US8034337B2 - Interleukin-1α antibodies - Google Patents
Interleukin-1α antibodies Download PDFInfo
- Publication number
- US8034337B2 US8034337B2 US12/455,458 US45545809A US8034337B2 US 8034337 B2 US8034337 B2 US 8034337B2 US 45545809 A US45545809 A US 45545809A US 8034337 B2 US8034337 B2 US 8034337B2
- Authority
- US
- United States
- Prior art keywords
- human
- cells
- cell
- mab
- hil
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active, expires
Links
- 108010082786 Interleukin-1alpha Proteins 0.000 title description 2
- 102000004125 Interleukin-1alpha Human genes 0.000 title description 2
- 241000282414 Homo sapiens Species 0.000 claims abstract description 54
- 101001002634 Homo sapiens Interleukin-1 alpha Proteins 0.000 claims description 51
- 125000003275 alpha amino acid group Chemical group 0.000 claims 2
- 238000009739 binding Methods 0.000 abstract description 28
- 239000000427 antigen Substances 0.000 abstract description 8
- 102000036639 antigens Human genes 0.000 abstract description 8
- 108091007433 antigens Proteins 0.000 abstract description 8
- 102000009109 Fc receptors Human genes 0.000 abstract description 5
- 108010087819 Fc receptors Proteins 0.000 abstract description 5
- 230000003213 activating effect Effects 0.000 abstract description 4
- 230000004154 complement system Effects 0.000 abstract description 4
- 210000004027 cell Anatomy 0.000 description 87
- 238000000034 method Methods 0.000 description 42
- 239000000523 sample Substances 0.000 description 23
- 150000001413 amino acids Chemical group 0.000 description 21
- 150000007523 nucleic acids Chemical class 0.000 description 21
- 108020004707 nucleic acids Proteins 0.000 description 20
- 102000039446 nucleic acids Human genes 0.000 description 20
- 108090000623 proteins and genes Proteins 0.000 description 18
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 13
- 210000003719 b-lymphocyte Anatomy 0.000 description 11
- 102000004169 proteins and genes Human genes 0.000 description 11
- 239000000758 substrate Substances 0.000 description 10
- 102100023471 E-selectin Human genes 0.000 description 9
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 9
- 231100000599 cytotoxic agent Toxicity 0.000 description 8
- 239000000203 mixture Substances 0.000 description 8
- 239000013598 vector Substances 0.000 description 8
- 230000001404 mediated effect Effects 0.000 description 7
- 239000006228 supernatant Substances 0.000 description 7
- 108010024212 E-Selectin Proteins 0.000 description 6
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 6
- 241001529936 Murinae Species 0.000 description 6
- 101000762949 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) Exotoxin A Proteins 0.000 description 6
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 6
- 239000002619 cytotoxin Substances 0.000 description 6
- 230000000694 effects Effects 0.000 description 6
- 210000002889 endothelial cell Anatomy 0.000 description 6
- 239000012091 fetal bovine serum Substances 0.000 description 6
- 239000001963 growth medium Substances 0.000 description 6
- 239000002609 medium Substances 0.000 description 6
- 238000010186 staining Methods 0.000 description 6
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 239000013604 expression vector Substances 0.000 description 5
- 108010082117 matrigel Proteins 0.000 description 5
- 210000001616 monocyte Anatomy 0.000 description 5
- 239000002773 nucleotide Substances 0.000 description 5
- 125000003729 nucleotide group Chemical group 0.000 description 5
- 238000001890 transfection Methods 0.000 description 5
- 238000011144 upstream manufacturing Methods 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 4
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 4
- 238000002965 ELISA Methods 0.000 description 4
- 101000599852 Homo sapiens Intercellular adhesion molecule 1 Proteins 0.000 description 4
- 206010061218 Inflammation Diseases 0.000 description 4
- 102100020881 Interleukin-1 alpha Human genes 0.000 description 4
- 102000000588 Interleukin-2 Human genes 0.000 description 4
- 108010002350 Interleukin-2 Proteins 0.000 description 4
- 108090001005 Interleukin-6 Proteins 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- 101710120037 Toxin CcdB Proteins 0.000 description 4
- 210000002469 basement membrane Anatomy 0.000 description 4
- 239000012636 effector Substances 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 238000000684 flow cytometry Methods 0.000 description 4
- 238000003018 immunoassay Methods 0.000 description 4
- 230000004054 inflammatory process Effects 0.000 description 4
- 230000002147 killing effect Effects 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 239000011159 matrix material Substances 0.000 description 4
- 238000006386 neutralization reaction Methods 0.000 description 4
- 108020004705 Codon Proteins 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 239000012981 Hank's balanced salt solution Substances 0.000 description 3
- 101000622123 Homo sapiens E-selectin Proteins 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 238000003556 assay Methods 0.000 description 3
- 239000011324 bead Substances 0.000 description 3
- 239000012472 biological sample Substances 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- 229940127089 cytotoxic agent Drugs 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 230000002255 enzymatic effect Effects 0.000 description 3
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 230000001965 increasing effect Effects 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000003127 radioimmunoassay Methods 0.000 description 3
- 239000012146 running buffer Substances 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- IAKHMKGGTNLKSZ-INIZCTEOSA-N (S)-colchicine Chemical compound C1([C@@H](NC(C)=O)CC2)=CC(=O)C(OC)=CC=C1C1=C2C=C(OC)C(OC)=C1OC IAKHMKGGTNLKSZ-INIZCTEOSA-N 0.000 description 2
- 102000004127 Cytokines Human genes 0.000 description 2
- 108090000695 Cytokines Proteins 0.000 description 2
- 101710112752 Cytotoxin Proteins 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- -1 JM-216 Chemical compound 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 2
- 206010028980 Neoplasm Diseases 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- 239000004793 Polystyrene Substances 0.000 description 2
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 2
- 229920002684 Sepharose Polymers 0.000 description 2
- 108091081024 Start codon Proteins 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 238000004166 bioassay Methods 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 239000002254 cytotoxic agent Substances 0.000 description 2
- 230000003013 cytotoxicity Effects 0.000 description 2
- 231100000135 cytotoxicity Toxicity 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 239000012997 ficoll-paque Substances 0.000 description 2
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 210000004602 germ cell Anatomy 0.000 description 2
- 210000005260 human cell Anatomy 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 230000005291 magnetic effect Effects 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 210000004379 membrane Anatomy 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 230000003472 neutralizing effect Effects 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 239000004033 plastic Substances 0.000 description 2
- 229920003023 plastic Polymers 0.000 description 2
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 2
- 108091033319 polynucleotide Proteins 0.000 description 2
- 102000040430 polynucleotide Human genes 0.000 description 2
- 239000002157 polynucleotide Substances 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 229920002223 polystyrene Polymers 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 108090000765 processed proteins & peptides Proteins 0.000 description 2
- 238000001742 protein purification Methods 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 230000002269 spontaneous effect Effects 0.000 description 2
- 210000004357 third molar Anatomy 0.000 description 2
- 239000003053 toxin Substances 0.000 description 2
- 231100000765 toxin Toxicity 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- 210000004881 tumor cell Anatomy 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 1
- 108010066676 Abrin Proteins 0.000 description 1
- 241000589158 Agrobacterium Species 0.000 description 1
- IPWKGIFRRBGCJO-IMJSIDKUSA-N Ala-Ser Chemical compound C[C@H]([NH3+])C(=O)N[C@@H](CO)C([O-])=O IPWKGIFRRBGCJO-IMJSIDKUSA-N 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 206010003445 Ascites Diseases 0.000 description 1
- 208000031504 Asymptomatic Infections Diseases 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 241000193738 Bacillus anthracis Species 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 231100000023 Cell-mediated cytotoxicity Toxicity 0.000 description 1
- 206010057250 Cell-mediated cytotoxicity Diseases 0.000 description 1
- 241000282552 Chlorocebus aethiops Species 0.000 description 1
- 229920000742 Cotton Polymers 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 238000008157 ELISA kit Methods 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 1
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 1
- 229920000209 Hexadimethrine bromide Polymers 0.000 description 1
- 101001074035 Homo sapiens Zinc finger protein GLI2 Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 102000000589 Interleukin-1 Human genes 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 240000007643 Phytolacca americana Species 0.000 description 1
- 235000009074 Phytolacca americana Nutrition 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 108010039491 Ricin Proteins 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 108010084592 Saporins Proteins 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 229940123237 Taxane Drugs 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 102100035558 Zinc finger protein GLI2 Human genes 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 229940045799 anthracyclines and related substance Drugs 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 229940044684 anti-microtubule agent Drugs 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 230000005880 cancer cell killing Effects 0.000 description 1
- 239000002041 carbon nanotube Substances 0.000 description 1
- 229910021393 carbon nanotube Inorganic materials 0.000 description 1
- 229960004562 carboplatin Drugs 0.000 description 1
- 238000000423 cell based assay Methods 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 238000012832 cell culture technique Methods 0.000 description 1
- 230000004709 cell invasion Effects 0.000 description 1
- 230000022534 cell killing Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 230000005890 cell-mediated cytotoxicity Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 229960001338 colchicine Drugs 0.000 description 1
- 238000004440 column chromatography Methods 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 238000003113 dilution method Methods 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 239000003534 dna topoisomerase inhibitor Substances 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 238000005538 encapsulation Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 210000003743 erythrocyte Anatomy 0.000 description 1
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 1
- 229960005542 ethidium bromide Drugs 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 229930004094 glycosylphosphatidylinositol Natural products 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 230000005484 gravity Effects 0.000 description 1
- 239000005090 green fluorescent protein Substances 0.000 description 1
- 230000011132 hemopoiesis Effects 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- ZFGMDIBRIDKWMY-PASTXAENSA-N heparin Chemical compound CC(O)=N[C@@H]1[C@@H](O)[C@H](O)[C@@H](COS(O)(=O)=O)O[C@@H]1O[C@@H]1[C@@H](C(O)=O)O[C@@H](O[C@H]2[C@@H]([C@@H](OS(O)(=O)=O)[C@@H](O[C@@H]3[C@@H](OC(O)[C@H](OS(O)(=O)=O)[C@H]3O)C(O)=O)O[C@@H]2O)CS(O)(=O)=O)[C@H](O)[C@H]1O ZFGMDIBRIDKWMY-PASTXAENSA-N 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 102000055219 human IL1A Human genes 0.000 description 1
- 238000005286 illumination Methods 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- PGHMRUGBZOYCAA-UHFFFAOYSA-N ionomycin Natural products O1C(CC(O)C(C)C(O)C(C)C=CCC(C)CC(C)C(O)=CC(=O)C(C)CC(C)CC(CCC(O)=O)C)CCC1(C)C1OC(C)(C(C)O)CC1 PGHMRUGBZOYCAA-UHFFFAOYSA-N 0.000 description 1
- PGHMRUGBZOYCAA-ADZNBVRBSA-N ionomycin Chemical compound O1[C@H](C[C@H](O)[C@H](C)[C@H](O)[C@H](C)/C=C/C[C@@H](C)C[C@@H](C)C(/O)=C/C(=O)[C@@H](C)C[C@@H](C)C[C@@H](CCC(O)=O)C)CC[C@@]1(C)[C@@H]1O[C@](C)([C@@H](C)O)CC1 PGHMRUGBZOYCAA-ADZNBVRBSA-N 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 239000004816 latex Substances 0.000 description 1
- 229920000126 latex Polymers 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 238000002595 magnetic resonance imaging Methods 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 150000002739 metals Chemical class 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 229960001756 oxaliplatin Drugs 0.000 description 1
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 230000005298 paramagnetic effect Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 210000004180 plasmocyte Anatomy 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 238000002331 protein detection Methods 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 239000004017 serum-free culture medium Substances 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- MPLHNVLQVRSVEE-UHFFFAOYSA-N texas red Chemical compound [O-]S(=O)(=O)C1=CC(S(Cl)(=O)=O)=CC=C1C(C1=CC=2CCCN3CCCC(C=23)=C1O1)=C2C1=C(CCC1)C3=[N+]1CCCC3=C2 MPLHNVLQVRSVEE-UHFFFAOYSA-N 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 229940044693 topoisomerase inhibitor Drugs 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 230000014723 transformation of host cell by virus Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 238000003146 transient transfection Methods 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 210000003606 umbilical vein Anatomy 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 208000019553 vascular disease Diseases 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 229920003169 water-soluble polymer Polymers 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/244—Interleukins [IL]
- C07K16/245—IL-1
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/545—IL-1
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/069—Vascular Endothelial cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0693—Tumour cells; Cancer cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/10—Cells modified by introduction of foreign genetic material
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6863—Cytokines, i.e. immune system proteins modifying a biological response such as cell growth proliferation or differentiation, e.g. TNF, CNF, GM-CSF, lymphotoxin, MIF or their receptors
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6863—Cytokines, i.e. immune system proteins modifying a biological response such as cell growth proliferation or differentiation, e.g. TNF, CNF, GM-CSF, lymphotoxin, MIF or their receptors
- G01N33/6869—Interleukin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55522—Cytokines; Lymphokines; Interferons
- A61K2039/55527—Interleukins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/5412—IL-6
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/10—Immunoglobulins specific features characterized by their source of isolation or production
- C07K2317/14—Specific host cells or culture conditions, e.g. components, pH or temperature
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2330/00—Production
- C12N2330/50—Biochemical production, i.e. in a transformed host cell
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/52—Assays involving cytokines
- G01N2333/54—Interleukins [IL]
- G01N2333/545—IL-1
Definitions
- the invention relates generally to the fields of immunology, inflammation, cancer, vascular disorders, and medicine. More particularly, the invention relates to antibodies (Abs) which specifically bind interleukin-1 ⁇ (IL-1 ⁇ ) and methods of using such Abs to treat, prevent, or detect a pathology associated with aberrant IL-1 ⁇ expression.
- Abs antibodies which specifically bind interleukin-1 ⁇ (IL-1 ⁇ ) and methods of using such Abs to treat, prevent, or detect a pathology associated with aberrant IL-1 ⁇ expression.
- IL-1 ⁇ is pro-inflammatory cytokine that plays a role in a number of different activities including inflammation, immune responses, tumor metastasis, and hematopoiesis.
- IgG autoantibodies against IL-1 ⁇ occur naturally in the general human population and are thought to be beneficial in diseases such as atherosclerosis.
- the invention is based on the development of fully human monoclonal Abs (mAbs) that include (i) an antigen-binding variable region that exhibits very high binding affinity for human IL-1 ⁇ and (ii) a constant region that is effective at both activating the complement system though C1q binding and binding to several different Fc receptors.
- mAbs monoclonal Abs
- the IL-1 ⁇ specific mAbs described herein was made by replacing the constant region of a human IgG4 mAb having a variable region specific for human IL-1 ⁇ with the constant region of a human IgG1 mAb.
- the invention features a purified human IgG1 mAb that specifically binds to human IL-1 ⁇ , the mAb including a heavy chain covalently joined to a light chain.
- the heavy chain can include the amino acid sequence of SEQ ID NO: 9 and the light chain can include the amino acid sequence of SEQ ID NO:11.
- a set of isolated nucleic acids including a first nucleic acid encoding the heavy chain of a human IgG1 mAb that specifically binds to IL-1 ⁇ , and a second nucleic acid encoding the light chain of the human IgG1 mAb that specifically binds to human IL-1 ⁇ .
- the first nucleic acid can encode the amino acid sequence of SEQ ID NO: 9 and the second nucleic acid can encode the amino acid sequence of SEQ ID NO:11.
- the first nucleic acid can include the nucleotide sequence of SEQ ID NO: 10 and the second nucleic acid can include the nucleotide sequence of SEQ ID NO:12.
- the invention features an expression vector including a nucleic acid encoding the amino acid sequence of SEQ ID NO: 9 or SEQ ID NO: 11.
- Another feature of the invention is an isolated host cell (e.g. a mammalian cell such as a CHO cell) including set of isolated nucleic acids including a first nucleic acid encoding the heavy chain of a human IgG1 mAb that specifically binds to IL-1 ⁇ , and a second nucleic acid encoding the light chain of the human IgG1 mAb that specifically binds to human IL-1 ⁇ .
- the heavy chain can include the amino acid sequence of SEQ ID NO: 9 and a light chain can include the amino acid sequence of SEQ ID NO:11.
- the invention further features a method of killing a cell expressing human IL-1 ⁇ .
- This method can include the step of contacting the cell with a purified human IgG1 mAb that specifically binds to human IL-1 ⁇ .
- a method of inhibiting migration of a human cell through a basement membrane matrix is also within the invention.
- This method can include the step of adding a purified mAb that specifically binds to human IL-1 ⁇ to a mixture including a basement membrane matrix and the human cell.
- a method of inhibiting an IL-1 ⁇ -induced increase in ICAM-1 and/or E-selectin expression on the surface of a human endothelial cell can include the step of adding a purified mAb that specifically binds to human IL-1 ⁇ to a mixture including the endothelial cell and IL-1 ⁇ .
- the invention additionally includes a method of tracking inflammation in a human subject previously subjected to the steps of: obtaining from the subject a first sample of peripheral blood mononuclear cells at a first time; contacting the first sample with a purified mAb that specifically binds to human IL-1 ⁇ ; and determining the percent of cells in the first sample that bind the monoclonal Ab.
- This method can include the steps of: (a) obtaining from the subject a second sample of peripheral blood mononuclear cells at a second time; (b) contacting the second sample with the purified mAb that specifically binds to human IL-1 ⁇ ; (c) determining the percent of cells in the second sample that bind the monoclonal Ab; and (d) comparing the percent of cells in the first sample that bind the mAb to the percent of cells in the second sample that bind the monoclonal Ab.
- the purified mAb can be a human IgG1 mAb including a heavy chain covalently joined to a light chain, e.g., wherein the heavy chain includes the amino acid sequence of SEQ ID NO: 9 and the light chain includes the amino acid sequence of SEQ ID NO:11.
- Another method within the invention features the steps of: (a) enriching a biological sample obtained from a human subject using a filter to separate molecules according to molecular weight into a first fraction including intact IgG complexed with IL-1 ⁇ and second fraction including molecules less than 100 Kda; and (b) quantifying the amount of IL-1 ⁇ in the first fraction.
- Yet another method within the invention features the steps of: (a) enriching a sample of plasma obtained from a human subject using a filter that separates molecules according to molecular weight into a first fraction including intact IgG complexed with IL-1 ⁇ and second fraction including molecule less than 100 Kda; (b) adding the first fraction to a substrate including immobilized anti-human IgG Abs under conditions that allow IgG in the first fraction to specifically bind the anti-human IgG Abs immobilized on the substrate; (c) washing the substrate to remove material in the first fraction that does not specifically bind the immobilized anti-human IgG Abs; (d) contacting the substrate washed in step (c) with an Ab that specifically binds human IL-1 ⁇ under conditions that allows the Ab that specifically binds human IL-1 ⁇ to specifically bind any human IL-1 ⁇ bound to the substrate; (e) washing the substrate to remove any of the Ab that specifically binds human IL-1 ⁇ that is not bound to the substrate; and (f) quantifying the amount of Ab
- the specified ligand or Ab binds to its particular “target” and does not bind in a significant amount to other proteins present in the sample or to other proteins to which the ligand or Ab may come in contact in an organism.
- a first molecule that “specifically binds” a second molecule has an equilibrium affinity constant greater than about 10 5 (e.g., 10 6 , 10 7 , 10 8 , 10 9 , 10 10 , 10 11 , and 10 12 or more) liters/mole for that second molecule.
- purified means separated from components that naturally accompany such molecules.
- an Ab or protein is purified when it is at least about 10% (e.g., 9%, 10%, 20%, 30% 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.9%, and 100%), by weight, free from the non-Ab proteins or other naturally-occurring organic molecules with which it is naturally associated. Purity can be measured by any appropriate method, e.g., column chromatography, polyacrylamide gel electrophoresis, or HPLC analysis. A chemically-synthesized protein or other recombinant protein produced in a cell type other than the cell type in which it naturally occurs is “purified.”
- compositions and methods relating to fully human mAbs that include (i) an antigen-binding variable region that exhibits very high binding affinity for IL-1 ⁇ and (ii) a constant region that is effective at both activating the complement system though C1q binding and binding to several different Fc receptors.
- compositions and methods that include (i) an antigen-binding variable region that exhibits very high binding affinity for IL-1 ⁇ and (ii) a constant region that is effective at both activating the complement system though C1q binding and binding to several different Fc receptors.
- Immunological methods for example, assays for detection and localization of antigen-Ab complexes, immunoprecipitation, immunoblotting, and the like
- methodology treatises such as Current Protocols in Immunology, Coligan et al., ed., John Wiley & Sons, New York.
- Techniques of molecular biology are described in detail in treatises such as Molecular Cloning: A Laboratory Manual, 2nd ed., vol.
- the invention features a fully human mAb that includes (i) an antigen-binding variable region that exhibits very high binding affinity for human IL-1 ⁇ and (ii) a constant region that is effective at both activating the complement system though C1q binding and binding to several different Fc receptors.
- the human Ab is preferably an IgG1.
- the Ka of the Ab is preferably at least 1 ⁇ 10 9 M ⁇ 1 or greater (e.g., greater than 9 ⁇ 10 10 M ⁇ 1 , 8 ⁇ 10 10 M ⁇ 1 , 7 ⁇ 10 10 M ⁇ 1 , 6 ⁇ 10 10 M ⁇ 1 , 5 ⁇ 10 10 M ⁇ 1 , 4 ⁇ 10 10 M ⁇ 1 , 3 ⁇ 10 10 M ⁇ 1 , 2 ⁇ 10 10 M ⁇ 1 , or 1 ⁇ 10 10 M ⁇ 1 ).
- B lymphocytes which express Ig specific for human IL-1 ⁇ occur naturally in human beings
- a presently preferred method for raising mAbs is to first isolate such a B lymphocyte from a subject and then immortalize it so that it can be continuously replicated in culture.
- Subjects lacking large numbers of naturally occurring B lymphocytes which express Ig specific for human IL-1 ⁇ may be immunized with one or more human IL-1 ⁇ antigens to increase the number of such B lymphocytes.
- Human mAbs are prepared by immortalizing a human Ab secreting cell (e.g., a human plasma cell). See, e.g., U.S. Pat. No. 4,634,664.
- one or more human subjects are screened for the presence of such human IL-1 ⁇ -specific Ab in their blood.
- Those subjects that express the desired Ab can then be used as B lymphocyte donors.
- peripheral blood is obtained from a human donor that possesses B lymphocytes that express human IL-1 ⁇ -specific Ab.
- B lymphocytes are then isolated from the blood sample, e.g., by cells sorting (e.g., fluorescence activated cell sorting, “FACS”; or magnetic bead cell sorting) to select B lymphocytes expressing human IL-1 ⁇ -specific Ig.
- cells sorting e.g., fluorescence activated cell sorting, “FACS”; or magnetic bead cell sorting
- the B lymphocytes within this population that express Ig specific for human IL-1 ⁇ can then be isolated by limiting dilution methods (e.g., cells in wells of a microtiter plate that are positive for Ig specific for human IL-1 ⁇ are selected and subcultured, and the process repeated until a desired clonal line can be isolated). See, e.g., Goding, Monoclonal Abs: Principles and Practice, pp. 59-103, Academic Press, 1986.
- MAbs secreted by these clonal cell lines can be purified from the culture medium or a bodily fluid (e.g., ascites) by conventional Ig purification procedures such as salt cuts, size exclusion, ion exchange separation, and affinity chromatography.
- heterologous expression systems to produce mAbs. See, e.g., the methods described in U.S. patent application Ser. No. 11/754,899.
- the genes encoding an mAb specific for human IL-1 ⁇ might be cloned and introduced into an expression vector (e.g., a plasmid-based expression vector) for expression in a heterologous host cell (e.g., CHO cells, COS cells, myeloma cells, and E. coli cells).
- a heterologous host cell e.g., CHO cells, COS cells, myeloma cells, and E. coli cells.
- Igs include heavy (H) and light (L) chains in an H 2 L 2 configuration
- the genes encoding each may be separately isolated and expressed in different vectors.
- chimeric mAbs which are antigen-binding molecules having different portions derived from different animal species (e.g., variable region of a mouse Ig fused to the constant region of a human Ig), might be used in the invention.
- Such chimeric Abs can be prepared by methods known in the art. E. G., Morrison et al., Proc. Nat'l. Acad. Sci. USA, 81:6851, 1984; Neuberger et al., Nature, 312:604, 1984; Takeda et al., Nature, 314:452, 1984.
- Abs can be humanized by methods known in the art.
- monoclonal Abs with a desired binding specificity can be commercially humanized or as described in U.S. Pat. Nos. 5,693,762; 5,530,101; or 5,585,089.
- the mAbs described herein might be affinity matured to enhance or otherwise alter their binding specificity by known methods such as VH and VL domain shuffling (Marks et al. Bio/Technology 10:779-783, 1992), random mutagenesis of the hypervariable regions (HVRs) and/or framework residues (Barbas et al. Proc Nat. Acad. Sci. USA 91:3809-3813, 1994; Schier et al. Gene 169:147-155, 1995; Yelton et al. J. Immunol. 155:1994-2004, 1995; Jackson et al., J. Immunol. 154(7):3310-9, 1995; and Hawkins et al, J. Mol. Biol.
- Amino acid sequence variants of an Ab may be prepared by introducing appropriate changes into the nucleotide sequence encoding the Ab.
- modifications to nucleic acid sequences encoding mAbs might be altered (e.g., without changing the amino acid sequence of the mAb) for enhancing production of the mAb in certain expression systems (e.g., intron elimination and/or codon optimization for a given expression system).
- the mAbs described herein can also be modified by conjugation to another protein (e.g., another mAb) or non-protein molecule.
- a mAb might be conjugated to a water soluble polymer such as polyethylene glycol or a carbon nanotube (See, e.g., Kam et al., Proc. Natl. Acad. Sci. USA 102: 11600-11605, 2005). See, U.S. patent application Ser. No. 11/754,899.
- a water soluble polymer such as polyethylene glycol or a carbon nanotube
- the mAb compositions of the invention are at least 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 95, 96, 97, 98, 99, 99.9 or more percent by weight pure (excluding any excipients).
- the mAb compositions of the invention might include only a single type of mAb (i.e., one produced from a single clonal B lymphocyte line) or might include a mixture of two or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10 or more) different types of mAbs.
- the Ab compositions of the invention might also include other mAbs that specifically bind antigens other than human IL-1 ⁇ .
- the human IL-1 ⁇ mAbs might be conjugated another molecule such as a cytotoxin or detectable label.
- a human IL-1 ⁇ specific mAb might be conjugated with one or more cytotoxins to more effectively kill cells expressing IL-1 ⁇ .
- Cytotoxins for use in the invention can be any cytotoxic agent (e.g., molecule that can kill a cell after contacting the cell) that can be conjugated to a human IL-1 ⁇ specific mAb.
- cytotoxins include, without limitation, radionuclides (e.g., 35 S, 14 C, 32 P, 125 I, 131 I, 90 Y, 89 Zr, 201 Tl, 186 Re, 188 Re, 57 Cu, 213 Bi, and 211 At), conjugated radionuclides, and chemotherapeutic agents.
- radionuclides e.g., 35 S, 14 C, 32 P, 125 I, 131 I, 90 Y, 89 Zr, 201 Tl, 186 Re, 188 Re, 57 Cu, 213 Bi, and 211 At
- conjugated radionuclides e.g., chemotherapeutic agents.
- cytotoxins include, but are not limited to, antimetabolites (e.g., 5-fluorouricil (5-FU), methotrexate (MTX), fludarabine, etc.), anti-microtubule agents (e.g., vincristine, vinblastine, colchicine, taxanes (such as paclitaxel and docetaxel), etc.), alkylating agents (e.g., cyclophasphamide, melphalan, bischloroethylnitrosurea (BCNU), etc.), platinum agents (e.g., cisplatin (also termed cDDP), carboplatin, oxaliplatin, JM-216, CI-973, etc.), anthracyclines (e.g., doxorubicin, daunorubicin, etc.), antibiotic agents (e.g., mitomycin-C), topoisomerase inhibitors (e.g., etoposide, tenoposide, and
- the human IL-1 ⁇ specific mAb can also be conjugated to a detectable label.
- detectable labels in the present invention include biotin or streptavidin, magnetic beads, fluorescent dyes (e.g., fluorescein isothiocyanate, texas red, rhodamine, green fluorescent protein, and the like), radiolabels (e.g., 3 H, 125 I, 35 S, 14 C, 32 P, 111 In, 97 Ru, 67 Ga, 68 Ga, or 72 As), radioopaque substances such as metals for radioimaging, paramagnetic agents for magnetic resonance imaging, enzymes (e.g., horseradish peroxidase, alkaline phosphatase and others commonly used in an ELISA), and colorimetric labels such as colloidal gold or colored glass or plastic (e.g., polystyrene, polypropylene, latex, etc.) beads.
- fluorescent dyes e.g., fluorescein isothiocyanate,
- radiolabels may be detected using photographic film or scintillation counters.
- Fluorescent markers may also be used and can be detected using a photodetector to detect emitted illumination.
- Enzymatic labels are typically detected by providing the enzyme with a substrate and detecting the reaction product produced by the action of the enzyme on the substrate, and colorimetric labels are detected by simply visualizing the colored label.
- the present invention also encompasses nucleic acid molecules encoding fully human mAbs specific for human IL-1 ⁇ . Although the same nucleic acid molecule might encode both the heavy and light chains of a human IL-1 ⁇ -specific mAb, two different nucleic acid molecules, one encoding the heavy chain and the other encoding the light chain might also be used.
- the amino acid sequences of three IgG1 mAbs specific for human IL-1 ⁇ are presented herein. See SEQ ID NOs: 1, 3, 5, 7, 9, and 11. Exemplary nucleic acid molecules encoding these amino acid sequences are also described herein. See SEQ ID NOs: 2, 4, 6, 8, 10, and 12. Any other suitable nucleic acid that encodes the amino acid sequences of the two described IgG1 mAbs or other mAbs within the invention might also be used.
- the nucleic acid molecules of the invention might be incorporated into an expression vector in an orientation wherein such nucleic acid molecules are operatively linked to expression control sequences such as transcriptional and translational control sequences.
- expression vectors include vectors derived from plasmids and vectors derived from viruses such as adenoviruses, adeno-associated viruses, and retroviruses.
- the nucleic acid molecules encoding a light chain and a heavy chain might be incorporated into a single vector or different vectors.
- the vectors of the invention might also include regulatory sequences such as promoters and/or enhancers (see, U.S. Pat. No. 5,168,062, U.S. Pat. No. 4,510,245 and U.S. Pat. No. 4,968,615), selectable markers, or sequences encoding affinity tags (for facilitating purification) or a detectable label.
- the vectors of the invention can be introduced into a suitable host cell, e.g., a prokaryotic cell such as a bacteria or, preferably, a eukaryotic cell such as mammalian, plant, or yeast host cell.
- a suitable host cell e.g., a prokaryotic cell such as a bacteria or, preferably, a eukaryotic cell such as mammalian, plant, or yeast host cell.
- suitable host cell e.g., a prokaryotic cell such as a bacteria or, preferably, a eukaryotic cell such as mammalian, plant, or yeast host cell.
- methods for introducing heterologous polynucleotides into host cells include use of viral vectors, electroporation, encapsulation of the polynucleotide(s) in liposomes, dextran-mediated transfection, calcium phosphate precipitation, polybrene-mediated transfection, protoplast fusion, Agrobacterium -mediated transformation,
- Mammalian cell lines are presently preferred for expression of mAbs from vectors.
- mammalian host cells include Chinese hamster ovary (CHO) cells (e.g., the DG44 CHO cell line), HeLa cells, baby hamster kidney (BHK) cells, African green monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), NS0 cells, SP2 cells, HEK-293T cells, 293 Freestyle cells, and NIH-3T3 cells.
- the mAbs of the invention might also be expressed in transgenic animals or plants. See, e.g., U.S. Pat. Nos. 5,827,690; 5,756,687; 5,750,172; 5,741,957; 6,046,037; and 5,959,177.
- the invention provides a method for detecting a human IL-1 ⁇ -expressing cell in a sample by contacting the cell with a human IL-1 ⁇ -specific mAb and detecting the mAb bound to the cell.
- the invention also provides a method for killing a human IL-1 ⁇ -expressing cell by contacting the cell with a human IL-1 ⁇ -specific mAb. Such killing can be accomplished by complement-mediated killing, Ab-dependent cell-mediated cytotoxicity, or Ab-mediated delivery of a cytotoxin.
- the Abs described herein have also been shown to be useful for other methods.
- MABp1 has been to reduce IL-1 ⁇ induced ICAM1 and E-selectin expression on endothelial cells.
- MABp1 has also been shown to be used in immunoassays for detecting and quantifying IL-1 ⁇ in a biological sample.
- V-HC Variable region heavy chain
- V-LC variable region light chain sequences were gene synthesized using amino acid sequence information provided in U.S. Pat. No. 5,959,085.
- V-HC was PCR amplified introducing Hindlll/Clal sites upstream of the ATG start codon and a Nhel site at the 3′ end.
- the human germline IgG1 constant region was PCR amplified modifying the two 5′ triplets encoding for the first two amino acids Ala-Ser to an Nhel site, and introducing a BamHI site at the 3′ end.
- the human germline IgG1 constant region amino acid sequence corresponded to Swiss-Prot entry P01857, except for a K171Q and a V261L exchange.
- the V-HC and constant IgG1-HC sequence were ligated using the Nhel site and cloned into pcDNA3 using Hindlll and BamHl sites.
- the V-LC was PCR amplified introducing Hindlll/Clal sites upstream of the ATG start codon and a BsiWI site at the 3′ end.
- the human constant Kappa-LC sequence was PCR amplified introducing a 5′ BsiWI site encoding an additional Arg and the first amino acids Thr, and a BamHI site at the 3′ end.
- the human constant Kappa-LC amino acid sequence corresponded to Swiss-Prot entry P01834.
- V-HC and constant Kappa-LC sequences were ligated using the BsiWI site and cloned into pcDNA3 using HindIII and BamHI sites.
- the complete sequence encoding the NATHMAB-hIL-1a/IgG1 heavy chain was gene synthesized.
- the V-HC sequence corresponded to the amino acid sequence described in U.S. Pat. No. 5,959,085.
- the human constant IgG1-HC sequence corresponded to Swiss-Prot entry P01857.
- the nucleotide sequence was codon optimized for expression in CHO cells. A Kozac sequence (gccacc) was added upstream of the start ATG.
- the complete sequence encoding the NATHMAB-hIL-1a/Kappa light chain was gene synthesized.
- the V-LC sequence corresponded to the amino acid sequence described in U.S. Pat. No. 5,959,085.
- the human constant Kappa-LC sequence corresponded to Swiss-Prot entry P01834.
- the nucleotide sequence was codon optimized for expression in CHO cells. A Kozac sequence (gccacc) was added upstream of ATG.
- NATHMAB-IL-1 ⁇ was expressed and purified using a transient transfection method.
- Cell culture supernatant or protein G affinity purified Ab was subjected to further analysis as described below.
- Human embryonic kidney (HEK) 293T cells were cultured in DMEM containing 10% FCS, and transiently transfected using jetPEI reagent (Polyplus) according to manufacturer's protocol. Cells were seeded on 10 cm dishes (3 ⁇ 10 6 cells per 10 cm dish) 24 h prior to transfection to reach approximately 50% density at the time point of transfection.
- NATHMAB-hIL1 ⁇ Neutralizing activity of NATHMAB-hIL1 ⁇ was tested in a bioassay using the murine EL4-6.1 subline which produces high levels of IL-2 when treated with murine or human IL-1 ⁇ (Zubler et al., J. Immunol. 134:3662-3668, 1985).
- the indicated concentrations of NATHMAB-hIL-1 ⁇ (eluate) were incubated for 30 min at 37° C. with various concentrations of recombinant hIL-1 ⁇ (eBioscience) in a final volume of 100 ⁇ l/well in a 96-well culture plate (flat bottomed). Each point was carried out in triplicate and in culture medium (DMEM, 5% FCS).
- NATHMAB-hIL-1 ⁇ effectively neutralized IL-2 secretion by EL-4 cells induced by membrane-bound hIL-1 ⁇ .
- NATHMAB-hIL-1 ⁇ was tested for neutralization of murine IL-1 ⁇ .
- NATHMAB-hIL-1 ⁇ Indicated amounts of NATHMAB-hIL-1 ⁇ supernatant were incubated with recombinant human (h) or murine (m) IL-1 ⁇ (eBioscience). The supernatant containing the Ab neutralized human, but not murine, IL-1 ⁇ .
- PBMC peripheral blood mononuclear cells isolated from the buffy coat by standard Ficoll Paque preparation
- E effector cells
- THP1 cells were used as the targets (T).
- the assay was carried out in 96-well plates with each point in triplicate. After 1 ⁇ 10 4 targets that were incubated with different concentration of MABp1 for 15 mins, effector cells were added in an ET ratio of 25:1 and 50:1 to 1 ⁇ 10 4 targets and incubated for another 4 hours.
- % specific lysis (mean experimental release-mean spontaneous release without antibody) ⁇ 100/(mean maximal release from targets-mean spontaneous release from targets)
- A. untreated PBMC were used as effector cells.
- B. rhIL-2-treated PBMC were used as effector cells. In both cases, increasing concentrations (1.25 to 20 ug/ml) of MABp1 resulted in increased target cell killing (up to about 90%) at both ET ratios.
- the binding affinity of purified MABp1 was determined using surface plasmon resonanace (SPR) on a BIAcore 2000 instrument (GE Health Sciences).
- SPR surface plasmon resonanace
- a mouse monoclonal anti-human IgG (Fc) Ab was covalently immobilized on the flow cells of a CM5 sensor chip using a human Ab capture kit and amine coupling kit (GE Health Sciences). Immobilization levels of 8000-14000 RU would typically be achieved.
- three start-up cycles with HBS-EP running buffer (GE Health Sciences) and two start-up cycles with MABp1 were run to stabilize the CM5 surface and to remove any non-covalently bound Ab.
- MABp1 Ab was diluted into HBS-EP running buffer to a final concentration of 1 ⁇ g/mL and immobilized to 700 RU on one flow cell of the CM5 sensor chip.
- Carrier-free human IL-1A cytokine (eBioscience, #34-8019) was serially diluted in HBS-EP running buffer over a test range from 100 nM to 0.05 nM. Flow rate was 30 ⁇ l/min. Dissociation data for each cytokine dilution was recorded for 15 minutes.
- the CM5 surface was regenerated after each cycle using a single injection of 3 M MgCl 2 for 25 seconds at a flow rate of 30 ⁇ l/min. BiaEvaluation software and a Langmuir binding model was used to fit the data.
- the K D for MABp1 was determined to be less than 2.0 ⁇ 10 10 M.
