US5574010A - Treatment of pancreatic tumors with peptide YY and analogs thereof - Google Patents

Treatment of pancreatic tumors with peptide YY and analogs thereof Download PDF

Info

Publication number
US5574010A
US5574010A US08/338,395 US33839594A US5574010A US 5574010 A US5574010 A US 5574010A US 33839594 A US33839594 A US 33839594A US 5574010 A US5574010 A US 5574010A
Authority
US
United States
Prior art keywords
peptide
pyy
administering
pancreatic
effected
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Expired - Lifetime
Application number
US08/338,395
Inventor
David W. McFadden
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of California
University of California San Diego UCSD
Original Assignee
University of California San Diego UCSD
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of California San Diego UCSD filed Critical University of California San Diego UCSD
Priority to US08/338,395 priority Critical patent/US5574010A/en
Assigned to REGENTS OF THE THE UNIVERSITY OF CALIFORNIA, THE reassignment REGENTS OF THE THE UNIVERSITY OF CALIFORNIA, THE ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: MCFADDEN, DAVID W.
Priority to PCT/US1995/014303 priority patent/WO1996014854A1/en
Priority to AU42301/96A priority patent/AU4230196A/en
Application granted granted Critical
Publication of US5574010A publication Critical patent/US5574010A/en
Anticipated expiration legal-status Critical
Expired - Lifetime legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones

