembly comprising a flexible articulation system
US10245027B2 (en) 2014-12-18 2019-04-02 Ethicon Llc Surgical instrument with an anvil that is selectively movable about a discrete non-movable axis relative to a staple cartridge
US12029419B2 (en) 2014-12-18 2024-07-09 Cilag Gmbh International Surgical instrument including a flexible support configured to support a flexible firing member
US10695058B2 (en) 2014-12-18 2020-06-30 Ethicon Llc Surgical instrument systems comprising an articulatable end effector and means for adjusting the firing stroke of a firing member
US11083453B2 (en) 2014-12-18 2021-08-10 Cilag Gmbh International Surgical stapling system including a flexible firing actuator and lateral buckling supports
US11678877B2 (en) 2014-12-18 2023-06-20 Cilag Gmbh International Surgical instrument including a flexible support configured to support a flexible firing member
US10806448B2 (en) 2014-12-18 2020-10-20 Ethicon Llc Surgical instrument assembly comprising a flexible articulation system
US10188385B2 (en) 2014-12-18 2019-01-29 Ethicon Llc Surgical instrument system comprising lockable systems
US11399831B2 (en) 2014-12-18 2022-08-02 Cilag Gmbh International Drive arrangements for articulatable surgical instruments
US11812958B2 (en) 2014-12-18 2023-11-14 Cilag Gmbh International Locking arrangements for detachable shaft assemblies with articulatable surgical end effectors
US10743873B2 (en) 2014-12-18 2020-08-18 Ethicon Llc Drive arrangements for articulatable surgical instruments
US10945728B2 (en) 2014-12-18 2021-03-16 Ethicon Llc Locking arrangements for detachable shaft assemblies with articulatable surgical end effectors
US11154301B2 (en) 2015-02-27 2021-10-26 Cilag Gmbh International Modular stapling assembly
US10159483B2 (en) 2015-02-27 2018-12-25 Ethicon Llc Surgical apparatus configured to track an end-of-life parameter
US10180463B2 (en) 2015-02-27 2019-01-15 Ethicon Llc Surgical apparatus configured to assess whether a performance parameter of the surgical apparatus is within an acceptable performance band
US11744588B2 (en) 2015-02-27 2023-09-05 Cilag Gmbh International Surgical stapling instrument including a removably attachable battery pack
US11324506B2 (en) 2015-02-27 2022-05-10 Cilag Gmbh International Modular stapling assembly
US10245028B2 (en) 2015-02-27 2019-04-02 Ethicon Llc Power adapter for a surgical instrument
US12076018B2 (en) 2015-02-27 2024-09-03 Cilag Gmbh International Modular stapling assembly
US10182816B2 (en) 2015-02-27 2019-01-22 Ethicon Llc Charging system that enables emergency resolutions for charging a battery
US10548504B2 (en) 2015-03-06 2020-02-04 Ethicon Llc Overlaid multi sensor radio frequency (RF) electrode system to measure tissue compression
US10206605B2 (en) 2015-03-06 2019-02-19 Ethicon Llc Time dependent evaluation of sensor data to determine stability, creep, and viscoelastic elements of measures
US10966627B2 (en) 2015-03-06 2021-04-06 Ethicon Llc Time dependent evaluation of sensor data to determine stability, creep, and viscoelastic elements of measures
US12440208B2 (en) 2015-03-06 2025-10-14 Cilag Gmbh International Powered surgical instrument
US10729432B2 (en) 2015-03-06 2020-08-04 Ethicon Llc Methods for operating a powered surgical instrument
US11224423B2 (en) 2015-03-06 2022-01-18 Cilag Gmbh International Smart sensors with local signal processing
US10772625B2 (en) 2015-03-06 2020-09-15 Ethicon Llc Signal and power communication system positioned on a rotatable shaft
US11426160B2 (en) 2015-03-06 2022-08-30 Cilag Gmbh International Smart sensors with local signal processing
US10687806B2 (en) 2015-03-06 2020-06-23 Ethicon Llc Adaptive tissue compression techniques to adjust closure rates for multiple tissue types
US11350843B2 (en) 2015-03-06 2022-06-07 Cilag Gmbh International Time dependent evaluation of sensor data to determine stability, creep, and viscoelastic elements of measures
US10245033B2 (en) 2015-03-06 2019-04-02 Ethicon Llc Surgical instrument comprising a lockable battery housing
US10524787B2 (en) 2015-03-06 2020-01-07 Ethicon Llc Powered surgical instrument with parameter-based firing rate
US10441279B2 (en) 2015-03-06 2019-10-15 Ethicon Llc Multiple level thresholds to modify operation of powered surgical instruments
US11109859B2 (en) 2015-03-06 2021-09-07 Cilag Gmbh International Surgical instrument comprising a lockable battery housing
US10531887B2 (en) 2015-03-06 2020-01-14 Ethicon Llc Powered surgical instrument including speed display
US11944338B2 (en) 2015-03-06 2024-04-02 Cilag Gmbh International Multiple level thresholds to modify operation of powered surgical instruments
US11826132B2 (en) 2015-03-06 2023-11-28 Cilag Gmbh International Time dependent evaluation of sensor data to determine stability, creep, and viscoelastic elements of measures
US10617412B2 (en) 2015-03-06 2020-04-14 Ethicon Llc System for detecting the mis-insertion of a staple cartridge into a surgical stapler
US11918212B2 (en) 2015-03-31 2024-03-05 Cilag Gmbh International Surgical instrument with selectively disengageable drive systems
US10213201B2 (en) 2015-03-31 2019-02-26 Ethicon Llc Stapling end effector configured to compensate for an uneven gap between a first jaw and a second jaw
US10433844B2 (en) 2015-03-31 2019-10-08 Ethicon Llc Surgical instrument with selectively disengageable threaded drive systems
US11058425B2 (en) 2015-08-17 2021-07-13 Ethicon Llc Implantable layers for a surgical instrument
US10617418B2 (en) 2015-08-17 2020-04-14 Ethicon Llc Implantable layers for a surgical instrument
US10835249B2 (en) 2015-08-17 2020-11-17 Ethicon Llc Implantable layers for a surgical instrument
US11490889B2 (en) 2015-09-23 2022-11-08 Cilag Gmbh International Surgical stapler having motor control based on an electrical parameter related to a motor current
US11344299B2 (en) 2015-09-23 2022-05-31 Cilag Gmbh International Surgical stapler having downstream current-based motor control
US11849946B2 (en) 2015-09-23 2023-12-26 Cilag Gmbh International Surgical stapler having downstream current-based motor control
US10863986B2 (en) 2015-09-23 2020-12-15 Ethicon Llc Surgical stapler having downstream current-based motor control
US10238386B2 (en) 2015-09-23 2019-03-26 Ethicon Llc Surgical stapler having motor control based on an electrical parameter related to a motor current
US10327769B2 (en) 2015-09-23 2019-06-25 Ethicon Llc Surgical stapler having motor control based on a drive system component
US10363036B2 (en) 2015-09-23 2019-07-30 Ethicon Llc Surgical stapler having force-based motor control
US11026678B2 (en) 2015-09-23 2021-06-08 Cilag Gmbh International Surgical stapler having motor control based on an electrical parameter related to a motor current
US12245901B2 (en) 2015-09-25 2025-03-11 Cilag Gmbh International Implantable layer comprising boundary indicators
US10299878B2 (en) 2015-09-25 2019-05-28 Ethicon Llc Implantable adjunct systems for determining adjunct skew
US11076929B2 (en) 2015-09-25 2021-08-03 Cilag Gmbh International Implantable adjunct systems for determining adjunct skew
US11944308B2 (en) 2015-09-30 2024-04-02 Cilag Gmbh International Compressible adjunct with crossing spacer fibers
US10285699B2 (en) 2015-09-30 2019-05-14 Ethicon Llc Compressible adjunct
US10932779B2 (en) 2015-09-30 2021-03-02 Ethicon Llc Compressible adjunct with crossing spacer fibers
US10478188B2 (en) 2015-09-30 2019-11-19 Ethicon Llc Implantable layer comprising a constricted configuration
US10736633B2 (en) 2015-09-30 2020-08-11 Ethicon Llc Compressible adjunct with looping members
US10307160B2 (en) 2015-09-30 2019-06-04 Ethicon Llc Compressible adjunct assemblies with attachment layers
US11793522B2 (en) 2015-09-30 2023-10-24 Cilag Gmbh International Staple cartridge assembly including a compressible adjunct
US11903586B2 (en) 2015-09-30 2024-02-20 Cilag Gmbh International Compressible adjunct with crossing spacer fibers
US10433846B2 (en) 2015-09-30 2019-10-08 Ethicon Llc Compressible adjunct with crossing spacer fibers
US11890015B2 (en) 2015-09-30 2024-02-06 Cilag Gmbh International Compressible adjunct with crossing spacer fibers
US10524788B2 (en) 2015-09-30 2020-01-07 Ethicon Llc Compressible adjunct with attachment regions
US11690623B2 (en) 2015-09-30 2023-07-04 Cilag Gmbh International Method for applying an implantable layer to a fastener cartridge
US10172620B2 (en) 2015-09-30 2019-01-08 Ethicon Llc Compressible adjuncts with bonding nodes
US10271849B2 (en) 2015-09-30 2019-04-30 Ethicon Llc Woven constructs with interlocked standing fibers
US11712244B2 (en) 2015-09-30 2023-08-01 Cilag Gmbh International Implantable layer with spacer fibers
US12137912B2 (en) 2015-09-30 2024-11-12 Cilag Gmbh International Compressible adjunct with attachment regions
US10327777B2 (en) 2015-09-30 2019-06-25 Ethicon Llc Implantable layer comprising plastically deformed fibers
US11553916B2 (en) 2015-09-30 2023-01-17 Cilag Gmbh International Compressible adjunct with crossing spacer fibers
US10561420B2 (en) 2015-09-30 2020-02-18 Ethicon Llc Tubular absorbable constructs
US10603039B2 (en) 2015-09-30 2020-03-31 Ethicon Llc Progressively releasable implantable adjunct for use with a surgical stapling instrument
US10980539B2 (en) 2015-09-30 2021-04-20 Ethicon Llc Implantable adjunct comprising bonded layers
US11083454B2 (en) 2015-12-30 2021-08-10 Cilag Gmbh International Mechanisms for compensating for drivetrain failure in powered surgical instruments
US11759208B2 (en) 2015-12-30 2023-09-19 Cilag Gmbh International Mechanisms for compensating for battery pack failure in powered surgical instruments
US12324579B2 (en) 2015-12-30 2025-06-10 Cilag Gmbh International Mechanisms for compensating for battery pack failure in powered surgical instruments
US12156653B2 (en) 2015-12-30 2024-12-03 Cilag Gmbh International Surgical instruments with motor control circuits