- MABp1 Inhibits Tumor Cell Invasion of a basement Membrane Matrix
- Matrigel (BD), a basement membrane matrix, was thawed at 4° C. overnight and the dilute (5 mg/ml to 1 mg/ml) in serum free cold cell culture media. 100 ul of the diluted matrigel was placed into the upper chambers of a 24-well transwell (Costar) and the transwell was incubated at 37° C. for at least 4 to 5 h for gelling.
- Tumor cells (MDA-MB-231 and THP-1) were harvested from tissue culture flasks by Trypsin/EDTA, washed with culture media, and resuspended in medium containing 1% FBS at a density of 1 ⁇ 10 6 cells/ml.
- the gelled matrigel was gently washed with warmed serum free-culture media, and 100 ul of the cell suspension was added in each well.
- the lower chamber of the transwell was filled with 600 ul of culture media, and the plates was incubated at 37° C. for 12 to 24 h.
- the cells that did not invade the matrigel were gently scraped off the top of each transwell with a cotton swab.
- the transwells were then removed from the 24-well plates and stained with crystal violet after fixing the invaded cells with 70% ethanol or methanol.
- the invaded cells were counted under a light microscope.
- the percent of cells invading the matrigel was significantly inhibited in the presence of MABp1.
- Human umbilical vein endothelial cells (HUVEC) (BD Biosciences) were seeded to 24-well plates at 5 ⁇ 10 5 per well in 1 mL of M-200 medium supplemented with low-serum growth supplement (Invitrogen). Cells were allowed to settle for 3-4 hours. Medium was aspirated and a fresh 1 mL of M-200 was added per well. MABp1 was added directly to cells @ 4.26 ⁇ g/mL, co-incubated for 15 minutes at room temperature, and then recombinant human IL-1 ⁇ (rhIL1A, eBioscience) was added to a final concentration of 40 pg/mL. Positive control wells received the addition of IL-1 ⁇ only.
- rhIL1A human IL-1 ⁇
- HUVEC cells in the absence of IL-1 ⁇ or the absence of MABp1 served as negative controls. After 17-20 hours incubation at 37° C., 5% CO 2 , cells were lifted from the plates by a non-enzymatic treatment for 20 minutes using CellStripper reagent (Cellgro Mediatech) and then immediately assayed for CD54 (ICAM-1) expression using standard flow cytometry protocols.
- Staining buffer comprised Dulbecco's PBS supplemented with 2% heat-inactivated fetal bovine serum.
- MABp1 Blocks Increase in E-Selectin Expression in Endothelial Cells
- HUVEC cells in 6-well plates were co-cultured overnight with 5 ⁇ 10 6 GPI-IL1A DG44 cells in M-200 medium, either alone, in the presence of 10 ⁇ g/mL MABp1, or in the presence of 10 ⁇ g/mL D5 isotype control Ab.
- HUVEC monolayers were washed extensively with Dulbecco's PBS and then lifted by non-enzymatic treatment for 20 minutes with CellStripper reagent (Cellgro Mediatech) and then immediately assayed for CD62E (E-selectin) expression using standard flow-cytometry protocols.
- Staining buffer comprised Dulbecco's PBS supplemented with 2% heat-inactivated fetal bovine serum.
- PE-conjugated mouse anti-human CD62E mAb eBioscience, clone P2H3
- a PE-conjugated mouse IgG1k isotype control eBiocience, clone P3
- Two washes in staining buffer were subsequently performed and then samples were acquired on a FACSCalibur flow cytometer (BD Biosciences). Upregulated E-selectin expression on the surface of HUVEC cells induced by membranous GPI-IL-1 ⁇ was neutralized by MABp1 to baseline levels exhibited by unstimulated HUVEC cells.
- the MRC-5 cell line derived from fetal human lung fibroblasts, was obtained from the ATCC collection (CCL-171).
- the IL-1 neutralizing potency of MABp1 was assayed by measuring IL-1A induced release of IL-6 from MRC-5 cells.
- MRC-5 cells were seeded at 5 ⁇ 10 3 per well to a 96-well plate in 100 microliters of DMEM complete medium. Cells were cultured overnight at 37° C. in a humidified 5% CO 2 incubator. Confluent MRC-5 cells were subsequently cultured another 24 hours with 20 pg/mL of recombinant human IL-1A (rhIL1A, eBioscience) either alone or in the presence of increasing concentrations of MABp1.
- Negative control cells were not stimulated with rhIL1A. After the 24 hours, supernatants were collected and assayed for IL-6 release using and IL-6 ELISA kit from eBioscience.
- the IC 50 or concentration of MABp1 required to inhibit 50% of the maximal IL-6 release, was in the range of 0.001-0.01 ⁇ g/mL.
- MABp 1 Identifies IL-1a+ Cells
- erythrocytes were then lysed (BD Biosciences PharmLyse solution) at room temperature for 15 minutes, centrifuged at 300 ⁇ g for 5 minutes, and aspirated. Sample pellets were washed three times with 1 mL Hank's balanced salt solution (HBSS) containing 2% heat-inactivated fetal bovine serum. Sample was resuspended in 0.3 mL HBSS+2% FBS and data was acquired on a FACSCalibur flow cytometer and analyzed using CellQuest software. Flow cytometric analysis of human PBMC using MABp1 showed that only 0.2% of PBMC were positive for IL-1 ⁇ .
- HBSS Hank's balanced salt solution
- Flow cytometric analysis (as in Example 11) of human PBMC using MABp1 showed a 3.6-fold increase in the percent of PBMC positive for IL-1 ⁇ + in a subject with a sub-clinical infection compared to a normal control.
- an increase in the percent of PBMC positive for IL-1 ⁇ + in a subject with an inflamed wisdom tooth, an increase in the percent of PBMC positive for IL-1 ⁇ + .
- a substantial decrease in the number of IL-1 ⁇ + PBMC was observed from 14 to 45 days after removal of the wisdom tooth.
- IL-1 ⁇ In general, very low levels of IL-1 ⁇ are present in the plasma of human subjects. Because these levels are often beyond the detection threshold of conventional immunoassays, an ELISA with improved sensitivity was developed.
- exogenous anti-IL-1 ⁇ Ab e.g., MABp1
- a biological sample being tested e.g., human plasma
- the latter step can often be omitted.
- the sample with IL-1a-Ab complexes is then applied to a filter (Amicon centrifugal device) with a molecular weight cutoff of about 100 kDa to separate the IL-1 ⁇ -Ab complexes from molecules in the sample less than the molecular weight cutoff. In one experiment, this resulted in a 50-fold concentration.
- the processed sample (and dilutions thereof) was then added to wells of a microtiter plate coated with an anti-human IgG capture Ab (2 ug/ml mouse anti-human IgG, Fc-specific, Southern Biotech product code #9042-01). After allowing time to bind the IL-1 ⁇ -Ab complexes in the sample, the wells were washed to remove non-binding material.
- a labeled anti-human IL-1 ⁇ secondary Ab was then added to the wells (0.2 ug/ml biotin-conjugated monoclonal mouse anti-human IL-1A Ab, clone CRM6, eBioscience catalog #13-7017). After allowing time to bind the IL-1 ⁇ in the wells, the plate was washed and the amount of labeled anti-human IL-1 ⁇ in each well was quantified as an indication of the concentration of IL-1 ⁇ in the sample being tested.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Biotechnology (AREA)
- Cell Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Zoology (AREA)
- Microbiology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Wood Science & Technology (AREA)
- Urology & Nephrology (AREA)
- Biophysics (AREA)
- Hematology (AREA)
- General Engineering & Computer Science (AREA)
- Food Science & Technology (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Physics & Mathematics (AREA)
- Vascular Medicine (AREA)
- Oncology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Epidemiology (AREA)
Abstract
Description
>hIL-1a-IgG1-HC |
(SEQ ID NO:1) |
MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCTASGFTFSM | |
FGVHWVRQAPGKGLEWVAAVSYDGSNKYYAESVKGRFTISRDNSKNILFL | |
QMDSLRLEDTAVYYCARGRPKVVIPAPLAHWGQGTLVTFSSASTKGPSVF | |
PLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS | |
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC | |
PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN | |
WYVDGVEVHNAQTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK | |
ALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSD | |
IALEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVKDSRWQQGNVFSCS | |
VMHEALHNHYTQKSLSLSPGK | |
>hIL-1a-IgG1-HC |
(SEQ ID NO:2) |
atggagttcgggctgagttgggtgttcctggtggctctgctgcggggcgt | |
gcagtgccaggtgcagctggtggagagtgggggtggcgtggtgcagcctg | |
gccggtctctgcgcctgtcttgcactgcctccggttttaccttttctatg | |
tttggtgtgcactgggtgcgccaggctcccggcaagggactggaatgggt | |
ggccgccgtgagttacgacgggtccaacaaatattacgctgagagcgtga | |
aaggcagattcaccatcagcagagataattccaagaatattctgttcctg | |
cagatggacagtctgagactggaggacactgctgtgtactactgcgctcg | |
tggacgccctaaggtggtcatccccgcccccctggcacattggggccagg | |
gaactctggtgaccttttctagcgctagcaccaagggcccatcggtcttc | |
cccctggcaccctcctccaagagcacctctgggggcacagcggccctggg | |
ctgcctggtcaaggactacttccccgaaccggtgacggtgtcgtggaact | |
caggcgccctgaccagcggcgtccacaccttcccggctgtcctacagtcc | |
tcaggactctactccctcagcagcgtagtgaccgtgccctccagcagctt | |
gggcacccagacctacatctgcaacgtgaatcacaagcccagcaacacca | |
aggtggacaagaaagttgagcccaaatcttgtgacaaaactcacacatgc | |
ccaccgtgcccagcacctgaactcctggggggaccgtcagtcttcctctt | |
ccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtca | |
catgcgtggtggtggacgtgagccacgaagaccctgaggtcaagttcaac | |
tggtacgtggacggcgtggaggtgcataatgcccagacaaagccgcggga | |
ggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgc | |
accaggactggctgaatggcaaggagtacaagtgcaaggtctccaacaaa | |
gccctcccagcccccatcgagaaaaccatctccaaagccaaagggcagcc | |
ccgagaaccacaggtgtacaccctgcccccatcccgggatgagctgacca | |
agaaccaggtcagcctgacctgcctggtcaaaggcttctatcccagcgac | |
atcgccctggagtgggagagcaatgggcagccggagaacaactacaagac | |
cacgcctcccgtgctggactccgacggctccttcttcctctacagcaagc | |
tcaccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctcc | |
gtgatgcatgaggctctgcacaaccactacacgcagaagagcctctcctt | |
aagtccgggaaaataa |
>hIL-1a-K-LC |
[SEQ ID NO:3] |
MDMRVPAQLLGLLLLWFPGSRCDIQMTQSPSSVSASVGDRVTITCRASQG | |
ISSWLAWYQQKPGKAPKLLIYEASNLETGVPSRFSGSGSGSDFTLTISSL | |
QPEDFATYYCQQTSSFLLSFGGGTKVEHRTVAAPSVFIFPPSDEQLKSGT | |
ASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL | |
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC | |
>hIL-1a-K-LC |
[SEQ ID NO:4] |
atggacatgcgcgtgcccgcccagctgctggggctgctgctgctgtggtt | |
ccctggatctaggtgcgacattcagatgacccagtcccccagctcagtgt | |
cagcctccgtgggcgacagagtgacaatcacctgccgcgcctctcaggga | |
atctctagttggctggcctggtaccagcagaagcctggaaaggcccccaa | |
gctgctgatctatgaagcctccaacctggagaccggcgtgccctctcgct | |
tcagcggctcaggctcaggcagtgattttactctgaccatcagctccctg | |
cagccagaggatttcgctacttactactgccagcagacctcttccttcct | |
gctgtccttcgggggaggcacaaaggtggagcaccgtacggtggctgcac | |
catctgtcttcatcttcccgccatctgatgagcagttgaaatctggaact | |
gcctctgttgtgtgcctgctgaataacttctatcccagagaggccaaagt | |
acagtggaaggtggataacgccctccaatcgggtaactcccaggagagtg | |
tcacagagcaggacagcaaggacagcacctacagcctcagcagcaccctg | |
acgctgagcaaagcagactacgagaaacacaaagtctacgcctgcgaagt | |
cacccatcagggcctgagttcaccggtgacaaagagcttcaacaggggag | |
agtgttag |
>NATHMAB-hIL-1A-IGG1-HC |
[SEQ ID NO:5] |
MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCTASGFTFSM | |
FGVHWVRQAPGKGLEWVAAVSYDGSNKYYAESVKGRFTISRDNSKNILFL | |
QMDSLRLEDTAVYYCARGRPKVVIPAPLAHWGQGTLVTFSSASTKGPSVF | |
PLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS | |
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC | |
PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN | |
WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK | |
ALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSD | |
IAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS | |
VMHEALHNHYTQKSLSLSPGK | |
>NATHMAB-hIL-1A-IGG1-HC |
[SEQ ID NO:6] |
gccaccatggagtttggtctgtcctgggtgttcttggtggctctgctgag | |
gggggtgcagtgccaggtccagctggtggagtctggtgggggagtggtgc | |
agcctgggagatctctgcggctgtcttgcactgcctctggtttcactttc | |
tctatgtttggtgtgcattgggtcaggcaagcaccaggcaaaggactcga | |
gtgggtcgcagctgtgagctatgacgggtctaacaaatattacgctgagt | |
ctgtcaagggtaggtttaccatcagccgggataattccaaaaatatcctg | |
ttcctgcaaatggactctctgaggctggaagatactgcagtctactattg | |
tgcaagggggaggccaaaggtggtgatccccgctcccctcgctcactggg | |
gacagggaaccctggtgactttcagctctgctagcaccaagggccctagc | |
gtgttcccattggctccttcctccaaatctacttctggaggcaccgccgc | |
cctgggatgtctcgtgaaagattattttcctgagcccgtcaccgtgagct | |
ggaacagcggcgccctgactagcggcgtgcacacctttcccgcagtgctg | |
caatctagcgggctgtactccctgagctctgtcgtgaccgtgccctccag | |
cagcctcggaactcagacctacatctgcaatgtcaatcataaaccctcta | |
ataccaaagtcgataagaaggtcgaacctaaatcttgcgataaaacccat | |
acctgccccccttgcccagcacccgaactgctgggcggtccctctgtgtt | |
tctgttcccccccaaacccaaagataccctgatgatctctaggacccccg | |
aggtcacttgtgtcgtggtggatgtgtcccacgaagatccagaagtcaaa | |
ttcaactggtatgtggacggggtcgaagtgcacaacgcaaagaccaagcc | |
tagggaggaacagtataatagcacatatagggtggtcagcgtcctgaccg | |
tcctgcatcaggactggctgaatggcaaagaatataagtgtaaagtgtcc | |
aacaaggccctgccagccccaatcgaaaagacaatctctaaagccaaggg | |
gcaaccccgggaacctcaggtctatacactgccaccctctcgggatgaac | |
tgaccaagaatcaggtgagcctgacatgtcttgtgaagggtttttatccc | |
tccgacattgccgtggagtgggagagcaatggacaaccagaaaataacta | |
caaaaccacaccccctgtgctggactccgatggttccttcttcctctact | |
ctaagctgacagtggataagtctaggtggcagcaggggaatgtgttctcc | |
tgctctgtgatgcacgaggcactgcacaatcattatacacaaaagtctct | |
gtctctgtctccaggaaagtaa |
>NATHMAB-hIL-1A-K-LC |
[SEQ ID NO:7] |
MDMRVPAQLLGLLLLWFPGSRCDIQMTQSPSSVSASVGDRVTITCRASQG | |
ISSWLAWYQQKPGKAPKLLIYEASNLETGVPSRFSGSGSGSDFTLTISSL | |
QPEDFATYYCQQTSSFLLSFGGGTKVEHTVAAPSVFIFPPSDEQLKSGTA | |
SVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT | |
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC | |
NATHMAB-hIL-1A-K-LC |
[SEQ ID NO:8] |
gccaccatggacatgcgcgttcctgcccagctcctcggactgctgctgct | |
ttggttcccaggctcccggtgtgatattcagatgacacagtctccctcct | |
ccgtatctgcatccgtgggcgacagggtcacaatcacttgtagggccagc | |
caggggatctctagttggctcgcatggtaccaacaaaagccaggtaaggc | |
tccgaaactgctcatttacgaagctagtaacctcgaaacaggcgtgccaa | |
gccggtttagcggctccggttccggttctgacttcaccctcactatttcc | |
tccctgcaacctgaggattttgccacatattactgtcagcaaacttcttc | |
ttttctgctctcctttggtgggggaactaaggtggagcacacagtggccg | |
cccccagcgtctttatcttccccccaagcgatgaacagctgaagtcaggg | |
accgccagcgtggtctgcctgctcaataatttttaccctcgcgaggctaa | |
ggtccaatggaaagtggataacgccctccagagcggtaactctcaggagt | |
ctgtcacagagcaagacagcaaggatagcacctattccctctccagcacc | |
ctgacactgtctaaggccgactacgagaaacacaaagtgtacgcttgtga | |
ggtgactcaccagggactgagtagccctgtgacaaaatctttcaataggg | |
gagaatgctga |
[SEQ ID NO:9] |
MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCTASGFTFSM | |
FGVHWVRQAPGKGLEWVAAVSYDGSNKYYAESVKGRFTISRDNSKNILFL | |
QMDSLRLEDTAVYYCARGRPKVVIPAPLAHWGQGTLVTFSSASTKGPSVF | |
PLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS | |
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTC | |
PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN | |
WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK | |
ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSD | |
IAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS | |
VMHEALHNHYTQKSLSLSPGK | |
[SEQ ID NO:10] |
gccaccatggagtttggtctgtcctgggtgttcttggtggctctgctgag | |
gggggtgcagtgccaggtccagctggtggagtctggtgggggagtggtgc | |
agcctgggagatctctgcggctgtcttgcactgcctctggtttcactttc | |
tctatgtttggtgtgcattgggtcaggcaagcaccaggcaaaggactcga | |
gtgggtcgcagctgtgagctatgacgggtctaacaaatattacgctgagt | |
ctgtcaagggtaggtttaccatcagccgggataattccaaaaatatcctg | |
ttcctgcaaatggactctctgaggctggaagatactgcagtctactattg | |
tgcaagggggaggccaaaggtggtgatccccgctcccctcgctcactggg | |
gacagggaaccctggtgactttcagctctgctagcaccaagggccctagc | |
gtgttcccattggctccttcctccaaatctacttctggaggcaccgccgc | |
cctgggatgtctcgtgaaagattattttcctgagcccgtcaccgtgagct | |
ggaacagcggcgccctgactagcggcgtgcacacctttcccgcagtgctg | |
caatctagcgggctgtactccctgagctctgtcgtgaccgtgccctccag | |
cagcctcggaactcagacctacatctgcaatgtcaatcataaaccctcta | |
ataccaaagtcgataagagggtcgaacctaaatcttgcgataaaacccat | |
acctgccccccttgcccagcacccgaactgctgggcggtccctctgtgtt | |
tctgttcccccccaaacccaaagataccctgatgatctctaggacccccg | |
aggtcacttgtgtcgtggtggatgtgtcccacgaagatccagaagtcaaa | |
ttcaactggtatgtggacggggtcgaagtgcacaacgcaaagaccaagcc | |
tagggaggaacagtataatagcacatatagggtggtcagcgtcctgaccg | |
tcctgcatcaggactggctgaatggcaaagaatataagtgtaaagtgtcc | |
aacaaggccctgccagccccaatcgaaaagacaatctctaaagccaaggg | |
gcaaccccgggaacctcaggtctatacactgccaccctctcgggaggaaa | |
tgaccaagaatcaggtgagcctgacatgtcttgtgaagggtttttatccc | |
tccgacattgccgtggagtgggagagcaatggacaaccagaaaataacta | |
caaaaccacaccccctgtgctggactccgatggttccttcttcctctact | |
ctaagctgacagtggataagtctaggtggcagcaggggaatgtgttctcc | |
tgctctgtgatgcacgaggcactgcacaatcattatacacaaaagtctct | |
gtctctgtctccaggaaagtaa |
Light Chain
[SEQ ID NO:11] |
MDMRVPAQLLGLLLLWFPGSRCDIQMTQSPSSVSASVGDRVTITCRASQG | |
ISSWLAWYQQKPGKAPKLLIYEASNLETGVPSRFSGSGSGSDFTLTISSL | |
QPEDFATYYCQQTSSFLLSFGGGTKVEHKRTVAAPSVFIFPPSDEQLKSG | |
TASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST | |
LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC | |
[SEQ ID NO:12] |
gccaccatggacatgcgcgttcctgcccagctcctcggactgctgctgct | |
ttggttcccaggctcccggtgtgatattcagatgacacagtctccctcct | |
ccgtatctgcatccgtgggcgacagggtcacaatcacttgtagggccagc | |
caggggatctctagttggctcgcatggtaccaacaaaagccaggtaaggc | |
tccgaaactgctcatttacgaagctagtaacctcgaaacaggcgtgccaa | |
gccggtttagcggctccggttccggttctgacttcaccctcactatttcc | |
tccctgcaacctgaggattttgccacatattactgtcagcaaacttcttc | |
ttttctgctctcctttggtggaggaactaaggtggagcacaagcggacag | |
ttgctgctcctagcgtctttatcttccctccaagcgatgaacagctgaag | |
tcagggaccgccagcgtggtctgcctgctcaataatttttaccctcgcga | |
ggctaaggtccaatggaaagtggataacgccctccagagcggtaactctc | |
aggagtctgtcacagagcaagacagcaaggatagcacctattccctctcc | |
agcaccctgacactgtctaaggccgactacgagaaacacaaagtgtacgc | |
ttgtgaggtgactcaccagggactgagtagccctgtgacaaaatctttca | |
ataggggagaatgctga |
Claims (1)
Priority Applications (14)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US12/455,458 US8034337B2 (en) | 2008-05-30 | 2009-06-01 | Interleukin-1α antibodies |
US13/224,913 US8388969B2 (en) | 2008-05-30 | 2011-09-02 | Interleukin-1 alpha antibodies and methods of use |
US13/225,029 US8962814B2 (en) | 2008-05-30 | 2011-09-02 | Interleukin-1α antibodies and methods of use |
US13/225,004 US20120164665A1 (en) | 2008-05-30 | 2011-09-02 | Interleukin-1 Alpha Antibodies and Methods of Use |
US13/224,943 US8388956B2 (en) | 2008-05-30 | 2011-09-02 | Interleukin-1 alpha antibodies and methods of use |
US13/224,975 US20120021512A1 (en) | 2008-05-30 | 2011-09-02 | Interleukin-1 Alpha Antibodies and Methods of Use |
US13/762,453 US8679489B2 (en) | 2008-05-30 | 2013-02-08 | Inhibiting cell migration |
US13/767,292 US8784817B2 (en) | 2008-05-30 | 2013-02-14 | Method for killing IL-1 alpha expressing cells |
US14/177,892 US8956831B2 (en) | 2008-05-30 | 2014-02-11 | Nucleic acids encoding a human monoclonal antibody that specifically binds to IL-1α |
US14/567,072 US9181338B2 (en) | 2008-05-30 | 2014-12-11 | Human antibody specific for IL-1alpha |
US14/877,964 US9840558B2 (en) | 2008-05-30 | 2015-10-08 | Human antibody specific for interleukin-1alpha |
US15/789,774 US10899833B2 (en) | 2008-05-30 | 2017-10-20 | Human antibody specific for interleukin-1 alpha |
US17/154,137 US20210171623A1 (en) | 2008-05-30 | 2021-01-21 | Human antibody specific for interleukin-1alpha |
US18/483,270 US20240034781A1 (en) | 2008-05-30 | 2023-10-09 | Human antibody specific for interleukin-1alpha |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US5758608P | 2008-05-30 | 2008-05-30 | |
US12139108P | 2008-12-10 | 2008-12-10 | |
US17835009P | 2009-05-14 | 2009-05-14 | |
US12/455,458 US8034337B2 (en) | 2008-05-30 | 2009-06-01 | Interleukin-1α antibodies |
Related Child Applications (5)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/225,029 Division US8962814B2 (en) | 2008-05-30 | 2011-09-02 | Interleukin-1α antibodies and methods of use |
US13/225,004 Division US20120164665A1 (en) | 2008-05-30 | 2011-09-02 | Interleukin-1 Alpha Antibodies and Methods of Use |
US13/224,913 Division US8388969B2 (en) | 2008-05-30 | 2011-09-02 | Interleukin-1 alpha antibodies and methods of use |
US13/224,975 Division US20120021512A1 (en) | 2008-05-30 | 2011-09-02 | Interleukin-1 Alpha Antibodies and Methods of Use |
US13/224,943 Division US8388956B2 (en) | 2008-05-30 | 2011-09-02 | Interleukin-1 alpha antibodies and methods of use |
Publications (2)
Publication Number | Publication Date |
---|---|
US20090298096A1 US20090298096A1 (en) | 2009-12-03 |
US8034337B2 true US8034337B2 (en) | 2011-10-11 |
Family
ID=41380314
Family Applications (14)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/455,458 Active 2030-01-12 US8034337B2 (en) | 2008-05-30 | 2009-06-01 | Interleukin-1α antibodies |
US13/224,943 Active US8388956B2 (en) | 2008-05-30 | 2011-09-02 | Interleukin-1 alpha antibodies and methods of use |
US13/225,004 Abandoned US20120164665A1 (en) | 2008-05-30 | 2011-09-02 | Interleukin-1 Alpha Antibodies and Methods of Use |
US13/224,975 Abandoned US20120021512A1 (en) | 2008-05-30 | 2011-09-02 | Interleukin-1 Alpha Antibodies and Methods of Use |
US13/224,913 Active US8388969B2 (en) | 2008-05-30 | 2011-09-02 | Interleukin-1 alpha antibodies and methods of use |
US13/225,029 Active 2030-03-17 US8962814B2 (en) | 2008-05-30 | 2011-09-02 | Interleukin-1α antibodies and methods of use |
US13/762,453 Active US8679489B2 (en) | 2008-05-30 | 2013-02-08 | Inhibiting cell migration |
US13/767,292 Active US8784817B2 (en) | 2008-05-30 | 2013-02-14 | Method for killing IL-1 alpha expressing cells |
US14/177,892 Active US8956831B2 (en) | 2008-05-30 | 2014-02-11 | Nucleic acids encoding a human monoclonal antibody that specifically binds to IL-1α |
US14/567,072 Active US9181338B2 (en) | 2008-05-30 | 2014-12-11 | Human antibody specific for IL-1alpha |
US14/877,964 Active 2029-08-23 US9840558B2 (en) | 2008-05-30 | 2015-10-08 | Human antibody specific for interleukin-1alpha |
US15/789,774 Active 2029-07-06 US10899833B2 (en) | 2008-05-30 | 2017-10-20 | Human antibody specific for interleukin-1 alpha |
US17/154,137 Abandoned US20210171623A1 (en) | 2008-05-30 | 2021-01-21 | Human antibody specific for interleukin-1alpha |
US18/483,270 Pending US20240034781A1 (en) | 2008-05-30 | 2023-10-09 | Human antibody specific for interleukin-1alpha |
Family Applications After (13)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/224,943 Active US8388956B2 (en) | 2008-05-30 | 2011-09-02 | Interleukin-1 alpha antibodies and methods of use |
US13/225,004 Abandoned US20120164665A1 (en) | 2008-05-30 | 2011-09-02 | Interleukin-1 Alpha Antibodies and Methods of Use |
US13/224,975 Abandoned US20120021512A1 (en) | 2008-05-30 | 2011-09-02 | Interleukin-1 Alpha Antibodies and Methods of Use |
US13/224,913 Active US8388969B2 (en) | 2008-05-30 | 2011-09-02 | Interleukin-1 alpha antibodies and methods of use |
US13/225,029 Active 2030-03-17 US8962814B2 (en) | 2008-05-30 | 2011-09-02 | Interleukin-1α antibodies and methods of use |
US13/762,453 Active US8679489B2 (en) | 2008-05-30 | 2013-02-08 | Inhibiting cell migration |
US13/767,292 Active US8784817B2 (en) | 2008-05-30 | 2013-02-14 | Method for killing IL-1 alpha expressing cells |
US14/177,892 Active US8956831B2 (en) | 2008-05-30 | 2014-02-11 | Nucleic acids encoding a human monoclonal antibody that specifically binds to IL-1α |
US14/567,072 Active US9181338B2 (en) | 2008-05-30 | 2014-12-11 | Human antibody specific for IL-1alpha |
US14/877,964 Active 2029-08-23 US9840558B2 (en) | 2008-05-30 | 2015-10-08 | Human antibody specific for interleukin-1alpha |
US15/789,774 Active 2029-07-06 US10899833B2 (en) | 2008-05-30 | 2017-10-20 | Human antibody specific for interleukin-1 alpha |
US17/154,137 Abandoned US20210171623A1 (en) | 2008-05-30 | 2021-01-21 | Human antibody specific for interleukin-1alpha |
US18/483,270 Pending US20240034781A1 (en) | 2008-05-30 | 2023-10-09 | Human antibody specific for interleukin-1alpha |
Country Status (24)
Country | Link |
---|---|
US (14) | US8034337B2 (en) |
EP (3) | EP3705135A1 (en) |
JP (5) | JP5670318B2 (en) |
KR (3) | KR101567117B1 (en) |
CN (4) | CN103656638B (en) |
AU (1) | AU2009255670B2 (en) |
BR (1) | BRPI0909610B1 (en) |
CA (2) | CA2726345C (en) |
CO (1) | CO6351749A2 (en) |
DK (1) | DK2285409T3 (en) |
ES (2) | ES2797126T3 (en) |
HK (2) | HK1159481A1 (en) |
HU (1) | HUE029003T2 (en) |
IL (5) | IL209576A (en) |
MX (1) | MX2010012963A (en) |
MY (1) | MY154067A (en) |
NZ (1) | NZ590033A (en) |
PH (1) | PH12014501773A1 (en) |
PL (2) | PL3085773T3 (en) |
PT (1) | PT2285409T (en) |
RU (2) | RU2498998C2 (en) |
SI (1) | SI2285409T1 (en) |
WO (1) | WO2009148575A1 (en) |
ZA (1) | ZA201009224B (en) |
Cited By (419)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20110311547A1 (en) * | 2010-06-18 | 2011-12-22 | Xbiotech, Inc. | Arthritis Treatment |
US8664367B2 (en) | 2010-05-14 | 2014-03-04 | Abbvie, Inc. | IL-I binding proteins |
CN104684929A (en) * | 2012-10-04 | 2015-06-03 | 埃克斯生物科技公司 | Treating vascular disease and complications thereof |
US10149680B2 (en) | 2013-04-16 | 2018-12-11 | Ethicon Llc | Surgical instrument comprising a gap setting system |
US10149682B2 (en) | 2010-09-30 | 2018-12-11 | Ethicon Llc | Stapling system including an actuation system |
US10159483B2 (en) | 2015-02-27 | 2018-12-25 | Ethicon Llc | Surgical apparatus configured to track an end-of-life parameter |
US10172620B2 (en) | 2015-09-30 | 2019-01-08 | Ethicon Llc | Compressible adjuncts with bonding nodes |
US10172616B2 (en) | 2006-09-29 | 2019-01-08 | Ethicon Llc | Surgical staple cartridge |
US10180463B2 (en) | 2015-02-27 | 2019-01-15 | Ethicon Llc | Surgical apparatus configured to assess whether a performance parameter of the surgical apparatus is within an acceptable performance band |
US10188385B2 (en) | 2014-12-18 | 2019-01-29 | Ethicon Llc | Surgical instrument system comprising lockable systems |
US10201363B2 (en) | 2006-01-31 | 2019-02-12 | Ethicon Llc | Motor-driven surgical instrument |
US10201364B2 (en) | 2014-03-26 | 2019-02-12 | Ethicon Llc | Surgical instrument comprising a rotatable shaft |
US10201349B2 (en) | 2013-08-23 | 2019-02-12 | Ethicon Llc | End effector detection and firing rate modulation systems for surgical instruments |
US10206605B2 (en) | 2015-03-06 | 2019-02-19 | Ethicon Llc | Time dependent evaluation of sensor data to determine stability, creep, and viscoelastic elements of measures |
US10206676B2 (en) | 2008-02-14 | 2019-02-19 | Ethicon Llc | Surgical cutting and fastening instrument |
US10206677B2 (en) | 2014-09-26 | 2019-02-19 | Ethicon Llc | Surgical staple and driver arrangements for staple cartridges |
US10211586B2 (en) | 2017-06-28 | 2019-02-19 | Ethicon Llc | Surgical shaft assemblies with watertight housings |
US10206678B2 (en) | 2006-10-03 | 2019-02-19 | Ethicon Llc | Surgical stapling instrument with lockout features to prevent advancement of a firing assembly unless an unfired surgical staple cartridge is operably mounted in an end effector portion of the instrument |
US10213201B2 (en) | 2015-03-31 | 2019-02-26 | Ethicon Llc | Stapling end effector configured to compensate for an uneven gap between a first jaw and a second jaw |
US10213262B2 (en) | 2006-03-23 | 2019-02-26 | Ethicon Llc | Manipulatable surgical systems with selectively articulatable fastening device |
US10226249B2 (en) | 2013-03-01 | 2019-03-12 | Ethicon Llc | Articulatable surgical instruments with conductive pathways for signal communication |
US10231794B2 (en) | 2011-05-27 | 2019-03-19 | Ethicon Llc | Surgical stapling instruments with rotatable staple deployment arrangements |
US10238391B2 (en) | 2013-03-14 | 2019-03-26 | Ethicon Llc | Drive train control arrangements for modular surgical instruments |
US10238386B2 (en) | 2015-09-23 | 2019-03-26 | Ethicon Llc | Surgical stapler having motor control based on an electrical parameter related to a motor current |
US10245033B2 (en) | 2015-03-06 | 2019-04-02 | Ethicon Llc | Surgical instrument comprising a lockable battery housing |
US10245030B2 (en) | 2016-02-09 | 2019-04-02 | Ethicon Llc | Surgical instruments with tensioning arrangements for cable driven articulation systems |
US10245035B2 (en) | 2005-08-31 | 2019-04-02 | Ethicon Llc | Stapling assembly configured to produce different formed staple heights |
US10245027B2 (en) | 2014-12-18 | 2019-04-02 | Ethicon Llc | Surgical instrument with an anvil that is selectively movable about a discrete non-movable axis relative to a staple cartridge |
US10245032B2 (en) | 2005-08-31 | 2019-04-02 | Ethicon Llc | Staple cartridges for forming staples having differing formed staple heights |
US10258330B2 (en) | 2010-09-30 | 2019-04-16 | Ethicon Llc | End effector including an implantable arrangement |
US10258331B2 (en) | 2016-02-12 | 2019-04-16 | Ethicon Llc | Mechanisms for compensating for drivetrain failure in powered surgical instruments |
US10258333B2 (en) | 2012-06-28 | 2019-04-16 | Ethicon Llc | Surgical fastening apparatus with a rotary end effector drive shaft for selective engagement with a motorized drive system |
US10258418B2 (en) | 2017-06-29 | 2019-04-16 | Ethicon Llc | System for controlling articulation forces |
US10265074B2 (en) | 2010-09-30 | 2019-04-23 | Ethicon Llc | Implantable layers for surgical stapling devices |
US10265068B2 (en) | 2015-12-30 | 2019-04-23 | Ethicon Llc | Surgical instruments with separable motors and motor control circuits |
US10271846B2 (en) | 2005-08-31 | 2019-04-30 | Ethicon Llc | Staple cartridge for use with a surgical stapler |
US10271849B2 (en) | 2015-09-30 | 2019-04-30 | Ethicon Llc | Woven constructs with interlocked standing fibers |
US10278780B2 (en) | 2007-01-10 | 2019-05-07 | Ethicon Llc | Surgical instrument for use with robotic system |
US10278702B2 (en) | 2004-07-28 | 2019-05-07 | Ethicon Llc | Stapling system comprising a firing bar and a lockout |
US10292704B2 (en) | 2015-12-30 | 2019-05-21 | Ethicon Llc | Mechanisms for compensating for battery pack failure in powered surgical instruments |
US10293100B2 (en) | 2004-07-28 | 2019-05-21 | Ethicon Llc | Surgical stapling instrument having a medical substance dispenser |
US10299878B2 (en) | 2015-09-25 | 2019-05-28 | Ethicon Llc | Implantable adjunct systems for determining adjunct skew |
US10299787B2 (en) | 2007-06-04 | 2019-05-28 | Ethicon Llc | Stapling system comprising rotary inputs |
US10299792B2 (en) | 2014-04-16 | 2019-05-28 | Ethicon Llc | Fastener cartridge comprising non-uniform fasteners |
US10307170B2 (en) | 2017-06-20 | 2019-06-04 | Ethicon Llc | Method for closed loop control of motor velocity of a surgical stapling and cutting instrument |
US10307163B2 (en) | 2008-02-14 | 2019-06-04 | Ethicon Llc | Detachable motor powered surgical instrument |
US10314589B2 (en) | 2006-06-27 | 2019-06-11 | Ethicon Llc | Surgical instrument including a shifting assembly |
USD851762S1 (en) | 2017-06-28 | 2019-06-18 | Ethicon Llc | Anvil |
US10327769B2 (en) | 2015-09-23 | 2019-06-25 | Ethicon Llc | Surgical stapler having motor control based on a drive system component |
US10327767B2 (en) | 2017-06-20 | 2019-06-25 | Ethicon Llc | Control of motor velocity of a surgical stapling and cutting instrument based on angle of articulation |
US10335148B2 (en) | 2010-09-30 | 2019-07-02 | Ethicon Llc | Staple cartridge including a tissue thickness compensator for a surgical stapler |
US10335145B2 (en) | 2016-04-15 | 2019-07-02 | Ethicon Llc | Modular surgical instrument with configurable operating mode |
USD854151S1 (en) | 2017-06-28 | 2019-07-16 | Ethicon Llc | Surgical instrument shaft |
US10357247B2 (en) | 2016-04-15 | 2019-07-23 | Ethicon Llc | Surgical instrument with multiple program responses during a firing motion |
US10363037B2 (en) | 2016-04-18 | 2019-07-30 | Ethicon Llc | Surgical instrument system comprising a magnetic lockout |
US10363036B2 (en) | 2015-09-23 | 2019-07-30 | Ethicon Llc | Surgical stapler having force-based motor control |
US10363031B2 (en) | 2010-09-30 | 2019-07-30 | Ethicon Llc | Tissue thickness compensators for surgical staplers |
US10368865B2 (en) | 2015-12-30 | 2019-08-06 | Ethicon Llc | Mechanisms for compensating for drivetrain failure in powered surgical instruments |
US10368864B2 (en) | 2017-06-20 | 2019-08-06 | Ethicon Llc | Systems and methods for controlling displaying motor velocity for a surgical instrument |
US10376263B2 (en) | 2016-04-01 | 2019-08-13 | Ethicon Llc | Anvil modification members for surgical staplers |
US10390841B2 (en) | 2017-06-20 | 2019-08-27 | Ethicon Llc | Control of motor velocity of a surgical stapling and cutting instrument based on angle of articulation |
US10398434B2 (en) | 2017-06-29 | 2019-09-03 | Ethicon Llc | Closed loop velocity control of closure member for robotic surgical instrument |
US10398433B2 (en) | 2007-03-28 | 2019-09-03 | Ethicon Llc | Laparoscopic clamp load measuring devices |
US10405859B2 (en) | 2016-04-15 | 2019-09-10 | Ethicon Llc | Surgical instrument with adjustable stop/start control during a firing motion |
US10413294B2 (en) | 2012-06-28 | 2019-09-17 | Ethicon Llc | Shaft assembly arrangements for surgical instruments |
US10420550B2 (en) | 2009-02-06 | 2019-09-24 | Ethicon Llc | Motor driven surgical fastener device with switching system configured to prevent firing initiation until activated |
US10420549B2 (en) | 2008-09-23 | 2019-09-24 | Ethicon Llc | Motorized surgical instrument |
US10426463B2 (en) | 2006-01-31 | 2019-10-01 | Ehticon LLC | Surgical instrument having a feedback system |
US10426481B2 (en) | 2014-02-24 | 2019-10-01 | Ethicon Llc | Implantable layer assemblies |
US10426471B2 (en) | 2016-12-21 | 2019-10-01 | Ethicon Llc | Surgical instrument with multiple failure response modes |
US10426467B2 (en) | 2016-04-15 | 2019-10-01 | Ethicon Llc | Surgical instrument with detection sensors |
US10441285B2 (en) | 2012-03-28 | 2019-10-15 | Ethicon Llc | Tissue thickness compensator comprising tissue ingrowth features |
US10441279B2 (en) | 2015-03-06 | 2019-10-15 | Ethicon Llc | Multiple level thresholds to modify operation of powered surgical instruments |
US10448948B2 (en) | 2016-02-12 | 2019-10-22 | Ethicon Llc | Mechanisms for compensating for drivetrain failure in powered surgical instruments |
US10448950B2 (en) | 2016-12-21 | 2019-10-22 | Ethicon Llc | Surgical staplers with independently actuatable closing and firing systems |
US10456137B2 (en) | 2016-04-15 | 2019-10-29 | Ethicon Llc | Staple formation detection mechanisms |
US10463370B2 (en) | 2008-02-14 | 2019-11-05 | Ethicon Llc | Motorized surgical instrument |
US10485543B2 (en) | 2016-12-21 | 2019-11-26 | Ethicon Llc | Anvil having a knife slot width |