Definitions

  • the present invention relates generally to methods for treating pancreatic tumors. More particularly, the present invention is directed to methods for treating both benign and malignant pancreatic tumors with peptide YY and analogs thereof.
  • Pancreatic tumors result in the death of more than 95 percent of afflicted patients. Isselbacher, et al. (ed.) Harrison's Principles of Internal Medicine, 1532-34 (13th ed., 1994). In 1993, approximately 25,000 patients died of pancreatic cancer, making it the fifth most common cause of cancer-related mortality. Cancer Facts and Figures, American Cancer Society (1993).
  • Pancreatic tumors occur twice as frequently in the pancreatic head (60 percent of cases) as in the body (15-20 percent) or tail (about 5 percent) of the gland. Cotran, et at. (ed.) Rubbins Pathologic Basis of Disease, 988-992 (4th ed. 1989).
  • Surgical resection offers the only effective treatment of this disease. Surgical resection, however, is limited, for all practical purposes, to those individuals having tumors in the pancreatic head and in whom jaundice was the initial symptom. Even with the operation, the five year survival rate for these patients is only five percent. Isselbacher, et al. (ed.) Harrison's Principles of Internal Medicine, 1532-34 (13th ed., 1994).
  • peptide YY is an effective anti-proliferation agent which, when contacted with pancreatic tumor cells, is useful in reducing the degree to which the tumor cells proliferate.
  • the method includes the step of contacting the proliferating pancreatic tumor with an effective amount of peptide YY or an analog of peptide YY which are also referred to herein as peptide YY agonists.
  • the contacting step can be carded out according to any of the known procedures for administering drugs to pancreatic tumors including parenteral delivery, e.g. administered to the tumor in a subject intravenously, subcutaneously, by implantation of a sustained release formulation (e.g. near the pancreas), transdermally (e.g. topically or by iontophoretic path), by implantable or external infusion pump, or by perfusion (e.g. of the pancreas).
  • the contacting step may also be effected externally or transmucously.
  • the types of benign pancreatic tumor cells which may be treated in accordance with the present invention include serous cyst adenomas, microcystic tumors, and solid-cystic tumors.
  • the method is also effective in reducing the proliferation of malignant pancreatic tumor cells such as carcinomas arising from the ducts, acini, or islets of the pancreas.
  • Aib aminoisobutyric acid
  • Orn Ornithine
  • Tic tetrahydroisoquinoline-3-carboxylic acid
  • Peptide YY is a 36 amino acid residue peptide amide isolated originally from porcine intestine and localized in the endocrine cells of the gastrointestinal tract and the pancreas (Tatemotu et al., 79 Proc. Natl. Acad. Sci. 2514 (1982)).
  • the amino acid sequences of porcine and human PYY are as follows:
  • the amino acid sequence for dog PYY and rat is the same as porcine PYY.
  • PYY is believed to inhibit gut motility and blood flow (Laburthe, 1 Trends Endocrinol. Metab. 168 (1990)), to mediate intestinal secretion (Cox et at., 101 Br. J. Pharmacol. 247 (1990)); Playford et at., 335 Cancer 1555 (1990)), and stimulate net absorption (MacFayden et at., 7 Neuropeptides 219 (1986)).
  • Novel analogs have been prepared in order to emulate and preferably enhance the duration of effect, biological activity, and selectivity of the natural peptide.
  • Many of these analogs are derived from biologically active peptide fragments of PYY (e.g., PYY 22-36 and PYY 25-36 ).
  • Such analogs, which inhibit the proliferation of pancreatic tumors, will be called peptide YY agonists herein.
  • Peptide YY agonists which can be used to practice the therapeutic method of the present invention include, but are not limited to, those covered by the formulae or those specifically recited in the publications set forth below, all of which are hereby incorporated by reference.
  • Peptide YY agonists which can be used to practice the therapeutic method of the present invention also include the closely related peptide neuropeptide Y (NPY) as well as derivatives, fragments, and analogs of NPY.
  • NPY closely related peptide neuropeptide Y
  • the amino acid sequences of porcine and human NPY are as follows:
  • porcine NPY--NPY YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY (SEQ. NO. 4)
  • rat NPY The amino acid sequence for rat NPY, rabbit NPY, and guinea pig NPY are the same as human NPY.
  • NPY analogs include but are not limited to, those covered by the formulae or those specifically recited in the publications set forth below, all of which are hereby incorporated by reference.
  • Preferred peptide YY agonists of the invention is of the formula: ##STR1## wherein:
  • X is a chain of 0-5 amino acids, inclusive, the N-terminal one of which is bonded to R 1 and R 2
  • Y is a chain of 0-4 amino acids, inclusive, the C-terminal one of which is bonded to R 3 and R 4
  • R 1 is H, C 1 -C 2 alkyl (e.g., methyl), C 6 -C 18 aryl (e.g., phenyl, napthaleneacetyl), C 1 --C 12 acyl (e.g., formyl, acetyl, and myristoyl), C 7 -C 18 aralkyl (e.g., benzyl), or C 7 -C 18 alkaryl (e.g., p-methylphenyl);
  • C 1 -C 2 alkyl e.g., methyl
  • C 6 -C 18 aryl e.g., phenyl, napthaleneacetyl
  • C 1 --C 12 acyl e.g., formyl, acetyl, and myristoyl
  • C 7 -C 18 aralkyl e.g., benzyl
  • C 7 -C 18 alkaryl e.g., p-methylpheny
  • R 2 is H, C 1 -C 12 alkyl (e.g., methyl), C 6 -C 18 aryl (e.g., phenyl, naphthaleneacetyl), C 1 -C 12 acyl (e.g., formyl, acetyl, and myristoyl), C 7 -C 18 aralkyl (e.g., benzyl), or C 7 -C 18 alkaryl (e.g., p-methylphenyl);
  • C 1 -C 12 alkyl e.g., methyl
  • C 6 -C 18 aryl e.g., phenyl, naphthaleneacetyl
  • C 1 -C 12 acyl e.g., formyl, acetyl, and myristoyl
  • C 7 -C 18 aralkyl e.g., benzyl
  • C 7 -C 18 alkaryl e.g.,
  • a 22 is an aromatic amino acid, Ala, Aib, Anb, N-Me-Ala, or is deleted;
  • a 23 is Ser, Thr, Ala, N-Me-Ser, N-Me-Thr, N-Me-Ala, or is deleted;
  • a 24 is Leu, lie, Vat, Trp, Gly, Aib, Anb, N-Me-Leu, or is deleted;
  • a 25 is Arg, Lys, homo-Arg, diethyl-homo-Arg, Lys- ⁇ -NH-R (where R is H, a branched or straight chain C 1 -C 10 alkyl group, or an aryl group), Orn, or is deleted;
  • a 26 is His, Thr, 3-Me-His, 1-Me-His, ⁇ -pyrozolylalanine, N-Me-His, Arg, Lys, homo-Arg, diethyl-homo-Arg, Lys- ⁇ -NH-R (where R is H, a branched or straight chain C 1 -C 10 alkyl group, or an aryl group), Orn, or is deleted;
  • a 27 is an aromatic amino acid other than Tyr
  • a 28 is Leu, Ile, Vat, Trp, Aib, Aib, Anb, or N-Me-Leu;
  • a 29 is Asn, Ala, Gln, Gly, Trp, or N-Me-Asn;
  • a 30 is Leu, Ile, Val, Trp, Aib, Anb, or N-Me-Leu;
  • a 31 is Vat, Ile, Trp, Aib, Anb, or N-Me-Val;
  • a 32 is Thr, Ser, N-Me-Set, or N-Me-Thr;
  • R 3 is H, C 1 -C 12 alkyl (e.g., methyl), C 6 -C 18 aryl (e.g., phenyl, naphthaleneacetyl), C 1 -C 12 acyl (e.g., formyl, acetyl, and myristoyl), C 7 -C 18 aralkyl (e.g., benzyl), or C 7 -C 18 alkaryl (e.g., p-methylphenyl);
  • C 1 -C 12 alkyl e.g., methyl
  • C 6 -C 18 aryl e.g., phenyl, naphthaleneacetyl
  • C 1 -C 12 acyl e.g., formyl, acetyl, and myristoyl
  • C 7 -C 18 aralkyl e.g., benzyl
  • C 7 -C 18 alkaryl e.g.,
  • R 4 is H, C 1 -C 12 alkyl (e.g., methyl), C 6 -C 18 aryl (e.g., phenyl, naphthaleneacetyl), C 1 -C 12 acyl (e.g., formyl, acetyl, and myristoyl), C 7 -C 18 aralkyl (e.g., benzyl), or C 7 -C 18 alkaryl (e.g., p-methylphenyl),
  • C 1 -C 12 alkyl e.g., methyl
  • C 6 -C 18 aryl e.g., phenyl, naphthaleneacetyl
  • C 1 -C 12 acyl e.g., formyl, acetyl, and myristoyl
  • C 7 -C 18 aralkyl e.g., benzyl
  • C 7 -C 18 alkaryl e.g.,
  • Particularly preferred agonists of this formula to be used in the method of the invention include:
  • peptide YY agonists of the invention is of the formula: ##STR2## wherein:
  • Y is a chain of 0-4 amino acids, inclusive the C-terminal one of which bonds to R 3 and R 4 ;
  • R 1 is H, C 1 -C 12 alkyl, C 6 -C 18 aryl, C 1 -C 12 acyl, C 7 -C 18 aralkyl, or C 7 -C 18 alkaryl;
  • R 2 is H, C 1 -C 12 alkyl, C 6 -C 18 aryl, C 1 -C 12 acyl, C 7 -C 18 aralkyl, or C 7 -C 18 alkaryl;
  • a 25 is Arg, Lys, homo-Arg, diethyl-homo-Arg, Lys- ⁇ -NH-R (where R is H, a branched or straight chain C 1 -C 10 alkyl group, or an aryl group), Orn, or is deleted;
  • a 26 is Ala, His, Thr, 3-Me-His, 1-Me-His, ⁇ -pyrozolylalanine, N-Me-His, Arg, Lys, homo-Arg, diethyl-homo-Arg, Lys- ⁇ -NH-R (where R is H, a branched or straight chain C 1 -C 10 alkyl group, or an aryl group), Orn or is deleted;
  • a 27 is an aromatic amino acid
  • a 28 is Leu, Ile, Val, Trp, Aib, Anb, or N-Me-Leu;
  • a 29 is Asn, Ala, Gln, Gly, Trp, or N-Me-Asn;
  • a 30 is Leu, Ile, Val, Trp, Aib, Anb, or N-Me-Leu;
  • a 31 is Val, Ile, Trp, Aib, Anb, or N-Me-Val;
  • a 32 is Thr, Set, N-Me-Set, or N-Me-Thr or D-Trp;
  • R 3 is H, C 1-C 12 alkyl, C 6 -C 18 aryl, C 1 -C 12 acyl, C 7 -C 18 aralkyl, or C 7 -C 18 alkaryl;
  • R 4 is H, C 1 -C 12 alkyl, C 6 -C 18 aryl, C 1 -C 12 acyl, C 7 -C 18 aralkyl, or C 7 -C 18 alkaryl,
  • each amino acid residue e.g., Leu and A 1
  • R is the side chain.
  • Lines between amino acid residues represent peptide bonds which join the amino acids.
  • the amino acid residue is optically active, it is the L-form configuration that is intended unless D-form is expressly designated.
  • PYY, homologues, fragments, and analogs thereof can be purchased commercially (Bachem California 1993-94 Catalogue, Torrance, Calif.; Sigma Peptides and Amino Acids 1994 Catalog, St. Louis, Miss.).
  • the PYY analogs of the present invention may also be synthesized by many techniques that are known to those skilled in the peptide art. An excellent summary of the many techniques so available may be found in Solid Phase Peptide Synthesis 2nd ed. (Stewart, J. M. and Young, J. D., Pierce Chemical Company, Rockford, Ill. 1984).
  • Analog #1 (Sequence ID No. 5), obtained from the University of Cincinnati, Cincinnati, Ohio, was synthesized as follows. Peptide synthesis was performed on an Applied Biosystems® (Forster City, Calif.) Model 430A synthesizer. Amino acid and sequence analyses were carried out using Waters® (Milford, Mass.) Pico-Tag and Applied Biosystems® Model 470A instruments, respectively. The peptide was purified using a Waters Model 600 solvent delivery system equipped with a Model 481 Spectrophotometer and U6K injector according to standard protocols. Peptide mass spectra were determined at the University of Michigan, Protein Chemistry Facility, An Arbor, Michigan according to standard methods. All Boc-L-amino acid derivatives, solvents, chemicals and the resins were obtained commercially and used without further purification.