US10265068B2 (en) 2015-12-30 2019-04-23 Ethicon Llc Surgical instruments with separable motors and motor control circuits
US10292704B2 (en) 2015-12-30 2019-05-21 Ethicon Llc Mechanisms for compensating for battery pack failure in powered surgical instruments
US11058422B2 (en) 2015-12-30 2021-07-13 Cilag Gmbh International Mechanisms for compensating for battery pack failure in powered surgical instruments
US10368865B2 (en) 2015-12-30 2019-08-06 Ethicon Llc Mechanisms for compensating for drivetrain failure in powered surgical instruments
US11484309B2 (en) 2015-12-30 2022-11-01 Cilag Gmbh International Surgical stapling system comprising a controller configured to cause a motor to reset a firing sequence
US11129613B2 (en) 2015-12-30 2021-09-28 Cilag Gmbh International Surgical instruments with separable motors and motor control circuits
US10245030B2 (en) 2016-02-09 2019-04-02 Ethicon Llc Surgical instruments with tensioning arrangements for cable driven articulation systems
US10413291B2 (en) 2016-02-09 2019-09-17 Ethicon Llc Surgical instrument articulation mechanism with slotted secondary constraint
US11523823B2 (en) 2016-02-09 2022-12-13 Cilag Gmbh International Surgical instruments with non-symmetrical articulation arrangements
US10653413B2 (en) 2016-02-09 2020-05-19 Ethicon Llc Surgical instruments with an end effector that is highly articulatable relative to an elongate shaft assembly
US10588625B2 (en) 2016-02-09 2020-03-17 Ethicon Llc Articulatable surgical instruments with off-axis firing beam arrangements
US11730471B2 (en) 2016-02-09 2023-08-22 Cilag Gmbh International Articulatable surgical instruments with single articulation link arrangements
US10433837B2 (en) 2016-02-09 2019-10-08 Ethicon Llc Surgical instruments with multiple link articulation arrangements
US10245029B2 (en) 2016-02-09 2019-04-02 Ethicon Llc Surgical instrument with articulating and axially translatable end effector
US10470764B2 (en) 2016-02-09 2019-11-12 Ethicon Llc Surgical instruments with closure stroke reduction arrangements
US11213293B2 (en) 2016-02-09 2022-01-04 Cilag Gmbh International Articulatable surgical instruments with single articulation link arrangements
US11344303B2 (en) 2016-02-12 2022-05-31 Cilag Gmbh International Mechanisms for compensating for drivetrain failure in powered surgical instruments
US10448948B2 (en) 2016-02-12 2019-10-22 Ethicon Llc Mechanisms for compensating for drivetrain failure in powered surgical instruments
US12508025B2 (en) 2016-02-12 2025-12-30 Cilag Gmbh International Mechanisms for compensating for drivetrain failure in powered surgical instruments
US11779336B2 (en) 2016-02-12 2023-10-10 Cilag Gmbh International Mechanisms for compensating for drivetrain failure in powered surgical instruments
US11224426B2 (en) 2016-02-12 2022-01-18 Cilag Gmbh International Mechanisms for compensating for drivetrain failure in powered surgical instruments
US10258331B2 (en) 2016-02-12 2019-04-16 Ethicon Llc Mechanisms for compensating for drivetrain failure in powered surgical instruments
US11826045B2 (en) 2016-02-12 2023-11-28 Cilag Gmbh International Mechanisms for compensating for drivetrain failure in powered surgical instruments
US10617413B2 (en) 2016-04-01 2020-04-14 Ethicon Llc Closure system arrangements for surgical cutting and stapling devices with separate and distinct firing shafts
US10376263B2 (en) 2016-04-01 2019-08-13 Ethicon Llc Anvil modification members for surgical staplers
US11771454B2 (en) 2016-04-15 2023-10-03 Cilag Gmbh International Stapling assembly including a controller for monitoring a clamping laod
US11284891B2 (en) 2016-04-15 2022-03-29 Cilag Gmbh International Surgical instrument with multiple program responses during a firing motion
US10335145B2 (en) 2016-04-15 2019-07-02 Ethicon Llc Modular surgical instrument with configurable operating mode
US12440209B2 (en) 2016-04-15 2025-10-14 Cilag Gmbh International Surgical instrument with multiple program responses during a firing motion
US10357247B2 (en) 2016-04-15 2019-07-23 Ethicon Llc Surgical instrument with multiple program responses during a firing motion
US12144500B2 (en) 2016-04-15 2024-11-19 Cilag Gmbh International Surgical instrument with multiple program responses during a firing motion
US11517306B2 (en) 2016-04-15 2022-12-06 Cilag Gmbh International Surgical instrument with detection sensors
US10405859B2 (en) 2016-04-15 2019-09-10 Ethicon Llc Surgical instrument with adjustable stop/start control during a firing motion
US11317910B2 (en) 2016-04-15 2022-05-03 Cilag Gmbh International Surgical instrument with detection sensors
US11311292B2 (en) 2016-04-15 2022-04-26 Cilag Gmbh International Surgical instrument with detection sensors
US10426467B2 (en) 2016-04-15 2019-10-01 Ethicon Llc Surgical instrument with detection sensors
US11350932B2 (en) 2016-04-15 2022-06-07 Cilag Gmbh International Surgical instrument with improved stop/start control during a firing motion
US11179150B2 (en) 2016-04-15 2021-11-23 Cilag Gmbh International Systems and methods for controlling a surgical stapling and cutting instrument
US10456137B2 (en) 2016-04-15 2019-10-29 Ethicon Llc Staple formation detection mechanisms
US11051810B2 (en) 2016-04-15 2021-07-06 Cilag Gmbh International Modular surgical instrument with configurable operating mode
US11191545B2 (en) 2016-04-15 2021-12-07 Cilag Gmbh International Staple formation detection mechanisms
US11931028B2 (en) 2016-04-15 2024-03-19 Cilag Gmbh International Surgical instrument with multiple program responses during a firing motion
US11642125B2 (en) 2016-04-15 2023-05-09 Cilag Gmbh International Robotic surgical system including a user interface and a control circuit
US10828028B2 (en) 2016-04-15 2020-11-10 Ethicon Llc Surgical instrument with multiple program responses during a firing motion
US10492783B2 (en) 2016-04-15 2019-12-03 Ethicon, Llc Surgical instrument with improved stop/start control during a firing motion
US11026684B2 (en) 2016-04-15 2021-06-08 Ethicon Llc Surgical instrument with multiple program responses during a firing motion
US11607239B2 (en) 2016-04-15 2023-03-21 Cilag Gmbh International Systems and methods for controlling a surgical stapling and cutting instrument
US11811253B2 (en) 2016-04-18 2023-11-07 Cilag Gmbh International Surgical robotic system with fault state detection configurations based on motor current draw
US12261471B2 (en) 2016-04-18 2025-03-25 Cilag Gmbh International Technologies for detection of drive train failures in a surgical instrument
US10478181B2 (en) 2016-04-18 2019-11-19 Ethicon Llc Cartridge lockout arrangements for rotary powered surgical cutting and stapling instruments
US10433840B2 (en) 2016-04-18 2019-10-08 Ethicon Llc Surgical instrument comprising a replaceable cartridge jaw
US11559303B2 (en) 2016-04-18 2023-01-24 Cilag Gmbh International Cartridge lockout arrangements for rotary powered surgical cutting and stapling instruments
US10426469B2 (en) 2016-04-18 2019-10-01 Ethicon Llc Surgical instrument comprising a primary firing lockout and a secondary firing lockout
US11147554B2 (en) 2016-04-18 2021-10-19 Cilag Gmbh International Surgical instrument system comprising a magnetic lockout
US11317917B2 (en) 2016-04-18 2022-05-03 Cilag Gmbh International Surgical stapling system comprising a lockable firing assembly
US10368867B2 (en) 2016-04-18 2019-08-06 Ethicon Llc Surgical instrument comprising a lockout
US11350928B2 (en) 2016-04-18 2022-06-07 Cilag Gmbh International Surgical instrument comprising a tissue thickness lockout and speed control system
US10363037B2 (en) 2016-04-18 2019-07-30 Ethicon Llc Surgical instrument system comprising a magnetic lockout
US12171507B2 (en) 2016-08-16 2024-12-24 Cilag Gmbh International Surgical tool with manual control of end effector jaws
US10667811B2 (en) 2016-12-21 2020-06-02 Ethicon Llc Surgical stapling instruments and staple-forming anvils
US10517596B2 (en) 2016-12-21 2019-12-31 Ethicon Llc Articulatable surgical instruments with articulation stroke amplification features
US10537325B2 (en) 2016-12-21 2020-01-21 Ethicon Llc Staple forming pocket arrangement to accommodate different types of staples
US10568624B2 (en) 2016-12-21 2020-02-25 Ethicon Llc Surgical instruments with jaws that are pivotable about a fixed axis and include separate and distinct closure and firing systems
US11350934B2 (en) 2016-12-21 2022-06-07 Cilag Gmbh International Staple forming pocket arrangement to accommodate different types of staples
US10568626B2 (en) 2016-12-21 2020-02-25 Ethicon Llc Surgical instruments with jaw opening features for increasing a jaw opening distance
US10568625B2 (en) 2016-12-21 2020-02-25 Ethicon Llc Staple cartridges and arrangements of staples and staple cavities therein
US10582928B2 (en) 2016-12-21 2020-03-10 Ethicon Llc Articulation lock arrangements for locking an end effector in an articulated position in response to actuation of a jaw closure system
US10588632B2 (en) 2016-12-21 2020-03-17 Ethicon Llc Surgical end effectors and firing members thereof
US12185946B2 (en) 2016-12-21 2025-01-07 Cilag Gmbh International Articulatable surgical stapling instruments
US10588630B2 (en) 2016-12-21 2020-03-17 Ethicon Llc Surgical tool assemblies with closure stroke reduction features
US11350935B2 (en) 2016-12-21 2022-06-07 Cilag Gmbh International Surgical tool assemblies with closure stroke reduction features
US10588631B2 (en) 2016-12-21 2020-03-17 Ethicon Llc Surgical instruments with positive jaw opening features
US11317913B2 (en) 2016-12-21 2022-05-03 Cilag Gmbh International Lockout arrangements for surgical end effectors and replaceable tool assemblies
US10524789B2 (en) 2016-12-21 2020-01-07 Ethicon Llc Laterally actuatable articulation lock arrangements for locking an end effector of a surgical instrument in an articulated configuration
US10603036B2 (en) 2016-12-21 2020-03-31 Ethicon Llc Articulatable surgical instrument with independent pivotable linkage distal of an articulation lock