US10485539B2 (en) | 2006-01-31 | 2019-11-26 | Ethicon Llc | Surgical instrument with firing lockout |
US10485536B2 (en) | 2010-09-30 | 2019-11-26 | Ethicon Llc | Tissue stapler having an anti-microbial agent |
US10492785B2 (en) | 2016-12-21 | 2019-12-03 | Ethicon Llc | Shaft assembly comprising a lockout |
US10492783B2 (en) | 2016-04-15 | 2019-12-03 | Ethicon, Llc | Surgical instrument with improved stop/start control during a firing motion |
USD869655S1 (en) | 2017-06-28 | 2019-12-10 | Ethicon Llc | Surgical fastener cartridge |
US10499914B2 (en) | 2016-12-21 | 2019-12-10 | Ethicon Llc | Staple forming pocket arrangements |
US10517590B2 (en) | 2007-01-10 | 2019-12-31 | Ethicon Llc | Powered surgical instrument having a transmission system |
US10517596B2 (en) | 2016-12-21 | 2019-12-31 | Ethicon Llc | Articulatable surgical instruments with articulation stroke amplification features |
US10517594B2 (en) | 2014-10-29 | 2019-12-31 | Ethicon Llc | Cartridge assemblies for surgical staplers |
US10524787B2 (en) | 2015-03-06 | 2020-01-07 | Ethicon Llc | Powered surgical instrument with parameter-based firing rate |
US10524790B2 (en) | 2011-05-27 | 2020-01-07 | Ethicon Llc | Robotically-controlled surgical stapling devices that produce formed staples having different lengths |
US10531887B2 (en) | 2015-03-06 | 2020-01-14 | Ethicon Llc | Powered surgical instrument including speed display |
US10537325B2 (en) | 2016-12-21 | 2020-01-21 | Ethicon Llc | Staple forming pocket arrangement to accommodate different types of staples |
US10568626B2 (en) | 2016-12-21 | 2020-02-25 | Ethicon Llc | Surgical instruments with jaw opening features for increasing a jaw opening distance |
US10568625B2 (en) | 2016-12-21 | 2020-02-25 | Ethicon Llc | Staple cartridges and arrangements of staples and staple cavities therein |
US10568652B2 (en) | 2006-09-29 | 2020-02-25 | Ethicon Llc | Surgical staples having attached drivers of different heights and stapling instruments for deploying the same |
US10575868B2 (en) | 2013-03-01 | 2020-03-03 | Ethicon Llc | Surgical instrument with coupler assembly |
US10588626B2 (en) | 2014-03-26 | 2020-03-17 | Ethicon Llc | Surgical instrument displaying subsequent step of use |
US10588623B2 (en) | 2010-09-30 | 2020-03-17 | Ethicon Llc | Adhesive film laminate |
US10588632B2 (en) | 2016-12-21 | 2020-03-17 | Ethicon Llc | Surgical end effectors and firing members thereof |
US10588633B2 (en) | 2017-06-28 | 2020-03-17 | Ethicon Llc | Surgical instruments with open and closable jaws and axially movable firing member that is initially parked in close proximity to the jaws prior to firing |
USD879809S1 (en) | 2017-06-20 | 2020-03-31 | Ethicon Llc | Display panel with changeable graphical user interface |
USD879808S1 (en) | 2017-06-20 | 2020-03-31 | Ethicon Llc | Display panel with graphical user interface |
US10617417B2 (en) | 2014-11-06 | 2020-04-14 | Ethicon Llc | Staple cartridge comprising a releasable adjunct material |
US10617418B2 (en) | 2015-08-17 | 2020-04-14 | Ethicon Llc | Implantable layers for a surgical instrument |
US10617416B2 (en) | 2013-03-14 | 2020-04-14 | Ethicon Llc | Control systems for surgical instruments |
US10617413B2 (en) | 2016-04-01 | 2020-04-14 | Ethicon Llc | Closure system arrangements for surgical cutting and stapling devices with separate and distinct firing shafts |
US10617412B2 (en) | 2015-03-06 | 2020-04-14 | Ethicon Llc | System for detecting the mis-insertion of a staple cartridge into a surgical stapler |
US10624861B2 (en) | 2010-09-30 | 2020-04-21 | Ethicon Llc | Tissue thickness compensator configured to redistribute compressive forces |
US10624633B2 (en) | 2017-06-20 | 2020-04-21 | Ethicon Llc | Systems and methods for controlling motor velocity of a surgical stapling and cutting instrument |
US10631859B2 (en) | 2017-06-27 | 2020-04-28 | Ethicon Llc | Articulation systems for surgical instruments |
US10639115B2 (en) | 2012-06-28 | 2020-05-05 | Ethicon Llc | Surgical end effectors having angled tissue-contacting surfaces |
US10646220B2 (en) | 2017-06-20 | 2020-05-12 | Ethicon Llc | Systems and methods for controlling displacement member velocity for a surgical instrument |
US10660640B2 (en) | 2008-02-14 | 2020-05-26 | Ethicon Llc | Motorized surgical cutting and fastening instrument |
US10667808B2 (en) | 2012-03-28 | 2020-06-02 | Ethicon Llc | Staple cartridge comprising an absorbable adjunct |
US10667809B2 (en) | 2016-12-21 | 2020-06-02 | Ethicon Llc | Staple cartridge and staple cartridge channel comprising windows defined therein |
US10675028B2 (en) | 2006-01-31 | 2020-06-09 | Ethicon Llc | Powered surgical instruments with firing system lockout arrangements |
US10682134B2 (en) | 2017-12-21 | 2020-06-16 | Ethicon Llc | Continuous use self-propelled stapling instrument |
US10682142B2 (en) | 2008-02-14 | 2020-06-16 | Ethicon Llc | Surgical stapling apparatus including an articulation system |
US10687806B2 (en) | 2015-03-06 | 2020-06-23 | Ethicon Llc | Adaptive tissue compression techniques to adjust closure rates for multiple tissue types |
US10687813B2 (en) | 2017-12-15 | 2020-06-23 | Ethicon Llc | Adapters with firing stroke sensing arrangements for use in connection with electromechanical surgical instruments |
US10695063B2 (en) | 2012-02-13 | 2020-06-30 | Ethicon Llc | Surgical cutting and fastening instrument with apparatus for determining cartridge and firing motion status |
US10695062B2 (en) | 2010-10-01 | 2020-06-30 | Ethicon Llc | Surgical instrument including a retractable firing member |
US10695058B2 (en) | 2014-12-18 | 2020-06-30 | Ethicon Llc | Surgical instrument systems comprising an articulatable end effector and means for adjusting the firing stroke of a firing member |
US10702267B2 (en) | 2007-03-15 | 2020-07-07 | Ethicon Llc | Surgical stapling instrument having a releasable buttress material |
USD890784S1 (en) | 2017-06-20 | 2020-07-21 | Ethicon Llc | Display panel with changeable graphical user interface |
US10716614B2 (en) | 2017-06-28 | 2020-07-21 | Ethicon Llc | Surgical shaft assemblies with slip ring assemblies with increased contact pressure |
US10716565B2 (en) | 2017-12-19 | 2020-07-21 | Ethicon Llc | Surgical instruments with dual articulation drivers |
US10729509B2 (en) | 2017-12-19 | 2020-08-04 | Ethicon Llc | Surgical instrument comprising closure and firing locking mechanism |
US10729501B2 (en) | 2017-09-29 | 2020-08-04 | Ethicon Llc | Systems and methods for language selection of a surgical instrument |
US10736630B2 (en) | 2014-10-13 | 2020-08-11 | Ethicon Llc | Staple cartridge |
US10736628B2 (en) | 2008-09-23 | 2020-08-11 | Ethicon Llc | Motor-driven surgical cutting instrument |
US10736636B2 (en) | 2014-12-10 | 2020-08-11 | Ethicon Llc | Articulatable surgical instrument system |
US10743875B2 (en) | 2017-12-15 | 2020-08-18 | Ethicon Llc | Surgical end effectors with jaw stiffener arrangements configured to permit monitoring of firing member |
US10743873B2 (en) | 2014-12-18 | 2020-08-18 | Ethicon Llc | Drive arrangements for articulatable surgical instruments |
US10743872B2 (en) | 2017-09-29 | 2020-08-18 | Ethicon Llc | System and methods for controlling a display of a surgical instrument |
US10743874B2 (en) | 2017-12-15 | 2020-08-18 | Ethicon Llc | Sealed adapters for use with electromechanical surgical instruments |
US10743870B2 (en) | 2008-02-14 | 2020-08-18 | Ethicon Llc | Surgical stapling apparatus with interlockable firing system |
US10743851B2 (en) | 2008-02-14 | 2020-08-18 | Ethicon Llc | Interchangeable tools for surgical instruments |
US10743849B2 (en) | 2006-01-31 | 2020-08-18 | Ethicon Llc | Stapling system including an articulation system |
US10751076B2 (en) | 2009-12-24 | 2020-08-25 | Ethicon Llc | Motor-driven surgical cutting instrument with electric actuator directional control assembly |
US10758229B2 (en) | 2016-12-21 | 2020-09-01 | Ethicon Llc | Surgical instrument comprising improved jaw control |
US10758230B2 (en) | 2016-12-21 | 2020-09-01 | Ethicon Llc | Surgical instrument with primary and safety processors |
WO2020176730A1 (en) | 2019-02-27 | 2020-09-03 | Janssen Biotech, Inc. | Antibody formulation |
WO2020176738A1 (en) | 2019-02-28 | 2020-09-03 | Janssen Biotech, Inc. | Anti-il-alpha antibody for the treatment of hidradenitis suppurativa |
US10765427B2 (en) | 2017-06-28 | 2020-09-08 | Ethicon Llc | Method for articulating a surgical instrument |
US10765429B2 (en) | 2017-09-29 | 2020-09-08 | Ethicon Llc | Systems and methods for providing alerts according to the operational state of a surgical instrument |
US10765425B2 (en) | 2008-09-23 | 2020-09-08 | Ethicon Llc | Robotically-controlled motorized surgical instrument with an end effector |
US10772629B2 (en) | 2017-06-27 | 2020-09-15 | Ethicon Llc | Surgical anvil arrangements |
US10772625B2 (en) | 2015-03-06 | 2020-09-15 | Ethicon Llc | Signal and power communication system positioned on a rotatable shaft |
US10780539B2 (en) | 2011-05-27 | 2020-09-22 | Ethicon Llc | Stapling instrument for use with a robotic system |
US10779824B2 (en) | 2017-06-28 | 2020-09-22 | Ethicon Llc | Surgical instrument comprising an articulation system lockable by a closure system |
US10779825B2 (en) | 2017-12-15 | 2020-09-22 | Ethicon Llc | Adapters with end effector position sensing and control arrangements for use in connection with electromechanical surgical instruments |
US10779826B2 (en) | 2017-12-15 | 2020-09-22 | Ethicon Llc | Methods of operating surgical end effectors |
US10779821B2 (en) | 2018-08-20 | 2020-09-22 | Ethicon Llc | Surgical stapler anvils with tissue stop features configured to avoid tissue pinch |
US10779903B2 (en) | 2017-10-31 | 2020-09-22 | Ethicon Llc | Positive shaft rotation lock activated by jaw closure |
US10779820B2 (en) | 2017-06-20 | 2020-09-22 | Ethicon Llc | Systems and methods for controlling motor speed according to user input for a surgical instrument |
US10796471B2 (en) | 2017-09-29 | 2020-10-06 | Ethicon Llc | Systems and methods of displaying a knife position for a surgical instrument |
US10806448B2 (en) | 2014-12-18 | 2020-10-20 | Ethicon Llc | Surgical instrument assembly comprising a flexible articulation system |
US10806449B2 (en) | 2005-11-09 | 2020-10-20 | Ethicon Llc | End effectors for surgical staplers |
US10813639B2 (en) | 2017-06-20 | 2020-10-27 | Ethicon Llc | Closed loop feedback control of motor velocity of a surgical stapling and cutting instrument based on system conditions |
US10828028B2 (en) | 2016-04-15 | 2020-11-10 | Ethicon Llc | Surgical instrument with multiple program responses during a firing motion |
US10828033B2 (en) | 2017-12-15 | 2020-11-10 | Ethicon Llc | Handheld electromechanical surgical instruments with improved motor control arrangements for positioning components of an adapter coupled thereto |
US10835330B2 (en) | 2017-12-19 | 2020-11-17 | Ethicon Llc | Method for determining the position of a rotatable jaw of a surgical instrument attachment assembly |
US10842492B2 (en) | 2018-08-20 | 2020-11-24 | Ethicon Llc | Powered articulatable surgical instruments with clutching and locking arrangements for linking an articulation drive system to a firing drive system |
US10842490B2 (en) | 2017-10-31 | 2020-11-24 | Ethicon Llc | Cartridge body design with force reduction based on firing completion |
US10842491B2 (en) | 2006-01-31 | 2020-11-24 | Ethicon Llc | Surgical system with an actuation console |
US10856869B2 (en) | 2017-06-27 | 2020-12-08 | Ethicon Llc | Surgical anvil arrangements |
US10856870B2 (en) | 2018-08-20 | 2020-12-08 | Ethicon Llc | Switching arrangements for motor powered articulatable surgical instruments |
US10863986B2 (en) | 2015-09-23 | 2020-12-15 | Ethicon Llc | Surgical stapler having downstream current-based motor control |
US10869666B2 (en) | 2017-12-15 | 2020-12-22 | Ethicon Llc | Adapters with control systems for controlling multiple motors of an electromechanical surgical instrument |
USD906355S1 (en) | 2017-06-28 | 2020-12-29 | Ethicon Llc | Display screen or portion thereof with a graphical user interface for a surgical instrument |
EP3582813A4 (en) * | 2017-02-16 | 2020-12-30 | XBiotech, Inc | Treatment of hidradenitis suppurativa |
US10881399B2 (en) | 2017-06-20 | 2021-01-05 | Ethicon Llc | Techniques for adaptive control of motor velocity of a surgical stapling and cutting instrument |
US10881396B2 (en) | 2017-06-20 | 2021-01-05 | Ethicon Llc | Surgical instrument with variable duration trigger arrangement |
US10888321B2 (en) | 2017-06-20 | 2021-01-12 | Ethicon Llc | Systems and methods for controlling velocity of a displacement member of a surgical stapling and cutting instrument |
USD907648S1 (en) | 2017-09-29 | 2021-01-12 | Ethicon Llc | Display screen or portion thereof with animated graphical user interface |
USD907647S1 (en) | 2017-09-29 | 2021-01-12 | Ethicon Llc | Display screen or portion thereof with animated graphical user interface |
US10903685B2 (en) | 2017-06-28 | 2021-01-26 | Ethicon Llc | Surgical shaft assemblies with slip ring assemblies forming capacitive channels |
US10898183B2 (en) | 2017-06-29 | 2021-01-26 | Ethicon Llc | Robotic surgical instrument with closed loop feedback techniques for advancement of closure member during firing |
US10905423B2 (en) | 2014-09-05 | 2021-02-02 | Ethicon Llc | Smart cartridge wake up operation and data retention |
US10905418B2 (en) | 2014-10-16 | 2021-02-02 | Ethicon Llc | Staple cartridge comprising a tissue thickness compensator |
US10912575B2 (en) | 2007-01-11 | 2021-02-09 | Ethicon Llc | Surgical stapling device having supports for a flexible drive mechanism |
US10912559B2 (en) | 2018-08-20 | 2021-02-09 | Ethicon Llc | Reinforced deformable anvil tip for surgical stapler anvil |
US10918380B2 (en) | 2006-01-31 | 2021-02-16 | Ethicon Llc | Surgical instrument system including a control system |
USD910847S1 (en) | 2017-12-19 | 2021-02-16 | Ethicon Llc | Surgical instrument assembly |
US10932772B2 (en) | 2017-06-29 | 2021-03-02 | Ethicon Llc | Methods for closed loop velocity control for robotic surgical instrument |
US10932778B2 (en) | 2008-10-10 | 2021-03-02 | Ethicon Llc | Powered surgical cutting and stapling apparatus with manually retractable firing system |
US10945728B2 (en) | 2014-12-18 | 2021-03-16 | Ethicon Llc | Locking arrangements for detachable shaft assemblies with articulatable surgical end effectors |
US10945731B2 (en) | 2010-09-30 | 2021-03-16 | Ethicon Llc | Tissue thickness compensator comprising controlled release and expansion |
US10959725B2 (en) | 2012-06-15 | 2021-03-30 | Ethicon Llc | Articulatable surgical instrument comprising a firing drive |
USD914878S1 (en) | 2018-08-20 | 2021-03-30 | Ethicon Llc | Surgical instrument anvil |
US10966718B2 (en) | 2017-12-15 | 2021-04-06 | Ethicon Llc | Dynamic clamping assemblies with improved wear characteristics for use in connection with electromechanical surgical instruments |
US10980537B2 (en) | 2017-06-20 | 2021-04-20 | Ethicon Llc | Closed loop feedback control of motor velocity of a surgical stapling and cutting instrument based on measured time over a specified number of shaft rotations |
US10980539B2 (en) | 2015-09-30 | 2021-04-20 | Ethicon Llc | Implantable adjunct comprising bonded layers |
US10987102B2 (en) | 2010-09-30 | 2021-04-27 | Ethicon Llc | Tissue thickness compensator comprising a plurality of layers |
USD917500S1 (en) | 2017-09-29 | 2021-04-27 | Ethicon Llc | Display screen or portion thereof with graphical user interface |
US10993716B2 (en) | 2017-06-27 | 2021-05-04 | Ethicon Llc | Surgical anvil arrangements |
US11006955B2 (en) | 2017-12-15 | 2021-05-18 | Ethicon Llc | End effectors with positive jaw opening features for use with adapters for electromechanical surgical instruments |
US11006951B2 (en) | 2007-01-10 | 2021-05-18 | Ethicon Llc | Surgical instrument with wireless communication between control unit and sensor transponders |
US11007022B2 (en) | 2017-06-29 | 2021-05-18 | Ethicon Llc | Closed loop velocity control techniques based on sensed tissue parameters for robotic surgical instrument |
US11007004B2 (en) | 2012-06-28 | 2021-05-18 | Ethicon Llc | Powered multi-axial articulable electrosurgical device with external dissection features |
US11013511B2 (en) | 2007-06-22 | 2021-05-25 | Ethicon Llc | Surgical stapling instrument with an articulatable end effector |
US11020112B2 (en) | 2017-12-19 | 2021-06-01 | Ethicon Llc | Surgical tools configured for interchangeable use with different controller interfaces |
US11020115B2 (en) | 2014-02-12 | 2021-06-01 | Cilag Gmbh International | Deliverable surgical instrument |
US20210171623A1 (en) * | 2008-05-30 | 2021-06-10 | Janssen Biotech, Inc. | Human antibody specific for interleukin-1alpha |
US11033267B2 (en) | 2017-12-15 | 2021-06-15 | Ethicon Llc | Systems and methods of controlling a clamping member firing rate of a surgical instrument |
US11039836B2 (en) | 2007-01-11 | 2021-06-22 | Cilag Gmbh International | Staple cartridge for use with a surgical stapling instrument |
US11039834B2 (en) | 2018-08-20 | 2021-06-22 | Cilag Gmbh International | Surgical stapler anvils with staple directing protrusions and tissue stability features |
US11045192B2 (en) | 2018-08-20 | 2021-06-29 | Cilag Gmbh International | Fabricating techniques for surgical stapler anvils |
US11045270B2 (en) | 2017-12-19 | 2021-06-29 | Cilag Gmbh International | Robotic attachment comprising exterior drive actuator |
US11051807B2 (en) | 2019-06-28 | 2021-07-06 | Cilag Gmbh International | Packaging assembly including a particulate trap |
US11051813B2 (en) | 2006-01-31 | 2021-07-06 | Cilag Gmbh International | Powered surgical instruments with firing system lockout arrangements |
US11071545B2 (en) | 2014-09-05 | 2021-07-27 | Cilag Gmbh International | Smart cartridge wake up operation and data retention |
US11071543B2 (en) | 2017-12-15 | 2021-07-27 | Cilag Gmbh International | Surgical end effectors with clamping assemblies configured to increase jaw aperture ranges |
US11071554B2 (en) | 2017-06-20 | 2021-07-27 | Cilag Gmbh International | Closed loop feedback control of motor velocity of a surgical stapling and cutting instrument based on magnitude of velocity error measurements |
US11076853B2 (en) | 2017-12-21 | 2021-08-03 | Cilag Gmbh International | Systems and methods of displaying a knife position during transection for a surgical instrument |
US11083458B2 (en) | 2018-08-20 | 2021-08-10 | Cilag Gmbh International | Powered surgical instruments with clutching arrangements to convert linear drive motions to rotary drive motions |
US11090046B2 (en) | 2017-06-20 | 2021-08-17 | Cilag Gmbh International | Systems and methods for controlling displacement member motion of a surgical stapling and cutting instrument |
US11090075B2 (en) | 2017-10-30 | 2021-08-17 | Cilag Gmbh International | Articulation features for surgical end effector |
US11133106B2 (en) | 2013-08-23 | 2021-09-28 | Cilag Gmbh International | Surgical instrument assembly comprising a retraction assembly |
US11129680B2 (en) | 2017-12-21 | 2021-09-28 | Cilag Gmbh International | Surgical instrument comprising a projector |
US11129615B2 (en) | 2009-02-05 | 2021-09-28 | Cilag Gmbh International | Surgical stapling system |
US11134944B2 (en) | 2017-10-30 | 2021-10-05 | Cilag Gmbh International | Surgical stapler knife motion controls |
US11134942B2 (en) | 2016-12-21 | 2021-10-05 | Cilag Gmbh International | Surgical stapling instruments and staple-forming anvils |
US11141153B2 (en) | 2014-10-29 | 2021-10-12 | Cilag Gmbh International | Staple cartridges comprising driver arrangements |
US11147551B2 (en) | 2019-03-25 | 2021-10-19 | Cilag Gmbh International | Firing drive arrangements for surgical systems |
US11147553B2 (en) | 2019-03-25 | 2021-10-19 | Cilag Gmbh International | Firing drive arrangements for surgical systems |
WO2021211927A1 (en) | 2020-04-16 | 2021-10-21 | Janssen Biotech, Inc. | Treatment of hidradenitis suppurativa |
WO2021211924A1 (en) | 2020-04-16 | 2021-10-21 | Janssen Biotech, Inc. | Treatment of atopic dermatitis |
US11154301B2 (en) | 2015-02-27 | 2021-10-26 | Cilag Gmbh International | Modular stapling assembly |
US11172929B2 (en) | 2019-03-25 | 2021-11-16 | Cilag Gmbh International | Articulation drive arrangements for surgical systems |
US11179150B2 (en) | 2016-04-15 | 2021-11-23 | Cilag Gmbh International | Systems and methods for controlling a surgical stapling and cutting instrument |
US11191831B2 (en) | 2011-04-01 | 2021-12-07 | Janssen Biotech, Inc. | Treatment of psychiatric conditions |
US11197670B2 (en) | 2017-12-15 | 2021-12-14 | Cilag Gmbh International | Surgical end effectors with pivotal jaws configured to touch at their respective distal ends when fully closed |
US11197671B2 (en) | 2012-06-28 | 2021-12-14 | Cilag Gmbh International | Stapling assembly comprising a lockout |
US11202633B2 (en) | 2014-09-26 | 2021-12-21 | Cilag Gmbh International | Surgical stapling buttresses and adjunct materials |
US11207064B2 (en) | 2011-05-27 | 2021-12-28 | Cilag Gmbh International | Automated end effector component reloading system for use with a robotic system |
US11207065B2 (en) | 2018-08-20 | 2021-12-28 | Cilag Gmbh International | Method for fabricating surgical stapler anvils |
US11213293B2 (en) | 2016-02-09 | 2022-01-04 | Cilag Gmbh International | Articulatable surgical instruments with single articulation link arrangements |
US11219455B2 (en) | 2019-06-28 | 2022-01-11 | Cilag Gmbh International | Surgical instrument including a lockout key |
US11224428B2 (en) | 2016-12-21 | 2022-01-18 | Cilag Gmbh International | Surgical stapling systems |
US11224426B2 (en) | 2016-02-12 | 2022-01-18 | Cilag Gmbh International | Mechanisms for compensating for drivetrain failure in powered surgical instruments |
US11224427B2 (en) | 2006-01-31 | 2022-01-18 | Cilag Gmbh International | Surgical stapling system including a console and retraction assembly |
US11224423B2 (en) | 2015-03-06 | 2022-01-18 | Cilag Gmbh International | Smart sensors with local signal processing |
US11224497B2 (en) | 2019-06-28 | 2022-01-18 | Cilag Gmbh International | Surgical systems with multiple RFID tags |
US11229437B2 (en) | 2019-06-28 | 2022-01-25 | Cilag Gmbh International | Method for authenticating the compatibility of a staple cartridge with a surgical instrument |
US11234698B2 (en) | 2019-12-19 | 2022-02-01 | Cilag Gmbh International | Stapling system comprising a clamp lockout and a firing lockout |
US11241230B2 (en) | 2012-06-28 | 2022-02-08 | Cilag Gmbh International | Clip applier tool for use with a robotic surgical system |
US11246592B2 (en) | 2017-06-28 | 2022-02-15 | Cilag Gmbh International | Surgical instrument comprising an articulation system lockable to a frame |
US11246590B2 (en) | 2005-08-31 | 2022-02-15 | Cilag Gmbh International | Staple cartridge including staple drivers having different unfired heights |
US11246678B2 (en) | 2019-06-28 | 2022-02-15 | Cilag Gmbh International | Surgical stapling system having a frangible RFID tag |
US11253256B2 (en) | 2018-08-20 | 2022-02-22 | Cilag Gmbh International | Articulatable motor powered surgical instruments with dedicated articulation motor arrangements |
US11253254B2 (en) | 2019-04-30 | 2022-02-22 | Cilag Gmbh International | Shaft rotation actuator on a surgical instrument |
US11259803B2 (en) | 2019-06-28 | 2022-03-01 | Cilag Gmbh International | Surgical stapling system having an information encryption protocol |
US11259805B2 (en) | 2017-06-28 | 2022-03-01 | Cilag Gmbh International | Surgical instrument comprising firing member supports |
US11259799B2 (en) | 2014-03-26 | 2022-03-01 | Cilag Gmbh International | Interface systems for use with surgical instruments |
US11266405B2 (en) | 2017-06-27 | 2022-03-08 | Cilag Gmbh International | Surgical anvil manufacturing methods |
US11266409B2 (en) | 2014-04-16 | 2022-03-08 | Cilag Gmbh International | Fastener cartridge comprising a sled including longitudinally-staggered ramps |
US11272927B2 (en) | 2008-02-15 | 2022-03-15 | Cilag Gmbh International | Layer arrangements for surgical staple cartridges |
US11278279B2 (en) | 2006-01-31 | 2022-03-22 | Cilag Gmbh International | Surgical instrument assembly |
US11284898B2 (en) | 2014-09-18 | 2022-03-29 | Cilag Gmbh International | Surgical instrument including a deployable knife |
US11291451B2 (en) | 2019-06-28 | 2022-04-05 | Cilag Gmbh International | Surgical instrument with battery compatibility verification functionality |
US11291449B2 (en) | 2009-12-24 | 2022-04-05 | Cilag Gmbh International | Surgical cutting instrument that analyzes tissue thickness |
US11291441B2 (en) | 2007-01-10 | 2022-04-05 | Cilag Gmbh International | Surgical instrument with wireless communication between control unit and remote sensor |
US11291440B2 (en) | 2018-08-20 | 2022-04-05 | Cilag Gmbh International | Method for operating a powered articulatable surgical instrument |
US11291447B2 (en) | 2019-12-19 | 2022-04-05 | Cilag Gmbh International | Stapling instrument comprising independent jaw closing and staple firing systems |
US11298125B2 (en) | 2010-09-30 | 2022-04-12 | Cilag Gmbh International | Tissue stapler having a thickness compensator |
US11298132B2 (en) | 2019-06-28 | 2022-04-12 | Cilag GmbH Inlernational | Staple cartridge including a honeycomb extension |
US11298127B2 (en) | 2019-06-28 | 2022-04-12 | Cilag GmbH Interational | Surgical stapling system having a lockout mechanism for an incompatible cartridge |
US11304695B2 (en) | 2017-08-03 | 2022-04-19 | Cilag Gmbh International | Surgical system shaft interconnection |
US11304696B2 (en) | 2019-12-19 | 2022-04-19 | Cilag Gmbh International | Surgical instrument comprising a powered articulation system |
US11311294B2 (en) | 2014-09-05 | 2022-04-26 | Cilag Gmbh International | Powered medical device including measurement of closure state of jaws |
US11311290B2 (en) | 2017-12-21 | 2022-04-26 | Cilag Gmbh International | Surgical instrument comprising an end effector dampener |
US11317917B2 (en) | 2016-04-18 | 2022-05-03 | Cilag Gmbh International | Surgical stapling system comprising a lockable firing assembly |
US11317913B2 (en) | 2016-12-21 | 2022-05-03 | Cilag Gmbh International | Lockout arrangements for surgical end effectors and replaceable tool assemblies |
US11324501B2 (en) | 2018-08-20 | 2022-05-10 | Cilag Gmbh International | Surgical stapling devices with improved closure members |
US11324503B2 (en) | 2017-06-27 | 2022-05-10 | Cilag Gmbh International | Surgical firing member arrangements |
US11350928B2 (en) | 2016-04-18 | 2022-06-07 | Cilag Gmbh International | Surgical instrument comprising a tissue thickness lockout and speed control system |
US11376098B2 (en) | 2019-06-28 | 2022-07-05 | Cilag Gmbh International | Surgical instrument system comprising an RFID system |
US11382638B2 (en) | 2017-06-20 | 2022-07-12 | Cilag Gmbh International | Closed loop feedback control of motor velocity of a surgical stapling and cutting instrument based on measured time over a specified displacement distance |
US11382627B2 (en) | 2014-04-16 | 2022-07-12 | Cilag Gmbh International | Surgical stapling assembly comprising a firing member including a lateral extension |
US11399837B2 (en) | 2019-06-28 | 2022-08-02 | Cilag Gmbh International | Mechanisms for motor control adjustments of a motorized surgical instrument |
US11399829B2 (en) | 2017-09-29 | 2022-08-02 | Cilag Gmbh International | Systems and methods of initiating a power shutdown mode for a surgical instrument |
US11419606B2 (en) | 2016-12-21 | 2022-08-23 | Cilag Gmbh International | Shaft assembly comprising a clutch configured to adapt the output of a rotary firing member to two different systems |
US11426167B2 (en) | 2019-06-28 | 2022-08-30 | Cilag Gmbh International | Mechanisms for proper anvil attachment surgical stapling head assembly |
US11426251B2 (en) | 2019-04-30 | 2022-08-30 | Cilag Gmbh International | Articulation directional lights on a surgical instrument |
US11432816B2 (en) | 2019-04-30 | 2022-09-06 | Cilag Gmbh International | Articulation pin for a surgical instrument |
US11446029B2 (en) | 2019-12-19 | 2022-09-20 | Cilag Gmbh International | Staple cartridge comprising projections extending from a curved deck surface |
US11452526B2 (en) | 2020-10-29 | 2022-09-27 | Cilag Gmbh International | Surgical instrument comprising a staged voltage regulation start-up system |
US11452528B2 (en) | 2019-04-30 | 2022-09-27 | Cilag Gmbh International | Articulation actuators for a surgical instrument |
USD966512S1 (en) | 2020-06-02 | 2022-10-11 | Cilag Gmbh International | Staple cartridge |
US11464512B2 (en) | 2019-12-19 | 2022-10-11 | Cilag Gmbh International | Staple cartridge comprising a curved deck surface |
US11464513B2 (en) | 2012-06-28 | 2022-10-11 | Cilag Gmbh International | Surgical instrument system including replaceable end effectors |
US11464601B2 (en) | 2019-06-28 | 2022-10-11 | Cilag Gmbh International | Surgical instrument comprising an RFID system for tracking a movable component |
US11471155B2 (en) | 2017-08-03 | 2022-10-18 | Cilag Gmbh International | Surgical system bailout |
US11471157B2 (en) | 2019-04-30 | 2022-10-18 | Cilag Gmbh International | Articulation control mapping for a surgical instrument |
USD967421S1 (en) | 2020-06-02 | 2022-10-18 | Cilag Gmbh International | Staple cartridge |
US11478241B2 (en) | 2019-06-28 | 2022-10-25 | Cilag Gmbh International | Staple cartridge including projections |
US11478247B2 (en) | 2010-07-30 | 2022-10-25 | Cilag Gmbh International | Tissue acquisition arrangements and methods for surgical stapling devices |
US11484312B2 (en) | 2005-08-31 | 2022-11-01 | Cilag Gmbh International | Staple cartridge comprising a staple driver arrangement |
US11497488B2 (en) | 2014-03-26 | 2022-11-15 | Cilag Gmbh International | Systems and methods for controlling a segmented circuit |
US11497492B2 (en) | 2019-06-28 | 2022-11-15 | Cilag Gmbh International | Surgical instrument including an articulation lock |
US11504116B2 (en) | 2011-04-29 | 2022-11-22 | Cilag Gmbh International | Layer of material for a surgical end effector |
US11504122B2 (en) | 2019-12-19 | 2022-11-22 | Cilag Gmbh International | Surgical instrument comprising a nested firing member |
US11517325B2 (en) | 2017-06-20 | 2022-12-06 | Cilag Gmbh International | Closed loop feedback control of motor velocity of a surgical stapling and cutting instrument based on measured displacement distance traveled over a specified time interval |
US11517390B2 (en) | 2020-10-29 | 2022-12-06 | Cilag Gmbh International | Surgical instrument comprising a limited travel switch |
US11523822B2 (en) | 2019-06-28 | 2022-12-13 | Cilag Gmbh International | Battery pack including a circuit interrupter |
US11523821B2 (en) | 2014-09-26 | 2022-12-13 | Cilag Gmbh International | Method for creating a flexible staple line |
US11523823B2 (en) | 2016-02-09 | 2022-12-13 | Cilag Gmbh International | Surgical instruments with non-symmetrical articulation arrangements |
US11529139B2 (en) | 2019-12-19 | 2022-12-20 | Cilag Gmbh International | Motor driven surgical instrument |
US11529137B2 (en) | 2019-12-19 | 2022-12-20 | Cilag Gmbh International | Staple cartridge comprising driver retention members |
US11534259B2 (en) | 2020-10-29 | 2022-12-27 | Cilag Gmbh International | Surgical instrument comprising an articulation indicator |
USD974560S1 (en) | 2020-06-02 | 2023-01-03 | Cilag Gmbh International | Staple cartridge |
USD975278S1 (en) | 2020-06-02 | 2023-01-10 | Cilag Gmbh International | Staple cartridge |
USD975851S1 (en) | 2020-06-02 | 2023-01-17 | Cilag Gmbh International | Staple cartridge |
US11553971B2 (en) | 2019-06-28 | 2023-01-17 | Cilag Gmbh International | Surgical RFID assemblies for display and communication |
USD975850S1 (en) | 2020-06-02 | 2023-01-17 | Cilag Gmbh International | Staple cartridge |
USD976401S1 (en) | 2020-06-02 | 2023-01-24 | Cilag Gmbh International | Staple cartridge |
US11559304B2 (en) | 2019-12-19 | 2023-01-24 | Cilag Gmbh International | Surgical instrument comprising a rapid closure mechanism |
US11564682B2 (en) | 2007-06-04 | 2023-01-31 | Cilag Gmbh International | Surgical stapler device |
US11564686B2 (en) | 2017-06-28 | 2023-01-31 | Cilag Gmbh International | Surgical shaft assemblies with flexible interfaces |
US11571215B2 (en) | 2010-09-30 | 2023-02-07 | Cilag Gmbh International | Layer of material for a surgical end effector |
US11576672B2 (en) | 2019-12-19 | 2023-02-14 | Cilag Gmbh International | Surgical instrument comprising a closure system including a closure member and an opening member driven by a drive screw |
USD980425S1 (en) | 2020-10-29 | 2023-03-07 | Cilag Gmbh International | Surgical instrument assembly |
US11607239B2 (en) | 2016-04-15 | 2023-03-21 | Cilag Gmbh International | Systems and methods for controlling a surgical stapling and cutting instrument |
US11607219B2 (en) | 2019-12-19 | 2023-03-21 | Cilag Gmbh International | Staple cartridge comprising a detachable tissue cutting knife |
US11617577B2 (en) | 2020-10-29 | 2023-04-04 | Cilag Gmbh International | Surgical instrument comprising a sensor configured to sense whether an articulation drive of the surgical instrument is actuatable |
US11622763B2 (en) | 2013-04-16 | 2023-04-11 | Cilag Gmbh International | Stapling assembly comprising a shiftable drive |
US11622766B2 (en) | 2012-06-28 | 2023-04-11 | Cilag Gmbh International | Empty clip cartridge lockout |
US11627959B2 (en) | 2019-06-28 | 2023-04-18 | Cilag Gmbh International | Surgical instruments including manual and powered system lockouts |
US11627960B2 (en) | 2020-12-02 | 2023-04-18 | Cilag Gmbh International | Powered surgical instruments with smart reload with separately attachable exteriorly mounted wiring connections |
US11638587B2 (en) | 2019-06-28 | 2023-05-02 | Cilag Gmbh International | RFID identification systems for surgical instruments |
US11638582B2 (en) | 2020-07-28 | 2023-05-02 | Cilag Gmbh International | Surgical instruments with torsion spine drive arrangements |
US11648005B2 (en) | 2008-09-23 | 2023-05-16 | Cilag Gmbh International | Robotically-controlled motorized surgical instrument with an end effector |
US11648009B2 (en) | 2019-04-30 | 2023-05-16 | Cilag Gmbh International | Rotatable jaw tip for a surgical instrument |
US11653920B2 (en) | 2020-12-02 | 2023-05-23 | Cilag Gmbh International | Powered surgical instruments with communication interfaces through sterile barrier |