  • MBHA Paramethylbenzhydrylamine
  • HA resin (0.45 mmol/gm, -NH 2 ) was placed in the reaction vessel of the peptide synthesizer and the protected amino acid derivatives were sequentially coupled using the program provided by the manufacturers modified to incorporate a double coupling procedure (see, e.g., Balasubramaniam et at., Peptide Research 1: 32, 1988). All amino acids were coupled using 2.2 equivalents of preformed symmetrical anhydrides. Arg, Gln and Asn, however, were coupled as preformed 1-hydroxybenzotriazole (HOBT) esters to avoid side reactions.
  • HOBT 1-hydroxybenzotriazole
  • the N- ⁇ -Boc group was removed and in some instances the free ⁇ -NH2 was acetylated by reaction with acetic anhydride (2 equivalents) and diisopropyl ethylamine until a negative ninhydrin test was obtained (Anal. Biochem. 34:595, 1970).
  • the peptide resin ( ⁇ 1.0 g) was then treated with HF (10 ml) containing p-cresol ( ⁇ 0.8 g) for 1 h at -2 to -4° C.
  • PYY analogs of the invention can be prepared by making appropriate modifications, within the ability of a person of ordinary skill in this field, of the synthetic methods disclosed herein.
  • peptide YY and peptide YY analogs While it is possible for peptide YY and peptide YY analogs to be administered as the pure or substantially pure compounds, it is preferable that they be administered as pharmaceutical formulations or preparation.
  • the carrier must be "acceptable” in the sense of being compatible with the active ingredient(s) of the formulation (and preferably, capable of stabilizing peptides) and not deleterious to the subject to be treated.
  • formulations may conveniently be presented in unit dosage form and may be prepared by any of the methods well known in the art of pharmacy. All methods include the step of bringing the active ingredient(s) into association with the carrier which constitutes one or more accessory ingredients.
  • the formulations for tablets or powders are prepared by uniformly and intimately blending the active ingredient with finely divided solid carriers, and then, if necessary, as in the case of tablets, forming the product into the desired shape and size.
  • Formulations suitable for intravenous administration conveniently comprise sterile aqueous solutions of the active ingredient(s).
  • the solutions are isotonic with the blood of the subject to be treated.
  • Such formulations may be conveniently prepared by dissolving solid active ingredient(s) in water to produce an aqueous solution, and rendering said solution sterile.
  • the formulation may be presented in unit or multi-dose containers, for example, sealed ampules or vials.
  • Formulations suitable for sustained release formulations include biodegradable polymers (e.g. U.S. Pat. Nos. 4,678,189 and 4,767,628, hereinafter incorporated by reference).
  • suitable biodegradable polymers include L-lactic acid, D-lactic acid, DL-lactic acid, glycolide, glycolic acid, and any optically active isomers, racements, or copolymers thereof.
  • Peptide YY and peptide YY agonists are administered to pancreatic tumors using the same procedures which are well-known for use in introducing chemotherapeutic agents to pancreatic tumors.
  • the particular route of administration will vary depending upon tumor type, location, extent of growth and other factors. By routine experimentation, the preferred route of administration and dosage regimen can be established on an individual basis.
  • the administration routes include: intravenous introduction to the tumor; subcutaneous introduction by implantation of a sustained release device near the tumor; transdermal introduction by topical or ion phoretic application; direct introduction to the tumor by an implantable or external infusion pump; or by perfusion. All of the above administration routes are well-known to those of ordinary skill in the art and have been used in pancreatic tumor treatment protocols using other chemotherapeutic agents.
  • administration techniques which introduce peptide YY or peptide YY agonists directly to the tumor.
  • Direct infusion and perfusion are examples.
  • the dosage level may be varied widely depending upon the patients tolerance to the particular peptide YY or analog being administered. Initial trial infusion or perfusion dosages on the order of two to four hundred pmol/kg/hour are preferably used.
  • the dosage level is adjusted upward or downward depending upon patient tolerance and tumor response.
  • the dosage level is increased to a level which provides a significant (i.e. at least 15 %) reduction in cell proliferation without causing adverse side effects, such as vomiting, abdominal pain or constipation.
  • the method of the present invention is preferably carried out continuously over extended periods of time to achieve maximum effectiveness.
  • Sustained release devices located adjacent to the tumor are well-suited for providing continual application.
  • Infusion and perfusion is preferably carded out continually for 6 hours up to 168 hours.
  • Patient and tumor response to the treatment is continually monitored during the treatment period with adjustments in dosage levels being made, if necessary.
  • Treatment is terminated when desired levels of reduction in minor cell proliferation are achieved or the patient experiences adverse side effects. It is preferred that treatment times, like dosages, be maximized to achieve maximum reduction in cell proliferation without creating adverse side effects.
  • PANC-1 and MiaPaCa-2 are two human pancreatic adenocarcinomas cancer cell lines which are available commercially from suppliers such as American Type Culture Collection, ATCC (Rockville, Md.).
  • the two tumor cells were grown in RPMI-1640 culture media supplemented with 10% fetal bovine serum, 29.2 mg/L of glutamine, 25 ⁇ g gentamicin, 5 ml penicillin, streptomycin, and fungizone solution (JRH Biosciences, Lenexa, Kans.) at 37° Celcius in a NAPCO water jacketed 5 % CO 2 incubator. All cell lines were detached with 0.25 % trypsin (Clonetics, San Diego, Calif.) once to twice a week when a confluent monolayer of tumor cells was achieved.
  • Control wells received 2 ⁇ l of 0.9% saline to mimic the volume and physical disturbance upon adhered tumor cells.
  • Each 96 well plate contained 18 control wells to allow for comparison within each plate during experimentation.
  • Ninety-six (96) well plates were repeated 6 times with varying concentrations of PYY and Analog #1 in both the PANC-1 and MiaPaCa-2 cells.
  • MTT assay measures mitochondrial NADH dependent dehydrogenase activity, and it has been among the most sensitive and reliable method to quantitative in vitro chemotherapy responses of tumor cells.
  • the MTT assay confirmed a significant decrease in the cell growth of both pancreatic tumor cell lines when PYY and Analog #1 were added to the cells.
  • the human pancreatic ductal adenocarcinoma Mia Paca-2 was examined for in vivo growth inhibition by peptide YY and Analog #1. Seventy thousand to 100,000 human Mia PaCa-2 cells were orthotopically transplanted into 48 male athymic mice. After one week, the animals were treated with either PYY or Analog #1 at 200 pmol/kg/hr via mini-osmotic pumps for four weeks. The paired cultures received saline. At sacrifice, both tumor size and mass were measured.
  • a patient having a pancreatic serous cyst adenoma is treated as follows in accordance with the present invention:
  • a sterile saline or distilled water solution containing from 7200 pmol to 864,000 pmol PYY or Analog gl in 1000 cc of total volume is administered intravenously to the patient at a rate of 12 to 24 ml/hour.
  • the solution is administered so as to provide a delivery rate of PYY or Analog #1 on the order of about 200 pmol/kg/hour to about 400 pmol/kg/hour.
  • the intravenous administration is conducted for 6 to 36 hours at a time depending upon patient tolerance. Standard intravenous delivery equipment is utilized. The treatment is repeated as required to achieve reduction in tumor cell proliferation.
  • a patient having a pancreatic solid-cystic tumor is treated as follows in accordance with the present invention:
  • a sterile saline or distilled water solution containing from PYY or Analog #1 is administered by directly perfusing the solution into the tumor site.
  • concentration of PYY or Analog #1 in the solution and the delivery rate are chosen to provide delivery of 200 pmol/kg/hour to 400 pmol/kg/hour.
  • Perfusion is accomplished using Alzet Mini-Osmotic pumps implanted subcutaneously which are connected to a polyethylene catheter tunneled through the abdominal musculature.
  • a patient having a carcinoma arising from a pancreatic duct is treated as follows in accordance with the present invention:
  • An implant device is prepared which is capable of delivering from 100 pmol to 1000 pmol of PYY or Analog #1 directly to the tumor for periods of up to 2 weeks.
  • the device is implanted adjacent to the tumor in accordance with standard implant insertion procedures.
  • a patient having a carcinoma arising from a pancreatic islet is treated as follows in accordance with the present invention:
  • a sterile saline solution containing PYY or Analog #1 is administered intravenously to the patient via a peripheral venous catheter or central venous catheter.
  • the delivery rate is selected so as to provide a dosage of from about 200 pmol/kg/hour to about 400 pmol/kg/hour of either PYY or Analog #1.
  • a patient having a carcinoma arising from a pancreatic acini is treated as follows in accordance with the present invention:
  • a sterile saline solution containing PYY or Analog #1 is administered by directly perfusing the solution into the tumor site.
  • the same perfusion procedure used in Example 4 is followed.
  • the concentration of PYY or Analog #1 and perfusion rate are selected to provide delivery of 200 pmol/kg/hour to 404 pmol/kg/hour of either peptide YY or Analog #1.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Endocrinology (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Zoology (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

A method of inhibiting proliferation of pancreatic tumors. The method involves contacting the pancreatic tumor with an effective amount of peptide YY or an analog of peptide YY. The method may be used either in vitro or in vivo to reduce tumor cell proliferation. The method is also effective in treating both benign and malignant tumors.