US10610224B2 (en) 2016-12-21 2020-04-07 Ethicon Llc Lockout arrangements for surgical end effectors and replaceable tool assemblies
US10517595B2 (en) 2016-12-21 2019-12-31 Ethicon Llc Jaw actuated lock arrangements for preventing advancement of a firing member in a surgical end effector unless an unfired cartridge is installed in the end effector
US10617414B2 (en) 2016-12-21 2020-04-14 Ethicon Llc Closure member arrangements for surgical instruments
US10624635B2 (en) 2016-12-21 2020-04-21 Ethicon Llc Firing members with non-parallel jaw engagement features for surgical end effectors
US10639035B2 (en) 2016-12-21 2020-05-05 Ethicon Llc Surgical stapling instruments and replaceable tool assemblies thereof
US10639034B2 (en) 2016-12-21 2020-05-05 Ethicon Llc Surgical instruments with lockout arrangements for preventing firing system actuation unless an unspent staple cartridge is present
US10667809B2 (en) 2016-12-21 2020-06-02 Ethicon Llc Staple cartridge and staple cartridge channel comprising windows defined therein
US10667810B2 (en) 2016-12-21 2020-06-02 Ethicon Llc Closure members with cam surface arrangements for surgical instruments with separate and distinct closure and firing systems
US11160551B2 (en) 2016-12-21 2021-11-02 Cilag Gmbh International Articulatable surgical stapling instruments
US10675026B2 (en) 2016-12-21 2020-06-09 Ethicon Llc Methods of stapling tissue
US11369376B2 (en) 2016-12-21 2022-06-28 Cilag Gmbh International Surgical stapling systems
US10675025B2 (en) 2016-12-21 2020-06-09 Ethicon Llc Shaft assembly comprising separately actuatable and retractable systems
US12011166B2 (en) 2016-12-21 2024-06-18 Cilag Gmbh International Articulatable surgical stapling instruments
US12004745B2 (en) 2016-12-21 2024-06-11 Cilag Gmbh International Surgical instrument system comprising an end effector lockout and a firing assembly lockout
US10682138B2 (en) 2016-12-21 2020-06-16 Ethicon Llc Bilaterally asymmetric staple forming pocket pairs
US11564688B2 (en) 2016-12-21 2023-01-31 Cilag Gmbh International Robotic surgical tool having a retraction mechanism
US10687809B2 (en) 2016-12-21 2020-06-23 Ethicon Llc Surgical staple cartridge with movable camming member configured to disengage firing member lockout features
US10695055B2 (en) 2016-12-21 2020-06-30 Ethicon Llc Firing assembly comprising a lockout
US11992213B2 (en) 2016-12-21 2024-05-28 Cilag Gmbh International Surgical stapling instruments with replaceable staple cartridges
US11497499B2 (en) 2016-12-21 2022-11-15 Cilag Gmbh International Articulatable surgical stapling instruments
US10736629B2 (en) 2016-12-21 2020-08-11 Ethicon Llc Surgical tool assemblies with clutching arrangements for shifting between closure systems with closure stroke reduction features and articulation and firing systems
US11571210B2 (en) 2016-12-21 2023-02-07 Cilag Gmbh International Firing assembly comprising a multiple failed-state fuse
US11957344B2 (en) 2016-12-21 2024-04-16 Cilag Gmbh International Surgical stapler having rows of obliquely oriented staples
US10758230B2 (en) 2016-12-21 2020-09-01 Ethicon Llc Surgical instrument with primary and safety processors
US10758229B2 (en) 2016-12-21 2020-09-01 Ethicon Llc Surgical instrument comprising improved jaw control
US10542982B2 (en) 2016-12-21 2020-01-28 Ethicon Llc Shaft assembly comprising first and second articulation lockouts
US11931034B2 (en) 2016-12-21 2024-03-19 Cilag Gmbh International Surgical stapling instruments with smart staple cartridges
US10779823B2 (en) 2016-12-21 2020-09-22 Ethicon Llc Firing member pin angle
US11918215B2 (en) 2016-12-21 2024-03-05 Cilag Gmbh International Staple cartridge with array of staple pockets
US10813638B2 (en) 2016-12-21 2020-10-27 Ethicon Llc Surgical end effectors with expandable tissue stop arrangements
US12226100B2 (en) 2016-12-21 2025-02-18 Cilag Gmbh International Method of deforming staples from two different types of staple cartridges with the same surgical stapling instrument
US10835247B2 (en) 2016-12-21 2020-11-17 Ethicon Llc Lockout arrangements for surgical end effectors
US10835245B2 (en) 2016-12-21 2020-11-17 Ethicon Llc Method for attaching a shaft assembly to a surgical instrument and, alternatively, to a surgical robot
US10856868B2 (en) 2016-12-21 2020-12-08 Ethicon Llc Firing member pin configurations
US10499914B2 (en) 2016-12-21 2019-12-10 Ethicon Llc Staple forming pocket arrangements
US11160553B2 (en) 2016-12-21 2021-11-02 Cilag Gmbh International Surgical stapling systems
US10881401B2 (en) 2016-12-21 2021-01-05 Ethicon Llc Staple firing member comprising a missing cartridge and/or spent cartridge lockout
US10426471B2 (en) 2016-12-21 2019-10-01 Ethicon Llc Surgical instrument with multiple failure response modes
US11224428B2 (en) 2016-12-21 2022-01-18 Cilag Gmbh International Surgical stapling systems
US10888322B2 (en) 2016-12-21 2021-01-12 Ethicon Llc Surgical instrument comprising a cutting member
US10893864B2 (en) 2016-12-21 2021-01-19 Ethicon Staple cartridges and arrangements of staples and staple cavities therein
US10898186B2 (en) 2016-12-21 2021-01-26 Ethicon Llc Staple forming pocket arrangements comprising primary sidewalls and pocket sidewalls
US11849948B2 (en) 2016-12-21 2023-12-26 Cilag Gmbh International Method for resetting a fuse of a surgical instrument shaft
US10905422B2 (en) 2016-12-21 2021-02-02 Ethicon Llc Surgical instrument for use with a robotic surgical system
US10918385B2 (en) 2016-12-21 2021-02-16 Ethicon Llc Surgical system comprising a firing member rotatable into an articulation state to articulate an end effector of the surgical system
US10959727B2 (en) 2016-12-21 2021-03-30 Ethicon Llc Articulatable surgical end effector with asymmetric shaft arrangement
US10973516B2 (en) 2016-12-21 2021-04-13 Ethicon Llc Surgical end effectors and adaptable firing members therefor
US10980536B2 (en) 2016-12-21 2021-04-20 Ethicon Llc No-cartridge and spent cartridge lockout arrangements for surgical staplers
US11191539B2 (en) 2016-12-21 2021-12-07 Cilag Gmbh International Shaft assembly comprising a manually-operable retraction system for use with a motorized surgical instrument system
US11191543B2 (en) 2016-12-21 2021-12-07 Cilag Gmbh International Assembly comprising a lock
US12245764B2 (en) 2016-12-21 2025-03-11 Cilag Gmbh International Shaft assembly comprising a lockout
US10492785B2 (en) 2016-12-21 2019-12-03 Ethicon Llc Shaft assembly comprising a lockout
US10485543B2 (en) 2016-12-21 2019-11-26 Ethicon Llc Anvil having a knife slot width
US11419606B2 (en) 2016-12-21 2022-08-23 Cilag Gmbh International Shaft assembly comprising a clutch configured to adapt the output of a rotary firing member to two different systems
US12274442B2 (en) 2016-12-21 2025-04-15 Cilag Gmbh International Surgical staple cartridge alignment features
US11191540B2 (en) 2016-12-21 2021-12-07 Cilag Gmbh International Protective cover arrangements for a joint interface between a movable jaw and actuator shaft of a surgical instrument
US10448950B2 (en) 2016-12-21 2019-10-22 Ethicon Llc Surgical staplers with independently actuatable closing and firing systems
US11766259B2 (en) 2016-12-21 2023-09-26 Cilag Gmbh International Method of deforming staples from two different types of staple cartridges with the same surgical stapling instrument
US11766260B2 (en) 2016-12-21 2023-09-26 Cilag Gmbh International Methods of stapling tissue
US11090048B2 (en) 2016-12-21 2021-08-17 Cilag Gmbh International Method for resetting a fuse of a surgical instrument shaft
US11179155B2 (en) 2016-12-21 2021-11-23 Cilag Gmbh International Anvil arrangements for surgical staplers
US11096689B2 (en) 2016-12-21 2021-08-24 Cilag Gmbh International Shaft assembly comprising a lockout
US11653917B2 (en) 2016-12-21 2023-05-23 Cilag Gmbh International Surgical stapling systems
US11701115B2 (en) 2016-12-21 2023-07-18 Cilag Gmbh International Methods of stapling tissue
US11134942B2 (en) 2016-12-21 2021-10-05 Cilag Gmbh International Surgical stapling instruments and staple-forming anvils
US11225517B2 (en) 2017-02-16 2022-01-18 Janssen Biotech, Inc. Treatment of hidradenitis suppurativa
EP3582813A4 (en) * 2017-02-16 2020-12-30 XBiotech, Inc TREATMENT OF HIDRADENITIS SUPPURATIVA
US11653914B2 (en) 2017-06-20 2023-05-23 Cilag Gmbh International Systems and methods for controlling motor velocity of a surgical stapling and cutting instrument according to articulation angle of end effector
US10980537B2 (en) 2017-06-20 2021-04-20 Ethicon Llc Closed loop feedback control of motor velocity of a surgical stapling and cutting instrument based on measured time over a specified number of shaft rotations
US10888321B2 (en) 2017-06-20 2021-01-12 Ethicon Llc Systems and methods for controlling velocity of a displacement member of a surgical stapling and cutting instrument
US11871939B2 (en) 2017-06-20 2024-01-16 Cilag Gmbh International Method for closed loop control of motor velocity of a surgical stapling and cutting instrument
US10881399B2 (en) 2017-06-20 2021-01-05 Ethicon Llc Techniques for adaptive control of motor velocity of a surgical stapling and cutting instrument
US10881396B2 (en) 2017-06-20 2021-01-05 Ethicon Llc Surgical instrument with variable duration trigger arrangement
US10307170B2 (en) 2017-06-20 2019-06-04 Ethicon Llc Method for closed loop control of motor velocity of a surgical stapling and cutting instrument
US12490980B2 (en) 2017-06-20 2025-12-09 Cilag Gmbh International Surgical instrument having controllable articulation velocity
US10595882B2 (en) 2017-06-20 2020-03-24 Ethicon Llc Methods for closed loop control of motor velocity of a surgical stapling and cutting instrument
US10327767B2 (en) 2017-06-20 2019-06-25 Ethicon Llc Control of motor velocity of a surgical stapling and cutting instrument based on angle of articulation