US11653914B2 (en) | 2017-06-20 | 2023-05-23 | Cilag Gmbh International | Systems and methods for controlling motor velocity of a surgical stapling and cutting instrument according to articulation angle of end effector |
US11653915B2 (en) | 2020-12-02 | 2023-05-23 | Cilag Gmbh International | Surgical instruments with sled location detection and adjustment features |
US11660163B2 (en) | 2019-06-28 | 2023-05-30 | Cilag Gmbh International | Surgical system with RFID tags for updating motor assembly parameters |
US11678877B2 (en) | 2014-12-18 | 2023-06-20 | Cilag Gmbh International | Surgical instrument including a flexible support configured to support a flexible firing member |
US11678882B2 (en) | 2020-12-02 | 2023-06-20 | Cilag Gmbh International | Surgical instruments with interactive features to remedy incidental sled movements |
US11684434B2 (en) | 2019-06-28 | 2023-06-27 | Cilag Gmbh International | Surgical RFID assemblies for instrument operational setting control |
US11696757B2 (en) | 2021-02-26 | 2023-07-11 | Cilag Gmbh International | Monitoring of internal systems to detect and track cartridge motion status |
US11696761B2 (en) | 2019-03-25 | 2023-07-11 | Cilag Gmbh International | Firing drive arrangements for surgical systems |
US11701111B2 (en) | 2019-12-19 | 2023-07-18 | Cilag Gmbh International | Method for operating a surgical stapling instrument |
US11701113B2 (en) | 2021-02-26 | 2023-07-18 | Cilag Gmbh International | Stapling instrument comprising a separate power antenna and a data transfer antenna |
US11717294B2 (en) | 2014-04-16 | 2023-08-08 | Cilag Gmbh International | End effector arrangements comprising indicators |
US11717291B2 (en) | 2021-03-22 | 2023-08-08 | Cilag Gmbh International | Staple cartridge comprising staples configured to apply different tissue compression |
US11717289B2 (en) | 2020-10-29 | 2023-08-08 | Cilag Gmbh International | Surgical instrument comprising an indicator which indicates that an articulation drive is actuatable |
US11723657B2 (en) | 2021-02-26 | 2023-08-15 | Cilag Gmbh International | Adjustable communication based on available bandwidth and power capacity |
US11723662B2 (en) | 2021-05-28 | 2023-08-15 | Cilag Gmbh International | Stapling instrument comprising an articulation control display |
US11723658B2 (en) | 2021-03-22 | 2023-08-15 | Cilag Gmbh International | Staple cartridge comprising a firing lockout |
US11730473B2 (en) | 2021-02-26 | 2023-08-22 | Cilag Gmbh International | Monitoring of manufacturing life-cycle |
US11737749B2 (en) | 2021-03-22 | 2023-08-29 | Cilag Gmbh International | Surgical stapling instrument comprising a retraction system |
US11737751B2 (en) | 2020-12-02 | 2023-08-29 | Cilag Gmbh International | Devices and methods of managing energy dissipated within sterile barriers of surgical instrument housings |
US11749877B2 (en) | 2021-02-26 | 2023-09-05 | Cilag Gmbh International | Stapling instrument comprising a signal antenna |
US11744583B2 (en) | 2021-02-26 | 2023-09-05 | Cilag Gmbh International | Distal communication array to tune frequency of RF systems |
US11744603B2 (en) | 2021-03-24 | 2023-09-05 | Cilag Gmbh International | Multi-axis pivot joints for surgical instruments and methods for manufacturing same |
US11744581B2 (en) | 2020-12-02 | 2023-09-05 | Cilag Gmbh International | Powered surgical instruments with multi-phase tissue treatment |
US11751869B2 (en) | 2021-02-26 | 2023-09-12 | Cilag Gmbh International | Monitoring of multiple sensors over time to detect moving characteristics of tissue |
US11759202B2 (en) | 2021-03-22 | 2023-09-19 | Cilag Gmbh International | Staple cartridge comprising an implantable layer |
US11766259B2 (en) | 2016-12-21 | 2023-09-26 | Cilag Gmbh International | Method of deforming staples from two different types of staple cartridges with the same surgical stapling instrument |
US11766260B2 (en) | 2016-12-21 | 2023-09-26 | Cilag Gmbh International | Methods of stapling tissue |
US11771419B2 (en) | 2019-06-28 | 2023-10-03 | Cilag Gmbh International | Packaging for a replaceable component of a surgical stapling system |
US11779330B2 (en) | 2020-10-29 | 2023-10-10 | Cilag Gmbh International | Surgical instrument comprising a jaw alignment system |
US11786243B2 (en) | 2021-03-24 | 2023-10-17 | Cilag Gmbh International | Firing members having flexible portions for adapting to a load during a surgical firing stroke |
US11786239B2 (en) | 2021-03-24 | 2023-10-17 | Cilag Gmbh International | Surgical instrument articulation joint arrangements comprising multiple moving linkage features |
US11793522B2 (en) | 2015-09-30 | 2023-10-24 | Cilag Gmbh International | Staple cartridge assembly including a compressible adjunct |
US11795217B2 (en) | 2018-06-29 | 2023-10-24 | Cedars-Sinai Medical Center | Interleukin-1 inhibition for combination treatment of pancreatic cancer cachexia |
US11793514B2 (en) | 2021-02-26 | 2023-10-24 | Cilag Gmbh International | Staple cartridge comprising sensor array which may be embedded in cartridge body |
US11793516B2 (en) | 2021-03-24 | 2023-10-24 | Cilag Gmbh International | Surgical staple cartridge comprising longitudinal support beam |
US11793518B2 (en) | 2006-01-31 | 2023-10-24 | Cilag Gmbh International | Powered surgical instruments with firing system lockout arrangements |
US11806011B2 (en) | 2021-03-22 | 2023-11-07 | Cilag Gmbh International | Stapling instrument comprising tissue compression systems |
US11812964B2 (en) | 2021-02-26 | 2023-11-14 | Cilag Gmbh International | Staple cartridge comprising a power management circuit |
US11826048B2 (en) | 2017-06-28 | 2023-11-28 | Cilag Gmbh International | Surgical instrument comprising selectively actuatable rotatable couplers |
US11826042B2 (en) | 2021-03-22 | 2023-11-28 | Cilag Gmbh International | Surgical instrument comprising a firing drive including a selectable leverage mechanism |
US11826012B2 (en) | 2021-03-22 | 2023-11-28 | Cilag Gmbh International | Stapling instrument comprising a pulsed motor-driven firing rack |
US11826132B2 (en) | 2015-03-06 | 2023-11-28 | Cilag Gmbh International | Time dependent evaluation of sensor data to determine stability, creep, and viscoelastic elements of measures |
US11832816B2 (en) | 2021-03-24 | 2023-12-05 | Cilag Gmbh International | Surgical stapling assembly comprising nonplanar staples and planar staples |
US11844518B2 (en) | 2020-10-29 | 2023-12-19 | Cilag Gmbh International | Method for operating a surgical instrument |
US11844520B2 (en) | 2019-12-19 | 2023-12-19 | Cilag Gmbh International | Staple cartridge comprising driver retention members |
US11849941B2 (en) | 2007-06-29 | 2023-12-26 | Cilag Gmbh International | Staple cartridge having staple cavities extending at a transverse angle relative to a longitudinal cartridge axis |
US11849943B2 (en) | 2020-12-02 | 2023-12-26 | Cilag Gmbh International | Surgical instrument with cartridge release mechanisms |
US11849952B2 (en) | 2010-09-30 | 2023-12-26 | Cilag Gmbh International | Staple cartridge comprising staples positioned within a compressible portion thereof |
US11849945B2 (en) | 2021-03-24 | 2023-12-26 | Cilag Gmbh International | Rotary-driven surgical stapling assembly comprising eccentrically driven firing member |
US11849944B2 (en) | 2021-03-24 | 2023-12-26 | Cilag Gmbh International | Drivers for fastener cartridge assemblies having rotary drive screws |
US11857183B2 (en) | 2021-03-24 | 2024-01-02 | Cilag Gmbh International | Stapling assembly components having metal substrates and plastic bodies |
US11877745B2 (en) | 2021-10-18 | 2024-01-23 | Cilag Gmbh International | Surgical stapling assembly having longitudinally-repeating staple leg clusters |
USD1013170S1 (en) | 2020-10-29 | 2024-01-30 | Cilag Gmbh International | Surgical instrument assembly |
US11883026B2 (en) | 2014-04-16 | 2024-01-30 | Cilag Gmbh International | Fastener cartridge assemblies and staple retainer cover arrangements |
US11890010B2 (en) | 2020-12-02 | 2024-02-06 | Cllag GmbH International | Dual-sided reinforced reload for surgical instruments |
US11890012B2 (en) | 2004-07-28 | 2024-02-06 | Cilag Gmbh International | Staple cartridge comprising cartridge body and attached support |
US11896217B2 (en) | 2020-10-29 | 2024-02-13 | Cilag Gmbh International | Surgical instrument comprising an articulation lock |
US11896219B2 (en) | 2021-03-24 | 2024-02-13 | Cilag Gmbh International | Mating features between drivers and underside of a cartridge deck |
US11896218B2 (en) | 2021-03-24 | 2024-02-13 | Cilag Gmbh International | Method of using a powered stapling device |
US11903581B2 (en) | 2019-04-30 | 2024-02-20 | Cilag Gmbh International | Methods for stapling tissue using a surgical instrument |
US11903582B2 (en) | 2021-03-24 | 2024-02-20 | Cilag Gmbh International | Leveraging surfaces for cartridge installation |
US11911032B2 (en) | 2019-12-19 | 2024-02-27 | Cilag Gmbh International | Staple cartridge comprising a seating cam |
US11925349B2 (en) | 2021-02-26 | 2024-03-12 | Cilag Gmbh International | Adjustment to transfer parameters to improve available power |
US11932688B2 (en) | 2010-08-23 | 2024-03-19 | Xbiotech Inc. | Treatment for neoplastic diseases |
US11931025B2 (en) | 2020-10-29 | 2024-03-19 | Cilag Gmbh International | Surgical instrument comprising a releasable closure drive lock |
US11931033B2 (en) | 2019-12-19 | 2024-03-19 | Cilag Gmbh International | Staple cartridge comprising a latch lockout |
US11937816B2 (en) | 2021-10-28 | 2024-03-26 | Cilag Gmbh International | Electrical lead arrangements for surgical instruments |
US11944336B2 (en) | 2021-03-24 | 2024-04-02 | Cilag Gmbh International | Joint arrangements for multi-planar alignment and support of operational drive shafts in articulatable surgical instruments |
US11944300B2 (en) | 2017-08-03 | 2024-04-02 | Cilag Gmbh International | Method for operating a surgical system bailout |
US11944296B2 (en) | 2020-12-02 | 2024-04-02 | Cilag Gmbh International | Powered surgical instruments with external connectors |
US11950777B2 (en) | 2021-02-26 | 2024-04-09 | Cilag Gmbh International | Staple cartridge comprising an information access control system |
US11950779B2 (en) | 2021-02-26 | 2024-04-09 | Cilag Gmbh International | Method of powering and communicating with a staple cartridge |
US11957337B2 (en) | 2021-10-18 | 2024-04-16 | Cilag Gmbh International | Surgical stapling assembly with offset ramped drive surfaces |
US11974742B2 (en) | 2017-08-03 | 2024-05-07 | Cilag Gmbh International | Surgical system comprising an articulation bailout |
US11980362B2 (en) | 2021-02-26 | 2024-05-14 | Cilag Gmbh International | Surgical instrument system comprising a power transfer coil |
US11980366B2 (en) | 2006-10-03 | 2024-05-14 | Cilag Gmbh International | Surgical instrument |
US11980363B2 (en) | 2021-10-18 | 2024-05-14 | Cilag Gmbh International | Row-to-row staple array variations |
US11986183B2 (en) | 2008-02-14 | 2024-05-21 | Cilag Gmbh International | Surgical cutting and fastening instrument comprising a plurality of sensors to measure an electrical parameter |
US11998198B2 (en) | 2004-07-28 | 2024-06-04 | Cilag Gmbh International | Surgical stapling instrument incorporating a two-piece E-beam firing mechanism |
US12004745B2 (en) | 2016-12-21 | 2024-06-11 | Cilag Gmbh International | Surgical instrument system comprising an end effector lockout and a firing assembly lockout |
US12004740B2 (en) | 2019-06-28 | 2024-06-11 | Cilag Gmbh International | Surgical stapling system having an information decryption protocol |
US12035913B2 (en) | 2019-12-19 | 2024-07-16 | Cilag Gmbh International | Staple cartridge comprising a deployable knife |
US12053175B2 (en) | 2020-10-29 | 2024-08-06 | Cilag Gmbh International | Surgical instrument comprising a stowed closure actuator stop |
US12089841B2 (en) | 2021-10-28 | 2024-09-17 | Cilag CmbH International | Staple cartridge identification systems |
Families Citing this family (34)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN109187944A (en) * | 2005-08-02 | 2019-01-11 | 埃克斯生物科技公司 | Using the diagnosis of IL-1 α autoantibody, treat and prevent vascular diseases |
AU2007251239B2 (en) * | 2006-05-15 | 2013-08-22 | Xbiotech Inc. | IL-1alpha immunization induces autoantibodies protective against atherosclerosis |
US20110008282A1 (en) * | 2006-05-15 | 2011-01-13 | Xbiotech, Inc. | IL-1alpha immunization induces autoantibodies protective against atherosclerosis |
EP2109623B1 (en) * | 2006-05-22 | 2011-10-12 | XBiotech, Inc | Treatment of cancer with anti-il-1 antibodies |
JP5976319B2 (en) * | 2008-09-12 | 2016-08-23 | エックスバイオテク,インコーポレイテッドXbiotech,Inc. | Targeting pathogenic monocytes |
AU2015271978B2 (en) * | 2010-08-23 | 2017-10-26 | Xbiotech Inc. | Treatment for neoplastic diseases |
ES2697056T3 (en) * | 2011-04-01 | 2019-01-21 | Xbiotech Inc | Treatment for dermatological pathologies |
CN102296050B (en) * | 2011-05-30 | 2013-04-03 | 苏州大学 | Anti-human IL-1alpha monoclonal antibody and application thereof |
EP2739587B1 (en) * | 2011-08-01 | 2020-05-27 | Denovo Sciences | Cell capture system |
US10466160B2 (en) | 2011-08-01 | 2019-11-05 | Celsee Diagnostics, Inc. | System and method for retrieving and analyzing particles |
CN103906536A (en) * | 2011-09-23 | 2014-07-02 | 埃克斯生物科技公司 | Cachexia treatment |
CN102636655B (en) * | 2012-05-10 | 2014-07-23 | 苏州大学附属第一医院 | Fluorescence in-situ micro-lymphocytotoxicity detection method and kit |
US9545441B2 (en) | 2012-09-18 | 2017-01-17 | Xbiotech, Inc. | Treatment of diabetes |
AU2013327498B2 (en) * | 2012-10-04 | 2018-06-28 | Janssen Biotech, Inc. | Treatment of psychiatric conditions |
US9606102B2 (en) | 2013-01-26 | 2017-03-28 | Denovo Sciences, Inc. | System and method for capturing and analyzing cells |
US9707562B2 (en) | 2013-03-13 | 2017-07-18 | Denovo Sciences, Inc. | System for capturing and analyzing cells |
US10391490B2 (en) | 2013-05-31 | 2019-08-27 | Celsee Diagnostics, Inc. | System and method for isolating and analyzing cells |
US10278120B2 (en) * | 2014-01-16 | 2019-04-30 | Industry-University Cooperation Foundation Hanyang University | Method for controlling small cell and apparatus for same |
RU2556816C1 (en) * | 2014-03-12 | 2015-07-20 | Открытое акционерное общество "Фармацевтический импорт, экспорт" (ОАО "Фармимэкс") | Strain of cells of chinese hamster ovaries - producer of recombinant antibody against tumour necrosis factor alpha of human being |
US20160099559A1 (en) * | 2014-10-01 | 2016-04-07 | Continental Automotive Systems, Inc. | Overcurrent protection for an automotive instrument cluster |
CN105573555B (en) * | 2016-01-28 | 2018-06-29 | 京东方科技集团股份有限公司 | A kind of pressure touch structure, touch-control display panel, display device |
US10391493B2 (en) | 2017-08-29 | 2019-08-27 | Celsee Diagnostics, Inc. | System and method for isolating and analyzing cells |
JP2019043215A (en) | 2017-08-30 | 2019-03-22 | いすゞ自動車株式会社 | Steering device |
US20210238273A1 (en) * | 2018-04-24 | 2021-08-05 | Janssen Biotech, Inc. | Treatment of atopic dermatitis |
US10633693B1 (en) | 2019-04-16 | 2020-04-28 | Celsee Diagnostics, Inc. | System and method for leakage control in a particle capture system |
US11273439B2 (en) | 2019-05-07 | 2022-03-15 | Bio-Rad Laboratories, Inc. | System and method for target material retrieval from microwells |
CN114072490A (en) | 2019-05-07 | 2022-02-18 | 伯乐实验室有限公司 | System and method for automated single cell processing |
CN111471655B (en) * | 2020-03-19 | 2023-07-07 | 湖州正熙医学检验实验室有限公司 | Anti-human IL12/23 stable transgenic cell strain and construction method and application thereof |
CA3095675A1 (en) * | 2020-10-07 | 2022-04-07 | Xbiotech Inc. | True human antibody specific for interleukin 1 alpha (il-1a) |
CA3095676A1 (en) * | 2020-10-07 | 2022-04-07 | Xbiotech Inc. | True human antibody specific for interleukin 1 alpha (il-1a) |
CA3095679A1 (en) * | 2020-10-07 | 2022-04-07 | Xbiotech Inc. | True human antibody specific for interleuken 1 alpha (il-1a) |
CA3095740A1 (en) * | 2020-10-07 | 2022-04-07 | Xbiotech Inc. | True human antibody specific for interleukin alpha (il-1a) |
WO2024065083A1 (en) * | 2022-09-26 | 2024-04-04 | 成都优洛生物科技有限公司 | METHOD FOR TESTING IN-VIVO DRUG EFFICACY OF IL-1α ANTIBODY IN NON-MURINE MAMMALS |
WO2024130541A1 (en) * | 2022-12-20 | 2024-06-27 | 成都优洛生物科技有限公司 | IL-1α-TARGETING ANTIBODY OR ANTIGEN-BINDING FRAGMENT THEREOF AND USE THEREOF |
Citations (31)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4634664A (en) | 1982-01-22 | 1987-01-06 | Sandoz Ltd. | Process for the production of human mono-clonal antibodies |
WO1990006371A1 (en) | 1988-12-08 | 1990-06-14 | Commissariat A L'energie Atomique | ANTI-INTERLEUKINE 1α AND 1β MONOCLONAL ANTIBODIES, METHOD FOR PRODUCING THE SAME AND APPLICATIONS OF SAID ANTIBODIES TO THE DETECTION OF INTERLEUKINES 1α AND 1β AND TO THERAPY |
US4965198A (en) | 1985-12-24 | 1990-10-23 | Konica Corporation | Monoclonal antibody and method of manufacturing hybridoma producing the same |
US5034316A (en) | 1987-03-30 | 1991-07-23 | The Regents Of The University Of California | In vitro human monoclonal IgG rheumatoid factor autoantibody |
US5168062A (en) | 1985-01-30 | 1992-12-01 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence |
US5231024A (en) | 1986-09-13 | 1993-07-27 | Basf Aktiengesellschaft | Monoclonal antibodies against human tumor necrosis factor (tnf), and use thereof |
WO1996035719A1 (en) | 1995-05-12 | 1996-11-14 | The National Blood Authority | Transeptithelial transport of molecular species |
US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US5654407A (en) | 1993-03-05 | 1997-08-05 | Bayer Corporation | Human anti-TNF antibodies |
US5792838A (en) | 1991-10-28 | 1998-08-11 | Glaxo Wellcome Inc. | Method for stabilizing immunoglobulin compositions |
US5795967A (en) | 1984-07-05 | 1998-08-18 | Genentech, Inc. | Tumor necrosis factor antagonists and their use |
US5932188A (en) | 1992-10-14 | 1999-08-03 | Sterling Winthrop Inc. | Therapeutic and diagnostic imaging compositions and methods |
US5959085A (en) | 1993-11-23 | 1999-09-28 | Schering Corporation | Human monoclonal antibodies against human cytokines and methods of making and using such antibodies |
US6090382A (en) | 1996-02-09 | 2000-07-18 | Basf Aktiengesellschaft | Human antibodies that bind human TNFα |
US6140470A (en) | 1995-06-30 | 2000-10-31 | Yale University | Human monoclonal anti-tumor antibodies |
US20030026806A1 (en) | 2000-10-27 | 2003-02-06 | Amgen Inc. | Antibodies and other selective IL-1 binding agents that allow binding to IL-1 receptor but not activation thereof |
US20030040617A9 (en) | 1999-03-12 | 2003-02-27 | Rosen Craig A. | Nucleic acids, proteins and antibodies |
US20030232054A1 (en) | 2000-01-25 | 2003-12-18 | Tang Y. Tom | Novel nucleic acids and polypeptides |
US20040185514A1 (en) | 1998-07-03 | 2004-09-23 | Athera Biotechnologies Ab | Method of diagnosing cadiovascular disease |
WO2004100987A2 (en) | 2003-05-06 | 2004-11-25 | Regeneron Pharmaceuticals, Inc. | Methods of using il-1 antagonists to treat neointimal hyperplasia |
US20050054019A1 (en) | 2003-08-04 | 2005-03-10 | Michaud Neil R. | Antibodies to c-Met |
US20050147603A1 (en) | 2003-12-24 | 2005-07-07 | Smith Henry J. | Autoantibodies utilized as carrier agents for pharmaceutical compounds used in tumor imaging and cancer treatment |
US20060159775A1 (en) | 2004-02-03 | 2006-07-20 | Mcgrath Michael S | Chlorite in the treatment of neurodegenerative disease |
WO2007015128A1 (en) | 2005-08-02 | 2007-02-08 | Xbiotech Inc. | DIAGNOSIS, TREATMENT, AND PREVENTION OF VASCULAR DISORDERS USING IL-1α AUTOANTIBODIES |
US20070071675A1 (en) | 2005-08-19 | 2007-03-29 | Chengbin Wu | Dual variable domain immunoglobulin and uses thereof |
WO2007039552A1 (en) | 2005-09-28 | 2007-04-12 | Cytos Biotechnology Ag | Interleukin-1 conjugates and uses thereof |
WO2007132338A2 (en) | 2006-05-15 | 2007-11-22 | Xbiotech Inc. | IL-1α IMMUNIZATION INDUCES AUTOANTIBODIES PROTECTIVE AGAINST ATHEROSCLEROSIS |
WO2007135546A2 (en) | 2006-05-22 | 2007-11-29 | Xbiotech Inc. | TREATMENT OF CANCER WITH ANTI-IL-1α ANTIBODIES |
US20080050310A1 (en) | 2006-05-30 | 2008-02-28 | Genentech, Inc. | Antibodies and immunoconjugates and uses therefor |
US20090298096A1 (en) | 2008-05-30 | 2009-12-03 | Xbiotech, Inc. | Interleukin-1 alpha ABS and methods of use |
US20100068212A1 (en) | 2008-09-12 | 2010-03-18 | Xbiotech, Inc. | Targeting pathogenic monocytes |
Family Cites Families (43)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4510245A (en) | 1982-11-18 | 1985-04-09 | Chiron Corporation | Adenovirus promoter system |
US4968615A (en) | 1985-12-18 | 1990-11-06 | Ciba-Geigy Corporation | Deoxyribonucleic acid segment from a virus |
DK590387A (en) | 1986-11-13 | 1988-05-14 | Otsuka Pharma Co Ltd | ANTIBODIES AGAINST INTERLEUKIN-1 |
US5750172A (en) | 1987-06-23 | 1998-05-12 | Pharming B.V. | Transgenic non human mammal milk |
US4968607A (en) | 1987-11-25 | 1990-11-06 | Immunex Corporation | Interleukin-1 receptors |
US20040101528A1 (en) * | 1988-02-25 | 2004-05-27 | Dower Steven K. | Type I IL-1 receptors |
US5407431A (en) | 1989-07-11 | 1995-04-18 | Med-Design Inc. | Intravenous catheter insertion device with retractable needle |
US5959177A (en) | 1989-10-27 | 1999-09-28 | The Scripps Research Institute | Transgenic plants expressing assembled secretory antibodies |
US5633076A (en) | 1989-12-01 | 1997-05-27 | Pharming Bv | Method of producing a transgenic bovine or transgenic bovine embryo |
JP3801196B2 (en) | 1993-03-09 | 2006-07-26 | ジェンザイム・コーポレイション | Isolation of the target compound from milk |
EP0659766A1 (en) | 1993-11-23 | 1995-06-28 | Schering-Plough | Human monoclonal antibodies against human cytokines and methods of making and using such antibodies |
US5827690A (en) | 1993-12-20 | 1998-10-27 | Genzyme Transgenics Corporatiion | Transgenic production of antibodies in milk |
US6046037A (en) | 1994-12-30 | 2000-04-04 | Hiatt; Andrew C. | Method for producing immunoglobulins containing protection proteins in plants and their use |
AU3395900A (en) * | 1999-03-12 | 2000-10-04 | Human Genome Sciences, Inc. | Human lung cancer associated gene sequences and polypeptides |
CA2796140A1 (en) * | 1999-03-25 | 2000-09-28 | Jochen Salfeld | Human antibodies that bind human il-12 and methods for producing |
ATE316982T1 (en) * | 1999-08-09 | 2006-02-15 | Lexigen Pharm Corp | MULTIPLE CYTOKINE ANTIBODIES COMPLEXES |
DE19943790C2 (en) | 1999-09-13 | 2001-11-15 | Ericsson Telefon Ab L M | Method and device for determining a synchronization error in a network node |
US6399857B1 (en) * | 1999-09-22 | 2002-06-04 | Paradigm Genetics, Inc. | Modified nucleotide sequence encoding a LexA DNA binding domain optimized for arabidopsis species |
US6380129B1 (en) | 1999-11-02 | 2002-04-30 | Richard J. Kraemer | Enhanced materials for treatment of contamination |
US20020131954A1 (en) | 2000-05-02 | 2002-09-19 | Tobinick Edward L. | Interleukin antagonists for the treatment of neurological, retinal and muscular disorders |
AU2007202323C1 (en) | 2000-06-29 | 2012-04-12 | Abbvie Inc. | Dual specificity antibodies and methods of making and using |
CA2426384A1 (en) | 2000-10-19 | 2003-04-17 | Kyowa Hakko Kogyo Co., Ltd. | Antibody inhibiting vplf activity |
US7595378B2 (en) * | 2001-06-13 | 2009-09-29 | Genmab A/S | Human monoclonal antibodies to epidermal growth factor receptor (EGFR) |
AR036833A1 (en) * | 2001-10-18 | 2004-10-06 | Bayer Corp | HUMAN ANTIBODIES THAT JOIN MN AND HAVE NEUTRALIZING ACTIVITY OF CELLULAR ADHESION. |
US7211602B2 (en) | 2001-11-16 | 2007-05-01 | Als Therapy Development Foundation, Inc. | Treatment of neurodegenerative disorders through the modulation of the polyamine pathway |
CN101914158A (en) * | 2002-02-14 | 2010-12-15 | 免疫医疗公司 | Anti-cd20 antibodies and fusion proteins thereof and methods of use |
JP4450644B2 (en) | 2003-03-03 | 2010-04-14 | 日本化薬株式会社 | Pharmaceutical preparations containing AMFs as active ingredients |
US20070025961A1 (en) * | 2003-06-03 | 2007-02-01 | Kenzo Bamba | Composition for stabilizing survival of transplanted hematopoietic stem cell, kit for obtaining the composition, method of stabilizing survival of transplanted hematopoietic stem cell, human monoclonal antibody or human polyclonal antibody and method of producing the same, gene encoding human monoclonal antibody and transf |
KR100493102B1 (en) | 2003-06-30 | 2005-06-02 | 삼성전자주식회사 | Hinge device for portable terminal with sub housing stopper |
US8957056B2 (en) | 2004-05-25 | 2015-02-17 | Sloan-Kettering Instiute For Cancer Research | Migrastatin analogs in the treatment of cancer |
US20050276807A1 (en) | 2004-06-15 | 2005-12-15 | Advanced Biotherapy, Inc. | Treatment of acne |
WO2006036936A2 (en) | 2004-09-27 | 2006-04-06 | Bridge Pharma, Inc. | The s-isomer of 2-{2-[n-(2-indanyl)-n-phenylamino]ethyl}piperidine and other dermal anesthetic agents |
BRPI0515745A (en) | 2004-12-09 | 2008-08-05 | Centocor Inc | antiintegrin immunoconjugates, methods and uses |
US20090215992A1 (en) | 2005-08-19 | 2009-08-27 | Chengbin Wu | Dual variable domain immunoglobulin and uses thereof |
AU2007217563A1 (en) * | 2006-02-22 | 2007-08-30 | University Of Zurich | Methods for treating autoimmune or demyelinating diseases |
US20100047204A1 (en) | 2006-04-14 | 2010-02-25 | Dana Sue Yoo | Use of organic compounds |
KR101317235B1 (en) * | 2006-04-21 | 2013-10-15 | 조마 테크놀로지 리미티드 | Antagonist anti-cd40 antibody pharmaceutical compositions |
CA2664738C (en) * | 2006-09-29 | 2017-03-07 | Oncomed Pharmaceuticals, Inc. | Compositions and methods for diagnosing and treating cancer |
US8324350B2 (en) | 2006-12-29 | 2012-12-04 | Abbott Laboratories | Dual-specific IL-1α/IL-1β antibodies |
CN102056485A (en) | 2008-04-15 | 2011-05-11 | 萨可德公司 | Topical LFA-1 antagonists for use in localized treatment of immune related disorders |
SG172855A1 (en) | 2009-01-29 | 2011-08-29 | Abbott Lab | Il-1 binding proteins |
CA2775402A1 (en) | 2009-10-15 | 2011-04-21 | Abbott Laboratories | Il-1 binding proteins |
US9724409B2 (en) | 2011-04-01 | 2017-08-08 | Xbiotech, Inc. | Treatment of inflammatory skin disease |
-
2009
- 2009-06-01 EP EP20156323.6A patent/EP3705135A1/en active Pending
- 2009-06-01 CN CN201310556893.3A patent/CN103656638B/en active Active
- 2009-06-01 RU RU2010148904/10A patent/RU2498998C2/en active
- 2009-06-01 CN CN2009801250336A patent/CN102112154B/en active Active
- 2009-06-01 MY MYPI2010005659A patent/MY154067A/en unknown
- 2009-06-01 US US12/455,458 patent/US8034337B2/en active Active
- 2009-06-01 KR KR1020107029639A patent/KR101567117B1/en active IP Right Grant
- 2009-06-01 MX MX2010012963A patent/MX2010012963A/en active IP Right Grant
- 2009-06-01 CN CN201610022556.XA patent/CN105467136B/en active Active
- 2009-06-01 CA CA2726345A patent/CA2726345C/en active Active
- 2009-06-01 AU AU2009255670A patent/AU2009255670B2/en active Active
- 2009-06-01 WO PCT/US2009/003355 patent/WO2009148575A1/en active Application Filing
- 2009-06-01 PL PL16164746T patent/PL3085773T3/en unknown
- 2009-06-01 SI SI200931460A patent/SI2285409T1/en unknown
- 2009-06-01 DK DK09758739.8T patent/DK2285409T3/en active
- 2009-06-01 PL PL09758739.8T patent/PL2285409T3/en unknown
- 2009-06-01 CN CN201810142794.3A patent/CN108578692B/en active Active
- 2009-06-01 JP JP2011511656A patent/JP5670318B2/en not_active Expired - Fee Related
- 2009-06-01 PT PT97587398T patent/PT2285409T/en unknown
- 2009-06-01 ES ES16164746T patent/ES2797126T3/en active Active
- 2009-06-01 EP EP16164746.6A patent/EP3085773B1/en active Active
- 2009-06-01 HU HUE09758739A patent/HUE029003T2/en unknown
- 2009-06-01 KR KR1020167037032A patent/KR20170005166A/en not_active Application Discontinuation
- 2009-06-01 CA CA3011485A patent/CA3011485A1/en not_active Abandoned
- 2009-06-01 KR KR1020157031363A patent/KR20150127300A/en not_active Application Discontinuation
- 2009-06-01 EP EP09758739.8A patent/EP2285409B1/en active Active
- 2009-06-01 BR BRPI0909610-8A patent/BRPI0909610B1/en active IP Right Grant
- 2009-06-01 NZ NZ590033A patent/NZ590033A/en unknown
- 2009-06-01 ES ES09758739.8T patent/ES2576681T3/en active Active
-
2010
- 2010-11-25 IL IL209576A patent/IL209576A/en active IP Right Grant
- 2010-12-22 ZA ZA2010/09224A patent/ZA201009224B/en unknown
- 2010-12-23 CO CO10161740A patent/CO6351749A2/en not_active Application Discontinuation
-
2011
- 2011-09-02 US US13/224,943 patent/US8388956B2/en active Active
- 2011-09-02 US US13/225,004 patent/US20120164665A1/en not_active Abandoned
- 2011-09-02 US US13/224,975 patent/US20120021512A1/en not_active Abandoned
- 2011-09-02 US US13/224,913 patent/US8388969B2/en active Active
- 2011-09-02 US US13/225,029 patent/US8962814B2/en active Active
- 2011-12-27 HK HK11113940.1A patent/HK1159481A1/xx unknown
- 2011-12-27 HK HK14105137.7A patent/HK1191865A1/en unknown
-
2013
- 2013-02-08 US US13/762,453 patent/US8679489B2/en active Active
- 2013-02-14 US US13/767,292 patent/US8784817B2/en active Active
- 2013-02-17 IL IL224752A patent/IL224752A/en active IP Right Grant
- 2013-08-19 RU RU2013138469A patent/RU2666915C2/en active
-
2014
- 2014-02-11 US US14/177,892 patent/US8956831B2/en active Active
- 2014-08-06 PH PH12014501773A patent/PH12014501773A1/en unknown
- 2014-10-02 IL IL234954A patent/IL234954B/en active IP Right Grant
- 2014-12-11 US US14/567,072 patent/US9181338B2/en active Active
- 2014-12-17 JP JP2014254716A patent/JP6133264B2/en active Active
-
2015
- 2015-10-08 US US14/877,964 patent/US9840558B2/en active Active
-
2017
- 2017-04-19 JP JP2017082461A patent/JP2017165743A/en active Pending
- 2017-10-20 US US15/789,774 patent/US10899833B2/en active Active
-
2019
- 2019-04-10 JP JP2019074562A patent/JP2019135250A/en active Pending
- 2019-08-19 IL IL268776A patent/IL268776B/en active IP Right Grant
-
2020
- 2020-05-22 JP JP2020089866A patent/JP6913209B2/en active Active
- 2020-07-06 IL IL275881A patent/IL275881B/en unknown
-
2021
- 2021-01-21 US US17/154,137 patent/US20210171623A1/en not_active Abandoned
-
2023
- 2023-10-09 US US18/483,270 patent/US20240034781A1/en active Pending
Patent Citations (35)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4634664A (en) | 1982-01-22 | 1987-01-06 | Sandoz Ltd. | Process for the production of human mono-clonal antibodies |
US5795967A (en) | 1984-07-05 | 1998-08-18 | Genentech, Inc. | Tumor necrosis factor antagonists and their use |
US5168062A (en) | 1985-01-30 | 1992-12-01 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence |
US4965198A (en) | 1985-12-24 | 1990-10-23 | Konica Corporation | Monoclonal antibody and method of manufacturing hybridoma producing the same |
US5231024A (en) | 1986-09-13 | 1993-07-27 | Basf Aktiengesellschaft | Monoclonal antibodies against human tumor necrosis factor (tnf), and use thereof |
US5034316A (en) | 1987-03-30 | 1991-07-23 | The Regents Of The University Of California | In vitro human monoclonal IgG rheumatoid factor autoantibody |
WO1990006371A1 (en) | 1988-12-08 | 1990-06-14 | Commissariat A L'energie Atomique | ANTI-INTERLEUKINE 1α AND 1β MONOCLONAL ANTIBODIES, METHOD FOR PRODUCING THE SAME AND APPLICATIONS OF SAID ANTIBODIES TO THE DETECTION OF INTERLEUKINES 1α AND 1β AND TO THERAPY |
US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US5792838A (en) | 1991-10-28 | 1998-08-11 | Glaxo Wellcome Inc. | Method for stabilizing immunoglobulin compositions |
US5932188A (en) | 1992-10-14 | 1999-08-03 | Sterling Winthrop Inc. | Therapeutic and diagnostic imaging compositions and methods |
US5654407A (en) | 1993-03-05 | 1997-08-05 | Bayer Corporation | Human anti-TNF antibodies |
US5959085A (en) | 1993-11-23 | 1999-09-28 | Schering Corporation | Human monoclonal antibodies against human cytokines and methods of making and using such antibodies |
WO1996035719A1 (en) | 1995-05-12 | 1996-11-14 | The National Blood Authority | Transeptithelial transport of molecular species |
US6140470A (en) | 1995-06-30 | 2000-10-31 | Yale University | Human monoclonal anti-tumor antibodies |
US6090382A (en) | 1996-02-09 | 2000-07-18 | Basf Aktiengesellschaft | Human antibodies that bind human TNFα |
US20040185514A1 (en) | 1998-07-03 | 2004-09-23 | Athera Biotechnologies Ab | Method of diagnosing cadiovascular disease |
US20030040617A9 (en) | 1999-03-12 | 2003-02-27 | Rosen Craig A. | Nucleic acids, proteins and antibodies |
US20030232054A1 (en) | 2000-01-25 | 2003-12-18 | Tang Y. Tom | Novel nucleic acids and polypeptides |
US20030026806A1 (en) | 2000-10-27 | 2003-02-06 | Amgen Inc. | Antibodies and other selective IL-1 binding agents that allow binding to IL-1 receptor but not activation thereof |
WO2004100987A2 (en) | 2003-05-06 | 2004-11-25 | Regeneron Pharmaceuticals, Inc. | Methods of using il-1 antagonists to treat neointimal hyperplasia |
US20050054019A1 (en) | 2003-08-04 | 2005-03-10 | Michaud Neil R. | Antibodies to c-Met |
US20050147603A1 (en) | 2003-12-24 | 2005-07-07 | Smith Henry J. | Autoantibodies utilized as carrier agents for pharmaceutical compounds used in tumor imaging and cancer treatment |
US20060159775A1 (en) | 2004-02-03 | 2006-07-20 | Mcgrath Michael S | Chlorite in the treatment of neurodegenerative disease |
US20090123415A1 (en) | 2005-08-02 | 2009-05-14 | Xbiotech, Inc. | Diagnosis, treatment, and prevention of vascular disorders using il-1 autoantibodies |
WO2007015128A1 (en) | 2005-08-02 | 2007-02-08 | Xbiotech Inc. | DIAGNOSIS, TREATMENT, AND PREVENTION OF VASCULAR DISORDERS USING IL-1α AUTOANTIBODIES |
US20070071675A1 (en) | 2005-08-19 | 2007-03-29 | Chengbin Wu | Dual variable domain immunoglobulin and uses thereof |
WO2007039552A1 (en) | 2005-09-28 | 2007-04-12 | Cytos Biotechnology Ag | Interleukin-1 conjugates and uses thereof |
WO2007132338A2 (en) | 2006-05-15 | 2007-11-22 | Xbiotech Inc. | IL-1α IMMUNIZATION INDUCES AUTOANTIBODIES PROTECTIVE AGAINST ATHEROSCLEROSIS |
WO2007135546A2 (en) | 2006-05-22 | 2007-11-29 | Xbiotech Inc. | TREATMENT OF CANCER WITH ANTI-IL-1α ANTIBODIES |
US20100040574A1 (en) | 2006-05-22 | 2010-02-18 | Xbiotech Inc. | TREATMENT OF CANCER WITH ANTI-IL-1alpha ANTIBODIES |
US20080050310A1 (en) | 2006-05-30 | 2008-02-28 | Genentech, Inc. | Antibodies and immunoconjugates and uses therefor |
US20090298096A1 (en) | 2008-05-30 | 2009-12-03 | Xbiotech, Inc. | Interleukin-1 alpha ABS and methods of use |