Description

BACKGROUND OF THE INVENTION
1. Field of the Invention
The present invention relates generally to methods for treating pancreatic tumors. More particularly, the present invention is directed to methods for treating both benign and malignant pancreatic tumors with peptide YY and analogs thereof.
2. Description of Related Art
Pancreatic tumors result in the death of more than 95 percent of afflicted patients. Isselbacher, et al. (ed.) Harrison's Principles of Internal Medicine, 1532-34 (13th ed., 1994). In 1993, approximately 25,000 patients died of pancreatic cancer, making it the fifth most common cause of cancer-related mortality. Cancer Facts and Figures, American Cancer Society (1993).
Pancreatic tumors occur twice as frequently in the pancreatic head (60 percent of cases) as in the body (15-20 percent) or tail (about 5 percent) of the gland. Cotran, et at. (ed.) Rubbins Pathologic Basis of Disease, 988-992 (4th ed. 1989). Currently, complete surgical resection of pancreatic tumors offers the only effective treatment of this disease. Surgical resection, however, is limited, for all practical purposes, to those individuals having tumors in the pancreatic head and in whom jaundice was the initial symptom. Even with the operation, the five year survival rate for these patients is only five percent. Isselbacher, et al. (ed.) Harrison's Principles of Internal Medicine, 1532-34 (13th ed., 1994).
SUMMARY OF THE INVENTION
The present invention involves a method for treating pancreatic tumor cells to reduce the proliferation of such cells. The method is applicable to both benign and malignant tumors. In addition, the method is useful in both in vivo and in vitro environments.
In accordance with the present invention, it was discovered that peptide YY is an effective anti-proliferation agent which, when contacted with pancreatic tumor cells, is useful in reducing the degree to which the tumor cells proliferate.
As a further feature of the present invention, it was discovered that certain analogs of peptide YY are also effective anti-pancreatic tumor agents.
The method includes the step of contacting the proliferating pancreatic tumor with an effective amount of peptide YY or an analog of peptide YY which are also referred to herein as peptide YY agonists. The contacting step can be carded out according to any of the known procedures for administering drugs to pancreatic tumors including parenteral delivery, e.g. administered to the tumor in a subject intravenously, subcutaneously, by implantation of a sustained release formulation (e.g. near the pancreas), transdermally (e.g. topically or by iontophoretic path), by implantable or external infusion pump, or by perfusion (e.g. of the pancreas). In other embodiments, the contacting step may also be effected externally or transmucously.
The types of benign pancreatic tumor cells which may be treated in accordance with the present invention include serous cyst adenomas, microcystic tumors, and solid-cystic tumors. The method is also effective in reducing the proliferation of malignant pancreatic tumor cells such as carcinomas arising from the ducts, acini, or islets of the pancreas.
Both definition and exemplification of peptide YY, and analogs of peptide YY, i.e. "peptide YY agonist" are set forth in the DESCRIPTION OF THE PREFERRED EMBODIMENTS below.
It was discovered that dosage levels on the order of a few pmol/kg/hour were effective in reducing cell proliferation. Higher dosages ranging up to 1000 pmol/kg/hour and even higher may be used provided that side effects are not too adverse. The most common adverse side effect of administration of peptide YY and its analogs is vomiting. In general the amount of peptide YY or peptide YY analog required to achieve desired therapeutic effectiveness will depend upon the condition being treated, the route of administration chosen, and the specific activity of the compound used, and ultimately will be decided by the attending physician or veterinarian by routine dosage adjustments.
Other features and advantages of the invention will be apparent from the following description of the preferred embodiments thereof, and from the claims.
Abbreviations:
Aib=aminoisobutyric acid
Anb=α-aminonormalbutyric acid
Bip=4,4'-biphenylalanine
Bth=3-benzothienyalanine
Dip=2,2-diphenylalanine
Nat=2-napthylalanine
Orn=Ornithine
Pcp=4-chlorophenylalanine
Thi=2-thienylalanine
Tic=tetrahydroisoquinoline-3-carboxylic acid
DESCRIPTION OF THE PREFERRED EMBODIMENTS
Peptide YY and Its Agonists:
Peptide YY (PYY) is a 36 amino acid residue peptide amide isolated originally from porcine intestine and localized in the endocrine cells of the gastrointestinal tract and the pancreas (Tatemotu et al., 79 Proc. Natl. Acad. Sci. 2514 (1982)). The amino acid sequences of porcine and human PYY are as follows:
porcine PYY--YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY (SEQ. ID. NO. 1)
human PYY--YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY (SEQ. ID. NO. 2)
The amino acid sequence for dog PYY and rat is the same as porcine PYY.
PYY is believed to inhibit gut motility and blood flow (Laburthe, 1 Trends Endocrinol. Metab. 168 (1990)), to mediate intestinal secretion (Cox et at., 101 Br. J. Pharmacol. 247 (1990)); Playford et at., 335 Cancer 1555 (1990)), and stimulate net absorption (MacFayden et at., 7 Neuropeptides 219 (1986)).
Novel analogs have been prepared in order to emulate and preferably enhance the duration of effect, biological activity, and selectivity of the natural peptide. Many of these analogs are derived from biologically active peptide fragments of PYY (e.g., PYY22-36 and PYY25-36). Such analogs, which inhibit the proliferation of pancreatic tumors, will be called peptide YY agonists herein.
Peptide YY agonists which can be used to practice the therapeutic method of the present invention include, but are not limited to, those covered by the formulae or those specifically recited in the publications set forth below, all of which are hereby incorporated by reference.
Balasubramaniam, et al., 1 Peptide Research 32 (1988);
Japanese Patent Application 2,225,497 (1990);
Balasubramaniam, et al., 14 Peptides 1011 (1993);
Grandt, et at., 51 Reg. Peptides 151 (1994); and
PCT U.S. application Ser. No. 94/03380 (1994).
Peptide YY agonists which can be used to practice the therapeutic method of the present invention also include the closely related peptide neuropeptide Y (NPY) as well as derivatives, fragments, and analogs of NPY. The amino acid sequences of porcine and human NPY are as follows:
human NPY--YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (SEQ. ID. NO. 3)
porcine NPY--NPY YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY (SEQ. NO. 4)
The amino acid sequence for rat NPY, rabbit NPY, and guinea pig NPY are the same as human NPY.
Examples of NPY analogs include but are not limited to, those covered by the formulae or those specifically recited in the publications set forth below, all of which are hereby incorporated by reference.
German Patent Application DE 3811193A1 (1989);
Balasubramaniam et al., 265 J. Biological Chem., 14724-14727 (1990);
Cox et al., 101 Br. J. Pharmacol., 247-252 (1990);
PCT Application WO 91/08223 (1991);
U.S. Pat. No. 5,026,685 (1991);
Balasubramaniam et al., 267 J. Biological Chem., 4680-4685 (1992);
European Patent Application 0355793 A3 (1992);
Dumont et al., 238 European J. Pharmacol., 37-45 (1993);
Kirby et al., 36 J. Med. Chem., 3802-3808 (1993);
PCT Application WO 94/00486 (1994);
Fournier et al., 45 Molecular Pharmacol., 93-101 (1994).
Balasubramaniam et al., 37 J. Med. Chem., 811-815 (1994);
Polter et al., 267 European J. Pharmacol., 253-262 (1994); and
U.S. Pat. No. 5,328,899 (1994).
Preferred peptide YY agonists of the invention is of the formula: ##STR1## wherein:
X is a chain of 0-5 amino acids, inclusive, the N-terminal one of which is bonded to R1 and R2
Y is a chain of 0-4 amino acids, inclusive, the C-terminal one of which is bonded to R3 and R4
R1 is H, C1 -C2 alkyl (e.g., methyl), C6 -C18 aryl (e.g., phenyl, napthaleneacetyl), C1 --C12 acyl (e.g., formyl, acetyl, and myristoyl), C7 -C18 aralkyl (e.g., benzyl), or C7 -C18 alkaryl (e.g., p-methylphenyl);
R2 is H, C1 -C12 alkyl (e.g., methyl), C6 -C18 aryl (e.g., phenyl, naphthaleneacetyl), C1 -C12 acyl (e.g., formyl, acetyl, and myristoyl), C7 -C18 aralkyl (e.g., benzyl), or C7 -C18 alkaryl (e.g., p-methylphenyl);
A22 is an aromatic amino acid, Ala, Aib, Anb, N-Me-Ala, or is deleted;
A23 is Ser, Thr, Ala, N-Me-Ser, N-Me-Thr, N-Me-Ala, or is deleted;
A24 is Leu, lie, Vat, Trp, Gly, Aib, Anb, N-Me-Leu, or is deleted;
A25 is Arg, Lys, homo-Arg, diethyl-homo-Arg, Lys-ε-NH-R (where R is H, a branched or straight chain C1 -C10 alkyl group, or an aryl group), Orn, or is deleted;
A26 is His, Thr, 3-Me-His, 1-Me-His, β-pyrozolylalanine, N-Me-His, Arg, Lys, homo-Arg, diethyl-homo-Arg, Lys-ε-NH-R (where R is H, a branched or straight chain C1 -C10 alkyl group, or an aryl group), Orn, or is deleted;
A27 is an aromatic amino acid other than Tyr;
A28 is Leu, Ile, Vat, Trp, Aib, Aib, Anb, or N-Me-Leu;
A29 is Asn, Ala, Gln, Gly, Trp, or N-Me-Asn;
A30 is Leu, Ile, Val, Trp, Aib, Anb, or N-Me-Leu;
A31 is Vat, Ile, Trp, Aib, Anb, or N-Me-Val;
A32 is Thr, Ser, N-Me-Set, or N-Me-Thr;
R3 is H, C1 -C12 alkyl (e.g., methyl), C6 -C18 aryl (e.g., phenyl, naphthaleneacetyl), C1 -C12 acyl (e.g., formyl, acetyl, and myristoyl), C7 -C18 aralkyl (e.g., benzyl), or C7 -C18 alkaryl (e.g., p-methylphenyl);
R4 is H, C1 -C12 alkyl (e.g., methyl), C6 -C18 aryl (e.g., phenyl, naphthaleneacetyl), C1 -C12 acyl (e.g., formyl, acetyl, and myristoyl), C7 -C18 aralkyl (e.g., benzyl), or C7 -C18 alkaryl (e.g., p-methylphenyl),
or a pharmaceutically acceptable salt thereof.
Particularly preferred agonists of this formula to be used in the method of the invention include:
N-α-Ala-Ser-Leu-Arg-His-Trp-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH.sub.2 (Analog #1) (SEQ. ID. NO. 5).
Also preferred peptide YY agonists of the invention is of the formula: ##STR2## wherein:
the N-terminal amino acid bonds to R1 and R2 ;
Y is a chain of 0-4 amino acids, inclusive the C-terminal one of which bonds to R3 and R4 ;
R1 is H, C1 -C12 alkyl, C6 -C18 aryl, C1 -C12 acyl, C7 -C18 aralkyl, or C7 -C18 alkaryl;
R2 is H, C1 -C12 alkyl, C6 -C18 aryl, C1 -C12 acyl, C7 -C18 aralkyl, or C7 -C18 alkaryl;
A25 is Arg, Lys, homo-Arg, diethyl-homo-Arg, Lys-ε-NH-R (where R is H, a branched or straight chain C1 -C10 alkyl group, or an aryl group), Orn, or is deleted;
A26 is Ala, His, Thr, 3-Me-His, 1-Me-His, β-pyrozolylalanine, N-Me-His, Arg, Lys, homo-Arg, diethyl-homo-Arg, Lys-ε-NH-R (where R is H, a branched or straight chain C1 -C10 alkyl group, or an aryl group), Orn or is deleted;
A27 is an aromatic amino acid;
A28 is Leu, Ile, Val, Trp, Aib, Anb, or N-Me-Leu;
A29 is Asn, Ala, Gln, Gly, Trp, or N-Me-Asn;
A30 is Leu, Ile, Val, Trp, Aib, Anb, or N-Me-Leu;
A31 is Val, Ile, Trp, Aib, Anb, or N-Me-Val;
A32 is Thr, Set, N-Me-Set, or N-Me-Thr or D-Trp;
R3 is H, C1-C 12 alkyl, C6 -C18 aryl, C1 -C12 acyl, C7 -C18 aralkyl, or C7 -C18 alkaryl; and
R4 is H, C1 -C12 alkyl, C6 -C18 aryl, C1 -C12 acyl, C7 -C18 aralkyl, or C7 -C18 alkaryl,
or a pharmaceutically acceptable salt thereof. Note that, unless indicated otherwise, for all peptide YY agonists described herein, each amino acid residue, e.g., Leu and A1, represents the structure of NH--C(R)H--CO--, in which R is the side chain. Lines between amino acid residues represent peptide bonds which join the amino acids. Also, where the amino acid residue is optically active, it is the L-form configuration that is intended unless D-form is expressly designated.
Synthesis of PYY Agonists:
Human PYY, homologues, fragments, and analogs thereof, can be purchased commercially (Bachem California 1993-94 Catalogue, Torrance, Calif.; Sigma Peptides and Amino Acids 1994 Catalog, St. Louis, Miss.). The PYY analogs of the present invention may also be synthesized by many techniques that are known to those skilled in the peptide art. An excellent summary of the many techniques so available may be found in Solid Phase Peptide Synthesis 2nd ed. (Stewart, J. M. and Young, J. D., Pierce Chemical Company, Rockford, Ill. 1984).
Analog #1 (Sequence ID No. 5), obtained from the University of Cincinnati, Cincinnati, Ohio, was synthesized as follows. Peptide synthesis was performed on an Applied Biosystems® (Forster City, Calif.) Model 430A synthesizer. Amino acid and sequence analyses were carried out using Waters® (Milford, Mass.) Pico-Tag and Applied Biosystems® Model 470A instruments, respectively. The peptide was purified using a Waters Model 600 solvent delivery system equipped with a Model 481 Spectrophotometer and U6K injector according to standard protocols. Peptide mass spectra were determined at the University of Michigan, Protein Chemistry Facility, An Arbor, Michigan according to standard methods. All Boc-L-amino acid derivatives, solvents, chemicals and the resins were obtained commercially and used without further purification.
Paramethylbenzhydrylamine (MBHA) resin (0.45 mmol/gm, -NH2) was placed in the reaction vessel of the peptide synthesizer and the protected amino acid derivatives were sequentially coupled using the program provided by the manufacturers modified to incorporate a double coupling procedure (see, e.g., Balasubramaniam et at., Peptide Research 1: 32, 1988). All amino acids were coupled using 2.2 equivalents of preformed symmetrical anhydrides. Arg, Gln and Asn, however, were coupled as preformed 1-hydroxybenzotriazole (HOBT) esters to avoid side reactions. At the end of the synthesis, the N-α-Boc group was removed and in some instances the free α-NH2 was acetylated by reaction with acetic anhydride (2 equivalents) and diisopropyl ethylamine until a negative ninhydrin test was obtained (Anal. Biochem. 34:595, 1970). The peptide resin (˜1.0 g) was then treated with HF (10 ml) containing p-cresol (˜0.8 g) for 1 h at -2 to -4° C. The HF was evaporated and the residue was transferred to a fritted filter funnel with diethyl ether, washed repeatedly with diethyl ether, extracted with acetic acid (2×15 ml) and lyophilized. The crude peptides thus obtained were purified by semipreparative RP-HPLC.
Other PYY analogs of the invention can be prepared by making appropriate modifications, within the ability of a person of ordinary skill in this field, of the synthetic methods disclosed herein.
While it is possible for peptide YY and peptide YY analogs to be administered as the pure or substantially pure compounds, it is preferable that they be administered as pharmaceutical formulations or preparation. The formulations to be used in the present invention, for both humans and animals, include peptide PYY any of the analogs set forth above, together with one or more pharmaceutically acceptable carriers therefor, and optionally other therapeutic ingredients.
The carrier must be "acceptable" in the sense of being compatible with the active ingredient(s) of the formulation (and preferably, capable of stabilizing peptides) and not deleterious to the subject to be treated.
The formulations may conveniently be presented in unit dosage form and may be prepared by any of the methods well known in the art of pharmacy. All methods include the step of bringing the active ingredient(s) into association with the carrier which constitutes one or more accessory ingredients.
In general, the formulations for tablets or powders are prepared by uniformly and intimately blending the active ingredient with finely divided solid carriers, and then, if necessary, as in the case of tablets, forming the product into the desired shape and size.
Formulations suitable for intravenous administration, on the other hand, conveniently comprise sterile aqueous solutions of the active ingredient(s). Preferably, the solutions are isotonic with the blood of the subject to be treated. Such formulations may be conveniently prepared by dissolving solid active ingredient(s) in water to produce an aqueous solution, and rendering said solution sterile. The formulation may be presented in unit or multi-dose containers, for example, sealed ampules or vials.
Formulations suitable for sustained release formulations include biodegradable polymers (e.g. U.S. Pat. Nos. 4,678,189 and 4,767,628, hereinafter incorporated by reference). Examples of suitable biodegradable polymers include L-lactic acid, D-lactic acid, DL-lactic acid, glycolide, glycolic acid, and any optically active isomers, racements, or copolymers thereof.
Peptide YY and peptide YY agonists are administered to pancreatic tumors using the same procedures which are well-known for use in introducing chemotherapeutic agents to pancreatic tumors. The particular route of administration will vary depending upon tumor type, location, extent of growth and other factors. By routine experimentation, the preferred route of administration and dosage regimen can be established on an individual basis. As mentioned previously, the administration routes include: intravenous introduction to the tumor; subcutaneous introduction by implantation of a sustained release device near the tumor; transdermal introduction by topical or ion phoretic application; direct introduction to the tumor by an implantable or external infusion pump; or by perfusion. All of the above administration routes are well-known to those of ordinary skill in the art and have been used in pancreatic tumor treatment protocols using other chemotherapeutic agents.