US10813639B2 (en) 2017-06-20 2020-10-27 Ethicon Llc Closed loop feedback control of motor velocity of a surgical stapling and cutting instrument based on system conditions
US11672532B2 (en) 2017-06-20 2023-06-13 Cilag Gmbh International Techniques for adaptive control of motor velocity of a surgical stapling and cutting instrument
USD879809S1 (en) 2017-06-20 2020-03-31 Ethicon Llc Display panel with changeable graphical user interface
US10624633B2 (en) 2017-06-20 2020-04-21 Ethicon Llc Systems and methods for controlling motor velocity of a surgical stapling and cutting instrument
US10368864B2 (en) 2017-06-20 2019-08-06 Ethicon Llc Systems and methods for controlling displaying motor velocity for a surgical instrument
US10390841B2 (en) 2017-06-20 2019-08-27 Ethicon Llc Control of motor velocity of a surgical stapling and cutting instrument based on angle of articulation
USD1039559S1 (en) 2017-06-20 2024-08-20 Cilag Gmbh International Display panel with changeable graphical user interface
US10779820B2 (en) 2017-06-20 2020-09-22 Ethicon Llc Systems and methods for controlling motor speed according to user input for a surgical instrument
US11793513B2 (en) 2017-06-20 2023-10-24 Cilag Gmbh International Systems and methods for controlling motor speed according to user input for a surgical instrument
USD879808S1 (en) 2017-06-20 2020-03-31 Ethicon Llc Display panel with graphical user interface
US11071554B2 (en) 2017-06-20 2021-07-27 Cilag Gmbh International Closed loop feedback control of motor velocity of a surgical stapling and cutting instrument based on magnitude of velocity error measurements
USD890784S1 (en) 2017-06-20 2020-07-21 Ethicon Llc Display panel with changeable graphical user interface
US12274438B2 (en) 2017-06-20 2025-04-15 Cilag Gmbh International Systems and methods for controlling motor velocity of a surgical stapling and cutting instrument according to articulation angle of end effector
US11517325B2 (en) 2017-06-20 2022-12-06 Cilag Gmbh International Closed loop feedback control of motor velocity of a surgical stapling and cutting instrument based on measured displacement distance traveled over a specified time interval
US11213302B2 (en) 2017-06-20 2022-01-04 Cilag Gmbh International Method for closed loop control of motor velocity of a surgical stapling and cutting instrument
US11090046B2 (en) 2017-06-20 2021-08-17 Cilag Gmbh International Systems and methods for controlling displacement member motion of a surgical stapling and cutting instrument
US10646220B2 (en) 2017-06-20 2020-05-12 Ethicon Llc Systems and methods for controlling displacement member velocity for a surgical instrument
US11382638B2 (en) 2017-06-20 2022-07-12 Cilag Gmbh International Closed loop feedback control of motor velocity of a surgical stapling and cutting instrument based on measured time over a specified displacement distance
US10772629B2 (en) 2017-06-27 2020-09-15 Ethicon Llc Surgical anvil arrangements
US10631859B2 (en) 2017-06-27 2020-04-28 Ethicon Llc Articulation systems for surgical instruments
US12207820B2 (en) 2017-06-27 2025-01-28 Cilag Gmbh International Surgical anvil arrangements
US11090049B2 (en) 2017-06-27 2021-08-17 Cilag Gmbh International Staple forming pocket arrangements
US11766258B2 (en) 2017-06-27 2023-09-26 Cilag Gmbh International Surgical anvil arrangements
US11324503B2 (en) 2017-06-27 2022-05-10 Cilag Gmbh International Surgical firing member arrangements
US11266405B2 (en) 2017-06-27 2022-03-08 Cilag Gmbh International Surgical anvil manufacturing methods
US12161326B2 (en) 2017-06-27 2024-12-10 Cilag Gmbh International Surgical anvil manufacturing methods
US10993716B2 (en) 2017-06-27 2021-05-04 Ethicon Llc Surgical anvil arrangements
US11141154B2 (en) 2017-06-27 2021-10-12 Cilag Gmbh International Surgical end effectors and anvils
US10856869B2 (en) 2017-06-27 2020-12-08 Ethicon Llc Surgical anvil arrangements
US11564686B2 (en) 2017-06-28 2023-01-31 Cilag Gmbh International Surgical shaft assemblies with flexible interfaces
US12446877B2 (en) 2017-06-28 2025-10-21 Cilag Gmbh International Surgical instrument having articulation lock actuated by closure tube displacement
US10903685B2 (en) 2017-06-28 2021-01-26 Ethicon Llc Surgical shaft assemblies with slip ring assemblies forming capacitive channels
US11529140B2 (en) 2017-06-28 2022-12-20 Cilag Gmbh International Surgical instrument lockout arrangement
US11083455B2 (en) 2017-06-28 2021-08-10 Cilag Gmbh International Surgical instrument comprising an articulation system ratio
USD869655S1 (en) 2017-06-28 2019-12-10 Ethicon Llc Surgical fastener cartridge
US11484310B2 (en) 2017-06-28 2022-11-01 Cilag Gmbh International Surgical instrument comprising a shaft including a closure tube profile
US12533127B2 (en) 2017-06-28 2026-01-27 Cilag Gmbh International Articulatable surgical instruments with movable jaws located in close proximity to an articulation axis
US10639037B2 (en) 2017-06-28 2020-05-05 Ethicon Llc Surgical instrument with axially movable closure member
US10211586B2 (en) 2017-06-28 2019-02-19 Ethicon Llc Surgical shaft assemblies with watertight housings
US11389161B2 (en) 2017-06-28 2022-07-19 Cilag Gmbh International Surgical instrument comprising selectively actuatable rotatable couplers
US10695057B2 (en) 2017-06-28 2020-06-30 Ethicon Llc Surgical instrument lockout arrangement
US11678880B2 (en) 2017-06-28 2023-06-20 Cilag Gmbh International Surgical instrument comprising a shaft including a housing arrangement
US11058424B2 (en) 2017-06-28 2021-07-13 Cilag Gmbh International Surgical instrument comprising an offset articulation joint
USD906355S1 (en) 2017-06-28 2020-12-29 Ethicon Llc Display screen or portion thereof with a graphical user interface for a surgical instrument
USD851762S1 (en) 2017-06-28 2019-06-18 Ethicon Llc Anvil
US10716614B2 (en) 2017-06-28 2020-07-21 Ethicon Llc Surgical shaft assemblies with slip ring assemblies with increased contact pressure
US11246592B2 (en) 2017-06-28 2022-02-15 Cilag Gmbh International Surgical instrument comprising an articulation system lockable to a frame
US11478242B2 (en) 2017-06-28 2022-10-25 Cilag Gmbh International Jaw retainer arrangement for retaining a pivotable surgical instrument jaw in pivotable retaining engagement with a second surgical instrument jaw
US11826048B2 (en) 2017-06-28 2023-11-28 Cilag Gmbh International Surgical instrument comprising selectively actuatable rotatable couplers
US10588633B2 (en) 2017-06-28 2020-03-17 Ethicon Llc Surgical instruments with open and closable jaws and axially movable firing member that is initially parked in close proximity to the jaws prior to firing
USD854151S1 (en) 2017-06-28 2019-07-16 Ethicon Llc Surgical instrument shaft
US10758232B2 (en) 2017-06-28 2020-09-01 Ethicon Llc Surgical instrument with positive jaw opening features
US10786253B2 (en) 2017-06-28 2020-09-29 Ethicon Llc Surgical end effectors with improved jaw aperture arrangements
US11696759B2 (en) 2017-06-28 2023-07-11 Cilag Gmbh International Surgical stapling instruments comprising shortened staple cartridge noses
US10765427B2 (en) 2017-06-28 2020-09-08 Ethicon Llc Method for articulating a surgical instrument
US11642128B2 (en) 2017-06-28 2023-05-09 Cilag Gmbh International Method for articulating a surgical instrument
US10779824B2 (en) 2017-06-28 2020-09-22 Ethicon Llc Surgical instrument comprising an articulation system lockable by a closure system
US11259805B2 (en) 2017-06-28 2022-03-01 Cilag Gmbh International Surgical instrument comprising firing member supports
US11020114B2 (en) 2017-06-28 2021-06-01 Cilag Gmbh International Surgical instruments with articulatable end effector with axially shortened articulation joint configurations
USD1018577S1 (en) 2017-06-28 2024-03-19 Cilag Gmbh International Display screen or portion thereof with a graphical user interface for a surgical instrument
US12324581B2 (en) 2017-06-28 2025-06-10 Cilag Gmbh International Surgical instrument comprising selectively actuatable rotatable couplers
US11000279B2 (en) 2017-06-28 2021-05-11 Ethicon Llc Surgical instrument comprising an articulation system ratio
US10898183B2 (en) 2017-06-29 2021-01-26 Ethicon Llc Robotic surgical instrument with closed loop feedback techniques for advancement of closure member during firing
US10398434B2 (en) 2017-06-29 2019-09-03 Ethicon Llc Closed loop velocity control of closure member for robotic surgical instrument
US10932772B2 (en) 2017-06-29 2021-03-02 Ethicon Llc Methods for closed loop velocity control for robotic surgical instrument
US10258418B2 (en) 2017-06-29 2019-04-16 Ethicon Llc System for controlling articulation forces
US11890005B2 (en) 2017-06-29 2024-02-06 Cilag Gmbh International Methods for closed loop velocity control for robotic surgical instrument
US11007022B2 (en) 2017-06-29 2021-05-18 Ethicon Llc Closed loop velocity control techniques based on sensed tissue parameters for robotic surgical instrument
US11974742B2 (en) 2017-08-03 2024-05-07 Cilag Gmbh International Surgical system comprising an articulation bailout
US11471155B2 (en) 2017-08-03 2022-10-18 Cilag Gmbh International Surgical system bailout
US11304695B2 (en) 2017-08-03 2022-04-19 Cilag Gmbh International Surgical system shaft interconnection
US11944300B2 (en) 2017-08-03 2024-04-02 Cilag Gmbh International Method for operating a surgical system bailout
US10729501B2 (en) 2017-09-29 2020-08-04 Ethicon Llc Systems and methods for language selection of a surgical instrument
US10765429B2 (en) 2017-09-29 2020-09-08 Ethicon Llc Systems and methods for providing alerts according to the operational state of a surgical instrument
US10743872B2 (en) 2017-09-29 2020-08-18 Ethicon Llc System and methods for controlling a display of a surgical instrument
USD917500S1 (en) 2017-09-29 2021-04-27 Ethicon Llc Display screen or portion thereof with graphical user interface