US20100068212A1 (en) | 2008-09-12 | 2010-03-18 | Xbiotech, Inc. | Targeting pathogenic monocytes |
WO2010030979A2 (en) | 2008-09-12 | 2010-03-18 | Xbiotech, Inc. | Targeting pathogenic monocytes |
Non-Patent Citations (50)
Title |
---|
Apte, Ron N., et al., Effects of micro-environment- and malignant cell-derived interleukin-1 in carcinogenesis, tumour invasiveness and tumour-host interactions, European Journal of Cancer, 2006, vol. 42:751-759. |
Bendtzen, Klaus et al., Detection of Autoantibodies to Cytokines, Molecular Biotechnology, 2000, vol. 14. |
Bendtzen, Klaus et al., High-Avidity Autoantibodies to Cytokines, Trends Immunology Today, May 1998, vol. 19, No. 5 209. |
Braddock, M. et al., Therapeutic potential of targeting IL-1 and IL-18 in inflammation, Expert Opin. Biol. Ther., 2004, vol. 4, No. 6:8476-860. |
Clinton Steven K. et al., Interleukin-1 gene expression in rabbit vascular tissue in vivo, American Journal of Pathology, Apr. 1991, vol. 138, No. 4:1005-1014. |
Dardik, Alan et al., Shear stress-stimulated endothelial cells induce smooth muscle cell chemotaxis via platelet-derived growth factor-BB and interleukin-1alpha, Journal of Vascular Surgergy, Feb. 2005, vol. 41:321-331. |
Dinarello, Charles A. et al., Anticytokine strategies in the treatment of the systemic inflammatory response syndrome, The Journal of the American Medical Association, Apr. 1993, vol. 269, No. 14:1829-1835. |
Dinarello, Charles A., Biologic basis for interleukin-1 in disease, BLOOD, Mar. 1996, vol. 87, No. 6:2095-2147. |
Dinarello, Charles A., Modalities for reducing interleukin 1 activity in disease, TiPS, May 1993, vol. 14:155-159. |
Dinarello, Charles A., The role of interleukin-1 in disease, The New England Journal of Medicine, 1993, vol. 328, No. 2:106-113. |
Dinarello, Charles A., Therapeutic strategies to reduce IL-1 activity in treating local and system inflammation, Current Opinion in Pharmacology, 2004, vol. 4:378-385. |
Eugui et al. Proc. Natl. Acad. Sc. USA., 1990, vol. 87, pp. 1305-1309. * |
Garrone, P. et al., Generation and characterization of a human monoclonal autoantibody that acts as a high affinity interleukin-1 alpha specific inhibitor, Molecular Immunology, 1996, vol. 33. No. 78:649-658. |
GenBank entry AY510107.1, Homosapiens 9F11 monoclonal IgM antibody light chain mRNA, complete cds, 2005 (retrieved from the Internet on Apr. 23, 2010, . |
GenBank entry AY510107.1, Homosapiens 9F11 monoclonal IgM antibody light chain mRNA, complete cds, 2005 (retrieved from the Internet on Apr. 23, 2010, <http://www.ncbi.nlm.nih.gov/nuccore/41388185>. |
Griffiths, Andrew D. et al., Human anti-self antibodies with high specificity from phage display libraries, the EMBO Journal, 1993, vol. 12, No. 2:725-734. |
Hansen, M. B. et al., Sex- and age-dependency of IgG auto-antibodies against IL-1alpha in healthy humans, European Journal of Clinical Investigation, 1994, vol. 24:212:218. |
Horai, R. et al., Production of mice deficient in genes for interleukin (IL)-1alpha, IL-1beta, IL-1alpha/beta, and IL-1 receptor antagonist shows that IL-1beta is crucial in turpentine-induced fever development and glucocorticoid secretion, J. Exp. Med, 1998, vol. 187, No. 9:1463-1475. |
Immunobiology, Janeway et al., The immune system in health and disease, 3rd edition, 1997, section 3.4 and figure 3.4. * |
Ito, R. et al., Interleukin 1alpha acts as an autocrine growth stimulator for human gastric carcinoma cells, Cancer Research, Sep. 1993, vol. 53:4102-4106. |
Jouvenne, P. et al., High levels of neutralizing autoantibodies against IL-1alpha are associated with a better prognosis in chronic polyarthritis: a follow-up study, Scand. J. Immunol., 1997, vol. 46:413-418. |
Kanai, T. et al., Extracorporeal elimination of TNF-alpha-producing CD14 dull CD16+ monocytes in leukocytapheresis therapy for ulcerative colitis, Inflamm Bowel Dis, Mar. 2007, vol. 13, No. 3:284-290. |
Kasahara, T. et al., Preparation and characterization of polyclonal and monoclonal antibodies against human interleukin 1 alpha (IL 1alpha), The Journal of Immunology, Mar. 1987, vol. 138, No. 6:1804-1812. |
Larrick, James W. et al., Prospects for the therapeutic use of human monoclonal antibodies, Journal of Biological Response Modifiers, 1986, vol. 5:379-393. |
Lindqvist, E. et al., Prognostic laboratory markers of joint damage in rheumatoid arthritis, Ann Rheum Dis, 2005, vol. 64:196-201. |
Mariotti, Massimo et al., Interleukin 1 alpha is a marker of endothelial cellular senescent, Immunity & Ageing, Apr. 2006:1-6. |
McHale, Julie F. et al., TNF-alpha and IL- sequentially induce endothelial ICAM-1 and VCAM-1 expression in MRL/Ipr lupus-prone mice, The American Association of Immunologists, 1999, vol. 163:3993-4000. |
Merhi-Soussi, F. et al., Interleukin-1 plays a major role in vascular inflammation and atherosclerosis in male apoliprotein E-knockout mice, Cardiovacular Research, 2006, vol. 66:583-593. |
Miossec, R, Anti-interleukin 1alpha autoantibodies, Ann Rheum Dis, 2002, vol. 61:577-579. |
Niki, Yasuo et al., Membrane-associated IL-1 contributes to Chronic Synovitis and cartilage destruction in human IL-1alpha transgenic mice, The Journal of Immunology, 2004:577-584. |
Ogushi, F. et al., Autoantibodies to IL-1alpha in sera from rapidly progressive idiopathic pulmonary fibrosis, The Journal of Medical Investigation, 2001, vol. 48:181-189. |
Ross, C. et al., Increased in vivo antibody activity against interferon alpha, interleuking-1alpha, and interleukin-6 after high-dose Ig therapy, Blood, Sep. 1997, vol. 90, No. 6:2376-2380. |
Ross, Christian, et al., High avidity IFN-neutralizing antibodies in pharmaceutically prepared human IgG, J. Clin. Invest., May 1995, vol. 95:1974-1978. |
Sandborg, Christy L. et al., Modulation of IL-1alpha, IL-1 beta, and 25K Mr Non-IL-1 activity released by human mononuclear cells, Journal of Leukocyte Biology, 1989, vol. 46:417-427. |
Satoh, H. et al., Characterization of anti-IL-1alpha autoantibodies in the sera from healthy humans, Immunopharmacology, 1994, vol. 27:107-118. |
Saurat, Jean-Hilaire, et al., Anti-interleukin-1alpoha autoantibodies in humans: Characterization, isotype distribution, and receptor-binding inhibition-Higher frequency in Schnitzler's syndrome (urticaria and macroglobulinemia), J. Allergy Clin. Immunol., Aug. 1991, vol. 88, No. 2:243-256. |
Saurat, Jean-Hilaire, et al., Anti-interleukin-1alpoha autoantibodies in humans: Characterization, isotype distribution, and receptor-binding inhibition—Higher frequency in Schnitzler's syndrome (urticaria and macroglobulinemia), J. Allergy Clin. Immunol., Aug. 1991, vol. 88, No. 2:243-256. |
Shirakawa, F. et al., Autocrine stimulation of interleukin 1alpha in the growth of adult human T-cell leukemia cells, Cancer Rsearch, Mar. 1089, vol. 49:1143-1147. |
Sunahara, N. et al., Differential determination of recombinant hum interleukin-1 alpha and its deamidated derivative by two sandwhich enzyme immunoassays using monoclonal antibodies. Comparison with a polyclonal antibody-based competitive enzyme immunoassay., J Immunol Methods, 1989, vol. 119:75-82 (Abstract only). |
Suzuki, Hiroshi et al., Demonstration of Neutralizing Autoantibodies against II-1alpha IN sera from patients with rheumatoid arthritis, The Journal of Immunology, Oct. 1, 1990, vol. 145, No. 7:2140-2146. |
Svenson, M. et al., Antibody to granulocyte-macrophage colony-stimulating factor is a dominant anti-cytokine activity in human IgG preparations, Blood, Mar. 1998, vol. 91, No. 6:2054-2061. |
Svenson, M. et al., Binding of Cytokines to Pharmaceutically Prepared Human Immunoglobulin, J. Clin. Invest., Nov. 1993, vol. 92:2533-2539. |
Svenson, M. et al., Cytokine vaccination: neutralising IL-1alpha autoantibodies induced by immunisation with homologous IL-1alpha, Journal of immunological methods, 2000:1-8. |
Svenson, M. et al., Distribution and characterization of autoantibodies to interleukin 1 alpha in normal human sera, Scand. J. Immunol., 1990, vol. 32:695-701. |
Svenson, M. et al., Effects of human anti-IL-1alpha autoantibodies on receptor binding and biological activities of IL-1 alpha, CYTOKINE, Mar. 1992, vol. 4, No. 2:125-133. |
Svenson, M. et al., IgG Autoantibodies against Interleuking 1alpha in sera of normal individuals, Scand. J. Immunol., 1989, vol. 29:489-492. |
Von Der Thusen, Jan H., et al., Interleukins in atherosclerosis: Molecular pathways and therapeutic potential, Pharmacol Rev, 2003, vol. 55, No. 1:133-166. |
Waehre et al., Increased expression of interleukin-1 in coronary artery disease with downregulatory effects of HMG-CoA reductase inhibitors, <<circ.ahajournals.org>>, downloaded on Jan. 15, 2008:1966-1972. |
Waehre et al., Increased expression of interleukin-1 in coronary artery disease with downregulatory effects of HMG-CoA reductase inhibitors, >, downloaded on Jan. 15, 2008:1966-1972. |
Wake, R. et al., Gender differences in ischemic heart disease, Recent Patents on Cardiovascular Drug Discovery, 2009, vol. 4:234-240. |
Cited By (956)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11684365B2 (en) | 2004-07-28 | 2023-06-27 | Cilag Gmbh International | Replaceable staple cartridges for surgical instruments |
US12029423B2 (en) | 2004-07-28 | 2024-07-09 | Cilag Gmbh International | Surgical stapling instrument comprising a staple cartridge |
US12011165B2 (en) | 2004-07-28 | 2024-06-18 | Cilag Gmbh International | Surgical stapling instrument comprising replaceable staple cartridge |
US11998198B2 (en) | 2004-07-28 | 2024-06-04 | Cilag Gmbh International | Surgical stapling instrument incorporating a two-piece E-beam firing mechanism |
US10278702B2 (en) | 2004-07-28 | 2019-05-07 | Ethicon Llc | Stapling system comprising a firing bar and a lockout |
US11963679B2 (en) | 2004-07-28 | 2024-04-23 | Cilag Gmbh International | Articulating surgical stapling instrument incorporating a two-piece E-beam firing mechanism |
US10485547B2 (en) | 2004-07-28 | 2019-11-26 | Ethicon Llc | Surgical staple cartridges |
US11896225B2 (en) | 2004-07-28 | 2024-02-13 | Cilag Gmbh International | Staple cartridge comprising a pan |
US10568629B2 (en) | 2004-07-28 | 2020-02-25 | Ethicon Llc | Articulating surgical stapling instrument |
US10383634B2 (en) | 2004-07-28 | 2019-08-20 | Ethicon Llc | Stapling system incorporating a firing lockout |
US11890012B2 (en) | 2004-07-28 | 2024-02-06 | Cilag Gmbh International | Staple cartridge comprising cartridge body and attached support |
US10687817B2 (en) | 2004-07-28 | 2020-06-23 | Ethicon Llc | Stapling device comprising a firing member lockout |
US10716563B2 (en) | 2004-07-28 | 2020-07-21 | Ethicon Llc | Stapling system comprising an instrument assembly including a lockout |
US11882987B2 (en) | 2004-07-28 | 2024-01-30 | Cilag Gmbh International | Articulating surgical stapling instrument incorporating a two-piece E-beam firing mechanism |
US11135352B2 (en) | 2004-07-28 | 2021-10-05 | Cilag Gmbh International | End effector including a gradually releasable medical adjunct |
US10292707B2 (en) | 2004-07-28 | 2019-05-21 | Ethicon Llc | Articulating surgical stapling instrument incorporating a firing mechanism |
US11812960B2 (en) | 2004-07-28 | 2023-11-14 | Cilag Gmbh International | Method of segmenting the operation of a surgical stapling instrument |
US10799240B2 (en) | 2004-07-28 | 2020-10-13 | Ethicon Llc | Surgical instrument comprising a staple firing lockout |
US10293100B2 (en) | 2004-07-28 | 2019-05-21 | Ethicon Llc | Surgical stapling instrument having a medical substance dispenser |
US11116502B2 (en) | 2004-07-28 | 2021-09-14 | Cilag Gmbh International | Surgical stapling instrument incorporating a two-piece firing mechanism |
US11083456B2 (en) | 2004-07-28 | 2021-08-10 | Cilag Gmbh International | Articulating surgical instrument incorporating a two-piece firing mechanism |
US10314590B2 (en) | 2004-07-28 | 2019-06-11 | Ethicon Llc | Articulating surgical stapling instrument incorporating a two-piece e-beam firing mechanism |
US10869664B2 (en) | 2005-08-31 | 2020-12-22 | Ethicon Llc | End effector for use with a surgical stapling instrument |
US11399828B2 (en) | 2005-08-31 | 2022-08-02 | Cilag Gmbh International | Fastener cartridge assembly comprising a fixed anvil and different staple heights |
US10842489B2 (en) | 2005-08-31 | 2020-11-24 | Ethicon Llc | Fastener cartridge assembly comprising a cam and driver arrangement |
US11771425B2 (en) | 2005-08-31 | 2023-10-03 | Cilag Gmbh International | Stapling assembly for forming staples to different formed heights |
US11172927B2 (en) | 2005-08-31 | 2021-11-16 | Cilag Gmbh International | Staple cartridges for forming staples having differing formed staple heights |
US10932774B2 (en) | 2005-08-31 | 2021-03-02 | Ethicon Llc | Surgical end effector for forming staples to different heights |
US10420553B2 (en) | 2005-08-31 | 2019-09-24 | Ethicon Llc | Staple cartridge comprising a staple driver arrangement |
US10271845B2 (en) | 2005-08-31 | 2019-04-30 | Ethicon Llc | Fastener cartridge assembly comprising a cam and driver arrangement |
US10321909B2 (en) | 2005-08-31 | 2019-06-18 | Ethicon Llc | Staple cartridge comprising a staple including deformable members |
US11179153B2 (en) | 2005-08-31 | 2021-11-23 | Cilag Gmbh International | Staple cartridges for forming staples having differing formed staple heights |
US11576673B2 (en) | 2005-08-31 | 2023-02-14 | Cilag Gmbh International | Stapling assembly for forming staples to different heights |
US11793512B2 (en) | 2005-08-31 | 2023-10-24 | Cilag Gmbh International | Staple cartridges for forming staples having differing formed staple heights |
US11484312B2 (en) | 2005-08-31 | 2022-11-01 | Cilag Gmbh International | Staple cartridge comprising a staple driver arrangement |
US10245035B2 (en) | 2005-08-31 | 2019-04-02 | Ethicon Llc | Stapling assembly configured to produce different formed staple heights |
US11484311B2 (en) | 2005-08-31 | 2022-11-01 | Cilag Gmbh International | Staple cartridge comprising a staple driver arrangement |
US11730474B2 (en) | 2005-08-31 | 2023-08-22 | Cilag Gmbh International | Fastener cartridge assembly comprising a movable cartridge and a staple driver arrangement |
US10245032B2 (en) | 2005-08-31 | 2019-04-02 | Ethicon Llc | Staple cartridges for forming staples having differing formed staple heights |
US11090045B2 (en) | 2005-08-31 | 2021-08-17 | Cilag Gmbh International | Staple cartridges for forming staples having differing formed staple heights |
US10842488B2 (en) | 2005-08-31 | 2020-11-24 | Ethicon Llc | Fastener cartridge assembly comprising a fixed anvil and different staple heights |
US10271846B2 (en) | 2005-08-31 | 2019-04-30 | Ethicon Llc | Staple cartridge for use with a surgical stapler |
US11839375B2 (en) | 2005-08-31 | 2023-12-12 | Cilag Gmbh International | Fastener cartridge assembly comprising an anvil and different staple heights |
US11272928B2 (en) | 2005-08-31 | 2022-03-15 | Cilag GmbH Intemational | Staple cartridges for forming staples having differing formed staple heights |
US10729436B2 (en) | 2005-08-31 | 2020-08-04 | Ethicon Llc | Robotically-controlled surgical stapling devices that produce formed staples having different lengths |
US11246590B2 (en) | 2005-08-31 | 2022-02-15 | Cilag Gmbh International | Staple cartridge including staple drivers having different unfired heights |
US11134947B2 (en) | 2005-08-31 | 2021-10-05 | Cilag Gmbh International | Fastener cartridge assembly comprising a camming sled with variable cam arrangements |
US10463369B2 (en) | 2005-08-31 | 2019-11-05 | Ethicon Llc | Disposable end effector for use with a surgical instrument |
US10278697B2 (en) | 2005-08-31 | 2019-05-07 | Ethicon Llc | Staple cartridge comprising a staple driver arrangement |
US10806449B2 (en) | 2005-11-09 | 2020-10-20 | Ethicon Llc | End effectors for surgical staplers |
US11793511B2 (en) | 2005-11-09 | 2023-10-24 | Cilag Gmbh International | Surgical instruments |
US10993713B2 (en) | 2005-11-09 | 2021-05-04 | Ethicon Llc | Surgical instruments |
US11648024B2 (en) | 2006-01-31 | 2023-05-16 | Cilag Gmbh International | Motor-driven surgical cutting and fastening instrument with position feedback |
US11890008B2 (en) | 2006-01-31 | 2024-02-06 | Cilag Gmbh International | Surgical instrument with firing lockout |
US10278722B2 (en) | 2006-01-31 | 2019-05-07 | Ethicon Llc | Motor-driven surgical cutting and fastening instrument |
US11224454B2 (en) | 2006-01-31 | 2022-01-18 | Cilag Gmbh International | Motor-driven surgical cutting and fastening instrument with tactile position feedback |
US11166717B2 (en) | 2006-01-31 | 2021-11-09 | Cilag Gmbh International | Surgical instrument with firing lockout |
US11246616B2 (en) | 2006-01-31 | 2022-02-15 | Cilag Gmbh International | Motor-driven surgical cutting and fastening instrument with tactile position feedback |
US10426463B2 (en) | 2006-01-31 | 2019-10-01 | Ehticon LLC | Surgical instrument having a feedback system |
US11278279B2 (en) | 2006-01-31 | 2022-03-22 | Cilag Gmbh International | Surgical instrument assembly |
US11350916B2 (en) | 2006-01-31 | 2022-06-07 | Cilag Gmbh International | Endoscopic surgical instrument with a handle that can articulate with respect to the shaft |
US10299817B2 (en) | 2006-01-31 | 2019-05-28 | Ethicon Llc | Motor-driven fastening assembly |
US11364046B2 (en) | 2006-01-31 | 2022-06-21 | Cilag Gmbh International | Motor-driven surgical cutting and fastening instrument with tactile position feedback |
US11103269B2 (en) | 2006-01-31 | 2021-08-31 | Cilag Gmbh International | Motor-driven surgical cutting and fastening instrument with tactile position feedback |
US10463384B2 (en) | 2006-01-31 | 2019-11-05 | Ethicon Llc | Stapling assembly |
US10463383B2 (en) | 2006-01-31 | 2019-11-05 | Ethicon Llc | Stapling instrument including a sensing system |
US11058420B2 (en) | 2006-01-31 | 2021-07-13 | Cilag Gmbh International | Surgical stapling apparatus comprising a lockout system |
US11051813B2 (en) | 2006-01-31 | 2021-07-06 | Cilag Gmbh International | Powered surgical instruments with firing system lockout arrangements |
US11612393B2 (en) | 2006-01-31 | 2023-03-28 | Cilag Gmbh International | Robotically-controlled end effector |
US10485539B2 (en) | 2006-01-31 | 2019-11-26 | Ethicon Llc | Surgical instrument with firing lockout |
US11944299B2 (en) | 2006-01-31 | 2024-04-02 | Cilag Gmbh International | Surgical instrument having force feedback capabilities |
US11051811B2 (en) | 2006-01-31 | 2021-07-06 | Ethicon Llc | End effector for use with a surgical instrument |
US11020113B2 (en) | 2006-01-31 | 2021-06-01 | Cilag Gmbh International | Surgical instrument having force feedback capabilities |
US11000275B2 (en) | 2006-01-31 | 2021-05-11 | Ethicon Llc | Surgical instrument |
US10993717B2 (en) | 2006-01-31 | 2021-05-04 | Ethicon Llc | Surgical stapling system comprising a control system |
US11648008B2 (en) | 2006-01-31 | 2023-05-16 | Cilag Gmbh International | Surgical instrument having force feedback capabilities |
US10959722B2 (en) | 2006-01-31 | 2021-03-30 | Ethicon Llc | Surgical instrument for deploying fasteners by way of rotational motion |
US10952728B2 (en) | 2006-01-31 | 2021-03-23 | Ethicon Llc | Powered surgical instruments with firing system lockout arrangements |
US11660110B2 (en) | 2006-01-31 | 2023-05-30 | Cilag Gmbh International | Motor-driven surgical cutting and fastening instrument with tactile position feedback |
US10918380B2 (en) | 2006-01-31 | 2021-02-16 | Ethicon Llc | Surgical instrument system including a control system |
US10893853B2 (en) | 2006-01-31 | 2021-01-19 | Ethicon Llc | Stapling assembly including motor drive systems |
US11890029B2 (en) | 2006-01-31 | 2024-02-06 | Cilag Gmbh International | Motor-driven surgical cutting and fastening instrument |
US10653417B2 (en) | 2006-01-31 | 2020-05-19 | Ethicon Llc | Surgical instrument |
US10842491B2 (en) | 2006-01-31 | 2020-11-24 | Ethicon Llc | Surgical system with an actuation console |
US10653435B2 (en) | 2006-01-31 | 2020-05-19 | Ethicon Llc | Motor-driven surgical cutting and fastening instrument with tactile position feedback |
US11793518B2 (en) | 2006-01-31 | 2023-10-24 | Cilag Gmbh International | Powered surgical instruments with firing system lockout arrangements |
US10806479B2 (en) | 2006-01-31 | 2020-10-20 | Ethicon Llc | Motor-driven surgical cutting and fastening instrument with tactile position feedback |
US11801051B2 (en) | 2006-01-31 | 2023-10-31 | Cilag Gmbh International | Accessing data stored in a memory of a surgical instrument |
US10201363B2 (en) | 2006-01-31 | 2019-02-12 | Ethicon Llc | Motor-driven surgical instrument |
US10743849B2 (en) | 2006-01-31 | 2020-08-18 | Ethicon Llc | Stapling system including an articulation system |
US11224427B2 (en) | 2006-01-31 | 2022-01-18 | Cilag Gmbh International | Surgical stapling system including a console and retraction assembly |
US10675028B2 (en) | 2006-01-31 | 2020-06-09 | Ethicon Llc | Powered surgical instruments with firing system lockout arrangements |
US10709468B2 (en) | 2006-01-31 | 2020-07-14 | Ethicon Llc | Motor-driven surgical cutting and fastening instrument |
US11883020B2 (en) | 2006-01-31 | 2024-01-30 | Cilag Gmbh International | Surgical instrument having a feedback system |
US10213262B2 (en) | 2006-03-23 | 2019-02-26 | Ethicon Llc | Manipulatable surgical systems with selectively articulatable fastening device |
US11272938B2 (en) | 2006-06-27 | 2022-03-15 | Cilag Gmbh International | Surgical instrument including dedicated firing and retraction assemblies |
US10420560B2 (en) | 2006-06-27 | 2019-09-24 | Ethicon Llc | Manually driven surgical cutting and fastening instrument |
US10314589B2 (en) | 2006-06-27 | 2019-06-11 | Ethicon Llc | Surgical instrument including a shifting assembly |
US11571231B2 (en) | 2006-09-29 | 2023-02-07 | Cilag Gmbh International | Staple cartridge having a driver for driving multiple staples |
US10568652B2 (en) | 2006-09-29 | 2020-02-25 | Ethicon Llc | Surgical staples having attached drivers of different heights and stapling instruments for deploying the same |
US10595862B2 (en) | 2006-09-29 | 2020-03-24 | Ethicon Llc | Staple cartridge including a compressible member |
US11622785B2 (en) | 2006-09-29 | 2023-04-11 | Cilag Gmbh International | Surgical staples having attached drivers and stapling instruments for deploying the same |
US10172616B2 (en) | 2006-09-29 | 2019-01-08 | Ethicon Llc | Surgical staple cartridge |
US10448952B2 (en) | 2006-09-29 | 2019-10-22 | Ethicon Llc | End effector for use with a surgical fastening instrument |
US10342541B2 (en) | 2006-10-03 | 2019-07-09 | Ethicon Llc | Surgical instruments with E-beam driver and rotary drive arrangements |
US11980366B2 (en) | 2006-10-03 | 2024-05-14 | Cilag Gmbh International | Surgical instrument |
US11382626B2 (en) | 2006-10-03 | 2022-07-12 | Cilag Gmbh International | Surgical system including a knife bar supported for rotational and axial travel |
US10206678B2 (en) | 2006-10-03 | 2019-02-19 | Ethicon Llc | Surgical stapling instrument with lockout features to prevent advancement of a firing assembly unless an unfired surgical staple cartridge is operably mounted in an end effector portion of the instrument |
US11877748B2 (en) | 2006-10-03 | 2024-01-23 | Cilag Gmbh International | Robotically-driven surgical instrument with E-beam driver |
US11166720B2 (en) | 2007-01-10 | 2021-11-09 | Cilag Gmbh International | Surgical instrument including a control module for assessing an end effector |
US10278780B2 (en) | 2007-01-10 | 2019-05-07 | Ethicon Llc | Surgical instrument for use with robotic system |
US12004743B2 (en) | 2007-01-10 | 2024-06-11 | Cilag Gmbh International | Staple cartridge comprising a sloped wall |
US11771426B2 (en) | 2007-01-10 | 2023-10-03 | Cilag Gmbh International | Surgical instrument with wireless communication |
US11350929B2 (en) | 2007-01-10 | 2022-06-07 | Cilag Gmbh International | Surgical instrument with wireless communication between control unit and sensor transponders |
US11812961B2 (en) | 2007-01-10 | 2023-11-14 | Cilag Gmbh International | Surgical instrument including a motor control system |
US10517682B2 (en) | 2007-01-10 | 2019-12-31 | Ethicon Llc | Surgical instrument with wireless communication between control unit and remote sensor |
US12082806B2 (en) | 2007-01-10 | 2024-09-10 | Cilag Gmbh International | Surgical instrument with wireless communication between control unit and sensor transponders |
US11918211B2 (en) | 2007-01-10 | 2024-03-05 | Cilag Gmbh International | Surgical stapling instrument for use with a robotic system |
US11844521B2 (en) | 2007-01-10 | 2023-12-19 | Cilag Gmbh International | Surgical instrument for use with a robotic system |
US10517590B2 (en) | 2007-01-10 | 2019-12-31 | Ethicon Llc | Powered surgical instrument having a transmission system |
US11291441B2 (en) | 2007-01-10 | 2022-04-05 | Cilag Gmbh International | Surgical instrument with wireless communication between control unit and remote sensor |
US11849947B2 (en) | 2007-01-10 | 2023-12-26 | Cilag Gmbh International | Surgical system including a control circuit and a passively-powered transponder |
US11000277B2 (en) | 2007-01-10 | 2021-05-11 | Ethicon Llc | Surgical instrument with wireless communication between control unit and remote sensor |
US11006951B2 (en) | 2007-01-10 | 2021-05-18 | Ethicon Llc | Surgical instrument with wireless communication between control unit and sensor transponders |
US10433918B2 (en) | 2007-01-10 | 2019-10-08 | Ethicon Llc | Surgical instrument system configured to evaluate the load applied to a firing member at the initiation of a firing stroke |
US10751138B2 (en) | 2007-01-10 | 2020-08-25 | Ethicon Llc | Surgical instrument for use with a robotic system |
US10918386B2 (en) | 2007-01-10 | 2021-02-16 | Ethicon Llc | Interlock and surgical instrument including same |
US10945729B2 (en) | 2007-01-10 | 2021-03-16 | Ethicon Llc | Interlock and surgical instrument including same |
US10952727B2 (en) | 2007-01-10 | 2021-03-23 | Ethicon Llc | Surgical instrument for assessing the state of a staple cartridge |
US11134943B2 (en) | 2007-01-10 | 2021-10-05 | Cilag Gmbh International | Powered surgical instrument including a control unit and sensor |
US11064998B2 (en) | 2007-01-10 | 2021-07-20 | Cilag Gmbh International | Surgical instrument with wireless communication between a control unit of a robotic system and remote sensor |
US11937814B2 (en) | 2007-01-10 | 2024-03-26 | Cilag Gmbh International | Surgical instrument for use with a robotic system |
US11931032B2 (en) | 2007-01-10 | 2024-03-19 | Cilag Gmbh International | Surgical instrument with wireless communication between a control unit of a robotic system and remote sensor |
US11666332B2 (en) | 2007-01-10 | 2023-06-06 | Cilag Gmbh International | Surgical instrument comprising a control circuit configured to adjust the operation of a motor |
US11039836B2 (en) | 2007-01-11 | 2021-06-22 | Cilag Gmbh International | Staple cartridge for use with a surgical stapling instrument |
US10912575B2 (en) | 2007-01-11 | 2021-02-09 | Ethicon Llc | Surgical stapling device having supports for a flexible drive mechanism |
US11839352B2 (en) | 2007-01-11 | 2023-12-12 | Cilag Gmbh International | Surgical stapling device with an end effector |
US10702267B2 (en) | 2007-03-15 | 2020-07-07 | Ethicon Llc | Surgical stapling instrument having a releasable buttress material |
US11337693B2 (en) | 2007-03-15 | 2022-05-24 | Cilag Gmbh International | Surgical stapling instrument having a releasable buttress material |
US10398433B2 (en) | 2007-03-28 | 2019-09-03 | Ethicon Llc | Laparoscopic clamp load measuring devices |
US11559302B2 (en) | 2007-06-04 | 2023-01-24 | Cilag Gmbh International | Surgical instrument including a firing member movable at different speeds |
US11134938B2 (en) | 2007-06-04 | 2021-10-05 | Cilag Gmbh International | Robotically-controlled shaft based rotary drive systems for surgical instruments |
US11911028B2 (en) | 2007-06-04 | 2024-02-27 | Cilag Gmbh International | Surgical instruments for use with a robotic surgical system |
US11672531B2 (en) | 2007-06-04 | 2023-06-13 | Cilag Gmbh International | Rotary drive systems for surgical instruments |
US12035906B2 (en) | 2007-06-04 | 2024-07-16 | Cilag Gmbh International | Surgical instrument including a handle system for advancing a cutting member |
US10327765B2 (en) | 2007-06-04 | 2019-06-25 | Ethicon Llc | Drive systems for surgical instruments |
US11564682B2 (en) | 2007-06-04 | 2023-01-31 | Cilag Gmbh International | Surgical stapler device |
US10299787B2 (en) | 2007-06-04 | 2019-05-28 | Ethicon Llc | Stapling system comprising rotary inputs |
US11154298B2 (en) | 2007-06-04 | 2021-10-26 | Cilag Gmbh International | Stapling system for use with a robotic surgical system |
US11992208B2 (en) | 2007-06-04 | 2024-05-28 | Cilag Gmbh International | Rotary drive systems for surgical instruments |
US11147549B2 (en) | 2007-06-04 | 2021-10-19 | Cilag Gmbh International | Stapling instrument including a firing system and a closure system |
US12023024B2 (en) | 2007-06-04 | 2024-07-02 | Cilag Gmbh International | Robotically-controlled shaft based rotary drive systems for surgical instruments |
US10368863B2 (en) | 2007-06-04 | 2019-08-06 | Ethicon Llc | Robotically-controlled shaft based rotary drive systems for surgical instruments |
US11857181B2 (en) | 2007-06-04 | 2024-01-02 | Cilag Gmbh International | Robotically-controlled shaft based rotary drive systems for surgical instruments |
US10363033B2 (en) | 2007-06-04 | 2019-07-30 | Ethicon Llc | Robotically-controlled surgical instruments |
US11648006B2 (en) | 2007-06-04 | 2023-05-16 | Cilag Gmbh International | Robotically-controlled shaft based rotary drive systems for surgical instruments |
US11013511B2 (en) | 2007-06-22 | 2021-05-25 | Ethicon Llc | Surgical stapling instrument with an articulatable end effector |
US11998200B2 (en) | 2007-06-22 | 2024-06-04 | Cilag Gmbh International | Surgical stapling instrument with an articulatable end effector |
US11849941B2 (en) | 2007-06-29 | 2023-12-26 | Cilag Gmbh International | Staple cartridge having staple cavities extending at a transverse angle relative to a longitudinal cartridge axis |
US12023025B2 (en) | 2007-06-29 | 2024-07-02 | Cilag Gmbh International | Surgical stapling instrument having a releasable buttress material |
US11925346B2 (en) | 2007-06-29 | 2024-03-12 | Cilag Gmbh International | Surgical staple cartridge including tissue supporting surfaces |
US10925605B2 (en) | 2008-02-14 | 2021-02-23 | Ethicon Llc | Surgical stapling system |
US10874396B2 (en) | 2008-02-14 | 2020-12-29 | Ethicon Llc | Stapling instrument for use with a surgical robot |
US10716568B2 (en) | 2008-02-14 | 2020-07-21 | Ethicon Llc | Surgical stapling apparatus with control features operable with one hand |
US10463370B2 (en) | 2008-02-14 | 2019-11-05 | Ethicon Llc | Motorized surgical instrument |
US11446034B2 (en) | 2008-02-14 | 2022-09-20 | Cilag Gmbh International | Surgical stapling assembly comprising first and second actuation systems configured to perform different functions |
US10542974B2 (en) | 2008-02-14 | 2020-01-28 | Ethicon Llc | Surgical instrument including a control system |
US10206676B2 (en) | 2008-02-14 | 2019-02-19 | Ethicon Llc | Surgical cutting and fastening instrument |
US10898194B2 (en) | 2008-02-14 | 2021-01-26 | Ethicon Llc | Detachable motor powered surgical instrument |
US10806450B2 (en) | 2008-02-14 | 2020-10-20 | Ethicon Llc | Surgical cutting and fastening instrument having a control system |
US10905427B2 (en) | 2008-02-14 | 2021-02-02 | Ethicon Llc | Surgical System |
US10722232B2 (en) | 2008-02-14 | 2020-07-28 | Ethicon Llc | Surgical instrument for use with different cartridges |
US11717285B2 (en) | 2008-02-14 | 2023-08-08 | Cilag Gmbh International | Surgical cutting and fastening instrument having RF electrodes |
US10888329B2 (en) | 2008-02-14 | 2021-01-12 | Ethicon Llc | Detachable motor powered surgical instrument |
US11464514B2 (en) | 2008-02-14 | 2022-10-11 | Cilag Gmbh International | Motorized surgical stapling system including a sensing array |
US10238385B2 (en) | 2008-02-14 | 2019-03-26 | Ethicon Llc | Surgical instrument system for evaluating tissue impedance |
US11998206B2 (en) | 2008-02-14 | 2024-06-04 | Cilag Gmbh International | Detachable motor powered surgical instrument |
US10265067B2 (en) | 2008-02-14 | 2019-04-23 | Ethicon Llc | Surgical instrument including a regulator and a control system |
US10682142B2 (en) | 2008-02-14 | 2020-06-16 | Ethicon Llc | Surgical stapling apparatus including an articulation system |
US10765432B2 (en) | 2008-02-14 | 2020-09-08 | Ethicon Llc | Surgical device including a control system |
US10898195B2 (en) | 2008-02-14 | 2021-01-26 | Ethicon Llc | Detachable motor powered surgical instrument |
US10905426B2 (en) | 2008-02-14 | 2021-02-02 | Ethicon Llc | Detachable motor powered surgical instrument |
US10682141B2 (en) | 2008-02-14 | 2020-06-16 | Ethicon Llc | Surgical device including a control system |
US11638583B2 (en) | 2008-02-14 | 2023-05-02 | Cilag Gmbh International | Motorized surgical system having a plurality of power sources |
US10470763B2 (en) | 2008-02-14 | 2019-11-12 | Ethicon Llc | Surgical cutting and fastening instrument including a sensing system |
US11986183B2 (en) | 2008-02-14 | 2024-05-21 | Cilag Gmbh International | Surgical cutting and fastening instrument comprising a plurality of sensors to measure an electrical parameter |
US11484307B2 (en) | 2008-02-14 | 2022-11-01 | Cilag Gmbh International | Loading unit coupleable to a surgical stapling system |
US10660640B2 (en) | 2008-02-14 | 2020-05-26 | Ethicon Llc | Motorized surgical cutting and fastening instrument |
US11801047B2 (en) | 2008-02-14 | 2023-10-31 | Cilag Gmbh International | Surgical stapling system comprising a control circuit configured to selectively monitor tissue impedance and adjust control of a motor |
US11612395B2 (en) | 2008-02-14 | 2023-03-28 | Cilag Gmbh International | Surgical system including a control system having an RFID tag reader |
US10639036B2 (en) | 2008-02-14 | 2020-05-05 | Ethicon Llc | Robotically-controlled motorized surgical cutting and fastening instrument |
US10238387B2 (en) | 2008-02-14 | 2019-03-26 | Ethicon Llc | Surgical instrument comprising a control system |