In order to achieve maximum dosage levels with minimum side-effects, it is preferred that administration techniques be used which introduce peptide YY or peptide YY agonists directly to the tumor. Direct infusion and perfusion are examples. The dosage level may be varied widely depending upon the patients tolerance to the particular peptide YY or analog being administered. Initial trial infusion or perfusion dosages on the order of two to four hundred pmol/kg/hour are preferably used. The dosage level is adjusted upward or downward depending upon patient tolerance and tumor response. Preferably the dosage level is increased to a level which provides a significant (i.e. at least 15 %) reduction in cell proliferation without causing adverse side effects, such as vomiting, abdominal pain or constipation.
The method of the present invention is preferably carried out continuously over extended periods of time to achieve maximum effectiveness. Sustained release devices located adjacent to the tumor are well-suited for providing continual application. Infusion and perfusion is preferably carded out continually for 6 hours up to 168 hours. Patient and tumor response to the treatment is continually monitored during the treatment period with adjustments in dosage levels being made, if necessary. Treatment is terminated when desired levels of reduction in minor cell proliferation are achieved or the patient experiences adverse side effects. It is preferred that treatment times, like dosages, be maximized to achieve maximum reduction in cell proliferation without creating adverse side effects.
Examples of practice are as follows:
EXAMPLE 1 Demonstration of Anti-Proliferative Activity In Vitro
In this example, the effectiveness of PYY and Analog #1 in reducing proliferation of two different pancreatic ductal adenocarcinomas in vitro is demonstrated. PANC-1 and MiaPaCa-2 are two human pancreatic adenocarcinomas cancer cell lines which are available commercially from suppliers such as American Type Culture Collection, ATCC (Rockville, Md.). For this example, the two tumor cells were grown in RPMI-1640 culture media supplemented with 10% fetal bovine serum, 29.2 mg/L of glutamine, 25 μg gentamicin, 5 ml penicillin, streptomycin, and fungizone solution (JRH Biosciences, Lenexa, Kans.) at 37° Celcius in a NAPCO water jacketed 5 % CO2 incubator. All cell lines were detached with 0.25 % trypsin (Clonetics, San Diego, Calif.) once to twice a week when a confluent monolayer of tumor cells was achieved. Cells were pelleted for 7 minutes at 500 g in a refrigerated centrifuge at 4 ° Celcius, and resuspended in trypsin free fortified RPMI 1640 culture media. Viable cells were counted on a hemocytometer slide with trypan blue.
Ten thousand, 20,000, 40,000 and 80,000 cells of each type were added to 96 well microculture plates (Costar, Cambridge, Mass.) in a total volume of 200 μl of culture media per well. Cells were allowed to adhere for 24 hours prior to addition of the PYY or Analog #1 peptides. Fresh culture media was exchanged prior to addition of peptides. In vitro incubation of pancreatic tumor cells with either PYY or Analog #1 was continued for 6 hours and 36 hours in length. PYY was added to cells at doses of 250 pmol, 25 pmol, and 2.5 pmol per well (N =14). Analog #1 was added to cells cultures at doses of 400 pmol, 40 pmol, and 4 pmol per well. Control wells received 2 μl of 0.9% saline to mimic the volume and physical disturbance upon adhered tumor cells. Each 96 well plate contained 18 control wells to allow for comparison within each plate during experimentation. Ninety-six (96) well plates were repeated 6 times with varying concentrations of PYY and Analog #1 in both the PANC-1 and MiaPaCa-2 cells.
At the end of the incubation period, 3-(4,5-dimethylthiazolyl-2-yl)-2,5-diphenyltetrazolium Bromide, MTr tetrazolium bromide (Sigma, St. Louis, Mo.) was added to fresh culture media at 0.5 mg/ml. Culture media was exchanged and tumor cells were incubated for 4 hours with MTT tetrazolium bromide at 37° Celcius. At the end of incubation, culture media was aspirated. Formazon crystal precipitates were dissolved in 200 μl of dimethyl sulfoxide (Sigma, St. Louis, Mo.). Quantitation of solubilized formazon was performed by obtaining absorption readings at 500 nm wavelength on an ELISA reader (Molecular Devices, Menlo Park, Calif.). The MTT assay measures mitochondrial NADH dependent dehydrogenase activity, and it has been among the most sensitive and reliable method to quantitative in vitro chemotherapy responses of tumor cells. (Alley, M. C., Scudiero, D. A., Monk, A., Hursey, M. L., Dzerwinski, M. J., Fine, D. L., Abbott, B. J., Mayo, J. G., Shoemaker, R. H. and Boyd, M. R., Feasibility of drug screening with panels of human tumor cell lines using a microculture tetrazolium assay Cancer Res., 48:589-601, 1988; Carmichael, J., DeGraff, W. G., Gazdar, A. F., Minna, J. D. and Mitchell, J. B., Evaluation of a tetrazolium-based semiautomated colorimetric assay: Assessment of chemosensitivity testing. Cancer Res., 47:936-942, 1987; McHale, A. P., McHale, L., Use of a tetrazolium based colorimetric assay in assessing photoradiation therapy in vitro. Cancer Lett., 41:315-321, 1988; and Saxton, R. E., Huang, M. Z., Plante D., Fetterman, H. F., Lufkin, R. B., Soudant, J., Castro, D. J., Laser and daunomycin chemophototherapy of human carcinoma cells. J. Clin. Laser Med. and Surg., 10(5):331-336, 1992.)
Analysis of absorption readings at 550 nm were analyzed by grouping wells of the same test conditions and verifying differences occurring between control and the various peptide concentration treatments by one-way ANOVA. Once statistical significance was achieved, P <0.05, each test group was compared to its paired control group by Student's T-test within each 96 well plate. A statistical significance was considered when P <0.05 was achieved.
The results of the MTT viability assays for PANC-1 and MiaPaCa-2 36 hours after exposure to either PYY or BIM-43004-1 are shown in the following Table. Percent reduction in cell growth is described as compared to control cell growth with normal saline inoculation.
              TABLE I                                                     
______________________________________                                    
Percent Reduction in Tumor Growth(%)                                      
Compound Compared to Control                                              
PEPTIDE  CONCENTRATION  PANC-1    Mia PaCa-2                              
______________________________________                                    
PYY      250      pmol      25.7%   15.4%                                 
PYY      25       pmol      14.7%   12.8%                                 
PYY      2.5      pmol      9.8%    0.5%                                  
Analog #1                                                                 
         400      pmol      18.2%   37.1%                                 
Analog #1                                                                 
         40       pmol      21.3%   33.6%                                 
Analog #1                                                                 
         4        pmol      10.5%   28.3%                                 
*P < 0.05 by ANOVA                                                        
______________________________________                                    
As shown in the above Table, the MTT assay confirmed a significant decrease in the cell growth of both pancreatic tumor cell lines when PYY and Analog #1 were added to the cells.
EXAMPLE 2 Demonstration of Anti-Proliferative Activity In Vivo
In this example, the effectiveness of PYY and Analog #1 in reducing proliferation of a pancreatic ductal adenocarcinoma in vivo is demonstrated.
The human pancreatic ductal adenocarcinoma Mia Paca-2 was examined for in vivo growth inhibition by peptide YY and Analog #1. Seventy thousand to 100,000 human Mia PaCa-2 cells were orthotopically transplanted into 48 male athymic mice. After one week, the animals were treated with either PYY or Analog #1 at 200 pmol/kg/hr via mini-osmotic pumps for four weeks. The paired cultures received saline. At sacrifice, both tumor size and mass were measured.
Control mice had significant human cancer growth within the pancreas as evidenced by histologic sections. At 9 weeks, ninety percent (90%) of control mice had substantial metastatic disease. Tumor mass was decreased by 60.5 % in Analog #1 treated mice and 27% in PYY treated mice.
EXAMPLE 3 Intravenous Treatment of Benign Pancreatic Tumor In Vivo
A patient having a pancreatic serous cyst adenoma is treated as follows in accordance with the present invention:
A sterile saline or distilled water solution containing from 7200 pmol to 864,000 pmol PYY or Analog gl in 1000 cc of total volume is administered intravenously to the patient at a rate of 12 to 24 ml/hour. The solution is administered so as to provide a delivery rate of PYY or Analog #1 on the order of about 200 pmol/kg/hour to about 400 pmol/kg/hour. The intravenous administration is conducted for 6 to 36 hours at a time depending upon patient tolerance. Standard intravenous delivery equipment is utilized. The treatment is repeated as required to achieve reduction in tumor cell proliferation.
EXAMPLE 4 Perfusion Treatment of Benign Pancreatic Tumor In Vivo
A patient having a pancreatic solid-cystic tumor is treated as follows in accordance with the present invention:
A sterile saline or distilled water solution containing from PYY or Analog #1 is administered by directly perfusing the solution into the tumor site. The concentration of PYY or Analog #1 in the solution and the delivery rate are chosen to provide delivery of 200 pmol/kg/hour to 400 pmol/kg/hour. Perfusion is accomplished using Alzet Mini-Osmotic pumps implanted subcutaneously which are connected to a polyethylene catheter tunneled through the abdominal musculature.
EXAMPLE 5 Implantation Treatment of Malignant Pancreatic Tumor In Vivo
A patient having a carcinoma arising from a pancreatic duct is treated as follows in accordance with the present invention:
An implant device is prepared which is capable of delivering from 100 pmol to 1000 pmol of PYY or Analog #1 directly to the tumor for periods of up to 2 weeks. The device is implanted adjacent to the tumor in accordance with standard implant insertion procedures.
EXAMPLE 6 Intravenous Treatment of Malignant Pancreatic Tumor In Vivo
A patient having a carcinoma arising from a pancreatic islet is treated as follows in accordance with the present invention:
A sterile saline solution containing PYY or Analog #1 is administered intravenously to the patient via a peripheral venous catheter or central venous catheter. The delivery rate is selected so as to provide a dosage of from about 200 pmol/kg/hour to about 400 pmol/kg/hour of either PYY or Analog #1.
EXAMPLE 7 Perfusion Treatment of Malignant Pancreatic Tumor In Vivo
A patient having a carcinoma arising from a pancreatic acini is treated as follows in accordance with the present invention:
A sterile saline solution containing PYY or Analog #1 is administered by directly perfusing the solution into the tumor site. The same perfusion procedure used in Example 4 is followed. The concentration of PYY or Analog #1 and perfusion rate are selected to provide delivery of 200 pmol/kg/hour to 404 pmol/kg/hour of either peptide YY or Analog #1.
The publications and other reference materials referred to herein to describe the background of the invention and to provide additional details regarding its practice are all hereby incorporated by reference.
The foregoing description has been limited to specific embodiments of this invention. It will be apparent, however, that variations and modifications may be made to the invention, with the attainment of some or all of the advantages of the invention. Such embodiments are also within the scope of the following claims.
__________________________________________________________________________
SEQUENCE LISTING                                                          
(1) GENERAL INFORMATION:                                                  
(iii) NUMBER OF SEQUENCES: 5                                              
(2) INFORMATION FOR SEQ ID NO:1:                                          
(i) SEQUENCE CHARACTERISTICS:                                             
(A) LENGTH: 36 amino acids                                                
(B) TYPE: amino acid                                                      
(D) TOPOLOGY: linear                                                      
(ii) MOLECULE TYPE: peptide                                               
(vi) ORIGINAL SOURCE:                                                     
(A) ORGANISM: porcine peptide YY                                          
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:1:                                   
TyrProAlaLysProGluAlaProGlyGluAspAlaSerProGluGlu                          
151015                                                                    
LeuSerArgTyrTyrAlaSerLeuArgHisTyrLeuAsnLeuValThr                          
202530                                                                    
ArgGlnArgTyr                                                              
35                                                                        
(2) INFORMATION FOR SEQ ID NO:2:                                          
(i) SEQUENCE CHARACTERISTICS:                                             
(A) LENGTH: 36 amino acids                                                
(B) TYPE: amino acid                                                      
(D) TOPOLOGY: linear                                                      
(ii) MOLECULE TYPE: peptide                                               
(vi) ORIGINAL SOURCE:                                                     
(A) ORGANISM: HUMAN PEPTIDE YY                                            
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:2:                                   
TyrProIleLysProGluAlaProGlyGluAspAlaSerProGluGlu                          
151015                                                                    
LeuAsnArgTyrTyrAlaSerLeuArgHisTyrLeuAsnLeuValThr                          
202530                                                                    
ArgGlnArgTyr                                                              
35                                                                        
(2) INFORMATION FOR SEQ ID NO:3:                                          
(i) SEQUENCE CHARACTERISTICS:                                             
(A) LENGTH: 36 amino acids                                                
(B) TYPE: amino acid                                                      
(D) TOPOLOGY: linear                                                      
(ii) MOLECULE TYPE: peptide                                               
(vi) ORIGINAL SOURCE:                                                     
(A) ORGANISM: HUMAN NEUROPEPTIDE Y                                        
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:3:                                   
TyrProSerLysProAspAsnProGlyGluAspAlaProAlaGluAsp                          
151015                                                                    
MetAlaArgTyrTyrSerAlaLeuArgHisTyrIleAsnLeuIleThr                          
202530                                                                    
ArgGlnArgTyr                                                              
35                                                                        
(2) INFORMATION FOR SEQ ID NO:4:                                          
(i) SEQUENCE CHARACTERISTICS:                                             
(A) LENGTH: 36 amino acids                                                
(B) TYPE: amino acid                                                      
(D) TOPOLOGY: linear                                                      
(ii) MOLECULE TYPE: peptide                                               
(vi) ORIGINAL SOURCE:                                                     
(A) ORGANISM: PORCINE NEURAL PEPTIDE Y                                    
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:4:                                   
TyrProSerLysProAspAsnProGlyGluAspAlaProAlaGluAsp                          
151015                                                                    
LeuAlaArgTyrTyrSerAlaLeuArgHisTyrIleAsnLeuIleThr                          
202530                                                                    
ArgGlnArgTyr                                                              
35                                                                        
(2) INFORMATION FOR SEQ ID NO:5:                                          
(i) SEQUENCE CHARACTERISTICS:                                             
(A) LENGTH: 15 amino acids                                                
(B) TYPE: amino acid                                                      
(D) TOPOLOGY: linear                                                      
(ii) MOLECULE TYPE: peptide                                               
(vi) ORIGINAL SOURCE:                                                     
(A) ORGANISM: peptide YY analog #1                                        
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:5:                                   
AlaSerLeuArgHisTrpLeuAsnLeuValThrArgGlnArgTyr                             
151015                                                                    
__________________________________________________________________________