US10796471B2 (en) 2017-09-29 2020-10-06 Ethicon Llc Systems and methods of displaying a knife position for a surgical instrument
US11998199B2 (en) 2017-09-29 2024-06-04 Cllag GmbH International System and methods for controlling a display of a surgical instrument
USD907647S1 (en) 2017-09-29 2021-01-12 Ethicon Llc Display screen or portion thereof with animated graphical user interface
USD907648S1 (en) 2017-09-29 2021-01-12 Ethicon Llc Display screen or portion thereof with animated graphical user interface
US11399829B2 (en) 2017-09-29 2022-08-02 Cilag Gmbh International Systems and methods of initiating a power shutdown mode for a surgical instrument
US11090075B2 (en) 2017-10-30 2021-08-17 Cilag Gmbh International Articulation features for surgical end effector
US11134944B2 (en) 2017-10-30 2021-10-05 Cilag Gmbh International Surgical stapler knife motion controls
US12076011B2 (en) 2017-10-30 2024-09-03 Cilag Gmbh International Surgical stapler knife motion controls
US10779903B2 (en) 2017-10-31 2020-09-22 Ethicon Llc Positive shaft rotation lock activated by jaw closure
US11963680B2 (en) 2017-10-31 2024-04-23 Cilag Gmbh International Cartridge body design with force reduction based on firing completion
US11478244B2 (en) 2017-10-31 2022-10-25 Cilag Gmbh International Cartridge body design with force reduction based on firing completion
US10842490B2 (en) 2017-10-31 2020-11-24 Ethicon Llc Cartridge body design with force reduction based on firing completion
US10966718B2 (en) 2017-12-15 2021-04-06 Ethicon Llc Dynamic clamping assemblies with improved wear characteristics for use in connection with electromechanical surgical instruments
US11197670B2 (en) 2017-12-15 2021-12-14 Cilag Gmbh International Surgical end effectors with pivotal jaws configured to touch at their respective distal ends when fully closed
US11896222B2 (en) 2017-12-15 2024-02-13 Cilag Gmbh International Methods of operating surgical end effectors
US10828033B2 (en) 2017-12-15 2020-11-10 Ethicon Llc Handheld electromechanical surgical instruments with improved motor control arrangements for positioning components of an adapter coupled thereto
US10869666B2 (en) 2017-12-15 2020-12-22 Ethicon Llc Adapters with control systems for controlling multiple motors of an electromechanical surgical instrument
US10743875B2 (en) 2017-12-15 2020-08-18 Ethicon Llc Surgical end effectors with jaw stiffener arrangements configured to permit monitoring of firing member
US10743874B2 (en) 2017-12-15 2020-08-18 Ethicon Llc Sealed adapters for use with electromechanical surgical instruments
US10687813B2 (en) 2017-12-15 2020-06-23 Ethicon Llc Adapters with firing stroke sensing arrangements for use in connection with electromechanical surgical instruments
US11071543B2 (en) 2017-12-15 2021-07-27 Cilag Gmbh International Surgical end effectors with clamping assemblies configured to increase jaw aperture ranges
US11033267B2 (en) 2017-12-15 2021-06-15 Ethicon Llc Systems and methods of controlling a clamping member firing rate of a surgical instrument
US10779826B2 (en) 2017-12-15 2020-09-22 Ethicon Llc Methods of operating surgical end effectors
US11006955B2 (en) 2017-12-15 2021-05-18 Ethicon Llc End effectors with positive jaw opening features for use with adapters for electromechanical surgical instruments
US10779825B2 (en) 2017-12-15 2020-09-22 Ethicon Llc Adapters with end effector position sensing and control arrangements for use in connection with electromechanical surgical instruments
US11020112B2 (en) 2017-12-19 2021-06-01 Ethicon Llc Surgical tools configured for interchangeable use with different controller interfaces
US12076096B2 (en) 2017-12-19 2024-09-03 Cilag Gmbh International Method for determining the position of a rotatable jaw of a surgical instrument attachment assembly
USD910847S1 (en) 2017-12-19 2021-02-16 Ethicon Llc Surgical instrument assembly
US11045270B2 (en) 2017-12-19 2021-06-29 Cilag Gmbh International Robotic attachment comprising exterior drive actuator
US11284953B2 (en) 2017-12-19 2022-03-29 Cilag Gmbh International Method for determining the position of a rotatable jaw of a surgical instrument attachment assembly
US10729509B2 (en) 2017-12-19 2020-08-04 Ethicon Llc Surgical instrument comprising closure and firing locking mechanism
US10835330B2 (en) 2017-12-19 2020-11-17 Ethicon Llc Method for determining the position of a rotatable jaw of a surgical instrument attachment assembly
US10716565B2 (en) 2017-12-19 2020-07-21 Ethicon Llc Surgical instruments with dual articulation drivers
US11337691B2 (en) 2017-12-21 2022-05-24 Cilag Gmbh International Surgical instrument configured to determine firing path
US11129680B2 (en) 2017-12-21 2021-09-28 Cilag Gmbh International Surgical instrument comprising a projector
US12336705B2 (en) 2017-12-21 2025-06-24 Cilag Gmbh International Continuous use self-propelled stapling instrument
US11369368B2 (en) 2017-12-21 2022-06-28 Cilag Gmbh International Surgical instrument comprising synchronized drive systems
US11883019B2 (en) 2017-12-21 2024-01-30 Cilag Gmbh International Stapling instrument comprising a staple feeding system
US11849939B2 (en) 2017-12-21 2023-12-26 Cilag Gmbh International Continuous use self-propelled stapling instrument
US11751867B2 (en) 2017-12-21 2023-09-12 Cilag Gmbh International Surgical instrument comprising sequenced systems
US11583274B2 (en) 2017-12-21 2023-02-21 Cilag Gmbh International Self-guiding stapling instrument
US11179151B2 (en) 2017-12-21 2021-11-23 Cilag Gmbh International Surgical instrument comprising a display
US10743868B2 (en) 2017-12-21 2020-08-18 Ethicon Llc Surgical instrument comprising a pivotable distal head
US11311290B2 (en) 2017-12-21 2022-04-26 Cilag Gmbh International Surgical instrument comprising an end effector dampener
US11076853B2 (en) 2017-12-21 2021-08-03 Cilag Gmbh International Systems and methods of displaying a knife position during transection for a surgical instrument
US11576668B2 (en) 2017-12-21 2023-02-14 Cilag Gmbh International Staple instrument comprising a firing path display
US11179152B2 (en) 2017-12-21 2021-11-23 Cilag Gmbh International Surgical instrument comprising a tissue grasping system
US10682134B2 (en) 2017-12-21 2020-06-16 Ethicon Llc Continuous use self-propelled stapling instrument
US11364027B2 (en) 2017-12-21 2022-06-21 Cilag Gmbh International Surgical instrument comprising speed control
US11795217B2 (en) 2018-06-29 2023-10-24 Cedars-Sinai Medical Center Interleukin-1 inhibition for combination treatment of pancreatic cancer cachexia
US12262888B2 (en) 2018-08-20 2025-04-01 Cilag Gmbh International Surgical instruments with progressive jaw closure arrangements
US10912559B2 (en) 2018-08-20 2021-02-09 Ethicon Llc Reinforced deformable anvil tip for surgical stapler anvil
US11039834B2 (en) 2018-08-20 2021-06-22 Cilag Gmbh International Surgical stapler anvils with staple directing protrusions and tissue stability features
US10856870B2 (en) 2018-08-20 2020-12-08 Ethicon Llc Switching arrangements for motor powered articulatable surgical instruments
US11045192B2 (en) 2018-08-20 2021-06-29 Cilag Gmbh International Fabricating techniques for surgical stapler anvils
US10779821B2 (en) 2018-08-20 2020-09-22 Ethicon Llc Surgical stapler anvils with tissue stop features configured to avoid tissue pinch
US10842492B2 (en) 2018-08-20 2020-11-24 Ethicon Llc Powered articulatable surgical instruments with clutching and locking arrangements for linking an articulation drive system to a firing drive system
USD914878S1 (en) 2018-08-20 2021-03-30 Ethicon Llc Surgical instrument anvil
US11957339B2 (en) 2018-08-20 2024-04-16 Cilag Gmbh International Method for fabricating surgical stapler anvils
US11291440B2 (en) 2018-08-20 2022-04-05 Cilag Gmbh International Method for operating a powered articulatable surgical instrument
US11207065B2 (en) 2018-08-20 2021-12-28 Cilag Gmbh International Method for fabricating surgical stapler anvils
US11324501B2 (en) 2018-08-20 2022-05-10 Cilag Gmbh International Surgical stapling devices with improved closure members
US12076008B2 (en) 2018-08-20 2024-09-03 Cilag Gmbh International Method for operating a powered articulatable surgical instrument
US11083458B2 (en) 2018-08-20 2021-08-10 Cilag Gmbh International Powered surgical instruments with clutching arrangements to convert linear drive motions to rotary drive motions
US11253256B2 (en) 2018-08-20 2022-02-22 Cilag Gmbh International Articulatable motor powered surgical instruments with dedicated articulation motor arrangements
WO2020176730A1 (en) 2019-02-27 2020-09-03 Janssen Biotech, Inc. Antibody formulation
WO2020176738A1 (en) 2019-02-28 2020-09-03 Janssen Biotech, Inc. Anti-il-alpha antibody for the treatment of hidradenitis suppurativa
US11147553B2 (en) 2019-03-25 2021-10-19 Cilag Gmbh International Firing drive arrangements for surgical systems
US11172929B2 (en) 2019-03-25 2021-11-16 Cilag Gmbh International Articulation drive arrangements for surgical systems
US11696761B2 (en) 2019-03-25 2023-07-11 Cilag Gmbh International Firing drive arrangements for surgical systems
US11147551B2 (en) 2019-03-25 2021-10-19 Cilag Gmbh International Firing drive arrangements for surgical systems
US12290259B2 (en) 2019-03-25 2025-05-06 Cilag Gmbh International Firing drive arrangements for surgical systems
US11253254B2 (en) 2019-04-30 2022-02-22 Cilag Gmbh International Shaft rotation actuator on a surgical instrument
US11426251B2 (en) 2019-04-30 2022-08-30 Cilag Gmbh International Articulation directional lights on a surgical instrument
US11452528B2 (en) 2019-04-30 2022-09-27 Cilag Gmbh International Articulation actuators for a surgical instrument
US11903581B2 (en) 2019-04-30 2024-02-20 Cilag Gmbh International Methods for stapling tissue using a surgical instrument
US11648009B2 (en) 2019-04-30 2023-05-16 Cilag Gmbh International Rotatable jaw tip for a surgical instrument