US11571212B2 (en) | 2008-02-14 | 2023-02-07 | Cilag Gmbh International | Surgical stapling system including an impedance sensor |
US10779822B2 (en) | 2008-02-14 | 2020-09-22 | Ethicon Llc | System including a surgical cutting and fastening instrument |
US10307163B2 (en) | 2008-02-14 | 2019-06-04 | Ethicon Llc | Detachable motor powered surgical instrument |
US10743870B2 (en) | 2008-02-14 | 2020-08-18 | Ethicon Llc | Surgical stapling apparatus with interlockable firing system |
US10888330B2 (en) | 2008-02-14 | 2021-01-12 | Ethicon Llc | Surgical system |
US10743851B2 (en) | 2008-02-14 | 2020-08-18 | Ethicon Llc | Interchangeable tools for surgical instruments |
US11058418B2 (en) | 2008-02-15 | 2021-07-13 | Cilag Gmbh International | Surgical end effector having buttress retention features |
US10856866B2 (en) | 2008-02-15 | 2020-12-08 | Ethicon Llc | Surgical end effector having buttress retention features |
US11154297B2 (en) | 2008-02-15 | 2021-10-26 | Cilag Gmbh International | Layer arrangements for surgical staple cartridges |
US11998194B2 (en) | 2008-02-15 | 2024-06-04 | Cilag Gmbh International | Surgical stapling assembly comprising an adjunct applicator |
US10390823B2 (en) | 2008-02-15 | 2019-08-27 | Ethicon Llc | End effector comprising an adjunct |
US11272927B2 (en) | 2008-02-15 | 2022-03-15 | Cilag Gmbh International | Layer arrangements for surgical staple cartridges |
US20210171623A1 (en) * | 2008-05-30 | 2021-06-10 | Janssen Biotech, Inc. | Human antibody specific for interleukin-1alpha |
US11406380B2 (en) | 2008-09-23 | 2022-08-09 | Cilag Gmbh International | Motorized surgical instrument |
US11045189B2 (en) | 2008-09-23 | 2021-06-29 | Cilag Gmbh International | Robotically-controlled motorized surgical instrument with an end effector |
US10456133B2 (en) | 2008-09-23 | 2019-10-29 | Ethicon Llc | Motorized surgical instrument |
US10485537B2 (en) | 2008-09-23 | 2019-11-26 | Ethicon Llc | Motorized surgical instrument |
US11684361B2 (en) | 2008-09-23 | 2023-06-27 | Cilag Gmbh International | Motor-driven surgical cutting instrument |
US10736628B2 (en) | 2008-09-23 | 2020-08-11 | Ethicon Llc | Motor-driven surgical cutting instrument |
US12029415B2 (en) | 2008-09-23 | 2024-07-09 | Cilag Gmbh International | Motor-driven surgical cutting instrument |
US11617575B2 (en) | 2008-09-23 | 2023-04-04 | Cilag Gmbh International | Motor-driven surgical cutting instrument |
US11517304B2 (en) | 2008-09-23 | 2022-12-06 | Cilag Gmbh International | Motor-driven surgical cutting instrument |
US10765425B2 (en) | 2008-09-23 | 2020-09-08 | Ethicon Llc | Robotically-controlled motorized surgical instrument with an end effector |
US10980535B2 (en) | 2008-09-23 | 2021-04-20 | Ethicon Llc | Motorized surgical instrument with an end effector |
US11648005B2 (en) | 2008-09-23 | 2023-05-16 | Cilag Gmbh International | Robotically-controlled motorized surgical instrument with an end effector |
US11617576B2 (en) | 2008-09-23 | 2023-04-04 | Cilag Gmbh International | Motor-driven surgical cutting instrument |
US10420549B2 (en) | 2008-09-23 | 2019-09-24 | Ethicon Llc | Motorized surgical instrument |
US11812954B2 (en) | 2008-09-23 | 2023-11-14 | Cilag Gmbh International | Robotically-controlled motorized surgical instrument with an end effector |
US10898184B2 (en) | 2008-09-23 | 2021-01-26 | Ethicon Llc | Motor-driven surgical cutting instrument |
US11871923B2 (en) | 2008-09-23 | 2024-01-16 | Cilag Gmbh International | Motorized surgical instrument |
US11103241B2 (en) | 2008-09-23 | 2021-08-31 | Cilag Gmbh International | Motor-driven surgical cutting instrument |
US10932778B2 (en) | 2008-10-10 | 2021-03-02 | Ethicon Llc | Powered surgical cutting and stapling apparatus with manually retractable firing system |
US11583279B2 (en) | 2008-10-10 | 2023-02-21 | Cilag Gmbh International | Powered surgical cutting and stapling apparatus with manually retractable firing system |
US11793521B2 (en) | 2008-10-10 | 2023-10-24 | Cilag Gmbh International | Powered surgical cutting and stapling apparatus with manually retractable firing system |
US11730477B2 (en) | 2008-10-10 | 2023-08-22 | Cilag Gmbh International | Powered surgical system with manually retractable firing system |
US11129615B2 (en) | 2009-02-05 | 2021-09-28 | Cilag Gmbh International | Surgical stapling system |
US10420550B2 (en) | 2009-02-06 | 2019-09-24 | Ethicon Llc | Motor driven surgical fastener device with switching system configured to prevent firing initiation until activated |
US11291449B2 (en) | 2009-12-24 | 2022-04-05 | Cilag Gmbh International | Surgical cutting instrument that analyzes tissue thickness |
US10751076B2 (en) | 2009-12-24 | 2020-08-25 | Ethicon Llc | Motor-driven surgical cutting instrument with electric actuator directional control assembly |
US9441038B2 (en) | 2010-05-14 | 2016-09-13 | Abbvie Inc. | IL-1 binding proteins |
US9303085B2 (en) | 2010-05-14 | 2016-04-05 | Abbvie Inc. | IL-1 binding proteins |
US9409986B2 (en) | 2010-05-14 | 2016-08-09 | Abbvie Inc. | IL-1 binding proteins |
US8664367B2 (en) | 2010-05-14 | 2014-03-04 | Abbvie, Inc. | IL-I binding proteins |
US9447183B2 (en) | 2010-05-14 | 2016-09-20 | Abbvie Inc. | IL-1 binding proteins |
US9447184B2 (en) | 2010-05-14 | 2016-09-20 | Abbvie Inc. | IL-1 binding proteins |
US20110311547A1 (en) * | 2010-06-18 | 2011-12-22 | Xbiotech, Inc. | Arthritis Treatment |
US11390672B2 (en) | 2010-06-18 | 2022-07-19 | Janssen Biotech, Inc. | Arthritis treatment |
US11478247B2 (en) | 2010-07-30 | 2022-10-25 | Cilag Gmbh International | Tissue acquisition arrangements and methods for surgical stapling devices |
US11932688B2 (en) | 2010-08-23 | 2024-03-19 | Xbiotech Inc. | Treatment for neoplastic diseases |
US11571215B2 (en) | 2010-09-30 | 2023-02-07 | Cilag Gmbh International | Layer of material for a surgical end effector |
US10463372B2 (en) | 2010-09-30 | 2019-11-05 | Ethicon Llc | Staple cartridge comprising multiple regions |
US11911027B2 (en) | 2010-09-30 | 2024-02-27 | Cilag Gmbh International | Adhesive film laminate |
US10258330B2 (en) | 2010-09-30 | 2019-04-16 | Ethicon Llc | End effector including an implantable arrangement |
US10987102B2 (en) | 2010-09-30 | 2021-04-27 | Ethicon Llc | Tissue thickness compensator comprising a plurality of layers |
US11925354B2 (en) | 2010-09-30 | 2024-03-12 | Cilag Gmbh International | Staple cartridge comprising staples positioned within a compressible portion thereof |
US10363031B2 (en) | 2010-09-30 | 2019-07-30 | Ethicon Llc | Tissue thickness compensators for surgical staplers |
US10265072B2 (en) | 2010-09-30 | 2019-04-23 | Ethicon Llc | Surgical stapling system comprising an end effector including an implantable layer |
US11672536B2 (en) | 2010-09-30 | 2023-06-13 | Cilag Gmbh International | Layer of material for a surgical end effector |
US10265074B2 (en) | 2010-09-30 | 2019-04-23 | Ethicon Llc | Implantable layers for surgical stapling devices |
US10335150B2 (en) | 2010-09-30 | 2019-07-02 | Ethicon Llc | Staple cartridge comprising an implantable layer |
US10945731B2 (en) | 2010-09-30 | 2021-03-16 | Ethicon Llc | Tissue thickness compensator comprising controlled release and expansion |
US10888328B2 (en) | 2010-09-30 | 2021-01-12 | Ethicon Llc | Surgical end effector |
US10835251B2 (en) | 2010-09-30 | 2020-11-17 | Ethicon Llc | Surgical instrument assembly including an end effector configurable in different positions |
US11812965B2 (en) | 2010-09-30 | 2023-11-14 | Cilag Gmbh International | Layer of material for a surgical end effector |
US10743877B2 (en) | 2010-09-30 | 2020-08-18 | Ethicon Llc | Surgical stapler with floating anvil |
US10149682B2 (en) | 2010-09-30 | 2018-12-11 | Ethicon Llc | Stapling system including an actuation system |
US10335148B2 (en) | 2010-09-30 | 2019-07-02 | Ethicon Llc | Staple cartridge including a tissue thickness compensator for a surgical stapler |
US11944292B2 (en) | 2010-09-30 | 2024-04-02 | Cilag Gmbh International | Anvil layer attached to a proximal end of an end effector |
US11406377B2 (en) | 2010-09-30 | 2022-08-09 | Cilag Gmbh International | Adhesive film laminate |
US11883025B2 (en) | 2010-09-30 | 2024-01-30 | Cilag Gmbh International | Tissue thickness compensator comprising a plurality of layers |
US10624861B2 (en) | 2010-09-30 | 2020-04-21 | Ethicon Llc | Tissue thickness compensator configured to redistribute compressive forces |
US11602340B2 (en) | 2010-09-30 | 2023-03-14 | Cilag Gmbh International | Adhesive film laminate |
US11737754B2 (en) | 2010-09-30 | 2023-08-29 | Cilag Gmbh International | Surgical stapler with floating anvil |
US11957795B2 (en) | 2010-09-30 | 2024-04-16 | Cilag Gmbh International | Tissue thickness compensator configured to redistribute compressive forces |
US11583277B2 (en) | 2010-09-30 | 2023-02-21 | Cilag Gmbh International | Layer of material for a surgical end effector |
US11684360B2 (en) | 2010-09-30 | 2023-06-27 | Cilag Gmbh International | Staple cartridge comprising a variable thickness compressible portion |
US11083452B2 (en) | 2010-09-30 | 2021-08-10 | Cilag Gmbh International | Staple cartridge including a tissue thickness compensator |
US11298125B2 (en) | 2010-09-30 | 2022-04-12 | Cilag Gmbh International | Tissue stapler having a thickness compensator |
US10182819B2 (en) | 2010-09-30 | 2019-01-22 | Ethicon Llc | Implantable layer assemblies |
US10588623B2 (en) | 2010-09-30 | 2020-03-17 | Ethicon Llc | Adhesive film laminate |
US10398436B2 (en) | 2010-09-30 | 2019-09-03 | Ethicon Llc | Staple cartridge comprising staples positioned within a compressible portion thereof |
US10485536B2 (en) | 2010-09-30 | 2019-11-26 | Ethicon Llc | Tissue stapler having an anti-microbial agent |
US11857187B2 (en) | 2010-09-30 | 2024-01-02 | Cilag Gmbh International | Tissue thickness compensator comprising controlled release and expansion |
US10869669B2 (en) | 2010-09-30 | 2020-12-22 | Ethicon Llc | Surgical instrument assembly |
US11559496B2 (en) | 2010-09-30 | 2023-01-24 | Cilag Gmbh International | Tissue thickness compensator configured to redistribute compressive forces |
US10548600B2 (en) | 2010-09-30 | 2020-02-04 | Ethicon Llc | Multiple thickness implantable layers for surgical stapling devices |
US10258332B2 (en) | 2010-09-30 | 2019-04-16 | Ethicon Llc | Stapling system comprising an adjunct and a flowable adhesive |
US11154296B2 (en) | 2010-09-30 | 2021-10-26 | Cilag Gmbh International | Anvil layer attached to a proximal end of an end effector |
US11540824B2 (en) | 2010-09-30 | 2023-01-03 | Cilag Gmbh International | Tissue thickness compensator |
US11849952B2 (en) | 2010-09-30 | 2023-12-26 | Cilag Gmbh International | Staple cartridge comprising staples positioned within a compressible portion thereof |
US10898193B2 (en) | 2010-09-30 | 2021-01-26 | Ethicon Llc | End effector for use with a surgical instrument |
US11850310B2 (en) | 2010-09-30 | 2023-12-26 | Cilag Gmbh International | Staple cartridge including an adjunct |
US11395651B2 (en) | 2010-09-30 | 2022-07-26 | Cilag Gmbh International | Adhesive film laminate |
US10695062B2 (en) | 2010-10-01 | 2020-06-30 | Ethicon Llc | Surgical instrument including a retractable firing member |
US11529142B2 (en) | 2010-10-01 | 2022-12-20 | Cilag Gmbh International | Surgical instrument having a power control circuit |
US11191831B2 (en) | 2011-04-01 | 2021-12-07 | Janssen Biotech, Inc. | Treatment of psychiatric conditions |
US11504116B2 (en) | 2011-04-29 | 2022-11-22 | Cilag Gmbh International | Layer of material for a surgical end effector |
US10383633B2 (en) | 2011-05-27 | 2019-08-20 | Ethicon Llc | Robotically-driven surgical assembly |
US10426478B2 (en) | 2011-05-27 | 2019-10-01 | Ethicon Llc | Surgical stapling systems |
US11439470B2 (en) | 2011-05-27 | 2022-09-13 | Cilag Gmbh International | Robotically-controlled surgical instrument with selectively articulatable end effector |
US10980534B2 (en) | 2011-05-27 | 2021-04-20 | Ethicon Llc | Robotically-controlled motorized surgical instrument with an end effector |
US10524790B2 (en) | 2011-05-27 | 2020-01-07 | Ethicon Llc | Robotically-controlled surgical stapling devices that produce formed staples having different lengths |
US10335151B2 (en) | 2011-05-27 | 2019-07-02 | Ethicon Llc | Robotically-driven surgical instrument |
US10813641B2 (en) | 2011-05-27 | 2020-10-27 | Ethicon Llc | Robotically-driven surgical instrument |
US10231794B2 (en) | 2011-05-27 | 2019-03-19 | Ethicon Llc | Surgical stapling instruments with rotatable staple deployment arrangements |
US11918208B2 (en) | 2011-05-27 | 2024-03-05 | Cilag Gmbh International | Robotically-controlled shaft based rotary drive systems for surgical instruments |
US10780539B2 (en) | 2011-05-27 | 2020-09-22 | Ethicon Llc | Stapling instrument for use with a robotic system |
US11207064B2 (en) | 2011-05-27 | 2021-12-28 | Cilag Gmbh International | Automated end effector component reloading system for use with a robotic system |
US12059154B2 (en) | 2011-05-27 | 2024-08-13 | Cilag Gmbh International | Surgical instrument with detachable motor control unit |
US10736634B2 (en) | 2011-05-27 | 2020-08-11 | Ethicon Llc | Robotically-driven surgical instrument including a drive system |
US11612394B2 (en) | 2011-05-27 | 2023-03-28 | Cilag Gmbh International | Automated end effector component reloading system for use with a robotic system |
US11266410B2 (en) | 2011-05-27 | 2022-03-08 | Cilag Gmbh International | Surgical device for use with a robotic system |
US10420561B2 (en) | 2011-05-27 | 2019-09-24 | Ethicon Llc | Robotically-driven surgical instrument |
US10617420B2 (en) | 2011-05-27 | 2020-04-14 | Ethicon Llc | Surgical system comprising drive systems |
US11583278B2 (en) | 2011-05-27 | 2023-02-21 | Cilag Gmbh International | Surgical stapling system having multi-direction articulation |
US11974747B2 (en) | 2011-05-27 | 2024-05-07 | Cilag Gmbh International | Surgical stapling instruments with rotatable staple deployment arrangements |
US10485546B2 (en) | 2011-05-27 | 2019-11-26 | Ethicon Llc | Robotically-driven surgical assembly |
US11129616B2 (en) | 2011-05-27 | 2021-09-28 | Cilag Gmbh International | Surgical stapling system |
US10695063B2 (en) | 2012-02-13 | 2020-06-30 | Ethicon Llc | Surgical cutting and fastening instrument with apparatus for determining cartridge and firing motion status |
US11918220B2 (en) | 2012-03-28 | 2024-03-05 | Cilag Gmbh International | Tissue thickness compensator comprising tissue ingrowth features |
US10667808B2 (en) | 2012-03-28 | 2020-06-02 | Ethicon Llc | Staple cartridge comprising an absorbable adjunct |
US11793509B2 (en) | 2012-03-28 | 2023-10-24 | Cilag Gmbh International | Staple cartridge including an implantable layer |
US10441285B2 (en) | 2012-03-28 | 2019-10-15 | Ethicon Llc | Tissue thickness compensator comprising tissue ingrowth features |
US11406378B2 (en) | 2012-03-28 | 2022-08-09 | Cilag Gmbh International | Staple cartridge comprising a compressible tissue thickness compensator |
US10959725B2 (en) | 2012-06-15 | 2021-03-30 | Ethicon Llc | Articulatable surgical instrument comprising a firing drive |
US11707273B2 (en) | 2012-06-15 | 2023-07-25 | Cilag Gmbh International | Articulatable surgical instrument comprising a firing drive |
US11602346B2 (en) | 2012-06-28 | 2023-03-14 | Cilag Gmbh International | Robotically powered surgical device with manually-actuatable reversing system |
US11197671B2 (en) | 2012-06-28 | 2021-12-14 | Cilag Gmbh International | Stapling assembly comprising a lockout |
US11007004B2 (en) | 2012-06-28 | 2021-05-18 | Ethicon Llc | Powered multi-axial articulable electrosurgical device with external dissection features |
US11464513B2 (en) | 2012-06-28 | 2022-10-11 | Cilag Gmbh International | Surgical instrument system including replaceable end effectors |
US11806013B2 (en) | 2012-06-28 | 2023-11-07 | Cilag Gmbh International | Firing system arrangements for surgical instruments |
US10874391B2 (en) | 2012-06-28 | 2020-12-29 | Ethicon Llc | Surgical instrument system including replaceable end effectors |
US10932775B2 (en) | 2012-06-28 | 2021-03-02 | Ethicon Llc | Firing system lockout arrangements for surgical instruments |
US11058423B2 (en) | 2012-06-28 | 2021-07-13 | Cilag Gmbh International | Stapling system including first and second closure systems for use with a surgical robot |
US10413294B2 (en) | 2012-06-28 | 2019-09-17 | Ethicon Llc | Shaft assembly arrangements for surgical instruments |
US11154299B2 (en) | 2012-06-28 | 2021-10-26 | Cilag Gmbh International | Stapling assembly comprising a firing lockout |
US11202631B2 (en) | 2012-06-28 | 2021-12-21 | Cilag Gmbh International | Stapling assembly comprising a firing lockout |
US11534162B2 (en) | 2012-06-28 | 2022-12-27 | Cilag GmbH Inlernational | Robotically powered surgical device with manually-actuatable reversing system |
US11622766B2 (en) | 2012-06-28 | 2023-04-11 | Cilag Gmbh International | Empty clip cartridge lockout |
US11540829B2 (en) | 2012-06-28 | 2023-01-03 | Cilag Gmbh International | Surgical instrument system including replaceable end effectors |
US11278284B2 (en) | 2012-06-28 | 2022-03-22 | Cilag Gmbh International | Rotary drive arrangements for surgical instruments |
US11779420B2 (en) | 2012-06-28 | 2023-10-10 | Cilag Gmbh International | Robotic surgical attachments having manually-actuated retraction assemblies |
US11241230B2 (en) | 2012-06-28 | 2022-02-08 | Cilag Gmbh International | Clip applier tool for use with a robotic surgical system |
US11141156B2 (en) | 2012-06-28 | 2021-10-12 | Cilag Gmbh International | Surgical stapling assembly comprising flexible output shaft |
US10485541B2 (en) | 2012-06-28 | 2019-11-26 | Ethicon Llc | Robotically powered surgical device with manually-actuatable reversing system |
US11141155B2 (en) | 2012-06-28 | 2021-10-12 | Cilag Gmbh International | Drive system for surgical tool |
US11109860B2 (en) | 2012-06-28 | 2021-09-07 | Cilag Gmbh International | Surgical end effectors for use with hand-held and robotically-controlled rotary powered surgical systems |
US10687812B2 (en) | 2012-06-28 | 2020-06-23 | Ethicon Llc | Surgical instrument system including replaceable end effectors |
US11510671B2 (en) | 2012-06-28 | 2022-11-29 | Cilag Gmbh International | Firing system lockout arrangements for surgical instruments |
US11039837B2 (en) | 2012-06-28 | 2021-06-22 | Cilag Gmbh International | Firing system lockout arrangements for surgical instruments |
US11083457B2 (en) | 2012-06-28 | 2021-08-10 | Cilag Gmbh International | Surgical instrument system including replaceable end effectors |
US10258333B2 (en) | 2012-06-28 | 2019-04-16 | Ethicon Llc | Surgical fastening apparatus with a rotary end effector drive shaft for selective engagement with a motorized drive system |
US10383630B2 (en) | 2012-06-28 | 2019-08-20 | Ethicon Llc | Surgical stapling device with rotary driven firing member |
US11857189B2 (en) | 2012-06-28 | 2024-01-02 | Cilag Gmbh International | Surgical instrument including first and second articulation joints |
US11918213B2 (en) | 2012-06-28 | 2024-03-05 | Cilag Gmbh International | Surgical stapler including couplers for attaching a shaft to an end effector |
US10420555B2 (en) | 2012-06-28 | 2019-09-24 | Ethicon Llc | Hand held rotary powered surgical instruments with end effectors that are articulatable about multiple axes |
US10639115B2 (en) | 2012-06-28 | 2020-05-05 | Ethicon Llc | Surgical end effectors having angled tissue-contacting surfaces |
US11373755B2 (en) | 2012-08-23 | 2022-06-28 | Cilag Gmbh International | Surgical device drive system including a ratchet mechanism |
CN104684929A (en) * | 2012-10-04 | 2015-06-03 | 埃克斯生物科技公司 | Treating vascular disease and complications thereof |
US11529138B2 (en) | 2013-03-01 | 2022-12-20 | Cilag Gmbh International | Powered surgical instrument including a rotary drive screw |
US11246618B2 (en) | 2013-03-01 | 2022-02-15 | Cilag Gmbh International | Surgical instrument soft stop |
US10226249B2 (en) | 2013-03-01 | 2019-03-12 | Ethicon Llc | Articulatable surgical instruments with conductive pathways for signal communication |
US10575868B2 (en) | 2013-03-01 | 2020-03-03 | Ethicon Llc | Surgical instrument with coupler assembly |
US10285695B2 (en) | 2013-03-01 | 2019-05-14 | Ethicon Llc | Articulatable surgical instruments with conductive pathways |
US11957345B2 (en) | 2013-03-01 | 2024-04-16 | Cilag Gmbh International | Articulatable surgical instruments with conductive pathways for signal communication |
US10238391B2 (en) | 2013-03-14 | 2019-03-26 | Ethicon Llc | Drive train control arrangements for modular surgical instruments |
US10893867B2 (en) | 2013-03-14 | 2021-01-19 | Ethicon Llc | Drive train control arrangements for modular surgical instruments |
US11992214B2 (en) | 2013-03-14 | 2024-05-28 | Cilag Gmbh International | Control systems for surgical instruments |
US10617416B2 (en) | 2013-03-14 | 2020-04-14 | Ethicon Llc | Control systems for surgical instruments |
US10470762B2 (en) | 2013-03-14 | 2019-11-12 | Ethicon Llc | Multi-function motor for a surgical instrument |
US11266406B2 (en) | 2013-03-14 | 2022-03-08 | Cilag Gmbh International | Control systems for surgical instruments |
US10149680B2 (en) | 2013-04-16 | 2018-12-11 | Ethicon Llc | Surgical instrument comprising a gap setting system |
US10405857B2 (en) | 2013-04-16 | 2019-09-10 | Ethicon Llc | Powered linear surgical stapler |
US11564679B2 (en) | 2013-04-16 | 2023-01-31 | Cilag Gmbh International | Powered surgical stapler |
US11406381B2 (en) | 2013-04-16 | 2022-08-09 | Cilag Gmbh International | Powered surgical stapler |
US11395652B2 (en) | 2013-04-16 | 2022-07-26 | Cilag Gmbh International | Powered surgical stapler |
US11690615B2 (en) | 2013-04-16 | 2023-07-04 | Cilag Gmbh International | Surgical system including an electric motor and a surgical instrument |
US10702266B2 (en) | 2013-04-16 | 2020-07-07 | Ethicon Llc | Surgical instrument system |
US11633183B2 (en) | 2013-04-16 | 2023-04-25 | Cilag International GmbH | Stapling assembly comprising a retraction drive |
US11638581B2 (en) | 2013-04-16 | 2023-05-02 | Cilag Gmbh International | Powered surgical stapler |
US10888318B2 (en) | 2013-04-16 | 2021-01-12 | Ethicon Llc | Powered surgical stapler |
US11622763B2 (en) | 2013-04-16 | 2023-04-11 | Cilag Gmbh International | Stapling assembly comprising a shiftable drive |
US11109858B2 (en) | 2013-08-23 | 2021-09-07 | Cilag Gmbh International | Surgical instrument including a display which displays the position of a firing element |
US11504119B2 (en) | 2013-08-23 | 2022-11-22 | Cilag Gmbh International | Surgical instrument including an electronic firing lockout |
US12053176B2 (en) | 2013-08-23 | 2024-08-06 | Cilag Gmbh International | End effector detention systems for surgical instruments |
US10869665B2 (en) | 2013-08-23 | 2020-12-22 | Ethicon Llc | Surgical instrument system including a control system |
US11918209B2 (en) | 2013-08-23 | 2024-03-05 | Cilag Gmbh International | Torque optimization for surgical instruments |
US10624634B2 (en) | 2013-08-23 | 2020-04-21 | Ethicon Llc | Firing trigger lockout arrangements for surgical instruments |
US11133106B2 (en) | 2013-08-23 | 2021-09-28 | Cilag Gmbh International | Surgical instrument assembly comprising a retraction assembly |
US11389160B2 (en) | 2013-08-23 | 2022-07-19 | Cilag Gmbh International | Surgical system comprising a display |
US11701110B2 (en) | 2013-08-23 | 2023-07-18 | Cilag Gmbh International | Surgical instrument including a drive assembly movable in a non-motorized mode of operation |
US11026680B2 (en) | 2013-08-23 | 2021-06-08 | Cilag Gmbh International | Surgical instrument configured to operate in different states |
US10201349B2 (en) | 2013-08-23 | 2019-02-12 | Ethicon Llc | End effector detection and firing rate modulation systems for surgical instruments |
US10898190B2 (en) | 2013-08-23 | 2021-01-26 | Ethicon Llc | Secondary battery arrangements for powered surgical instruments |
US10828032B2 (en) | 2013-08-23 | 2020-11-10 | Ethicon Llc | End effector detection systems for surgical instruments |
US10441281B2 (en) | 2013-08-23 | 2019-10-15 | Ethicon Llc | surgical instrument including securing and aligning features |
US11000274B2 (en) | 2013-08-23 | 2021-05-11 | Ethicon Llc | Powered surgical instrument |
US11134940B2 (en) | 2013-08-23 | 2021-10-05 | Cilag Gmbh International | Surgical instrument including a variable speed firing member |
US11376001B2 (en) | 2013-08-23 | 2022-07-05 | Cilag Gmbh International | Surgical stapling device with rotary multi-turn retraction mechanism |
US11020115B2 (en) | 2014-02-12 | 2021-06-01 | Cilag Gmbh International | Deliverable surgical instrument |
US10426481B2 (en) | 2014-02-24 | 2019-10-01 | Ethicon Llc | Implantable layer assemblies |
US10898185B2 (en) | 2014-03-26 | 2021-01-26 | Ethicon Llc | Surgical instrument power management through sleep and wake up control |
US12023023B2 (en) | 2014-03-26 | 2024-07-02 | Cilag Gmbh International | Interface systems for use with surgical instruments |
US10201364B2 (en) | 2014-03-26 | 2019-02-12 | Ethicon Llc | Surgical instrument comprising a rotatable shaft |
US11259799B2 (en) | 2014-03-26 | 2022-03-01 | Cilag Gmbh International | Interface systems for use with surgical instruments |
US11497488B2 (en) | 2014-03-26 | 2022-11-15 | Cilag Gmbh International | Systems and methods for controlling a segmented circuit |
US10588626B2 (en) | 2014-03-26 | 2020-03-17 | Ethicon Llc | Surgical instrument displaying subsequent step of use |
US10863981B2 (en) | 2014-03-26 | 2020-12-15 | Ethicon Llc | Interface systems for use with surgical instruments |
US12023022B2 (en) | 2014-03-26 | 2024-07-02 | Cilag Gmbh International | Systems and methods for controlling a segmented circuit |
US11963678B2 (en) | 2014-04-16 | 2024-04-23 | Cilag Gmbh International | Fastener cartridges including extensions having different configurations |
US10299792B2 (en) | 2014-04-16 | 2019-05-28 | Ethicon Llc | Fastener cartridge comprising non-uniform fasteners |
US11925353B2 (en) | 2014-04-16 | 2024-03-12 | Cilag Gmbh International | Surgical stapling instrument comprising internal passage between stapling cartridge and elongate channel |
US11266409B2 (en) | 2014-04-16 | 2022-03-08 | Cilag Gmbh International | Fastener cartridge comprising a sled including longitudinally-staggered ramps |
US12089849B2 (en) | 2014-04-16 | 2024-09-17 | Cilag Gmbh International | Staple cartridges including a projection |
US11185330B2 (en) | 2014-04-16 | 2021-11-30 | Cilag Gmbh International | Fastener cartridge assemblies and staple retainer cover arrangements |
US11382625B2 (en) | 2014-04-16 | 2022-07-12 | Cilag Gmbh International | Fastener cartridge comprising non-uniform fasteners |
US10327776B2 (en) | 2014-04-16 | 2019-06-25 | Ethicon Llc | Surgical stapling buttresses and adjunct materials |
US11717294B2 (en) | 2014-04-16 | 2023-08-08 | Cilag Gmbh International | End effector arrangements comprising indicators |
US11918222B2 (en) | 2014-04-16 | 2024-03-05 | Cilag Gmbh International | Stapling assembly having firing member viewing windows |
US10561422B2 (en) | 2014-04-16 | 2020-02-18 | Ethicon Llc | Fastener cartridge comprising deployable tissue engaging members |
US11944307B2 (en) | 2014-04-16 | 2024-04-02 | Cilag Gmbh International | Surgical stapling system including jaw windows |
US10542988B2 (en) | 2014-04-16 | 2020-01-28 | Ethicon Llc | End effector comprising an anvil including projections extending therefrom |
US11382627B2 (en) | 2014-04-16 | 2022-07-12 | Cilag Gmbh International | Surgical stapling assembly comprising a firing member including a lateral extension |
US10470768B2 (en) | 2014-04-16 | 2019-11-12 | Ethicon Llc | Fastener cartridge including a layer attached thereto |
US11298134B2 (en) | 2014-04-16 | 2022-04-12 | Cilag Gmbh International | Fastener cartridge comprising non-uniform fasteners |
US11974746B2 (en) | 2014-04-16 | 2024-05-07 | Cilag Gmbh International | Anvil for use with a surgical stapling assembly |
US11883026B2 (en) | 2014-04-16 | 2024-01-30 | Cilag Gmbh International | Fastener cartridge assemblies and staple retainer cover arrangements |
US11596406B2 (en) | 2014-04-16 | 2023-03-07 | Cilag Gmbh International | Fastener cartridges including extensions having different configurations |
US11517315B2 (en) | 2014-04-16 | 2022-12-06 | Cilag Gmbh International | Fastener cartridges including extensions having different configurations |
US11717297B2 (en) | 2014-09-05 | 2023-08-08 | Cilag Gmbh International | Smart cartridge wake up operation and data retention |
US11406386B2 (en) | 2014-09-05 | 2022-08-09 | Cilag Gmbh International | End effector including magnetic and impedance sensors |
US11653918B2 (en) | 2014-09-05 | 2023-05-23 | Cilag Gmbh International | Local display of tissue parameter stabilization |
US11076854B2 (en) | 2014-09-05 | 2021-08-03 | Cilag Gmbh International | Smart cartridge wake up operation and data retention |
US12042147B2 (en) | 2014-09-05 | 2024-07-23 | Cllag GmbH International | Smart cartridge wake up operation and data retention |
US11311294B2 (en) | 2014-09-05 | 2022-04-26 | Cilag Gmbh International | Powered medical device including measurement of closure state of jaws |
US10905423B2 (en) | 2014-09-05 | 2021-02-02 | Ethicon Llc | Smart cartridge wake up operation and data retention |
US11389162B2 (en) | 2014-09-05 | 2022-07-19 | Cilag Gmbh International | Smart cartridge wake up operation and data retention |
US11071545B2 (en) | 2014-09-05 | 2021-07-27 | Cilag Gmbh International | Smart cartridge wake up operation and data retention |
US12076017B2 (en) | 2014-09-18 | 2024-09-03 | Cilag Gmbh International | Surgical instrument including a deployable knife |
US11284898B2 (en) | 2014-09-18 | 2022-03-29 | Cilag Gmbh International | Surgical instrument including a deployable knife |
US11202633B2 (en) | 2014-09-26 | 2021-12-21 | Cilag Gmbh International | Surgical stapling buttresses and adjunct materials |
US10327764B2 (en) | 2014-09-26 | 2019-06-25 | Ethicon Llc | Method for creating a flexible staple line |
US10206677B2 (en) | 2014-09-26 | 2019-02-19 | Ethicon Llc | Surgical staple and driver arrangements for staple cartridges |
US10426477B2 (en) | 2014-09-26 | 2019-10-01 | Ethicon Llc | Staple cartridge assembly including a ramp |
US11523821B2 (en) | 2014-09-26 | 2022-12-13 | Cilag Gmbh International | Method for creating a flexible staple line |
US10751053B2 (en) | 2014-09-26 | 2020-08-25 | Ethicon Llc | Fastener cartridges for applying expandable fastener lines |
US12016564B2 (en) | 2014-09-26 | 2024-06-25 | Cilag Gmbh International | Circular fastener cartridges for applying radially expandable fastener lines |
US10426476B2 (en) | 2014-09-26 | 2019-10-01 | Ethicon Llc | Circular fastener cartridges for applying radially expandable fastener lines |
US10736630B2 (en) | 2014-10-13 | 2020-08-11 | Ethicon Llc | Staple cartridge |
US10905418B2 (en) | 2014-10-16 | 2021-02-02 | Ethicon Llc | Staple cartridge comprising a tissue thickness compensator |
US11701114B2 (en) | 2014-10-16 | 2023-07-18 | Cilag Gmbh International | Staple cartridge |
US11918210B2 (en) | 2014-10-16 | 2024-03-05 | Cilag Gmbh International | Staple cartridge comprising a cartridge body including a plurality of wells |
US12004741B2 (en) | 2014-10-16 | 2024-06-11 | Cilag Gmbh International | Staple cartridge comprising a tissue thickness compensator |
US11185325B2 (en) | 2014-10-16 | 2021-11-30 | Cilag Gmbh International | End effector including different tissue gaps |
US11931031B2 (en) | 2014-10-16 | 2024-03-19 | Cilag Gmbh International | Staple cartridge comprising a deck including an upper surface and a lower surface |
US11864760B2 (en) | 2014-10-29 | 2024-01-09 | Cilag Gmbh International | Staple cartridges comprising driver arrangements |
US11931038B2 (en) | 2014-10-29 | 2024-03-19 | Cilag Gmbh International | Cartridge assemblies for surgical staplers |
US11457918B2 (en) | 2014-10-29 | 2022-10-04 | Cilag Gmbh International | Cartridge assemblies for surgical staplers |
US11141153B2 (en) | 2014-10-29 | 2021-10-12 | Cilag Gmbh International | Staple cartridges comprising driver arrangements |
US11241229B2 (en) | 2014-10-29 | 2022-02-08 | Cilag Gmbh International | Staple cartridges comprising driver arrangements |
US10517594B2 (en) | 2014-10-29 | 2019-12-31 | Ethicon Llc | Cartridge assemblies for surgical staplers |
US10617417B2 (en) | 2014-11-06 | 2020-04-14 | Ethicon Llc | Staple cartridge comprising a releasable adjunct material |
US11337698B2 (en) | 2014-11-06 | 2022-05-24 | Cilag Gmbh International | Staple cartridge comprising a releasable adjunct material |
US10736636B2 (en) | 2014-12-10 | 2020-08-11 | Ethicon Llc | Articulatable surgical instrument system |
US11382628B2 (en) | 2014-12-10 | 2022-07-12 | Cilag Gmbh International | Articulatable surgical instrument system |
US10245027B2 (en) | 2014-12-18 | 2019-04-02 | Ethicon Llc | Surgical instrument with an anvil that is selectively movable about a discrete non-movable axis relative to a staple cartridge |
US10188385B2 (en) | 2014-12-18 | 2019-01-29 | Ethicon Llc | Surgical instrument system comprising lockable systems |
US10945728B2 (en) | 2014-12-18 | 2021-03-16 | Ethicon Llc | Locking arrangements for detachable shaft assemblies with articulatable surgical end effectors |
US10695058B2 (en) | 2014-12-18 | 2020-06-30 | Ethicon Llc | Surgical instrument systems comprising an articulatable end effector and means for adjusting the firing stroke of a firing member |
US10806448B2 (en) | 2014-12-18 | 2020-10-20 | Ethicon Llc | Surgical instrument assembly comprising a flexible articulation system |
US11083453B2 (en) | 2014-12-18 | 2021-08-10 | Cilag Gmbh International | Surgical stapling system including a flexible firing actuator and lateral buckling supports |
US11547404B2 (en) | 2014-12-18 | 2023-01-10 | Cilag Gmbh International | Surgical instrument assembly comprising a flexible articulation system |
US11399831B2 (en) | 2014-12-18 | 2022-08-02 | Cilag Gmbh International | Drive arrangements for articulatable surgical instruments |
US11547403B2 (en) | 2014-12-18 | 2023-01-10 | Cilag Gmbh International | Surgical instrument having a laminate firing actuator and lateral buckling supports |