Claims (18)

What is claimed is:
1. A method of inhibiting proliferation of pancreatic tumors in mammals, said method comprising the step of administering to said mammal an effective amount of PYY or a PYY agonist.
2. A method of claim 1, wherein said pancreatic tumor is benign.
3. A method of claim 1, wherein said pancreatic tumor is malignant.
4. The method of claim 1, wherein said administering is effected parenterally.
5. The method of claim 4, wherein said administering is effected intravenously.
6. The method of claim 4, wherein said administering is effected subcutaneously.
7. The method of claim 4,wherein said administering is effected by implantation.
8. The method of claim 4, wherein said administering is effected by perfusion.
9. The method of claim 2, wherein said administering is effected parenterally.
10. The method of claim 9, wherein said administering effected intravenously.
11. The method of claim 9, wherein said administering is effected subcutaneously.
12. The method of claim 9, wherein said administering is effected by implantation.
13. The method of claim 9, wherein said administering is effected by perfusion.
14. The method of claim 3, wherein said administering is effected parenterally.
15. The method of claim 14, wherein said administering is effected intravenously.
16. The method of claim 14, wherein said administering is effected subcutaneously.
17. The method of claim 14,wherein said administering is effected by implantation.
18. The method of claim 14, wherein said administering is effected by perfusion.
US08/338,395 1994-11-14 1994-11-14 Treatment of pancreatic tumors with peptide YY and analogs thereof Expired - Lifetime US5574010A (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
US08/338,395 US5574010A (en) 1994-11-14 1994-11-14 Treatment of pancreatic tumors with peptide YY and analogs thereof
PCT/US1995/014303 WO1996014854A1 (en) 1994-11-14 1995-11-03 Treatment of pancreatic tumors with peptide yy and analogs thereof
AU42301/96A AU4230196A (en) 1994-11-14 1995-11-03 Treatment of pancreatic tumors with peptide yy and analogs thereof

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
US08/338,395 US5574010A (en) 1994-11-14 1994-11-14 Treatment of pancreatic tumors with peptide YY and analogs thereof

Publications (1)

Publication Number Publication Date
US5574010A true US5574010A (en) 1996-11-12

Family

ID=23324657

Family Applications (1)

Application Number Title Priority Date Filing Date
US08/338,395 Expired - Lifetime US5574010A (en) 1994-11-14 1994-11-14 Treatment of pancreatic tumors with peptide YY and analogs thereof

Country Status (3)

Country Link
US (1) US5574010A (en)
AU (1) AU4230196A (en)
WO (1) WO1996014854A1 (en)

Cited By (48)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5916869A (en) * 1997-06-13 1999-06-29 North Carolina State University Method of treating birds in ovo
US6046167A (en) * 1998-03-25 2000-04-04 University Of Cincinnati Peptide YY analogs
WO2000047219A3 (en) * 1999-02-10 2002-01-31 Ontogeny Inc Methods and reagents for treating glucose metabolic disorders
US20020141985A1 (en) * 2000-12-14 2002-10-03 Amylin Parmaceuticals, Inc. Peptide YY and peptide YY agonists for treatment of metabolic disorders
US20040115135A1 (en) * 2002-12-17 2004-06-17 Quay Steven C. Compositions and methods for enhanced mucosal delivery of peptide YY and methods for treating and preventing obesity
US20040157777A1 (en) * 2002-12-17 2004-08-12 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery of Y2 receptor-binding peptides and methods for treating and preventing obesity
WO2004066966A2 (en) 2003-01-17 2004-08-12 Societe De Conseils De Recherches Et D'applications Scientifiques S.A.S. Peptide yy analogs
US20040214772A1 (en) * 2002-12-17 2004-10-28 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery of Y2 receptor-binding peptides and methods for treating and preventing obesity
US20040228846A1 (en) * 1999-02-10 2004-11-18 Curis, Inc. Methods and reagents for treating glucose metabolic disorders
US20050002927A1 (en) * 2002-12-17 2005-01-06 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery and non-infused administration of Y2 receptor-binding peptides and methods for treating and preventing obesity
US20050014693A1 (en) * 2000-04-10 2005-01-20 Cedars-Sinai Medical Center Methods for manipulating upper gastrointestinal transit, blood flow, and satiety, and for treating visceral hyperalgesia
US20050118657A1 (en) * 2003-12-02 2005-06-02 Corey Elias J. Noninvasive screening method for the detection of colorectal cancer
US20050176630A1 (en) * 2001-09-24 2005-08-11 Michael Cowley Modification of feeding behavior
US20060014678A1 (en) * 2002-06-28 2006-01-19 Imperial College Innovations Ltd. Modification of feeding behavior
US20060094653A1 (en) * 2004-02-11 2006-05-04 Levy Odile E Pancreatic polypeptide family motifs and polypeptides comprising the same
US20060122106A1 (en) * 2002-06-14 2006-06-08 Amylin Pharmaceuticals, Inc Prevention and/or treatment of inflammatory bowel disease using pyy or agonists thereof
WO2006066024A2 (en) 2004-12-13 2006-06-22 Amylin Pharmaceuticals, Inc. Pancreatic polypeptide family motifs, polypeptides and methods comprising the same
US20060189522A1 (en) * 2003-01-10 2006-08-24 Bloom Stephen R Modification of feeding behaviour
WO2007041052A2 (en) 2005-09-29 2007-04-12 Merck & Co., Inc. Acylated spiropiperidine derivatives as melanocortin-4 receptor modulators
US20070232537A1 (en) * 2005-12-19 2007-10-04 Nastech Pharmaceutical Company Inc. Intranasal pyy formulations with improved transmucosal pharmacokinetics
WO2008120653A1 (en) 2007-04-02 2008-10-09 Banyu Pharmaceutical Co., Ltd. Indoledione derivative
US20090181885A1 (en) * 2006-12-13 2009-07-16 Imperial Innovations Limited Novel compounds and their effects on feeding behaviour
WO2009129220A2 (en) 2008-04-14 2009-10-22 The Gereral Hospital Corporation Plectin-1 targeted agents for detection and treatment of pancreatic ductal adenocarcinoma
US20090298757A1 (en) * 2005-06-13 2009-12-03 Imperial Innovations Limited Oxyntomodulin analogues and their effects on feeding behaviour
US20100190712A1 (en) * 2007-09-11 2010-07-29 Dorian Bevec Use of peptide yy, alone or in combination with glucagon-like peptide, for use in medicine
US20110034374A1 (en) * 2001-09-07 2011-02-10 Imperial Innovations Limited Oxyntomodulin for Preventing or Treating Excess Weight
US7935799B2 (en) 1999-08-11 2011-05-03 Cedars-Sinai Medical Center Methods of treating diarrhea caused by small intestinal bacterial overgrowth
EP2329839A1 (en) 2002-01-10 2011-06-08 Imperial Innovations Limited Modification of feeding behavior by GLP-1 and PYY
EP2330125A2 (en) 2005-08-11 2011-06-08 Amylin Pharmaceuticals, Inc. Hybrid polypeptides with selectable properties
EP2330124A2 (en) 2005-08-11 2011-06-08 Amylin Pharmaceuticals Inc. Hybrid polypeptides with selectable properties
EP2390264A1 (en) 2005-02-11 2011-11-30 Amylin Pharmaceuticals Inc. GIP analog and hybrid polypeptides with selectable propperties
EP2417980A1 (en) 2004-02-11 2012-02-15 Amylin Pharmaceuticals Inc. Hybrid polypeptides with selectable properties
EP2698157A1 (en) 2006-09-22 2014-02-19 Merck Sharp & Dohme Corp. Method of treatment using fatty acid synthesis inhibitors
US20150198613A1 (en) * 2012-01-24 2015-07-16 University Of Massachusetts Soluble manf in pancreatic beta-cell disorders
EP3178835A1 (en) 2009-02-03 2017-06-14 Amunix Operating Inc. Extended recombinant polypeptides and compositions comprising same
EP3323423A1 (en) 2009-09-28 2018-05-23 Intarcia Therapeutics, Inc Rapid establishment and/or termination of substantial steady-state drug delivery
US10005824B2 (en) 2015-06-12 2018-06-26 Novo Nordisk A/S Selective PYY compounds and uses thereof
EP3406347A2 (en) 2012-02-27 2018-11-28 Amunix Operating Inc. Xten conjugate compositions and methods of making same
US10246497B2 (en) 2013-11-15 2019-04-02 Novo Nordisk A/S Selective PYY compounds and uses thereof
US10583172B2 (en) 2013-11-15 2020-03-10 Novo Nordisk A/S HPYY(1-36) having a beta-homoarginine substitution at position 35
WO2020077129A1 (en) 2018-10-11 2020-04-16 Intarcia Therapeutics, Inc. Human amylin analog polypeptides and methods of use
EP3733694A1 (en) 2016-05-16 2020-11-04 Intarcia Therapeutics, Inc Glucagon-receptor selective polypeptides and methods of use thereof
WO2021097186A1 (en) 2019-11-13 2021-05-20 Amunix Pharmaceuticals, Inc. Barcoded xten polypeptides and compositions thereof, and methods for making and using the same
US11382957B2 (en) 2010-12-16 2022-07-12 Novo Nordisk A/S Solid compositions comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid
US11759502B2 (en) 2012-03-22 2023-09-19 Novo Nordisk A/S Compositions of GLP-1 peptides and preparation thereof
US11833248B2 (en) 2018-02-02 2023-12-05 Novo Nordisk A/S Solid compositions comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid
US12239739B2 (en) 2013-05-02 2025-03-04 Novo Nordisk A/S Oral dosing of GLP-1 compounds
US12617815B2 (en) 2020-11-13 2026-05-05 Amunix Pharmaceuticals, Inc. Barcoded XTEN polypeptides and compositions thereof, and methods for making and using the same

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7601691B2 (en) 1999-05-17 2009-10-13 Conjuchem Biotechnologies Inc. Anti-obesity agents

Non-Patent Citations (22)

* Cited by examiner, † Cited by third party
Title
Balasubramaniam et al., "Structure-Activity Studies of Peptide YY(22-36): N-α-Ac-[Phe27 ]PYY(22-36), a Potent Antisecretory Peptide in Rat Jejunum," Peptides (1993) 14, pp. 1011-1016.
Balasubramaniam et al., Structure Activity Studies of Peptide YY(22 36): N Ac Phe 27 PYY(22 36), a Potent Antisecretory Peptide in Rat Jejunum, Peptides (1993) 14, pp. 1011 1016. *
Blackmore et al., Br. J. Cancer, (1992) 66 32 38. *
Blackmore et al., Br. J. Cancer, (1992) 66 32-38.
Evers et al., "Differential Effects of Gut Hormones on Pancreatic and Intestinal Growth During Administration of an Elemental Diet," Ann. Surg. (1990) 211, 5, 630-638.
Evers et al., Differential Effects of Gut Hormones on Pancreatic and Intestinal Growth During Administration of an Elemental Diet, Ann. Surg. (1990) 211, 5, 630 638. *
Harper s Review of Biochemistry, pp. 559 561 (Copyright 1985 Lange Medical Publications). *
Harper's Review of Biochemistry, pp. 559-561 (Copyright 1985--Lange Medical Publications).
Laburthe, M., "Peptide YY and Neuropeptide Y in the Gut/Availability, Biological Actions, and Receptors," Trends in Endocrinology and Metabolism, In press, Dec. 1989, pp. 035-041.
Laburthe, M., Peptide YY and Neuropeptide Y in the Gut/Availability, Biological Actions, and Receptors, Trends in Endocrinology and Metabolism, In press, Dec. 1989, pp. 035 041. *
Leiter et al., "Peptide YY/Structure of the Precursor and Expression in Exocrine Pancreas," J. Biol. Chem. (1987) vol. 262, No. 27, pp. 12984-12988.
Leiter et al., Peptide YY/Structure of the Precursor and Expression in Exocrine Pancreas, J. Biol. Chem. (1987) vol. 262, No. 27, pp. 12984 12988. *
Palmer Smith et al., Am. J. Physiol. (1993) 265 (1, pt. 1) pp. G149 G155. *
Palmer Smith et al., Am. J. Physiol. (1993) 265 (1, pt. 1) pp. G149-G155.
Pappas et al., Gastroenterology (1985) 89 pp. 1387 1392. *
Pappas et al., Gastroenterology (1985) 89 pp. 1387-1392.
Playford et al., "Preliminary report: role of peptide YY in defence aainst diarrhoea," The Lancet (1990) 335, 1555-1557.
Playford et al., Preliminary report: role of peptide YY in defence aainst diarrhoea, The Lancet (1990) 335, 1555 1557. *
R a m o et al., Neuropeptide Y and Peptide YY Stimulate the Growth of Exocrine Pancreatic Carcinoma Cells, Neuropeptides (1990) 15, 101 106. *
R am oet al., "Neuropeptide Y and Peptide YY Stimulate the Growth of Exocrine Pancreatic Carcinoma Cells," Neuropeptides (1990) 15, 101-106.
Sheikh et al., "Localization of Y1 receptors for NPY and PYY on vascular smooth muscle cells in rat pancreas," Am. Phys. Soc. (1991) G250-G257.
Sheikh et al., Localization of Y 1 receptors for NPY and PYY on vascular smooth muscle cells in rat pancreas, Am. Phys. Soc. (1991) G250 G257. *