US11471157B2 (en) 2019-04-30 2022-10-18 Cilag Gmbh International Articulation control mapping for a surgical instrument
US11432816B2 (en) 2019-04-30 2022-09-06 Cilag Gmbh International Articulation pin for a surgical instrument
US11241235B2 (en) 2019-06-28 2022-02-08 Cilag Gmbh International Method of using multiple RFID chips with a surgical assembly
US12458455B2 (en) 2019-06-28 2025-11-04 Cilag Gmbh International Surgical RFID assemblies for instrument operational setting control
US11684369B2 (en) 2019-06-28 2023-06-27 Cilag Gmbh International Method of using multiple RFID chips with a surgical assembly
US11660163B2 (en) 2019-06-28 2023-05-30 Cilag Gmbh International Surgical system with RFID tags for updating motor assembly parameters
US11744593B2 (en) 2019-06-28 2023-09-05 Cilag Gmbh International Method for authenticating the compatibility of a staple cartridge with a surgical instrument
US11638587B2 (en) 2019-06-28 2023-05-02 Cilag Gmbh International RFID identification systems for surgical instruments
US11523822B2 (en) 2019-06-28 2022-12-13 Cilag Gmbh International Battery pack including a circuit interrupter
US11553919B2 (en) 2019-06-28 2023-01-17 Cilag Gmbh International Method for authenticating the compatibility of a staple cartridge with a surgical instrument
US11553971B2 (en) 2019-06-28 2023-01-17 Cilag Gmbh International Surgical RFID assemblies for display and communication
US11298132B2 (en) 2019-06-28 2022-04-12 Cilag GmbH Inlernational Staple cartridge including a honeycomb extension
US11224497B2 (en) 2019-06-28 2022-01-18 Cilag Gmbh International Surgical systems with multiple RFID tags
US11259803B2 (en) 2019-06-28 2022-03-01 Cilag Gmbh International Surgical stapling system having an information encryption protocol
US11298127B2 (en) 2019-06-28 2022-04-12 Cilag GmbH Interational Surgical stapling system having a lockout mechanism for an incompatible cartridge
US11627959B2 (en) 2019-06-28 2023-04-18 Cilag Gmbh International Surgical instruments including manual and powered system lockouts
US12004740B2 (en) 2019-06-28 2024-06-11 Cilag Gmbh International Surgical stapling system having an information decryption protocol
US11350938B2 (en) 2019-06-28 2022-06-07 Cilag Gmbh International Surgical instrument comprising an aligned rfid sensor
US11229437B2 (en) 2019-06-28 2022-01-25 Cilag Gmbh International Method for authenticating the compatibility of a staple cartridge with a surgical instrument
US11246678B2 (en) 2019-06-28 2022-02-15 Cilag Gmbh International Surgical stapling system having a frangible RFID tag
US11219455B2 (en) 2019-06-28 2022-01-11 Cilag Gmbh International Surgical instrument including a lockout key
US11291451B2 (en) 2019-06-28 2022-04-05 Cilag Gmbh International Surgical instrument with battery compatibility verification functionality
US11684434B2 (en) 2019-06-28 2023-06-27 Cilag Gmbh International Surgical RFID assemblies for instrument operational setting control
US11464601B2 (en) 2019-06-28 2022-10-11 Cilag Gmbh International Surgical instrument comprising an RFID system for tracking a movable component
US11497492B2 (en) 2019-06-28 2022-11-15 Cilag Gmbh International Surgical instrument including an articulation lock
US11376098B2 (en) 2019-06-28 2022-07-05 Cilag Gmbh International Surgical instrument system comprising an RFID system
US11399837B2 (en) 2019-06-28 2022-08-02 Cilag Gmbh International Mechanisms for motor control adjustments of a motorized surgical instrument
US11478241B2 (en) 2019-06-28 2022-10-25 Cilag Gmbh International Staple cartridge including projections
US11771419B2 (en) 2019-06-28 2023-10-03 Cilag Gmbh International Packaging for a replaceable component of a surgical stapling system
US11426167B2 (en) 2019-06-28 2022-08-30 Cilag Gmbh International Mechanisms for proper anvil attachment surgical stapling head assembly
US11051807B2 (en) 2019-06-28 2021-07-06 Cilag Gmbh International Packaging assembly including a particulate trap
US11504122B2 (en) 2019-12-19 2022-11-22 Cilag Gmbh International Surgical instrument comprising a nested firing member
US11529137B2 (en) 2019-12-19 2022-12-20 Cilag Gmbh International Staple cartridge comprising driver retention members
US11911032B2 (en) 2019-12-19 2024-02-27 Cilag Gmbh International Staple cartridge comprising a seating cam
US12035913B2 (en) 2019-12-19 2024-07-16 Cilag Gmbh International Staple cartridge comprising a deployable knife
US11607219B2 (en) 2019-12-19 2023-03-21 Cilag Gmbh International Staple cartridge comprising a detachable tissue cutting knife
US11701111B2 (en) 2019-12-19 2023-07-18 Cilag Gmbh International Method for operating a surgical stapling instrument
US11844520B2 (en) 2019-12-19 2023-12-19 Cilag Gmbh International Staple cartridge comprising driver retention members
US11291447B2 (en) 2019-12-19 2022-04-05 Cilag Gmbh International Stapling instrument comprising independent jaw closing and staple firing systems
US11931033B2 (en) 2019-12-19 2024-03-19 Cilag Gmbh International Staple cartridge comprising a latch lockout
US11446029B2 (en) 2019-12-19 2022-09-20 Cilag Gmbh International Staple cartridge comprising projections extending from a curved deck surface
US11576672B2 (en) 2019-12-19 2023-02-14 Cilag Gmbh International Surgical instrument comprising a closure system including a closure member and an opening member driven by a drive screw
US11304696B2 (en) 2019-12-19 2022-04-19 Cilag Gmbh International Surgical instrument comprising a powered articulation system
US11464512B2 (en) 2019-12-19 2022-10-11 Cilag Gmbh International Staple cartridge comprising a curved deck surface
US11234698B2 (en) 2019-12-19 2022-02-01 Cilag Gmbh International Stapling system comprising a clamp lockout and a firing lockout
US11559304B2 (en) 2019-12-19 2023-01-24 Cilag Gmbh International Surgical instrument comprising a rapid closure mechanism
US11529139B2 (en) 2019-12-19 2022-12-20 Cilag Gmbh International Motor driven surgical instrument
WO2021211924A1 (en) 2020-04-16 2021-10-21 Janssen Biotech, Inc. Treatment of atopic dermatitis
WO2021211927A1 (en) 2020-04-16 2021-10-21 Janssen Biotech, Inc. Treatment of hidradenitis suppurativa
USD976401S1 (en) 2020-06-02 2023-01-24 Cilag Gmbh International Staple cartridge
USD966512S1 (en) 2020-06-02 2022-10-11 Cilag Gmbh International Staple cartridge
USD974560S1 (en) 2020-06-02 2023-01-03 Cilag Gmbh International Staple cartridge
USD975850S1 (en) 2020-06-02 2023-01-17 Cilag Gmbh International Staple cartridge
USD975851S1 (en) 2020-06-02 2023-01-17 Cilag Gmbh International Staple cartridge
USD967421S1 (en) 2020-06-02 2022-10-18 Cilag Gmbh International Staple cartridge
USD975278S1 (en) 2020-06-02 2023-01-10 Cilag Gmbh International Staple cartridge
US11864756B2 (en) 2020-07-28 2024-01-09 Cilag Gmbh International Surgical instruments with flexible ball chain drive arrangements
US12220126B2 (en) 2020-07-28 2025-02-11 Cilag Gmbh International Surgical instruments with double pivot articulation joint arrangements
US11826013B2 (en) 2020-07-28 2023-11-28 Cilag Gmbh International Surgical instruments with firing member closure features
US11660090B2 (en) 2020-07-28 2023-05-30 Cllag GmbH International Surgical instruments with segmented flexible drive arrangements
US12161323B2 (en) 2020-07-28 2024-12-10 Cilag Gmbh International Surgical instruments with torsion spine drive arrangements
US11883024B2 (en) 2020-07-28 2024-01-30 Cilag Gmbh International Method of operating a surgical instrument
US11871925B2 (en) 2020-07-28 2024-01-16 Cilag Gmbh International Surgical instruments with dual spherical articulation joint arrangements
US11737748B2 (en) 2020-07-28 2023-08-29 Cilag Gmbh International Surgical instruments with double spherical articulation joints with pivotable links
US11638582B2 (en) 2020-07-28 2023-05-02 Cilag Gmbh International Surgical instruments with torsion spine drive arrangements
US12064107B2 (en) 2020-07-28 2024-08-20 Cilag Gmbh International Articulatable surgical instruments with articulation joints comprising flexible exoskeleton arrangements
US11857182B2 (en) 2020-07-28 2024-01-02 Cilag Gmbh International Surgical instruments with combination function articulation joint arrangements
US11974741B2 (en) 2020-07-28 2024-05-07 Cilag Gmbh International Surgical instruments with differential articulation joint arrangements for accommodating flexible actuators
US12502171B2 (en) 2020-07-28 2025-12-23 Cilag Gmbh International Surgical instruments with flexible firing member actuator constraint arrangements
US12053175B2 (en) 2020-10-29 2024-08-06 Cilag Gmbh International Surgical instrument comprising a stowed closure actuator stop
US12029421B2 (en) 2020-10-29 2024-07-09 Cilag Gmbh International Surgical instrument comprising a staged voltage regulation start-up system
US11931025B2 (en) 2020-10-29 2024-03-19 Cilag Gmbh International Surgical instrument comprising a releasable closure drive lock
USD980425S1 (en) 2020-10-29 2023-03-07 Cilag Gmbh International Surgical instrument assembly
US11517390B2 (en) 2020-10-29 2022-12-06 Cilag Gmbh International Surgical instrument comprising a limited travel switch
US11717289B2 (en) 2020-10-29 2023-08-08 Cilag Gmbh International Surgical instrument comprising an indicator which indicates that an articulation drive is actuatable
US11617577B2 (en) 2020-10-29 2023-04-04 Cilag Gmbh International Surgical instrument comprising a sensor configured to sense whether an articulation drive of the surgical instrument is actuatable
US11896217B2 (en) 2020-10-29 2024-02-13 Cilag Gmbh International Surgical instrument comprising an articulation lock
US11452526B2 (en) 2020-10-29 2022-09-27 Cilag Gmbh International Surgical instrument comprising a staged voltage regulation start-up system
US11844518B2 (en) 2020-10-29 2023-12-19 Cilag Gmbh International Method for operating a surgical instrument
US12076194B2 (en) 2020-10-29 2024-09-03 Cilag Gmbh International Surgical instrument comprising an articulation indicator