US12029419B2 (en) | 2014-12-18 | 2024-07-09 | Cilag Gmbh International | Surgical instrument including a flexible support configured to support a flexible firing member |
US11812958B2 (en) | 2014-12-18 | 2023-11-14 | Cilag Gmbh International | Locking arrangements for detachable shaft assemblies with articulatable surgical end effectors |
US11553911B2 (en) | 2014-12-18 | 2023-01-17 | Cilag Gmbh International | Surgical instrument assembly comprising a flexible articulation system |
US10743873B2 (en) | 2014-12-18 | 2020-08-18 | Ethicon Llc | Drive arrangements for articulatable surgical instruments |
US11678877B2 (en) | 2014-12-18 | 2023-06-20 | Cilag Gmbh International | Surgical instrument including a flexible support configured to support a flexible firing member |
US11517311B2 (en) | 2014-12-18 | 2022-12-06 | Cilag Gmbh International | Surgical instrument systems comprising an articulatable end effector and means for adjusting the firing stroke of a firing member |
US11571207B2 (en) | 2014-12-18 | 2023-02-07 | Cilag Gmbh International | Surgical system including lateral supports for a flexible drive member |
US11154301B2 (en) | 2015-02-27 | 2021-10-26 | Cilag Gmbh International | Modular stapling assembly |
US11324506B2 (en) | 2015-02-27 | 2022-05-10 | Cilag Gmbh International | Modular stapling assembly |
US11744588B2 (en) | 2015-02-27 | 2023-09-05 | Cilag Gmbh International | Surgical stapling instrument including a removably attachable battery pack |
US12076018B2 (en) | 2015-02-27 | 2024-09-03 | Cilag Gmbh International | Modular stapling assembly |
US10159483B2 (en) | 2015-02-27 | 2018-12-25 | Ethicon Llc | Surgical apparatus configured to track an end-of-life parameter |
US10180463B2 (en) | 2015-02-27 | 2019-01-15 | Ethicon Llc | Surgical apparatus configured to assess whether a performance parameter of the surgical apparatus is within an acceptable performance band |
US10245028B2 (en) | 2015-02-27 | 2019-04-02 | Ethicon Llc | Power adapter for a surgical instrument |
US10182816B2 (en) | 2015-02-27 | 2019-01-22 | Ethicon Llc | Charging system that enables emergency resolutions for charging a battery |
US10966627B2 (en) | 2015-03-06 | 2021-04-06 | Ethicon Llc | Time dependent evaluation of sensor data to determine stability, creep, and viscoelastic elements of measures |
US10617412B2 (en) | 2015-03-06 | 2020-04-14 | Ethicon Llc | System for detecting the mis-insertion of a staple cartridge into a surgical stapler |
US11426160B2 (en) | 2015-03-06 | 2022-08-30 | Cilag Gmbh International | Smart sensors with local signal processing |
US10206605B2 (en) | 2015-03-06 | 2019-02-19 | Ethicon Llc | Time dependent evaluation of sensor data to determine stability, creep, and viscoelastic elements of measures |
US10524787B2 (en) | 2015-03-06 | 2020-01-07 | Ethicon Llc | Powered surgical instrument with parameter-based firing rate |
US10531887B2 (en) | 2015-03-06 | 2020-01-14 | Ethicon Llc | Powered surgical instrument including speed display |
US11944338B2 (en) | 2015-03-06 | 2024-04-02 | Cilag Gmbh International | Multiple level thresholds to modify operation of powered surgical instruments |
US10548504B2 (en) | 2015-03-06 | 2020-02-04 | Ethicon Llc | Overlaid multi sensor radio frequency (RF) electrode system to measure tissue compression |
US11350843B2 (en) | 2015-03-06 | 2022-06-07 | Cilag Gmbh International | Time dependent evaluation of sensor data to determine stability, creep, and viscoelastic elements of measures |
US10729432B2 (en) | 2015-03-06 | 2020-08-04 | Ethicon Llc | Methods for operating a powered surgical instrument |
US10441279B2 (en) | 2015-03-06 | 2019-10-15 | Ethicon Llc | Multiple level thresholds to modify operation of powered surgical instruments |
US11224423B2 (en) | 2015-03-06 | 2022-01-18 | Cilag Gmbh International | Smart sensors with local signal processing |
US11826132B2 (en) | 2015-03-06 | 2023-11-28 | Cilag Gmbh International | Time dependent evaluation of sensor data to determine stability, creep, and viscoelastic elements of measures |
US10245033B2 (en) | 2015-03-06 | 2019-04-02 | Ethicon Llc | Surgical instrument comprising a lockable battery housing |
US11109859B2 (en) | 2015-03-06 | 2021-09-07 | Cilag Gmbh International | Surgical instrument comprising a lockable battery housing |
US10687806B2 (en) | 2015-03-06 | 2020-06-23 | Ethicon Llc | Adaptive tissue compression techniques to adjust closure rates for multiple tissue types |
US10772625B2 (en) | 2015-03-06 | 2020-09-15 | Ethicon Llc | Signal and power communication system positioned on a rotatable shaft |
US10213201B2 (en) | 2015-03-31 | 2019-02-26 | Ethicon Llc | Stapling end effector configured to compensate for an uneven gap between a first jaw and a second jaw |
US10433844B2 (en) | 2015-03-31 | 2019-10-08 | Ethicon Llc | Surgical instrument with selectively disengageable threaded drive systems |
US11918212B2 (en) | 2015-03-31 | 2024-03-05 | Cilag Gmbh International | Surgical instrument with selectively disengageable drive systems |
US10835249B2 (en) | 2015-08-17 | 2020-11-17 | Ethicon Llc | Implantable layers for a surgical instrument |
US10617418B2 (en) | 2015-08-17 | 2020-04-14 | Ethicon Llc | Implantable layers for a surgical instrument |
US11058425B2 (en) | 2015-08-17 | 2021-07-13 | Ethicon Llc | Implantable layers for a surgical instrument |
US11849946B2 (en) | 2015-09-23 | 2023-12-26 | Cilag Gmbh International | Surgical stapler having downstream current-based motor control |
US11490889B2 (en) | 2015-09-23 | 2022-11-08 | Cilag Gmbh International | Surgical stapler having motor control based on an electrical parameter related to a motor current |
US10327769B2 (en) | 2015-09-23 | 2019-06-25 | Ethicon Llc | Surgical stapler having motor control based on a drive system component |
US11026678B2 (en) | 2015-09-23 | 2021-06-08 | Cilag Gmbh International | Surgical stapler having motor control based on an electrical parameter related to a motor current |
US10363036B2 (en) | 2015-09-23 | 2019-07-30 | Ethicon Llc | Surgical stapler having force-based motor control |
US10863986B2 (en) | 2015-09-23 | 2020-12-15 | Ethicon Llc | Surgical stapler having downstream current-based motor control |
US10238386B2 (en) | 2015-09-23 | 2019-03-26 | Ethicon Llc | Surgical stapler having motor control based on an electrical parameter related to a motor current |
US11344299B2 (en) | 2015-09-23 | 2022-05-31 | Cilag Gmbh International | Surgical stapler having downstream current-based motor control |
US10299878B2 (en) | 2015-09-25 | 2019-05-28 | Ethicon Llc | Implantable adjunct systems for determining adjunct skew |
US11076929B2 (en) | 2015-09-25 | 2021-08-03 | Cilag Gmbh International | Implantable adjunct systems for determining adjunct skew |
US10736633B2 (en) | 2015-09-30 | 2020-08-11 | Ethicon Llc | Compressible adjunct with looping members |
US10603039B2 (en) | 2015-09-30 | 2020-03-31 | Ethicon Llc | Progressively releasable implantable adjunct for use with a surgical stapling instrument |
US10524788B2 (en) | 2015-09-30 | 2020-01-07 | Ethicon Llc | Compressible adjunct with attachment regions |
US10271849B2 (en) | 2015-09-30 | 2019-04-30 | Ethicon Llc | Woven constructs with interlocked standing fibers |
US11553916B2 (en) | 2015-09-30 | 2023-01-17 | Cilag Gmbh International | Compressible adjunct with crossing spacer fibers |
US10172620B2 (en) | 2015-09-30 | 2019-01-08 | Ethicon Llc | Compressible adjuncts with bonding nodes |
US10932779B2 (en) | 2015-09-30 | 2021-03-02 | Ethicon Llc | Compressible adjunct with crossing spacer fibers |
US11944308B2 (en) | 2015-09-30 | 2024-04-02 | Cilag Gmbh International | Compressible adjunct with crossing spacer fibers |
US10285699B2 (en) | 2015-09-30 | 2019-05-14 | Ethicon Llc | Compressible adjunct |
US10307160B2 (en) | 2015-09-30 | 2019-06-04 | Ethicon Llc | Compressible adjunct assemblies with attachment layers |
US10561420B2 (en) | 2015-09-30 | 2020-02-18 | Ethicon Llc | Tubular absorbable constructs |
US11690623B2 (en) | 2015-09-30 | 2023-07-04 | Cilag Gmbh International | Method for applying an implantable layer to a fastener cartridge |
US11890015B2 (en) | 2015-09-30 | 2024-02-06 | Cilag Gmbh International | Compressible adjunct with crossing spacer fibers |
US10433846B2 (en) | 2015-09-30 | 2019-10-08 | Ethicon Llc | Compressible adjunct with crossing spacer fibers |
US10478188B2 (en) | 2015-09-30 | 2019-11-19 | Ethicon Llc | Implantable layer comprising a constricted configuration |
US11712244B2 (en) | 2015-09-30 | 2023-08-01 | Cilag Gmbh International | Implantable layer with spacer fibers |
US10327777B2 (en) | 2015-09-30 | 2019-06-25 | Ethicon Llc | Implantable layer comprising plastically deformed fibers |
US10980539B2 (en) | 2015-09-30 | 2021-04-20 | Ethicon Llc | Implantable adjunct comprising bonded layers |
US11793522B2 (en) | 2015-09-30 | 2023-10-24 | Cilag Gmbh International | Staple cartridge assembly including a compressible adjunct |
US11903586B2 (en) | 2015-09-30 | 2024-02-20 | Cilag Gmbh International | Compressible adjunct with crossing spacer fibers |
US11129613B2 (en) | 2015-12-30 | 2021-09-28 | Cilag Gmbh International | Surgical instruments with separable motors and motor control circuits |
US11484309B2 (en) | 2015-12-30 | 2022-11-01 | Cilag Gmbh International | Surgical stapling system comprising a controller configured to cause a motor to reset a firing sequence |
US10368865B2 (en) | 2015-12-30 | 2019-08-06 | Ethicon Llc | Mechanisms for compensating for drivetrain failure in powered surgical instruments |
US10265068B2 (en) | 2015-12-30 | 2019-04-23 | Ethicon Llc | Surgical instruments with separable motors and motor control circuits |
US10292704B2 (en) | 2015-12-30 | 2019-05-21 | Ethicon Llc | Mechanisms for compensating for battery pack failure in powered surgical instruments |
US11759208B2 (en) | 2015-12-30 | 2023-09-19 | Cilag Gmbh International | Mechanisms for compensating for battery pack failure in powered surgical instruments |
US11058422B2 (en) | 2015-12-30 | 2021-07-13 | Cilag Gmbh International | Mechanisms for compensating for battery pack failure in powered surgical instruments |
US11083454B2 (en) | 2015-12-30 | 2021-08-10 | Cilag Gmbh International | Mechanisms for compensating for drivetrain failure in powered surgical instruments |
US11213293B2 (en) | 2016-02-09 | 2022-01-04 | Cilag Gmbh International | Articulatable surgical instruments with single articulation link arrangements |
US10470764B2 (en) | 2016-02-09 | 2019-11-12 | Ethicon Llc | Surgical instruments with closure stroke reduction arrangements |
US11523823B2 (en) | 2016-02-09 | 2022-12-13 | Cilag Gmbh International | Surgical instruments with non-symmetrical articulation arrangements |
US10245029B2 (en) | 2016-02-09 | 2019-04-02 | Ethicon Llc | Surgical instrument with articulating and axially translatable end effector |
US10588625B2 (en) | 2016-02-09 | 2020-03-17 | Ethicon Llc | Articulatable surgical instruments with off-axis firing beam arrangements |
US10413291B2 (en) | 2016-02-09 | 2019-09-17 | Ethicon Llc | Surgical instrument articulation mechanism with slotted secondary constraint |
US10433837B2 (en) | 2016-02-09 | 2019-10-08 | Ethicon Llc | Surgical instruments with multiple link articulation arrangements |
US10245030B2 (en) | 2016-02-09 | 2019-04-02 | Ethicon Llc | Surgical instruments with tensioning arrangements for cable driven articulation systems |
US10653413B2 (en) | 2016-02-09 | 2020-05-19 | Ethicon Llc | Surgical instruments with an end effector that is highly articulatable relative to an elongate shaft assembly |
US11730471B2 (en) | 2016-02-09 | 2023-08-22 | Cilag Gmbh International | Articulatable surgical instruments with single articulation link arrangements |
US11779336B2 (en) | 2016-02-12 | 2023-10-10 | Cilag Gmbh International | Mechanisms for compensating for drivetrain failure in powered surgical instruments |
US10258331B2 (en) | 2016-02-12 | 2019-04-16 | Ethicon Llc | Mechanisms for compensating for drivetrain failure in powered surgical instruments |
US11826045B2 (en) | 2016-02-12 | 2023-11-28 | Cilag Gmbh International | Mechanisms for compensating for drivetrain failure in powered surgical instruments |
US11224426B2 (en) | 2016-02-12 | 2022-01-18 | Cilag Gmbh International | Mechanisms for compensating for drivetrain failure in powered surgical instruments |
US11344303B2 (en) | 2016-02-12 | 2022-05-31 | Cilag Gmbh International | Mechanisms for compensating for drivetrain failure in powered surgical instruments |
US10448948B2 (en) | 2016-02-12 | 2019-10-22 | Ethicon Llc | Mechanisms for compensating for drivetrain failure in powered surgical instruments |
US10376263B2 (en) | 2016-04-01 | 2019-08-13 | Ethicon Llc | Anvil modification members for surgical staplers |
US10617413B2 (en) | 2016-04-01 | 2020-04-14 | Ethicon Llc | Closure system arrangements for surgical cutting and stapling devices with separate and distinct firing shafts |
US10335145B2 (en) | 2016-04-15 | 2019-07-02 | Ethicon Llc | Modular surgical instrument with configurable operating mode |
US11191545B2 (en) | 2016-04-15 | 2021-12-07 | Cilag Gmbh International | Staple formation detection mechanisms |
US11284891B2 (en) | 2016-04-15 | 2022-03-29 | Cilag Gmbh International | Surgical instrument with multiple program responses during a firing motion |
US10426467B2 (en) | 2016-04-15 | 2019-10-01 | Ethicon Llc | Surgical instrument with detection sensors |
US10492783B2 (en) | 2016-04-15 | 2019-12-03 | Ethicon, Llc | Surgical instrument with improved stop/start control during a firing motion |
US10405859B2 (en) | 2016-04-15 | 2019-09-10 | Ethicon Llc | Surgical instrument with adjustable stop/start control during a firing motion |
US11350932B2 (en) | 2016-04-15 | 2022-06-07 | Cilag Gmbh International | Surgical instrument with improved stop/start control during a firing motion |
US11642125B2 (en) | 2016-04-15 | 2023-05-09 | Cilag Gmbh International | Robotic surgical system including a user interface and a control circuit |
US11026684B2 (en) | 2016-04-15 | 2021-06-08 | Ethicon Llc | Surgical instrument with multiple program responses during a firing motion |
US10828028B2 (en) | 2016-04-15 | 2020-11-10 | Ethicon Llc | Surgical instrument with multiple program responses during a firing motion |
US11607239B2 (en) | 2016-04-15 | 2023-03-21 | Cilag Gmbh International | Systems and methods for controlling a surgical stapling and cutting instrument |
US11051810B2 (en) | 2016-04-15 | 2021-07-06 | Cilag Gmbh International | Modular surgical instrument with configurable operating mode |
US10456137B2 (en) | 2016-04-15 | 2019-10-29 | Ethicon Llc | Staple formation detection mechanisms |
US11517306B2 (en) | 2016-04-15 | 2022-12-06 | Cilag Gmbh International | Surgical instrument with detection sensors |
US11771454B2 (en) | 2016-04-15 | 2023-10-03 | Cilag Gmbh International | Stapling assembly including a controller for monitoring a clamping laod |
US11179150B2 (en) | 2016-04-15 | 2021-11-23 | Cilag Gmbh International | Systems and methods for controlling a surgical stapling and cutting instrument |
US11317910B2 (en) | 2016-04-15 | 2022-05-03 | Cilag Gmbh International | Surgical instrument with detection sensors |
US11311292B2 (en) | 2016-04-15 | 2022-04-26 | Cilag Gmbh International | Surgical instrument with detection sensors |
US11931028B2 (en) | 2016-04-15 | 2024-03-19 | Cilag Gmbh International | Surgical instrument with multiple program responses during a firing motion |
US10357247B2 (en) | 2016-04-15 | 2019-07-23 | Ethicon Llc | Surgical instrument with multiple program responses during a firing motion |
US11559303B2 (en) | 2016-04-18 | 2023-01-24 | Cilag Gmbh International | Cartridge lockout arrangements for rotary powered surgical cutting and stapling instruments |
US10433840B2 (en) | 2016-04-18 | 2019-10-08 | Ethicon Llc | Surgical instrument comprising a replaceable cartridge jaw |
US11147554B2 (en) | 2016-04-18 | 2021-10-19 | Cilag Gmbh International | Surgical instrument system comprising a magnetic lockout |
US11811253B2 (en) | 2016-04-18 | 2023-11-07 | Cilag Gmbh International | Surgical robotic system with fault state detection configurations based on motor current draw |
US10363037B2 (en) | 2016-04-18 | 2019-07-30 | Ethicon Llc | Surgical instrument system comprising a magnetic lockout |
US10368867B2 (en) | 2016-04-18 | 2019-08-06 | Ethicon Llc | Surgical instrument comprising a lockout |
US10426469B2 (en) | 2016-04-18 | 2019-10-01 | Ethicon Llc | Surgical instrument comprising a primary firing lockout and a secondary firing lockout |
US11317917B2 (en) | 2016-04-18 | 2022-05-03 | Cilag Gmbh International | Surgical stapling system comprising a lockable firing assembly |
US10478181B2 (en) | 2016-04-18 | 2019-11-19 | Ethicon Llc | Cartridge lockout arrangements for rotary powered surgical cutting and stapling instruments |
US11350928B2 (en) | 2016-04-18 | 2022-06-07 | Cilag Gmbh International | Surgical instrument comprising a tissue thickness lockout and speed control system |
US10588630B2 (en) | 2016-12-21 | 2020-03-17 | Ethicon Llc | Surgical tool assemblies with closure stroke reduction features |
US11564688B2 (en) | 2016-12-21 | 2023-01-31 | Cilag Gmbh International | Robotic surgical tool having a retraction mechanism |
US10736629B2 (en) | 2016-12-21 | 2020-08-11 | Ethicon Llc | Surgical tool assemblies with clutching arrangements for shifting between closure systems with closure stroke reduction features and articulation and firing systems |
US10898186B2 (en) | 2016-12-21 | 2021-01-26 | Ethicon Llc | Staple forming pocket arrangements comprising primary sidewalls and pocket sidewalls |
US10667811B2 (en) | 2016-12-21 | 2020-06-02 | Ethicon Llc | Surgical stapling instruments and staple-forming anvils |
US11419606B2 (en) | 2016-12-21 | 2022-08-23 | Cilag Gmbh International | Shaft assembly comprising a clutch configured to adapt the output of a rotary firing member to two different systems |
US10517596B2 (en) | 2016-12-21 | 2019-12-31 | Ethicon Llc | Articulatable surgical instruments with articulation stroke amplification features |
US11701115B2 (en) | 2016-12-21 | 2023-07-18 | Cilag Gmbh International | Methods of stapling tissue |
US11350935B2 (en) | 2016-12-21 | 2022-06-07 | Cilag Gmbh International | Surgical tool assemblies with closure stroke reduction features |
US10758229B2 (en) | 2016-12-21 | 2020-09-01 | Ethicon Llc | Surgical instrument comprising improved jaw control |
US10517595B2 (en) | 2016-12-21 | 2019-12-31 | Ethicon Llc | Jaw actuated lock arrangements for preventing advancement of a firing member in a surgical end effector unless an unfired cartridge is installed in the end effector |
US10758230B2 (en) | 2016-12-21 | 2020-09-01 | Ethicon Llc | Surgical instrument with primary and safety processors |
US10639035B2 (en) | 2016-12-21 | 2020-05-05 | Ethicon Llc | Surgical stapling instruments and replaceable tool assemblies thereof |
US10524789B2 (en) | 2016-12-21 | 2020-01-07 | Ethicon Llc | Laterally actuatable articulation lock arrangements for locking an end effector of a surgical instrument in an articulated configuration |
US10499914B2 (en) | 2016-12-21 | 2019-12-10 | Ethicon Llc | Staple forming pocket arrangements |
US10639034B2 (en) | 2016-12-21 | 2020-05-05 | Ethicon Llc | Surgical instruments with lockout arrangements for preventing firing system actuation unless an unspent staple cartridge is present |
US10905422B2 (en) | 2016-12-21 | 2021-02-02 | Ethicon Llc | Surgical instrument for use with a robotic surgical system |
US10426471B2 (en) | 2016-12-21 | 2019-10-01 | Ethicon Llc | Surgical instrument with multiple failure response modes |
US10893864B2 (en) | 2016-12-21 | 2021-01-19 | Ethicon | Staple cartridges and arrangements of staples and staple cavities therein |
US10918385B2 (en) | 2016-12-21 | 2021-02-16 | Ethicon Llc | Surgical system comprising a firing member rotatable into an articulation state to articulate an end effector of the surgical system |
US12011166B2 (en) | 2016-12-21 | 2024-06-18 | Cilag Gmbh International | Articulatable surgical stapling instruments |
US10537325B2 (en) | 2016-12-21 | 2020-01-21 | Ethicon Llc | Staple forming pocket arrangement to accommodate different types of staples |
US12004745B2 (en) | 2016-12-21 | 2024-06-11 | Cilag Gmbh International | Surgical instrument system comprising an end effector lockout and a firing assembly lockout |
US10959727B2 (en) | 2016-12-21 | 2021-03-30 | Ethicon Llc | Articulatable surgical end effector with asymmetric shaft arrangement |
US10542982B2 (en) | 2016-12-21 | 2020-01-28 | Ethicon Llc | Shaft assembly comprising first and second articulation lockouts |
US11849948B2 (en) | 2016-12-21 | 2023-12-26 | Cilag Gmbh International | Method for resetting a fuse of a surgical instrument shaft |
US10624635B2 (en) | 2016-12-21 | 2020-04-21 | Ethicon Llc | Firing members with non-parallel jaw engagement features for surgical end effectors |
US11350934B2 (en) | 2016-12-21 | 2022-06-07 | Cilag Gmbh International | Staple forming pocket arrangement to accommodate different types of staples |
US11224428B2 (en) | 2016-12-21 | 2022-01-18 | Cilag Gmbh International | Surgical stapling systems |
US10973516B2 (en) | 2016-12-21 | 2021-04-13 | Ethicon Llc | Surgical end effectors and adaptable firing members therefor |
US10492785B2 (en) | 2016-12-21 | 2019-12-03 | Ethicon Llc | Shaft assembly comprising a lockout |
US10779823B2 (en) | 2016-12-21 | 2020-09-22 | Ethicon Llc | Firing member pin angle |
US10675026B2 (en) | 2016-12-21 | 2020-06-09 | Ethicon Llc | Methods of stapling tissue |
US11653917B2 (en) | 2016-12-21 | 2023-05-23 | Cilag Gmbh International | Surgical stapling systems |
US11497499B2 (en) | 2016-12-21 | 2022-11-15 | Cilag Gmbh International | Articulatable surgical stapling instruments |
US11191539B2 (en) | 2016-12-21 | 2021-12-07 | Cilag Gmbh International | Shaft assembly comprising a manually-operable retraction system for use with a motorized surgical instrument system |
US10617414B2 (en) | 2016-12-21 | 2020-04-14 | Ethicon Llc | Closure member arrangements for surgical instruments |
US11931034B2 (en) | 2016-12-21 | 2024-03-19 | Cilag Gmbh International | Surgical stapling instruments with smart staple cartridges |
US10610224B2 (en) | 2016-12-21 | 2020-04-07 | Ethicon Llc | Lockout arrangements for surgical end effectors and replaceable tool assemblies |
US11191540B2 (en) | 2016-12-21 | 2021-12-07 | Cilag Gmbh International | Protective cover arrangements for a joint interface between a movable jaw and actuator shaft of a surgical instrument |
US11191543B2 (en) | 2016-12-21 | 2021-12-07 | Cilag Gmbh International | Assembly comprising a lock |
US10980536B2 (en) | 2016-12-21 | 2021-04-20 | Ethicon Llc | No-cartridge and spent cartridge lockout arrangements for surgical staplers |
US11179155B2 (en) | 2016-12-21 | 2021-11-23 | Cilag Gmbh International | Anvil arrangements for surgical staplers |
US10568624B2 (en) | 2016-12-21 | 2020-02-25 | Ethicon Llc | Surgical instruments with jaws that are pivotable about a fixed axis and include separate and distinct closure and firing systems |
US10888322B2 (en) | 2016-12-21 | 2021-01-12 | Ethicon Llc | Surgical instrument comprising a cutting member |
US11957344B2 (en) | 2016-12-21 | 2024-04-16 | Cilag Gmbh International | Surgical stapler having rows of obliquely oriented staples |
US10485543B2 (en) | 2016-12-21 | 2019-11-26 | Ethicon Llc | Anvil having a knife slot width |
US10568626B2 (en) | 2016-12-21 | 2020-02-25 | Ethicon Llc | Surgical instruments with jaw opening features for increasing a jaw opening distance |
US10667809B2 (en) | 2016-12-21 | 2020-06-02 | Ethicon Llc | Staple cartridge and staple cartridge channel comprising windows defined therein |
US10603036B2 (en) | 2016-12-21 | 2020-03-31 | Ethicon Llc | Articulatable surgical instrument with independent pivotable linkage distal of an articulation lock |
US10568625B2 (en) | 2016-12-21 | 2020-02-25 | Ethicon Llc | Staple cartridges and arrangements of staples and staple cavities therein |
US11160553B2 (en) | 2016-12-21 | 2021-11-02 | Cilag Gmbh International | Surgical stapling systems |
US11160551B2 (en) | 2016-12-21 | 2021-11-02 | Cilag Gmbh International | Articulatable surgical stapling instruments |
US10813638B2 (en) | 2016-12-21 | 2020-10-27 | Ethicon Llc | Surgical end effectors with expandable tissue stop arrangements |
US10582928B2 (en) | 2016-12-21 | 2020-03-10 | Ethicon Llc | Articulation lock arrangements for locking an end effector in an articulated position in response to actuation of a jaw closure system |
US10835247B2 (en) | 2016-12-21 | 2020-11-17 | Ethicon Llc | Lockout arrangements for surgical end effectors |
US10835245B2 (en) | 2016-12-21 | 2020-11-17 | Ethicon Llc | Method for attaching a shaft assembly to a surgical instrument and, alternatively, to a surgical robot |
US10881401B2 (en) | 2016-12-21 | 2021-01-05 | Ethicon Llc | Staple firing member comprising a missing cartridge and/or spent cartridge lockout |
US10675025B2 (en) | 2016-12-21 | 2020-06-09 | Ethicon Llc | Shaft assembly comprising separately actuatable and retractable systems |
US11918215B2 (en) | 2016-12-21 | 2024-03-05 | Cilag Gmbh International | Staple cartridge with array of staple pockets |
US10682138B2 (en) | 2016-12-21 | 2020-06-16 | Ethicon Llc | Bilaterally asymmetric staple forming pocket pairs |
US10588631B2 (en) | 2016-12-21 | 2020-03-17 | Ethicon Llc | Surgical instruments with positive jaw opening features |
US10667810B2 (en) | 2016-12-21 | 2020-06-02 | Ethicon Llc | Closure members with cam surface arrangements for surgical instruments with separate and distinct closure and firing systems |
US10687809B2 (en) | 2016-12-21 | 2020-06-23 | Ethicon Llc | Surgical staple cartridge with movable camming member configured to disengage firing member lockout features |
US11766259B2 (en) | 2016-12-21 | 2023-09-26 | Cilag Gmbh International | Method of deforming staples from two different types of staple cartridges with the same surgical stapling instrument |
US11766260B2 (en) | 2016-12-21 | 2023-09-26 | Cilag Gmbh International | Methods of stapling tissue |
US11134942B2 (en) | 2016-12-21 | 2021-10-05 | Cilag Gmbh International | Surgical stapling instruments and staple-forming anvils |
US11317913B2 (en) | 2016-12-21 | 2022-05-03 | Cilag Gmbh International | Lockout arrangements for surgical end effectors and replaceable tool assemblies |
US11369376B2 (en) | 2016-12-21 | 2022-06-28 | Cilag Gmbh International | Surgical stapling systems |
US10448950B2 (en) | 2016-12-21 | 2019-10-22 | Ethicon Llc | Surgical staplers with independently actuatable closing and firing systems |
US10695055B2 (en) | 2016-12-21 | 2020-06-30 | Ethicon Llc | Firing assembly comprising a lockout |
US11992213B2 (en) | 2016-12-21 | 2024-05-28 | Cilag Gmbh International | Surgical stapling instruments with replaceable staple cartridges |
US10856868B2 (en) | 2016-12-21 | 2020-12-08 | Ethicon Llc | Firing member pin configurations |
US10588632B2 (en) | 2016-12-21 | 2020-03-17 | Ethicon Llc | Surgical end effectors and firing members thereof |
US11096689B2 (en) | 2016-12-21 | 2021-08-24 | Cilag Gmbh International | Shaft assembly comprising a lockout |
US11090048B2 (en) | 2016-12-21 | 2021-08-17 | Cilag Gmbh International | Method for resetting a fuse of a surgical instrument shaft |
US11571210B2 (en) | 2016-12-21 | 2023-02-07 | Cilag Gmbh International | Firing assembly comprising a multiple failed-state fuse |
US11225517B2 (en) | 2017-02-16 | 2022-01-18 | Janssen Biotech, Inc. | Treatment of hidradenitis suppurativa |
EP3582813A4 (en) * | 2017-02-16 | 2020-12-30 | XBiotech, Inc | Treatment of hidradenitis suppurativa |
US10888321B2 (en) | 2017-06-20 | 2021-01-12 | Ethicon Llc | Systems and methods for controlling velocity of a displacement member of a surgical stapling and cutting instrument |
US11090046B2 (en) | 2017-06-20 | 2021-08-17 | Cilag Gmbh International | Systems and methods for controlling displacement member motion of a surgical stapling and cutting instrument |
US10624633B2 (en) | 2017-06-20 | 2020-04-21 | Ethicon Llc | Systems and methods for controlling motor velocity of a surgical stapling and cutting instrument |
US10595882B2 (en) | 2017-06-20 | 2020-03-24 | Ethicon Llc | Methods for closed loop control of motor velocity of a surgical stapling and cutting instrument |
US11382638B2 (en) | 2017-06-20 | 2022-07-12 | Cilag Gmbh International | Closed loop feedback control of motor velocity of a surgical stapling and cutting instrument based on measured time over a specified displacement distance |
US10646220B2 (en) | 2017-06-20 | 2020-05-12 | Ethicon Llc | Systems and methods for controlling displacement member velocity for a surgical instrument |
US10327767B2 (en) | 2017-06-20 | 2019-06-25 | Ethicon Llc | Control of motor velocity of a surgical stapling and cutting instrument based on angle of articulation |
US10390841B2 (en) | 2017-06-20 | 2019-08-27 | Ethicon Llc | Control of motor velocity of a surgical stapling and cutting instrument based on angle of articulation |
US11672532B2 (en) | 2017-06-20 | 2023-06-13 | Cilag Gmbh International | Techniques for adaptive control of motor velocity of a surgical stapling and cutting instrument |
US11071554B2 (en) | 2017-06-20 | 2021-07-27 | Cilag Gmbh International | Closed loop feedback control of motor velocity of a surgical stapling and cutting instrument based on magnitude of velocity error measurements |
US10881399B2 (en) | 2017-06-20 | 2021-01-05 | Ethicon Llc | Techniques for adaptive control of motor velocity of a surgical stapling and cutting instrument |
US10307170B2 (en) | 2017-06-20 | 2019-06-04 | Ethicon Llc | Method for closed loop control of motor velocity of a surgical stapling and cutting instrument |
USD879808S1 (en) | 2017-06-20 | 2020-03-31 | Ethicon Llc | Display panel with graphical user interface |
US11871939B2 (en) | 2017-06-20 | 2024-01-16 | Cilag Gmbh International | Method for closed loop control of motor velocity of a surgical stapling and cutting instrument |
US11793513B2 (en) | 2017-06-20 | 2023-10-24 | Cilag Gmbh International | Systems and methods for controlling motor speed according to user input for a surgical instrument |
USD879809S1 (en) | 2017-06-20 | 2020-03-31 | Ethicon Llc | Display panel with changeable graphical user interface |
US10779820B2 (en) | 2017-06-20 | 2020-09-22 | Ethicon Llc | Systems and methods for controlling motor speed according to user input for a surgical instrument |
US11213302B2 (en) | 2017-06-20 | 2022-01-04 | Cilag Gmbh International | Method for closed loop control of motor velocity of a surgical stapling and cutting instrument |
US10980537B2 (en) | 2017-06-20 | 2021-04-20 | Ethicon Llc | Closed loop feedback control of motor velocity of a surgical stapling and cutting instrument based on measured time over a specified number of shaft rotations |
USD1039559S1 (en) | 2017-06-20 | 2024-08-20 | Cilag Gmbh International | Display panel with changeable graphical user interface |
US11653914B2 (en) | 2017-06-20 | 2023-05-23 | Cilag Gmbh International | Systems and methods for controlling motor velocity of a surgical stapling and cutting instrument according to articulation angle of end effector |
US10368864B2 (en) | 2017-06-20 | 2019-08-06 | Ethicon Llc | Systems and methods for controlling displaying motor velocity for a surgical instrument |
US10881396B2 (en) | 2017-06-20 | 2021-01-05 | Ethicon Llc | Surgical instrument with variable duration trigger arrangement |
US10813639B2 (en) | 2017-06-20 | 2020-10-27 | Ethicon Llc | Closed loop feedback control of motor velocity of a surgical stapling and cutting instrument based on system conditions |
US11517325B2 (en) | 2017-06-20 | 2022-12-06 | Cilag Gmbh International | Closed loop feedback control of motor velocity of a surgical stapling and cutting instrument based on measured displacement distance traveled over a specified time interval |
USD890784S1 (en) | 2017-06-20 | 2020-07-21 | Ethicon Llc | Display panel with changeable graphical user interface |
US11766258B2 (en) | 2017-06-27 | 2023-09-26 | Cilag Gmbh International | Surgical anvil arrangements |
US10993716B2 (en) | 2017-06-27 | 2021-05-04 | Ethicon Llc | Surgical anvil arrangements |
US11090049B2 (en) | 2017-06-27 | 2021-08-17 | Cilag Gmbh International | Staple forming pocket arrangements |
US11266405B2 (en) | 2017-06-27 | 2022-03-08 | Cilag Gmbh International | Surgical anvil manufacturing methods |
US10631859B2 (en) | 2017-06-27 | 2020-04-28 | Ethicon Llc | Articulation systems for surgical instruments |
US10772629B2 (en) | 2017-06-27 | 2020-09-15 | Ethicon Llc | Surgical anvil arrangements |
US10856869B2 (en) | 2017-06-27 | 2020-12-08 | Ethicon Llc | Surgical anvil arrangements |
US11324503B2 (en) | 2017-06-27 | 2022-05-10 | Cilag Gmbh International | Surgical firing member arrangements |
US11141154B2 (en) | 2017-06-27 | 2021-10-12 | Cilag Gmbh International | Surgical end effectors and anvils |
US10695057B2 (en) | 2017-06-28 | 2020-06-30 | Ethicon Llc | Surgical instrument lockout arrangement |
US11678880B2 (en) | 2017-06-28 | 2023-06-20 | Cilag Gmbh International | Surgical instrument comprising a shaft including a housing arrangement |
US11000279B2 (en) | 2017-06-28 | 2021-05-11 | Ethicon Llc | Surgical instrument comprising an articulation system ratio |
US11389161B2 (en) | 2017-06-28 | 2022-07-19 | Cilag Gmbh International | Surgical instrument comprising selectively actuatable rotatable couplers |
US10903685B2 (en) | 2017-06-28 | 2021-01-26 | Ethicon Llc | Surgical shaft assemblies with slip ring assemblies forming capacitive channels |
US10786253B2 (en) | 2017-06-28 | 2020-09-29 | Ethicon Llc | Surgical end effectors with improved jaw aperture arrangements |
US11484310B2 (en) | 2017-06-28 | 2022-11-01 | Cilag Gmbh International | Surgical instrument comprising a shaft including a closure tube profile |
US11642128B2 (en) | 2017-06-28 | 2023-05-09 | Cilag Gmbh International | Method for articulating a surgical instrument |
USD851762S1 (en) | 2017-06-28 | 2019-06-18 | Ethicon Llc | Anvil |
US11564686B2 (en) | 2017-06-28 | 2023-01-31 | Cilag Gmbh International | Surgical shaft assemblies with flexible interfaces |
USD854151S1 (en) | 2017-06-28 | 2019-07-16 | Ethicon Llc | Surgical instrument shaft |