Cited By (118)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7081239B2 (en) 1995-05-17 2006-07-25 Cedars-Sinai Medical Center Burns And Allen Research Center Methods for manipulating upper gastrointestinal transit, blood flow, and satiety, and for treating visceral hyperalgesia
US5916869A (en) * 1997-06-13 1999-06-29 North Carolina State University Method of treating birds in ovo
US6046167A (en) * 1998-03-25 2000-04-04 University Of Cincinnati Peptide YY analogs
AU779745B2 (en) * 1999-02-10 2005-02-10 Curis, Inc. Methods and reagents for treating glucose metabolic disorders
WO2000047219A3 (en) * 1999-02-10 2002-01-31 Ontogeny Inc Methods and reagents for treating glucose metabolic disorders
US7807641B2 (en) 1999-02-10 2010-10-05 Curis, Inc. Methods and reagents for treating glucose metabolic disorders
US7745216B2 (en) 1999-02-10 2010-06-29 Curis, Inc. Methods and reagents for treating glucose metabolic disorders
AU779745C (en) * 1999-02-10 2005-08-25 Curis, Inc. Methods and reagents for treating glucose metabolic disorders
US7396809B1 (en) 1999-02-10 2008-07-08 Curis, Inc. Methods and reagents for treating glucose metabolic disorders
US20040228846A1 (en) * 1999-02-10 2004-11-18 Curis, Inc. Methods and reagents for treating glucose metabolic disorders
US20080188406A1 (en) * 1999-02-10 2008-08-07 Curis, Inc. Methods and reagents for treating glucose metabolic disorders
US8388935B2 (en) 1999-08-11 2013-03-05 Cedars-Sinai Medical Center Methods of diagnosing and treating small intestinal bacterial overgrowth (SIBO) and SIBO-related conditions
US7935799B2 (en) 1999-08-11 2011-05-03 Cedars-Sinai Medical Center Methods of treating diarrhea caused by small intestinal bacterial overgrowth
US8110177B2 (en) 1999-08-11 2012-02-07 Cedars-Sinai Medical Center Methods of diagnosing and treating small intestinal bacterial overgrowth (SIBO) and SIBO-related conditions
US8197805B2 (en) 1999-08-11 2012-06-12 Cedars-Sinai Medical Center Methods of treating autoimmune diseases caused by small intestinal bacterial overgrowth
US20100209507A1 (en) * 1999-08-11 2010-08-19 Cedars-Sinai Medical Center Methods of diagnosing and treating small intestinal bacterial overgrowth (sibo) and sibo-related conditions
US9358276B2 (en) 1999-08-11 2016-06-07 Cedars-Sinai Medical Center Methods of diagnosing and treating small intestinal bacterial overgrowth (SIBO) and SIBO-related conditions
US8562952B2 (en) 1999-08-11 2013-10-22 Cedars-Sinai Medical Center Methods for manipulating satiety
US7608245B2 (en) 2000-04-10 2009-10-27 Cedars-Sinai Medical Center Methods for manipulating satiety
US7615207B2 (en) 2000-04-10 2009-11-10 Cedars-Sinai Medical Center Methods for treating irritable bowel syndrome
US20050014693A1 (en) * 2000-04-10 2005-01-20 Cedars-Sinai Medical Center Methods for manipulating upper gastrointestinal transit, blood flow, and satiety, and for treating visceral hyperalgesia
US7244412B2 (en) 2000-04-10 2007-07-17 Cedars-Sinai Medical Center Methods for manipulating upper gastrointestinal transit, blood flow, and satiety, and for treating visceral hyperalgesia
US20020141985A1 (en) * 2000-12-14 2002-10-03 Amylin Parmaceuticals, Inc. Peptide YY and peptide YY agonists for treatment of metabolic disorders
US8273713B2 (en) 2000-12-14 2012-09-25 Amylin Pharmaceuticals, Llc Methods of treating obesity using PYY[3-36]
US20110034374A1 (en) * 2001-09-07 2011-02-10 Imperial Innovations Limited Oxyntomodulin for Preventing or Treating Excess Weight
US8217001B2 (en) 2001-09-24 2012-07-10 Imperial Innovations Limited Modification of feeding behavior
US20090209461A1 (en) * 2001-09-24 2009-08-20 Imperial College Innovations Ltd. Modification of feeding behavior
EP2050460A1 (en) 2001-09-24 2009-04-22 Imperial Innovations Limited PYY and agonists thereof for modification of feeding behaviour
US7459432B2 (en) 2001-09-24 2008-12-02 Imperial College Innovations Ltd. Modification of feeding behavior
US20050176630A1 (en) * 2001-09-24 2005-08-11 Michael Cowley Modification of feeding behavior
EP2329839A1 (en) 2002-01-10 2011-06-08 Imperial Innovations Limited Modification of feeding behavior by GLP-1 and PYY
US8058233B2 (en) * 2002-01-10 2011-11-15 Oregon Health And Science University Modification of feeding behavior using PYY and GLP-1
US20060122106A1 (en) * 2002-06-14 2006-06-08 Amylin Pharmaceuticals, Inc Prevention and/or treatment of inflammatory bowel disease using pyy or agonists thereof
US20060014678A1 (en) * 2002-06-28 2006-01-19 Imperial College Innovations Ltd. Modification of feeding behavior
US7229966B2 (en) 2002-12-17 2007-06-12 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery of Y2 receptor-binding peptides and methods for treating and preventing obesity
US7186692B2 (en) 2002-12-17 2007-03-06 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery and non-infused administration of Y2 receptor-binding peptides and methods for treating and preventing obesity
US20080004218A1 (en) * 2002-12-17 2008-01-03 Nastech Pharmaceutical Company Inc. Methods for enhanced epithelial permeation of y2 receptor-binding peptides for treating and preventing obesity
US20070275893A1 (en) * 2002-12-17 2007-11-29 Nastech Pharmaceutical Company Inc. Compositions for enhanced epithelial permeation of peptide yy for treating obesity
US20040115135A1 (en) * 2002-12-17 2004-06-17 Quay Steven C. Compositions and methods for enhanced mucosal delivery of peptide YY and methods for treating and preventing obesity
US20040157777A1 (en) * 2002-12-17 2004-08-12 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery of Y2 receptor-binding peptides and methods for treating and preventing obesity
US20070161563A1 (en) * 2002-12-17 2007-07-12 Nastech Pharmaceutical Company Inc. A device for enhanced epithelial permeation of y2 receptor-binding peptides
US7157426B2 (en) 2002-12-17 2007-01-02 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery of Y2 receptor-binding peptides and methods for treating and preventing obesity
US20070129299A1 (en) * 2002-12-17 2007-06-07 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery of pyy peptide
US20040209807A1 (en) * 2002-12-17 2004-10-21 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery of Y2 receptor-binding peptides and methods for treating and preventing obesity
US20040214772A1 (en) * 2002-12-17 2004-10-28 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery of Y2 receptor-binding peptides and methods for treating and preventing obesity
US7166575B2 (en) 2002-12-17 2007-01-23 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery of peptide YY and methods for treating and preventing obesity
US20050002927A1 (en) * 2002-12-17 2005-01-06 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery and non-infused administration of Y2 receptor-binding peptides and methods for treating and preventing obesity
US7186691B2 (en) 2002-12-17 2007-03-06 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery of Y2 receptor-binding peptides and methods for treating and preventing obesity
US20080064636A1 (en) * 2003-01-10 2008-03-13 Imperial College Innovations Limited Modification of Feeding Behaviour
EP2371378A1 (en) 2003-01-10 2011-10-05 Imperial Innovations Limited Modification of feeding behaviour and weight control by oxyntomodulin
US20060189522A1 (en) * 2003-01-10 2006-08-24 Bloom Stephen R Modification of feeding behaviour
US7825091B2 (en) 2003-01-10 2010-11-02 Imperial Innovations Limited Modification of feeding behaviour
US20110021420A1 (en) * 2003-01-10 2011-01-27 Imperial Innovations Limited Modification of feeding behaviour
WO2004066966A2 (en) 2003-01-17 2004-08-12 Societe De Conseils De Recherches Et D'applications Scientifiques S.A.S. Peptide yy analogs
US7811989B2 (en) 2003-01-17 2010-10-12 Ipsen Pharma S.A.S. Peptide YY analogs
US20100331245A1 (en) * 2003-01-17 2010-12-30 Zheng Xin Dong Peptide yy analogs
EP2277527A2 (en) 2003-01-17 2011-01-26 Ipsen Pharma Peptide YY analogs
US20050118657A1 (en) * 2003-12-02 2005-06-02 Corey Elias J. Noninvasive screening method for the detection of colorectal cancer
EP2422806A2 (en) 2004-02-11 2012-02-29 Amylin Pharmaceuticals Inc. Hybrid polypeptides with selectable properties
US7723471B2 (en) 2004-02-11 2010-05-25 Amylin Pharmaceuticals, Inc. Pancreatic polypeptide family motifs, polypeptides and methods comprising the same
US8906849B2 (en) 2004-02-11 2014-12-09 Amylin Pharmaceuticals, Llc Pancreatic polypeptide family motifs, polypeptides and methods comprising the same
US8603969B2 (en) 2004-02-11 2013-12-10 Amylin Pharmaceuticals, Llc Pancreatic polypeptide family motifs and polypeptides comprising the same
US8426361B2 (en) 2004-02-11 2013-04-23 Amylin Pharmaceuticals, Llc Pancreatic polypeptide family motifs, polypeptides and methods comprising the same
EP2335716A2 (en) 2004-02-11 2011-06-22 Amylin Pharmaceuticals Inc. Pancreatic polypeptide family motifs and polypeptides comprising the same
EP2335715A2 (en) 2004-02-11 2011-06-22 Amylin Pharmaceuticals Inc. Pancreatic polypeptide family motifs and polypeptides comprising the same
US20100099619A1 (en) * 2004-02-11 2010-04-22 Amylin Pharmaceuticals, Inc. Pancreatic polypeptide family motifs, polypeptides and methods comprising the same
US20060135747A1 (en) * 2004-02-11 2006-06-22 Levy Odile E Pancreatic polypeptide family motifs, polypeptides and methods comprising the same
EP2422807A2 (en) 2004-02-11 2012-02-29 Amylin Pharmaceuticals Inc. Hybrid polypeptides with selectable properties
US20060094653A1 (en) * 2004-02-11 2006-05-04 Levy Odile E Pancreatic polypeptide family motifs and polypeptides comprising the same
EP2417980A1 (en) 2004-02-11 2012-02-15 Amylin Pharmaceuticals Inc. Hybrid polypeptides with selectable properties
EP2360180A2 (en) 2004-12-13 2011-08-24 Amylin Pharmaceuticals Inc. Pancreatic polypeptide family motifs, polypeptides and methods comprising the same
WO2006066024A2 (en) 2004-12-13 2006-06-22 Amylin Pharmaceuticals, Inc. Pancreatic polypeptide family motifs, polypeptides and methods comprising the same
EP3000826A1 (en) 2004-12-13 2016-03-30 Amylin Pharmaceuticals, LLC Pancreatic polypeptide family motifs, polypeptides and methods comprising the same
EP2392595A1 (en) 2005-02-11 2011-12-07 Amylin Pharmaceuticals Inc. GIP analog and hybrid polypeptides with selectable properties
EP2390264A1 (en) 2005-02-11 2011-11-30 Amylin Pharmaceuticals Inc. GIP analog and hybrid polypeptides with selectable propperties
US20090298757A1 (en) * 2005-06-13 2009-12-03 Imperial Innovations Limited Oxyntomodulin analogues and their effects on feeding behaviour
EP2330125A2 (en) 2005-08-11 2011-06-08 Amylin Pharmaceuticals, Inc. Hybrid polypeptides with selectable properties
EP2330124A2 (en) 2005-08-11 2011-06-08 Amylin Pharmaceuticals Inc. Hybrid polypeptides with selectable properties
WO2007041052A2 (en) 2005-09-29 2007-04-12 Merck & Co., Inc. Acylated spiropiperidine derivatives as melanocortin-4 receptor modulators
US20070232537A1 (en) * 2005-12-19 2007-10-04 Nastech Pharmaceutical Company Inc. Intranasal pyy formulations with improved transmucosal pharmacokinetics
EP2698157A1 (en) 2006-09-22 2014-02-19 Merck Sharp & Dohme Corp. Method of treatment using fatty acid synthesis inhibitors
EP2946778A1 (en) 2006-09-22 2015-11-25 Merck Sharp & Dohme Corp. Method of treatment using fatty acid synthesis inhibitors
US20090181885A1 (en) * 2006-12-13 2009-07-16 Imperial Innovations Limited Novel compounds and their effects on feeding behaviour
US8101576B2 (en) 2006-12-13 2012-01-24 Imperial Innovations Limited Compounds and their effects on feeding behaviour
WO2008120653A1 (en) 2007-04-02 2008-10-09 Banyu Pharmaceutical Co., Ltd. Indoledione derivative
US8193149B2 (en) * 2007-09-11 2012-06-05 Mondobiotech Laboratories Ag Use of Peptide YY, alone or in combination with glucagon-like peptide, for use in medicine
US20100190712A1 (en) * 2007-09-11 2010-07-29 Dorian Bevec Use of peptide yy, alone or in combination with glucagon-like peptide, for use in medicine
EP2862871A1 (en) 2008-04-14 2015-04-22 The General Hospital Corporation Plectin-1 targeted agents for detection and treatment of pancreatic ductal adenocarcinoma
US10124077B2 (en) 2008-04-14 2018-11-13 The General Hospital Corporation Plectin-1 targeted agents for detection and treatment of pancreatic ductal adenocarcinoma
US8829159B2 (en) 2008-04-14 2014-09-09 The General Hospital Corporation Plectin-1 targeted agents for detection and treatment of pancreatic ductal adenocarcinoma
WO2009129220A2 (en) 2008-04-14 2009-10-22 The Gereral Hospital Corporation Plectin-1 targeted agents for detection and treatment of pancreatic ductal adenocarcinoma
US20110182814A1 (en) * 2008-04-14 2011-07-28 Kimberly Kelly Plectin-1 targeted agents for detection and treatment of pancreatic ductal adenocarcinoma
US9387265B2 (en) 2008-04-14 2016-07-12 The General Hospital Corporation Plectin-1 targeted agents for detection and treatment of pancreatic ductal adenocarcinoma
EP3178835A1 (en) 2009-02-03 2017-06-14 Amunix Operating Inc. Extended recombinant polypeptides and compositions comprising same
EP3581579A1 (en) 2009-02-03 2019-12-18 Amunix Pharmaceuticals, Inc. Extended recombinant polypeptides and compositions comprising same
EP3323423A1 (en) 2009-09-28 2018-05-23 Intarcia Therapeutics, Inc Rapid establishment and/or termination of substantial steady-state drug delivery
EP3735944A1 (en) 2009-09-28 2020-11-11 Intarcia Therapeutics, Inc. Rapid establishment and/or termination of substantial steady-state drug delivery
US11382957B2 (en) 2010-12-16 2022-07-12 Novo Nordisk A/S Solid compositions comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid
US9891231B2 (en) * 2012-01-24 2018-02-13 University Of Massachusetts Soluble MANF in pancreatic β-cell disorders
US20150198613A1 (en) * 2012-01-24 2015-07-16 University Of Massachusetts Soluble manf in pancreatic beta-cell disorders
US10845371B2 (en) 2012-01-24 2020-11-24 University Of Massachusetts Soluble MANF in pancreatic beta-cell disorders
EP3406347A2 (en) 2012-02-27 2018-11-28 Amunix Operating Inc. Xten conjugate compositions and methods of making same
US11759503B2 (en) 2012-03-22 2023-09-19 Novo Nordisk A/S Compositions of GLP-1 peptides and preparation thereof
US12594326B2 (en) 2012-03-22 2026-04-07 Novo Nordisk A/S Compositions of GLP-1 peptides and preparation thereof
US11759502B2 (en) 2012-03-22 2023-09-19 Novo Nordisk A/S Compositions of GLP-1 peptides and preparation thereof
US11759501B2 (en) 2012-03-22 2023-09-19 Novo Nordisk A/S Compositions of GLP-1 peptides and preparation thereof
US12239739B2 (en) 2013-05-02 2025-03-04 Novo Nordisk A/S Oral dosing of GLP-1 compounds
US12514822B2 (en) 2013-05-02 2026-01-06 Novo Nordisk A/S Oral dosing of GLP-1 compounds
US10583172B2 (en) 2013-11-15 2020-03-10 Novo Nordisk A/S HPYY(1-36) having a beta-homoarginine substitution at position 35
US10246497B2 (en) 2013-11-15 2019-04-02 Novo Nordisk A/S Selective PYY compounds and uses thereof
US10005824B2 (en) 2015-06-12 2018-06-26 Novo Nordisk A/S Selective PYY compounds and uses thereof
US11840559B2 (en) 2016-05-16 2023-12-12 I2O Therapeutics, Inc. Glucagon-receptor selective polypeptides and methods of use thereof
EP3733694A1 (en) 2016-05-16 2020-11-04 Intarcia Therapeutics, Inc Glucagon-receptor selective polypeptides and methods of use thereof
US11833248B2 (en) 2018-02-02 2023-12-05 Novo Nordisk A/S Solid compositions comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid
US12396953B2 (en) 2018-02-02 2025-08-26 Novo Nordisk A/S Solid compositions comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid
WO2020077129A1 (en) 2018-10-11 2020-04-16 Intarcia Therapeutics, Inc. Human amylin analog polypeptides and methods of use
WO2021097186A1 (en) 2019-11-13 2021-05-20 Amunix Pharmaceuticals, Inc. Barcoded xten polypeptides and compositions thereof, and methods for making and using the same
US12617815B2 (en) 2020-11-13 2026-05-05 Amunix Pharmaceuticals, Inc. Barcoded XTEN polypeptides and compositions thereof, and methods for making and using the same