USD1013170S1 (en) 2020-10-29 2024-01-30 Cilag Gmbh International Surgical instrument assembly
US11779330B2 (en) 2020-10-29 2023-10-10 Cilag Gmbh International Surgical instrument comprising a jaw alignment system
US11534259B2 (en) 2020-10-29 2022-12-27 Cilag Gmbh International Surgical instrument comprising an articulation indicator
US12226099B2 (en) 2020-10-29 2025-02-18 Cilag Gmbh International Surgical stapler with pulse width modulated driven adjustable speed staple firing stroke
US11737751B2 (en) 2020-12-02 2023-08-29 Cilag Gmbh International Devices and methods of managing energy dissipated within sterile barriers of surgical instrument housings
US11890010B2 (en) 2020-12-02 2024-02-06 Cllag GmbH International Dual-sided reinforced reload for surgical instruments
US12133648B2 (en) 2020-12-02 2024-11-05 Cilag Gmbh International Surgical instrument with cartridge release mechanisms
US11627960B2 (en) 2020-12-02 2023-04-18 Cilag Gmbh International Powered surgical instruments with smart reload with separately attachable exteriorly mounted wiring connections
US11653920B2 (en) 2020-12-02 2023-05-23 Cilag Gmbh International Powered surgical instruments with communication interfaces through sterile barrier
US11944296B2 (en) 2020-12-02 2024-04-02 Cilag Gmbh International Powered surgical instruments with external connectors
US11653915B2 (en) 2020-12-02 2023-05-23 Cilag Gmbh International Surgical instruments with sled location detection and adjustment features
US12369912B2 (en) 2020-12-02 2025-07-29 Cilag Gmbh International Surgical instruments with interactive features to remedy incidental sled movements
US12171427B2 (en) 2020-12-02 2024-12-24 Cilag Gmbh International Powered surgical instruments with smart reload with separately attachable exteriorly mounted wiring connections
US11744581B2 (en) 2020-12-02 2023-09-05 Cilag Gmbh International Powered surgical instruments with multi-phase tissue treatment
US12471982B2 (en) 2020-12-02 2025-11-18 Cilag Gmbh International Method for tissue treatment by surgical instrument
US11849943B2 (en) 2020-12-02 2023-12-26 Cilag Gmbh International Surgical instrument with cartridge release mechanisms
US11678882B2 (en) 2020-12-02 2023-06-20 Cilag Gmbh International Surgical instruments with interactive features to remedy incidental sled movements
US12232724B2 (en) 2020-12-02 2025-02-25 Cilag Gmbh International Surgical instruments with sled location detection and adjustment features
US11812964B2 (en) 2021-02-26 2023-11-14 Cilag Gmbh International Staple cartridge comprising a power management circuit
US12324580B2 (en) 2021-02-26 2025-06-10 Cilag Gmbh International Method of powering and communicating with a staple cartridge
US12533126B2 (en) 2021-02-26 2026-01-27 Cilag Gmbh International Monitoring of manufacturing life-cycle
US12035912B2 (en) 2021-02-26 2024-07-16 Cilag Gmbh International Adjustable communication based on available bandwidth and power capacity
US12035910B2 (en) 2021-02-26 2024-07-16 Cllag GmbH International Monitoring of internal systems to detect and track cartridge motion status
US11980362B2 (en) 2021-02-26 2024-05-14 Cilag Gmbh International Surgical instrument system comprising a power transfer coil
US12108951B2 (en) 2021-02-26 2024-10-08 Cilag Gmbh International Staple cartridge comprising a sensing array and a temperature control system
US12035911B2 (en) 2021-02-26 2024-07-16 Cilag Gmbh International Stapling instrument comprising a separate power antenna and a data transfer antenna
US11793514B2 (en) 2021-02-26 2023-10-24 Cilag Gmbh International Staple cartridge comprising sensor array which may be embedded in cartridge body
US11696757B2 (en) 2021-02-26 2023-07-11 Cilag Gmbh International Monitoring of internal systems to detect and track cartridge motion status
US11723657B2 (en) 2021-02-26 2023-08-15 Cilag Gmbh International Adjustable communication based on available bandwidth and power capacity
US11950777B2 (en) 2021-02-26 2024-04-09 Cilag Gmbh International Staple cartridge comprising an information access control system
US11730473B2 (en) 2021-02-26 2023-08-22 Cilag Gmbh International Monitoring of manufacturing life-cycle
US11701113B2 (en) 2021-02-26 2023-07-18 Cilag Gmbh International Stapling instrument comprising a separate power antenna and a data transfer antenna
US11744583B2 (en) 2021-02-26 2023-09-05 Cilag Gmbh International Distal communication array to tune frequency of RF systems
US12369909B2 (en) 2021-02-26 2025-07-29 Cilag Gmbh International Monitoring of multiple sensors over time to detect moving characteristics of tissue
US12357309B2 (en) 2021-02-26 2025-07-15 Cilag Gmbh International Staple cartridge comprising a power management circuit
US11749877B2 (en) 2021-02-26 2023-09-05 Cilag Gmbh International Stapling instrument comprising a signal antenna
US11950779B2 (en) 2021-02-26 2024-04-09 Cilag Gmbh International Method of powering and communicating with a staple cartridge
US11925349B2 (en) 2021-02-26 2024-03-12 Cilag Gmbh International Adjustment to transfer parameters to improve available power
US11751869B2 (en) 2021-02-26 2023-09-12 Cilag Gmbh International Monitoring of multiple sensors over time to detect moving characteristics of tissue
US12144501B2 (en) 2021-02-26 2024-11-19 Cilag Gmbh International Monitoring of manufacturing life-cycle
US11737749B2 (en) 2021-03-22 2023-08-29 Cilag Gmbh International Surgical stapling instrument comprising a retraction system
US11826012B2 (en) 2021-03-22 2023-11-28 Cilag Gmbh International Stapling instrument comprising a pulsed motor-driven firing rack
US11759202B2 (en) 2021-03-22 2023-09-19 Cilag Gmbh International Staple cartridge comprising an implantable layer
US12527571B2 (en) 2021-03-22 2026-01-20 Cilag Gmbh International Surgical instrument comprising a firing drive including a selectable leverage mechanism
US11723658B2 (en) 2021-03-22 2023-08-15 Cilag Gmbh International Staple cartridge comprising a firing lockout
US12042146B2 (en) 2021-03-22 2024-07-23 Cilag Gmbh International Surgical stapling instrument comprising a retraction system
US11717291B2 (en) 2021-03-22 2023-08-08 Cilag Gmbh International Staple cartridge comprising staples configured to apply different tissue compression
US11806011B2 (en) 2021-03-22 2023-11-07 Cilag Gmbh International Stapling instrument comprising tissue compression systems
US11826042B2 (en) 2021-03-22 2023-11-28 Cilag Gmbh International Surgical instrument comprising a firing drive including a selectable leverage mechanism
US12023026B2 (en) 2021-03-22 2024-07-02 Cilag Gmbh International Staple cartridge comprising a firing lockout
US11896219B2 (en) 2021-03-24 2024-02-13 Cilag Gmbh International Mating features between drivers and underside of a cartridge deck
US11786243B2 (en) 2021-03-24 2023-10-17 Cilag Gmbh International Firing members having flexible portions for adapting to a load during a surgical firing stroke
US11849944B2 (en) 2021-03-24 2023-12-26 Cilag Gmbh International Drivers for fastener cartridge assemblies having rotary drive screws
US11832816B2 (en) 2021-03-24 2023-12-05 Cilag Gmbh International Surgical stapling assembly comprising nonplanar staples and planar staples
US11903582B2 (en) 2021-03-24 2024-02-20 Cilag Gmbh International Leveraging surfaces for cartridge installation
US11944336B2 (en) 2021-03-24 2024-04-02 Cilag Gmbh International Joint arrangements for multi-planar alignment and support of operational drive shafts in articulatable surgical instruments
US11744603B2 (en) 2021-03-24 2023-09-05 Cilag Gmbh International Multi-axis pivot joints for surgical instruments and methods for manufacturing same
US11793516B2 (en) 2021-03-24 2023-10-24 Cilag Gmbh International Surgical staple cartridge comprising longitudinal support beam
US11786239B2 (en) 2021-03-24 2023-10-17 Cilag Gmbh International Surgical instrument articulation joint arrangements comprising multiple moving linkage features
US11849945B2 (en) 2021-03-24 2023-12-26 Cilag Gmbh International Rotary-driven surgical stapling assembly comprising eccentrically driven firing member
US11896218B2 (en) 2021-03-24 2024-02-13 Cilag Gmbh International Method of using a powered stapling device
US11857183B2 (en) 2021-03-24 2024-01-02 Cilag Gmbh International Stapling assembly components having metal substrates and plastic bodies
US12102323B2 (en) 2021-03-24 2024-10-01 Cilag Gmbh International Rotary-driven surgical stapling assembly comprising a floatable component
US11998201B2 (en) 2021-05-28 2024-06-04 Cilag CmbH International Stapling instrument comprising a firing lockout
US11918217B2 (en) 2021-05-28 2024-03-05 Cilag Gmbh International Stapling instrument comprising a staple cartridge insertion stop
US11723662B2 (en) 2021-05-28 2023-08-15 Cilag Gmbh International Stapling instrument comprising an articulation control display
US11826047B2 (en) 2021-05-28 2023-11-28 Cilag Gmbh International Stapling instrument comprising jaw mounts
US11957337B2 (en) 2021-10-18 2024-04-16 Cilag Gmbh International Surgical stapling assembly with offset ramped drive surfaces
US11877745B2 (en) 2021-10-18 2024-01-23 Cilag Gmbh International Surgical stapling assembly having longitudinally-repeating staple leg clusters
US11980363B2 (en) 2021-10-18 2024-05-14 Cilag Gmbh International Row-to-row staple array variations
US12239317B2 (en) 2021-10-18 2025-03-04 Cilag Gmbh International Anvil comprising an arrangement of forming pockets proximal to tissue stop
US12089841B2 (en) 2021-10-28 2024-09-17 Cilag CmbH International Staple cartridge identification systems
US11937816B2 (en) 2021-10-28 2024-03-26 Cilag Gmbh International Electrical lead arrangements for surgical instruments
US12432790B2 (en) 2021-10-28 2025-09-30 Cilag Gmbh International Method and device for transmitting UART communications over a security short range wireless communication