US11478242B2 (en) | 2017-06-28 | 2022-10-25 | Cilag Gmbh International | Jaw retainer arrangement for retaining a pivotable surgical instrument jaw in pivotable retaining engagement with a second surgical instrument jaw |
US11058424B2 (en) | 2017-06-28 | 2021-07-13 | Cilag Gmbh International | Surgical instrument comprising an offset articulation joint |
US10211586B2 (en) | 2017-06-28 | 2019-02-19 | Ethicon Llc | Surgical shaft assemblies with watertight housings |
US10716614B2 (en) | 2017-06-28 | 2020-07-21 | Ethicon Llc | Surgical shaft assemblies with slip ring assemblies with increased contact pressure |
USD1018577S1 (en) | 2017-06-28 | 2024-03-19 | Cilag Gmbh International | Display screen or portion thereof with a graphical user interface for a surgical instrument |
US11020114B2 (en) | 2017-06-28 | 2021-06-01 | Cilag Gmbh International | Surgical instruments with articulatable end effector with axially shortened articulation joint configurations |
US10758232B2 (en) | 2017-06-28 | 2020-09-01 | Ethicon Llc | Surgical instrument with positive jaw opening features |
USD906355S1 (en) | 2017-06-28 | 2020-12-29 | Ethicon Llc | Display screen or portion thereof with a graphical user interface for a surgical instrument |
USD869655S1 (en) | 2017-06-28 | 2019-12-10 | Ethicon Llc | Surgical fastener cartridge |
US10779824B2 (en) | 2017-06-28 | 2020-09-22 | Ethicon Llc | Surgical instrument comprising an articulation system lockable by a closure system |
US11826048B2 (en) | 2017-06-28 | 2023-11-28 | Cilag Gmbh International | Surgical instrument comprising selectively actuatable rotatable couplers |
US10588633B2 (en) | 2017-06-28 | 2020-03-17 | Ethicon Llc | Surgical instruments with open and closable jaws and axially movable firing member that is initially parked in close proximity to the jaws prior to firing |
US11529140B2 (en) | 2017-06-28 | 2022-12-20 | Cilag Gmbh International | Surgical instrument lockout arrangement |
US11083455B2 (en) | 2017-06-28 | 2021-08-10 | Cilag Gmbh International | Surgical instrument comprising an articulation system ratio |
US10639037B2 (en) | 2017-06-28 | 2020-05-05 | Ethicon Llc | Surgical instrument with axially movable closure member |
US10765427B2 (en) | 2017-06-28 | 2020-09-08 | Ethicon Llc | Method for articulating a surgical instrument |
US11259805B2 (en) | 2017-06-28 | 2022-03-01 | Cilag Gmbh International | Surgical instrument comprising firing member supports |
US11246592B2 (en) | 2017-06-28 | 2022-02-15 | Cilag Gmbh International | Surgical instrument comprising an articulation system lockable to a frame |
US11696759B2 (en) | 2017-06-28 | 2023-07-11 | Cilag Gmbh International | Surgical stapling instruments comprising shortened staple cartridge noses |
US11007022B2 (en) | 2017-06-29 | 2021-05-18 | Ethicon Llc | Closed loop velocity control techniques based on sensed tissue parameters for robotic surgical instrument |
US10398434B2 (en) | 2017-06-29 | 2019-09-03 | Ethicon Llc | Closed loop velocity control of closure member for robotic surgical instrument |
US10898183B2 (en) | 2017-06-29 | 2021-01-26 | Ethicon Llc | Robotic surgical instrument with closed loop feedback techniques for advancement of closure member during firing |
US10932772B2 (en) | 2017-06-29 | 2021-03-02 | Ethicon Llc | Methods for closed loop velocity control for robotic surgical instrument |
US10258418B2 (en) | 2017-06-29 | 2019-04-16 | Ethicon Llc | System for controlling articulation forces |
US11890005B2 (en) | 2017-06-29 | 2024-02-06 | Cilag Gmbh International | Methods for closed loop velocity control for robotic surgical instrument |
US11974742B2 (en) | 2017-08-03 | 2024-05-07 | Cilag Gmbh International | Surgical system comprising an articulation bailout |
US11471155B2 (en) | 2017-08-03 | 2022-10-18 | Cilag Gmbh International | Surgical system bailout |
US11944300B2 (en) | 2017-08-03 | 2024-04-02 | Cilag Gmbh International | Method for operating a surgical system bailout |
US11304695B2 (en) | 2017-08-03 | 2022-04-19 | Cilag Gmbh International | Surgical system shaft interconnection |
US10729501B2 (en) | 2017-09-29 | 2020-08-04 | Ethicon Llc | Systems and methods for language selection of a surgical instrument |
USD917500S1 (en) | 2017-09-29 | 2021-04-27 | Ethicon Llc | Display screen or portion thereof with graphical user interface |
US10796471B2 (en) | 2017-09-29 | 2020-10-06 | Ethicon Llc | Systems and methods of displaying a knife position for a surgical instrument |
USD907647S1 (en) | 2017-09-29 | 2021-01-12 | Ethicon Llc | Display screen or portion thereof with animated graphical user interface |
US10765429B2 (en) | 2017-09-29 | 2020-09-08 | Ethicon Llc | Systems and methods for providing alerts according to the operational state of a surgical instrument |
USD907648S1 (en) | 2017-09-29 | 2021-01-12 | Ethicon Llc | Display screen or portion thereof with animated graphical user interface |
US11399829B2 (en) | 2017-09-29 | 2022-08-02 | Cilag Gmbh International | Systems and methods of initiating a power shutdown mode for a surgical instrument |
US11998199B2 (en) | 2017-09-29 | 2024-06-04 | Cllag GmbH International | System and methods for controlling a display of a surgical instrument |
US10743872B2 (en) | 2017-09-29 | 2020-08-18 | Ethicon Llc | System and methods for controlling a display of a surgical instrument |
US12076011B2 (en) | 2017-10-30 | 2024-09-03 | Cilag Gmbh International | Surgical stapler knife motion controls |
US11090075B2 (en) | 2017-10-30 | 2021-08-17 | Cilag Gmbh International | Articulation features for surgical end effector |
US11134944B2 (en) | 2017-10-30 | 2021-10-05 | Cilag Gmbh International | Surgical stapler knife motion controls |
US11478244B2 (en) | 2017-10-31 | 2022-10-25 | Cilag Gmbh International | Cartridge body design with force reduction based on firing completion |
US10842490B2 (en) | 2017-10-31 | 2020-11-24 | Ethicon Llc | Cartridge body design with force reduction based on firing completion |
US11963680B2 (en) | 2017-10-31 | 2024-04-23 | Cilag Gmbh International | Cartridge body design with force reduction based on firing completion |
US10779903B2 (en) | 2017-10-31 | 2020-09-22 | Ethicon Llc | Positive shaft rotation lock activated by jaw closure |
US10779826B2 (en) | 2017-12-15 | 2020-09-22 | Ethicon Llc | Methods of operating surgical end effectors |
US11071543B2 (en) | 2017-12-15 | 2021-07-27 | Cilag Gmbh International | Surgical end effectors with clamping assemblies configured to increase jaw aperture ranges |
US10966718B2 (en) | 2017-12-15 | 2021-04-06 | Ethicon Llc | Dynamic clamping assemblies with improved wear characteristics for use in connection with electromechanical surgical instruments |
US10687813B2 (en) | 2017-12-15 | 2020-06-23 | Ethicon Llc | Adapters with firing stroke sensing arrangements for use in connection with electromechanical surgical instruments |
US10779825B2 (en) | 2017-12-15 | 2020-09-22 | Ethicon Llc | Adapters with end effector position sensing and control arrangements for use in connection with electromechanical surgical instruments |
US11896222B2 (en) | 2017-12-15 | 2024-02-13 | Cilag Gmbh International | Methods of operating surgical end effectors |
US10743875B2 (en) | 2017-12-15 | 2020-08-18 | Ethicon Llc | Surgical end effectors with jaw stiffener arrangements configured to permit monitoring of firing member |
US11033267B2 (en) | 2017-12-15 | 2021-06-15 | Ethicon Llc | Systems and methods of controlling a clamping member firing rate of a surgical instrument |
US11006955B2 (en) | 2017-12-15 | 2021-05-18 | Ethicon Llc | End effectors with positive jaw opening features for use with adapters for electromechanical surgical instruments |
US11197670B2 (en) | 2017-12-15 | 2021-12-14 | Cilag Gmbh International | Surgical end effectors with pivotal jaws configured to touch at their respective distal ends when fully closed |
US10828033B2 (en) | 2017-12-15 | 2020-11-10 | Ethicon Llc | Handheld electromechanical surgical instruments with improved motor control arrangements for positioning components of an adapter coupled thereto |
US10869666B2 (en) | 2017-12-15 | 2020-12-22 | Ethicon Llc | Adapters with control systems for controlling multiple motors of an electromechanical surgical instrument |
US10743874B2 (en) | 2017-12-15 | 2020-08-18 | Ethicon Llc | Sealed adapters for use with electromechanical surgical instruments |
US12076096B2 (en) | 2017-12-19 | 2024-09-03 | Cilag Gmbh International | Method for determining the position of a rotatable jaw of a surgical instrument attachment assembly |
US11284953B2 (en) | 2017-12-19 | 2022-03-29 | Cilag Gmbh International | Method for determining the position of a rotatable jaw of a surgical instrument attachment assembly |
US10716565B2 (en) | 2017-12-19 | 2020-07-21 | Ethicon Llc | Surgical instruments with dual articulation drivers |
USD910847S1 (en) | 2017-12-19 | 2021-02-16 | Ethicon Llc | Surgical instrument assembly |
US10835330B2 (en) | 2017-12-19 | 2020-11-17 | Ethicon Llc | Method for determining the position of a rotatable jaw of a surgical instrument attachment assembly |
US11020112B2 (en) | 2017-12-19 | 2021-06-01 | Ethicon Llc | Surgical tools configured for interchangeable use with different controller interfaces |
US11045270B2 (en) | 2017-12-19 | 2021-06-29 | Cilag Gmbh International | Robotic attachment comprising exterior drive actuator |
US10729509B2 (en) | 2017-12-19 | 2020-08-04 | Ethicon Llc | Surgical instrument comprising closure and firing locking mechanism |
US11179151B2 (en) | 2017-12-21 | 2021-11-23 | Cilag Gmbh International | Surgical instrument comprising a display |
US11129680B2 (en) | 2017-12-21 | 2021-09-28 | Cilag Gmbh International | Surgical instrument comprising a projector |
US11076853B2 (en) | 2017-12-21 | 2021-08-03 | Cilag Gmbh International | Systems and methods of displaying a knife position during transection for a surgical instrument |
US11337691B2 (en) | 2017-12-21 | 2022-05-24 | Cilag Gmbh International | Surgical instrument configured to determine firing path |
US11364027B2 (en) | 2017-12-21 | 2022-06-21 | Cilag Gmbh International | Surgical instrument comprising speed control |
US10682134B2 (en) | 2017-12-21 | 2020-06-16 | Ethicon Llc | Continuous use self-propelled stapling instrument |
US11849939B2 (en) | 2017-12-21 | 2023-12-26 | Cilag Gmbh International | Continuous use self-propelled stapling instrument |
US11576668B2 (en) | 2017-12-21 | 2023-02-14 | Cilag Gmbh International | Staple instrument comprising a firing path display |
US11751867B2 (en) | 2017-12-21 | 2023-09-12 | Cilag Gmbh International | Surgical instrument comprising sequenced systems |
US11883019B2 (en) | 2017-12-21 | 2024-01-30 | Cilag Gmbh International | Stapling instrument comprising a staple feeding system |
US10743868B2 (en) | 2017-12-21 | 2020-08-18 | Ethicon Llc | Surgical instrument comprising a pivotable distal head |
US11583274B2 (en) | 2017-12-21 | 2023-02-21 | Cilag Gmbh International | Self-guiding stapling instrument |
US11369368B2 (en) | 2017-12-21 | 2022-06-28 | Cilag Gmbh International | Surgical instrument comprising synchronized drive systems |
US11179152B2 (en) | 2017-12-21 | 2021-11-23 | Cilag Gmbh International | Surgical instrument comprising a tissue grasping system |
US11311290B2 (en) | 2017-12-21 | 2022-04-26 | Cilag Gmbh International | Surgical instrument comprising an end effector dampener |
US11795217B2 (en) | 2018-06-29 | 2023-10-24 | Cedars-Sinai Medical Center | Interleukin-1 inhibition for combination treatment of pancreatic cancer cachexia |
US11083458B2 (en) | 2018-08-20 | 2021-08-10 | Cilag Gmbh International | Powered surgical instruments with clutching arrangements to convert linear drive motions to rotary drive motions |
US11957339B2 (en) | 2018-08-20 | 2024-04-16 | Cilag Gmbh International | Method for fabricating surgical stapler anvils |
US10912559B2 (en) | 2018-08-20 | 2021-02-09 | Ethicon Llc | Reinforced deformable anvil tip for surgical stapler anvil |
US11039834B2 (en) | 2018-08-20 | 2021-06-22 | Cilag Gmbh International | Surgical stapler anvils with staple directing protrusions and tissue stability features |
US11045192B2 (en) | 2018-08-20 | 2021-06-29 | Cilag Gmbh International | Fabricating techniques for surgical stapler anvils |
US10779821B2 (en) | 2018-08-20 | 2020-09-22 | Ethicon Llc | Surgical stapler anvils with tissue stop features configured to avoid tissue pinch |
US12076008B2 (en) | 2018-08-20 | 2024-09-03 | Cilag Gmbh International | Method for operating a powered articulatable surgical instrument |
US10856870B2 (en) | 2018-08-20 | 2020-12-08 | Ethicon Llc | Switching arrangements for motor powered articulatable surgical instruments |
USD914878S1 (en) | 2018-08-20 | 2021-03-30 | Ethicon Llc | Surgical instrument anvil |
US10842492B2 (en) | 2018-08-20 | 2020-11-24 | Ethicon Llc | Powered articulatable surgical instruments with clutching and locking arrangements for linking an articulation drive system to a firing drive system |
US11324501B2 (en) | 2018-08-20 | 2022-05-10 | Cilag Gmbh International | Surgical stapling devices with improved closure members |
US11253256B2 (en) | 2018-08-20 | 2022-02-22 | Cilag Gmbh International | Articulatable motor powered surgical instruments with dedicated articulation motor arrangements |
US11207065B2 (en) | 2018-08-20 | 2021-12-28 | Cilag Gmbh International | Method for fabricating surgical stapler anvils |
US11291440B2 (en) | 2018-08-20 | 2022-04-05 | Cilag Gmbh International | Method for operating a powered articulatable surgical instrument |
WO2020176730A1 (en) | 2019-02-27 | 2020-09-03 | Janssen Biotech, Inc. | Antibody formulation |
WO2020176738A1 (en) | 2019-02-28 | 2020-09-03 | Janssen Biotech, Inc. | Anti-il-alpha antibody for the treatment of hidradenitis suppurativa |
US11172929B2 (en) | 2019-03-25 | 2021-11-16 | Cilag Gmbh International | Articulation drive arrangements for surgical systems |
US11696761B2 (en) | 2019-03-25 | 2023-07-11 | Cilag Gmbh International | Firing drive arrangements for surgical systems |
US11147553B2 (en) | 2019-03-25 | 2021-10-19 | Cilag Gmbh International | Firing drive arrangements for surgical systems |
US11147551B2 (en) | 2019-03-25 | 2021-10-19 | Cilag Gmbh International | Firing drive arrangements for surgical systems |
US11432816B2 (en) | 2019-04-30 | 2022-09-06 | Cilag Gmbh International | Articulation pin for a surgical instrument |
US11903581B2 (en) | 2019-04-30 | 2024-02-20 | Cilag Gmbh International | Methods for stapling tissue using a surgical instrument |
US11648009B2 (en) | 2019-04-30 | 2023-05-16 | Cilag Gmbh International | Rotatable jaw tip for a surgical instrument |
US11253254B2 (en) | 2019-04-30 | 2022-02-22 | Cilag Gmbh International | Shaft rotation actuator on a surgical instrument |
US11452528B2 (en) | 2019-04-30 | 2022-09-27 | Cilag Gmbh International | Articulation actuators for a surgical instrument |
US11471157B2 (en) | 2019-04-30 | 2022-10-18 | Cilag Gmbh International | Articulation control mapping for a surgical instrument |
US11426251B2 (en) | 2019-04-30 | 2022-08-30 | Cilag Gmbh International | Articulation directional lights on a surgical instrument |
US11229437B2 (en) | 2019-06-28 | 2022-01-25 | Cilag Gmbh International | Method for authenticating the compatibility of a staple cartridge with a surgical instrument |
US11298127B2 (en) | 2019-06-28 | 2022-04-12 | Cilag GmbH Interational | Surgical stapling system having a lockout mechanism for an incompatible cartridge |
US11744593B2 (en) | 2019-06-28 | 2023-09-05 | Cilag Gmbh International | Method for authenticating the compatibility of a staple cartridge with a surgical instrument |
US11464601B2 (en) | 2019-06-28 | 2022-10-11 | Cilag Gmbh International | Surgical instrument comprising an RFID system for tracking a movable component |
US11350938B2 (en) | 2019-06-28 | 2022-06-07 | Cilag Gmbh International | Surgical instrument comprising an aligned rfid sensor |
US11553971B2 (en) | 2019-06-28 | 2023-01-17 | Cilag Gmbh International | Surgical RFID assemblies for display and communication |
US11627959B2 (en) | 2019-06-28 | 2023-04-18 | Cilag Gmbh International | Surgical instruments including manual and powered system lockouts |
US11553919B2 (en) | 2019-06-28 | 2023-01-17 | Cilag Gmbh International | Method for authenticating the compatibility of a staple cartridge with a surgical instrument |
US11478241B2 (en) | 2019-06-28 | 2022-10-25 | Cilag Gmbh International | Staple cartridge including projections |
US11376098B2 (en) | 2019-06-28 | 2022-07-05 | Cilag Gmbh International | Surgical instrument system comprising an RFID system |
US11241235B2 (en) | 2019-06-28 | 2022-02-08 | Cilag Gmbh International | Method of using multiple RFID chips with a surgical assembly |
US11224497B2 (en) | 2019-06-28 | 2022-01-18 | Cilag Gmbh International | Surgical systems with multiple RFID tags |
US11051807B2 (en) | 2019-06-28 | 2021-07-06 | Cilag Gmbh International | Packaging assembly including a particulate trap |
US11684434B2 (en) | 2019-06-28 | 2023-06-27 | Cilag Gmbh International | Surgical RFID assemblies for instrument operational setting control |
US11246678B2 (en) | 2019-06-28 | 2022-02-15 | Cilag Gmbh International | Surgical stapling system having a frangible RFID tag |
US11426167B2 (en) | 2019-06-28 | 2022-08-30 | Cilag Gmbh International | Mechanisms for proper anvil attachment surgical stapling head assembly |
US11638587B2 (en) | 2019-06-28 | 2023-05-02 | Cilag Gmbh International | RFID identification systems for surgical instruments |
US11219455B2 (en) | 2019-06-28 | 2022-01-11 | Cilag Gmbh International | Surgical instrument including a lockout key |
US11298132B2 (en) | 2019-06-28 | 2022-04-12 | Cilag GmbH Inlernational | Staple cartridge including a honeycomb extension |
US11660163B2 (en) | 2019-06-28 | 2023-05-30 | Cilag Gmbh International | Surgical system with RFID tags for updating motor assembly parameters |
US11497492B2 (en) | 2019-06-28 | 2022-11-15 | Cilag Gmbh International | Surgical instrument including an articulation lock |
US11771419B2 (en) | 2019-06-28 | 2023-10-03 | Cilag Gmbh International | Packaging for a replaceable component of a surgical stapling system |
US11259803B2 (en) | 2019-06-28 | 2022-03-01 | Cilag Gmbh International | Surgical stapling system having an information encryption protocol |
US11523822B2 (en) | 2019-06-28 | 2022-12-13 | Cilag Gmbh International | Battery pack including a circuit interrupter |
US11684369B2 (en) | 2019-06-28 | 2023-06-27 | Cilag Gmbh International | Method of using multiple RFID chips with a surgical assembly |
US12004740B2 (en) | 2019-06-28 | 2024-06-11 | Cilag Gmbh International | Surgical stapling system having an information decryption protocol |
US11399837B2 (en) | 2019-06-28 | 2022-08-02 | Cilag Gmbh International | Mechanisms for motor control adjustments of a motorized surgical instrument |
US11291451B2 (en) | 2019-06-28 | 2022-04-05 | Cilag Gmbh International | Surgical instrument with battery compatibility verification functionality |
US11504122B2 (en) | 2019-12-19 | 2022-11-22 | Cilag Gmbh International | Surgical instrument comprising a nested firing member |
US11304696B2 (en) | 2019-12-19 | 2022-04-19 | Cilag Gmbh International | Surgical instrument comprising a powered articulation system |
US11529139B2 (en) | 2019-12-19 | 2022-12-20 | Cilag Gmbh International | Motor driven surgical instrument |
US11529137B2 (en) | 2019-12-19 | 2022-12-20 | Cilag Gmbh International | Staple cartridge comprising driver retention members |
US11291447B2 (en) | 2019-12-19 | 2022-04-05 | Cilag Gmbh International | Stapling instrument comprising independent jaw closing and staple firing systems |
US11607219B2 (en) | 2019-12-19 | 2023-03-21 | Cilag Gmbh International | Staple cartridge comprising a detachable tissue cutting knife |
US11911032B2 (en) | 2019-12-19 | 2024-02-27 | Cilag Gmbh International | Staple cartridge comprising a seating cam |
US11844520B2 (en) | 2019-12-19 | 2023-12-19 | Cilag Gmbh International | Staple cartridge comprising driver retention members |
US11576672B2 (en) | 2019-12-19 | 2023-02-14 | Cilag Gmbh International | Surgical instrument comprising a closure system including a closure member and an opening member driven by a drive screw |
US11464512B2 (en) | 2019-12-19 | 2022-10-11 | Cilag Gmbh International | Staple cartridge comprising a curved deck surface |
US12035913B2 (en) | 2019-12-19 | 2024-07-16 | Cilag Gmbh International | Staple cartridge comprising a deployable knife |
US11931033B2 (en) | 2019-12-19 | 2024-03-19 | Cilag Gmbh International | Staple cartridge comprising a latch lockout |
US11234698B2 (en) | 2019-12-19 | 2022-02-01 | Cilag Gmbh International | Stapling system comprising a clamp lockout and a firing lockout |
US11701111B2 (en) | 2019-12-19 | 2023-07-18 | Cilag Gmbh International | Method for operating a surgical stapling instrument |
US11559304B2 (en) | 2019-12-19 | 2023-01-24 | Cilag Gmbh International | Surgical instrument comprising a rapid closure mechanism |
US11446029B2 (en) | 2019-12-19 | 2022-09-20 | Cilag Gmbh International | Staple cartridge comprising projections extending from a curved deck surface |
WO2021211927A1 (en) | 2020-04-16 | 2021-10-21 | Janssen Biotech, Inc. | Treatment of hidradenitis suppurativa |
WO2021211924A1 (en) | 2020-04-16 | 2021-10-21 | Janssen Biotech, Inc. | Treatment of atopic dermatitis |
USD975850S1 (en) | 2020-06-02 | 2023-01-17 | Cilag Gmbh International | Staple cartridge |
USD974560S1 (en) | 2020-06-02 | 2023-01-03 | Cilag Gmbh International | Staple cartridge |
USD976401S1 (en) | 2020-06-02 | 2023-01-24 | Cilag Gmbh International | Staple cartridge |
USD966512S1 (en) | 2020-06-02 | 2022-10-11 | Cilag Gmbh International | Staple cartridge |
USD967421S1 (en) | 2020-06-02 | 2022-10-18 | Cilag Gmbh International | Staple cartridge |
USD975851S1 (en) | 2020-06-02 | 2023-01-17 | Cilag Gmbh International | Staple cartridge |
USD975278S1 (en) | 2020-06-02 | 2023-01-10 | Cilag Gmbh International | Staple cartridge |
US11638582B2 (en) | 2020-07-28 | 2023-05-02 | Cilag Gmbh International | Surgical instruments with torsion spine drive arrangements |
US11857182B2 (en) | 2020-07-28 | 2024-01-02 | Cilag Gmbh International | Surgical instruments with combination function articulation joint arrangements |
US11737748B2 (en) | 2020-07-28 | 2023-08-29 | Cilag Gmbh International | Surgical instruments with double spherical articulation joints with pivotable links |
US11660090B2 (en) | 2020-07-28 | 2023-05-30 | Cllag GmbH International | Surgical instruments with segmented flexible drive arrangements |
US11974741B2 (en) | 2020-07-28 | 2024-05-07 | Cilag Gmbh International | Surgical instruments with differential articulation joint arrangements for accommodating flexible actuators |
US11826013B2 (en) | 2020-07-28 | 2023-11-28 | Cilag Gmbh International | Surgical instruments with firing member closure features |
US11871925B2 (en) | 2020-07-28 | 2024-01-16 | Cilag Gmbh International | Surgical instruments with dual spherical articulation joint arrangements |
US12064107B2 (en) | 2020-07-28 | 2024-08-20 | Cilag Gmbh International | Articulatable surgical instruments with articulation joints comprising flexible exoskeleton arrangements |
US11864756B2 (en) | 2020-07-28 | 2024-01-09 | Cilag Gmbh International | Surgical instruments with flexible ball chain drive arrangements |
US11883024B2 (en) | 2020-07-28 | 2024-01-30 | Cilag Gmbh International | Method of operating a surgical instrument |
US11896217B2 (en) | 2020-10-29 | 2024-02-13 | Cilag Gmbh International | Surgical instrument comprising an articulation lock |
US11779330B2 (en) | 2020-10-29 | 2023-10-10 | Cilag Gmbh International | Surgical instrument comprising a jaw alignment system |
USD1013170S1 (en) | 2020-10-29 | 2024-01-30 | Cilag Gmbh International | Surgical instrument assembly |
US11717289B2 (en) | 2020-10-29 | 2023-08-08 | Cilag Gmbh International | Surgical instrument comprising an indicator which indicates that an articulation drive is actuatable |
US11931025B2 (en) | 2020-10-29 | 2024-03-19 | Cilag Gmbh International | Surgical instrument comprising a releasable closure drive lock |
US11452526B2 (en) | 2020-10-29 | 2022-09-27 | Cilag Gmbh International | Surgical instrument comprising a staged voltage regulation start-up system |
US12053175B2 (en) | 2020-10-29 | 2024-08-06 | Cilag Gmbh International | Surgical instrument comprising a stowed closure actuator stop |
USD980425S1 (en) | 2020-10-29 | 2023-03-07 | Cilag Gmbh International | Surgical instrument assembly |
US11844518B2 (en) | 2020-10-29 | 2023-12-19 | Cilag Gmbh International | Method for operating a surgical instrument |
US11617577B2 (en) | 2020-10-29 | 2023-04-04 | Cilag Gmbh International | Surgical instrument comprising a sensor configured to sense whether an articulation drive of the surgical instrument is actuatable |
US11517390B2 (en) | 2020-10-29 | 2022-12-06 | Cilag Gmbh International | Surgical instrument comprising a limited travel switch |
US12076194B2 (en) | 2020-10-29 | 2024-09-03 | Cilag Gmbh International | Surgical instrument comprising an articulation indicator |
US12029421B2 (en) | 2020-10-29 | 2024-07-09 | Cilag Gmbh International | Surgical instrument comprising a staged voltage regulation start-up system |
US11534259B2 (en) | 2020-10-29 | 2022-12-27 | Cilag Gmbh International | Surgical instrument comprising an articulation indicator |
US11653920B2 (en) | 2020-12-02 | 2023-05-23 | Cilag Gmbh International | Powered surgical instruments with communication interfaces through sterile barrier |
US11627960B2 (en) | 2020-12-02 | 2023-04-18 | Cilag Gmbh International | Powered surgical instruments with smart reload with separately attachable exteriorly mounted wiring connections |
US11653915B2 (en) | 2020-12-02 | 2023-05-23 | Cilag Gmbh International | Surgical instruments with sled location detection and adjustment features |
US11849943B2 (en) | 2020-12-02 | 2023-12-26 | Cilag Gmbh International | Surgical instrument with cartridge release mechanisms |
US11678882B2 (en) | 2020-12-02 | 2023-06-20 | Cilag Gmbh International | Surgical instruments with interactive features to remedy incidental sled movements |
US11944296B2 (en) | 2020-12-02 | 2024-04-02 | Cilag Gmbh International | Powered surgical instruments with external connectors |
US11890010B2 (en) | 2020-12-02 | 2024-02-06 | Cllag GmbH International | Dual-sided reinforced reload for surgical instruments |
US11737751B2 (en) | 2020-12-02 | 2023-08-29 | Cilag Gmbh International | Devices and methods of managing energy dissipated within sterile barriers of surgical instrument housings |
US11744581B2 (en) | 2020-12-02 | 2023-09-05 | Cilag Gmbh International | Powered surgical instruments with multi-phase tissue treatment |
US11950777B2 (en) | 2021-02-26 | 2024-04-09 | Cilag Gmbh International | Staple cartridge comprising an information access control system |
US11925349B2 (en) | 2021-02-26 | 2024-03-12 | Cilag Gmbh International | Adjustment to transfer parameters to improve available power |
US11751869B2 (en) | 2021-02-26 | 2023-09-12 | Cilag Gmbh International | Monitoring of multiple sensors over time to detect moving characteristics of tissue |
US11950779B2 (en) | 2021-02-26 | 2024-04-09 | Cilag Gmbh International | Method of powering and communicating with a staple cartridge |
US12035911B2 (en) | 2021-02-26 | 2024-07-16 | Cilag Gmbh International | Stapling instrument comprising a separate power antenna and a data transfer antenna |
US12035912B2 (en) | 2021-02-26 | 2024-07-16 | Cilag Gmbh International | Adjustable communication based on available bandwidth and power capacity |
US11744583B2 (en) | 2021-02-26 | 2023-09-05 | Cilag Gmbh International | Distal communication array to tune frequency of RF systems |
US11749877B2 (en) | 2021-02-26 | 2023-09-05 | Cilag Gmbh International | Stapling instrument comprising a signal antenna |
US12035910B2 (en) | 2021-02-26 | 2024-07-16 | Cllag GmbH International | Monitoring of internal systems to detect and track cartridge motion status |
US11812964B2 (en) | 2021-02-26 | 2023-11-14 | Cilag Gmbh International | Staple cartridge comprising a power management circuit |
US11793514B2 (en) | 2021-02-26 | 2023-10-24 | Cilag Gmbh International | Staple cartridge comprising sensor array which may be embedded in cartridge body |
US11730473B2 (en) | 2021-02-26 | 2023-08-22 | Cilag Gmbh International | Monitoring of manufacturing life-cycle |
US11696757B2 (en) | 2021-02-26 | 2023-07-11 | Cilag Gmbh International | Monitoring of internal systems to detect and track cartridge motion status |
US11701113B2 (en) | 2021-02-26 | 2023-07-18 | Cilag Gmbh International | Stapling instrument comprising a separate power antenna and a data transfer antenna |
US11723657B2 (en) | 2021-02-26 | 2023-08-15 | Cilag Gmbh International | Adjustable communication based on available bandwidth and power capacity |
US11980362B2 (en) | 2021-02-26 | 2024-05-14 | Cilag Gmbh International | Surgical instrument system comprising a power transfer coil |
US12042146B2 (en) | 2021-03-22 | 2024-07-23 | Cilag Gmbh International | Surgical stapling instrument comprising a retraction system |
US11826012B2 (en) | 2021-03-22 | 2023-11-28 | Cilag Gmbh International | Stapling instrument comprising a pulsed motor-driven firing rack |
US12023026B2 (en) | 2021-03-22 | 2024-07-02 | Cilag Gmbh International | Staple cartridge comprising a firing lockout |
US11723658B2 (en) | 2021-03-22 | 2023-08-15 | Cilag Gmbh International | Staple cartridge comprising a firing lockout |
US11717291B2 (en) | 2021-03-22 | 2023-08-08 | Cilag Gmbh International | Staple cartridge comprising staples configured to apply different tissue compression |
US11759202B2 (en) | 2021-03-22 | 2023-09-19 | Cilag Gmbh International | Staple cartridge comprising an implantable layer |
US11806011B2 (en) | 2021-03-22 | 2023-11-07 | Cilag Gmbh International | Stapling instrument comprising tissue compression systems |
US11737749B2 (en) | 2021-03-22 | 2023-08-29 | Cilag Gmbh International | Surgical stapling instrument comprising a retraction system |
US11826042B2 (en) | 2021-03-22 | 2023-11-28 | Cilag Gmbh International | Surgical instrument comprising a firing drive including a selectable leverage mechanism |
US11944336B2 (en) | 2021-03-24 | 2024-04-02 | Cilag Gmbh International | Joint arrangements for multi-planar alignment and support of operational drive shafts in articulatable surgical instruments |
US11896219B2 (en) | 2021-03-24 | 2024-02-13 | Cilag Gmbh International | Mating features between drivers and underside of a cartridge deck |
US11832816B2 (en) | 2021-03-24 | 2023-12-05 | Cilag Gmbh International | Surgical stapling assembly comprising nonplanar staples and planar staples |
US11903582B2 (en) | 2021-03-24 | 2024-02-20 | Cilag Gmbh International | Leveraging surfaces for cartridge installation |
US11744603B2 (en) | 2021-03-24 | 2023-09-05 | Cilag Gmbh International | Multi-axis pivot joints for surgical instruments and methods for manufacturing same |
US11896218B2 (en) | 2021-03-24 | 2024-02-13 | Cilag Gmbh International | Method of using a powered stapling device |
US11786239B2 (en) | 2021-03-24 | 2023-10-17 | Cilag Gmbh International | Surgical instrument articulation joint arrangements comprising multiple moving linkage features |
US11857183B2 (en) | 2021-03-24 | 2024-01-02 | Cilag Gmbh International | Stapling assembly components having metal substrates and plastic bodies |
US11786243B2 (en) | 2021-03-24 | 2023-10-17 | Cilag Gmbh International | Firing members having flexible portions for adapting to a load during a surgical firing stroke |
US11793516B2 (en) | 2021-03-24 | 2023-10-24 | Cilag Gmbh International | Surgical staple cartridge comprising longitudinal support beam |
US11849945B2 (en) | 2021-03-24 | 2023-12-26 | Cilag Gmbh International | Rotary-driven surgical stapling assembly comprising eccentrically driven firing member |
US11849944B2 (en) | 2021-03-24 | 2023-12-26 | Cilag Gmbh International | Drivers for fastener cartridge assemblies having rotary drive screws |
US11723662B2 (en) | 2021-05-28 | 2023-08-15 | Cilag Gmbh International | Stapling instrument comprising an articulation control display |
US11826047B2 (en) | 2021-05-28 | 2023-11-28 | Cilag Gmbh International | Stapling instrument comprising jaw mounts |
US11918217B2 (en) | 2021-05-28 | 2024-03-05 | Cilag Gmbh International | Stapling instrument comprising a staple cartridge insertion stop |
US11998201B2 (en) | 2021-05-28 | 2024-06-04 | Cilag CmbH International | Stapling instrument comprising a firing lockout |
US11957337B2 (en) | 2021-10-18 | 2024-04-16 | Cilag Gmbh International | Surgical stapling assembly with offset ramped drive surfaces |
US11877745B2 (en) | 2021-10-18 | 2024-01-23 | Cilag Gmbh International | Surgical stapling assembly having longitudinally-repeating staple leg clusters |
US11980363B2 (en) | 2021-10-18 | 2024-05-14 | Cilag Gmbh International | Row-to-row staple array variations |
US11937816B2 (en) | 2021-10-28 | 2024-03-26 | Cilag Gmbh International | Electrical lead arrangements for surgical instruments |
US12089841B2 (en) | 2021-10-28 | 2024-09-17 | Cilag CmbH International | Staple cartridge identification systems |
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10899833B2 (en) | Human antibody specific for interleukin-1 alpha | |
AU2012200775B2 (en) | IL-1alpha Abs and methods of use |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: XBIOTECH, INC., CANADA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:SIMARD, JOHN;REEL/FRAME:023091/0933 Effective date: 20090811 |
|
STCF | Information on status: patent grant |
Free format text: PATENTED CASE |
|
FPAY | Fee payment |
Year of fee payment: 4 |
|
MAFP | Maintenance fee payment |
Free format text: PAYMENT OF MAINTENANCE FEE, 8TH YR, SMALL ENTITY (ORIGINAL EVENT CODE: M2552); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY Year of fee payment: 8 |
|
AS | Assignment |
Owner name: JANSSEN BIOTECH, INC., PENNSYLVANIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:XBIOTECH INC.;REEL/FRAME:051769/0927 Effective date: 20191230 |
|
FEPP | Fee payment procedure |
Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY |
|
MAFP | Maintenance fee payment |
Free format text: PAYMENT OF MAINTENANCE FEE, 12TH YEAR, LARGE ENTITY (ORIGINAL EVENT CODE: M1553); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY Year of fee payment: 12 |