Also Published As

Publication number Publication date
WO1996014854A1 (en) 1996-05-23
AU4230196A (en) 1996-06-06

Similar Documents

Publication Publication Date Title
US5574010A (en) Treatment of pancreatic tumors with peptide YY and analogs thereof
Niederau et al. Beneficial effects of cholecystokinin-receptor blockade and inhibition of proteolytic enzyme activity in experimental acute hemorrhagic pancreatitis in mice. Evidence for cholecystokinin as a major factor in the development of acute pancreatitis.
Thorner et al. Human pancreatic growth-hormone-releasing factor selectively stimulates growth-hormone secretion in man
US5428011A (en) Pharmaceutical preparations for inhibiting tumours associated with prostate adenocarcinoma
JP3915125B2 (en) Compounds comprising nitrosylated neuropeptides, analogs, fragments or derivatives thereof and methods of use thereof
KR101542480B1 (en) Method of treating prostate cancer with the gnrh antagonist degarelix
US5177189A (en) Polypeptide analogs of Apolipoprotein E
KR20240060873A (en) Gip/glp1 agonist compositions
RU98123834A (en) METHODS AND COMPOSITIONS USED TO INHIBIT αvβ5-MEDIATED ANGI GENESIS
Johnson et al. Effect of sulfation on the gastrointestinal actions of caerulein
JP3784418B2 (en) Combination of somatostatin analog and rapamycin
RU98123833A (en) METHODS AND COMPOSITIONS USED TO INHIBIT ANGIOGENESIS
Valenzuela et al. Effect of gastrin on pancreatic enzyme secretion and gallbladder emptying in man
US20060135413A1 (en) Depsipeptide for therapy of kidney cancer
EP0751954B1 (en) Anti-inflammatory composition and method with des-tyr dynorphin and analogues
Yamagishi et al. Gastric inhibitory polypeptide (GIP) is not the primary mediator of the enterogastrone action of fat in the dog
Balasubramaniam et al. Structure− activity studies including a ψ (CH2-NH) scan of peptide YY (PYY) active site, PYY (22− 36), for interaction with rat intestinal PYY receptors: development of analogues with potent in vivo activity in the intestine
JPH0242026A (en) Arthritis treatment
US5525593A (en) Medicinal use of IFG-II
US5411943A (en) Hepatoma treatment with somatostatin analogs
Yamaguchi et al. Calcitonin Gene—Related Peptide and Induction of Hyperglycemia in Conscious Rats In Vivo
JPH05506663A (en) Methods and compositions for treating injuries
EP0106812A2 (en) Pharmaceutical composition containing a fibrinolytic agent and a diffusion factor, useful for the treatment of the myocardium infarction
EP1214347B1 (en) Inhibition of abnormal cell growth with corticotropin-releasing hormone analogs
JPH06507633A (en) liver cancer treatment

Legal Events

Date Code Title Description
AS Assignment

Owner name: REGENTS OF THE THE UNIVERSITY OF CALIFORNIA, THE,

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:MCFADDEN, DAVID W.;REEL/FRAME:007266/0380

Effective date: 19941121

STCF Information on status: patent grant

Free format text: PATENTED CASE

FEPP Fee payment procedure

Free format text: PAYOR NUMBER ASSIGNED (ORIGINAL EVENT CODE: ASPN); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY

FPAY Fee payment

Year of fee payment: 4

FPAY Fee payment

Year of fee payment: 8

REMI Maintenance fee reminder mailed
FPAY Fee payment

Year of fee payment: 12

SULP Surcharge for late payment

Year of fee payment: 11