Also Published As

Publication number Publication date
RU2010148904A (en) 2012-07-10
JP2020143127A (en) 2020-09-10
JP2015091836A (en) 2015-05-14
IL209576A (en) 2014-11-30
EP2285409A1 (en) 2011-02-23
MX2010012963A (en) 2011-04-05
IL234954B (en) 2019-09-26
US8679489B2 (en) 2014-03-25
PH12014501773A1 (en) 2017-12-11
HUE029003T2 (en) 2017-01-30
CA2726345E (en) 2009-12-10
RU2666915C2 (en) 2018-09-13
IL268776B (en) 2021-06-30
AU2009255670B2 (en) 2011-12-15
US20150094455A1 (en) 2015-04-02
IL268776A (en) 2019-10-31
CO6351749A2 (en) 2011-12-20
EP3085773A3 (en) 2016-11-23
CN102112154B (en) 2013-10-30
US9181338B2 (en) 2015-11-10
MY154067A (en) 2015-04-30
CN105467136B (en) 2018-02-16
US20120021512A1 (en) 2012-01-26
EP2285409A4 (en) 2012-03-28
RU2013138469A (en) 2015-02-27
US20130177982A1 (en) 2013-07-11
EP3085773A2 (en) 2016-10-26
SI2285409T1 (en) 2016-10-28
US8784817B2 (en) 2014-07-22
IL234954A0 (en) 2014-11-30
AU2009255670A1 (en) 2009-12-10
CN103656638B (en) 2016-04-27
CA3011485A1 (en) 2009-12-10
US20120164665A1 (en) 2012-06-28
EP2285409B1 (en) 2016-04-20
US20120014971A1 (en) 2012-01-19
US8388956B2 (en) 2013-03-05
JP6133264B2 (en) 2017-05-24
PL2285409T3 (en) 2016-10-31
WO2009148575A8 (en) 2010-08-05
BRPI0909610A2 (en) 2017-09-12
US20090298096A1 (en) 2009-12-03
US20130171728A1 (en) 2013-07-04
US20120015433A1 (en) 2012-01-19
RU2498998C2 (en) 2013-11-20
US20120015384A1 (en) 2012-01-19
US20210171623A1 (en) 2021-06-10
BRPI0909610B1 (en) 2022-07-12
KR101567117B1 (en) 2015-11-06
NZ590033A (en) 2011-08-26
WO2009148575A1 (en) 2009-12-10
ES2797126T3 (en) 2020-12-01
US8962814B2 (en) 2015-02-24
US9840558B2 (en) 2017-12-12
JP6913209B2 (en) 2021-08-04
CA2726345C (en) 2018-08-28
US20240034781A1 (en) 2024-02-01
IL224752A (en) 2014-11-30
KR20150127300A (en) 2015-11-16
PH12014501773B1 (en) 2020-06-03
CN105467136A (en) 2016-04-06
EP3085773B1 (en) 2020-03-18
JP5670318B2 (en) 2015-02-18
JP2011524740A (en) 2011-09-08
IL275881A (en) 2020-08-31
EP3705135A1 (en) 2020-09-09
US20160024202A1 (en) 2016-01-28
CN108578692A (en) 2018-09-28
ES2576681T3 (en) 2016-07-08
IL275881B (en) 2022-05-01
PL3085773T3 (en) 2021-01-11
CA2726345A1 (en) 2009-12-10
ZA201009224B (en) 2011-11-30
US10899833B2 (en) 2021-01-26
HK1191865A1 (en) 2014-08-08
JP2017165743A (en) 2017-09-21
CN102112154A (en) 2011-06-29
CN103656638A (en) 2014-03-26
US20140186943A1 (en) 2014-07-03
JP2019135250A (en) 2019-08-15
IL209576A0 (en) 2011-01-31
HK1159481A1 (en) 2012-08-03
US20180127495A1 (en) 2018-05-10
CN108578692B (en) 2022-12-20
DK2285409T3 (en) 2016-08-01
US8388969B2 (en) 2013-03-05
PT2285409T (en) 2016-07-11
KR20170005166A (en) 2017-01-11
US8956831B2 (en) 2015-02-17
KR20110015647A (en) 2011-02-16

Similar Documents

Publication Publication Date Title
US10899833B2 (en) Human antibody specific for interleukin-1 alpha
HK40038118A (en) Il-1 alpha abs and methods of use
AU2012200775B2 (en) IL-1alpha Abs and methods of use

Legal Events

Date Code Title Description
AS Assignment

Owner name: XBIOTECH, INC., CANADA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:SIMARD, JOHN;REEL/FRAME:023091/0933

Effective date: 20090811

STCF Information on status: patent grant

Free format text: PATENTED CASE

FPAY Fee payment

Year of fee payment: 4

MAFP Maintenance fee payment

Free format text: PAYMENT OF MAINTENANCE FEE, 8TH YR, SMALL ENTITY (ORIGINAL EVENT CODE: M2552); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

Year of fee payment: 8

AS Assignment

Owner name: JANSSEN BIOTECH, INC., PENNSYLVANIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:XBIOTECH INC.;REEL/FRAME:051769/0927

Effective date: 20191230

FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY

MAFP Maintenance fee payment

Free format text: PAYMENT OF MAINTENANCE FEE, 12TH YEAR, LARGE ENTITY (ORIGINAL EVENT CODE: M1553); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY

Year of fee payment: 12