US20240002484A1 - ANTIBODIES TO HUMAN COMPLEMENT FACTOR C2b AND METHODS OF USE - Google Patents
ANTIBODIES TO HUMAN COMPLEMENT FACTOR C2b AND METHODS OF USE Download PDFInfo
- Publication number
- US20240002484A1 US20240002484A1 US18/330,903 US202318330903A US2024002484A1 US 20240002484 A1 US20240002484 A1 US 20240002484A1 US 202318330903 A US202318330903 A US 202318330903A US 2024002484 A1 US2024002484 A1 US 2024002484A1
- Authority
- US
- United States
- Prior art keywords
- antigen
- monoclonal antibody
- domain
- seq
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 230000000295 complement effect Effects 0.000 title claims abstract description 29
- 238000000034 method Methods 0.000 title claims abstract description 27
- 230000027455 binding Effects 0.000 claims abstract description 174
- 239000012634 fragment Substances 0.000 claims abstract description 114
- 239000000427 antigen Substances 0.000 claims abstract description 107
- 102000036639 antigens Human genes 0.000 claims abstract description 107
- 108091007433 antigens Proteins 0.000 claims abstract description 107
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 78
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 60
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 60
- 239000013598 vector Substances 0.000 claims abstract description 30
- 230000037361 pathway Effects 0.000 claims abstract description 23
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 19
- 230000024203 complement activation Effects 0.000 claims abstract description 14
- 230000002401 inhibitory effect Effects 0.000 claims abstract description 13
- 102000004856 Lectins Human genes 0.000 claims abstract description 10
- 108090001090 Lectins Proteins 0.000 claims abstract description 10
- 239000002523 lectin Substances 0.000 claims abstract description 10
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 101
- 210000004027 cell Anatomy 0.000 claims description 75
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 13
- 238000004519 manufacturing process Methods 0.000 claims description 11
- 239000003937 drug carrier Substances 0.000 claims description 6
- 210000004962 mammalian cell Anatomy 0.000 claims description 4
- 238000012258 culturing Methods 0.000 claims description 3
- 230000004913 activation Effects 0.000 abstract description 16
- 230000004154 complement system Effects 0.000 abstract description 4
- 238000010408 sweeping Methods 0.000 abstract description 3
- 241000282693 Cercopithecidae Species 0.000 description 84
- 235000001014 amino acid Nutrition 0.000 description 49
- 229940024606 amino acid Drugs 0.000 description 47
- 150000001413 amino acids Chemical class 0.000 description 47
- 210000002966 serum Anatomy 0.000 description 20
- 108090000623 proteins and genes Proteins 0.000 description 18
- 108091028043 Nucleic acid sequence Proteins 0.000 description 17
- 230000001965 increasing effect Effects 0.000 description 17
- 239000000203 mixture Substances 0.000 description 17
- 235000018102 proteins Nutrition 0.000 description 16
- 102000004169 proteins and genes Human genes 0.000 description 16
- 238000006467 substitution reaction Methods 0.000 description 16
- 102000003712 Complement factor B Human genes 0.000 description 15
- 108090000056 Complement factor B Proteins 0.000 description 15
- 230000013595 glycosylation Effects 0.000 description 15
- 238000006206 glycosylation reaction Methods 0.000 description 15
- 238000002347 injection Methods 0.000 description 15
- 239000007924 injection Substances 0.000 description 15
- 241000282567 Macaca fascicularis Species 0.000 description 14
- 229920001213 Polysorbate 20 Polymers 0.000 description 14
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 14
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 14
- 108060003951 Immunoglobulin Proteins 0.000 description 13
- 102000018358 immunoglobulin Human genes 0.000 description 13
- 238000013507 mapping Methods 0.000 description 13
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 12
- 239000000243 solution Substances 0.000 description 12
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 12
- 238000004458 analytical method Methods 0.000 description 11
- 108020004414 DNA Proteins 0.000 description 10
- 125000000539 amino acid group Chemical group 0.000 description 10
- 239000011248 coating agent Substances 0.000 description 10
- 238000000576 coating method Methods 0.000 description 10
- 230000000694 effects Effects 0.000 description 10
- 239000006228 supernatant Substances 0.000 description 10
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 9
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 9
- 101000993321 Homo sapiens Complement C2 Proteins 0.000 description 9
- 238000001802 infusion Methods 0.000 description 9
- 238000002965 ELISA Methods 0.000 description 8
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 8
- 239000003814 drug Substances 0.000 description 8
- 230000005847 immunogenicity Effects 0.000 description 8
- 102000004196 processed proteins & peptides Human genes 0.000 description 8
- 108090000765 processed proteins & peptides Proteins 0.000 description 8
- 239000003981 vehicle Substances 0.000 description 8
- 238000005406 washing Methods 0.000 description 8
- 108010067641 Complement C3-C5 Convertases Proteins 0.000 description 7
- 102000016574 Complement C3-C5 Convertases Human genes 0.000 description 7
- 101710184994 Complement control protein Proteins 0.000 description 7
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 7
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 7
- 230000002378 acidificating effect Effects 0.000 description 7
- 229940098773 bovine serum albumin Drugs 0.000 description 7
- 229940079593 drug Drugs 0.000 description 7
- 210000004602 germ cell Anatomy 0.000 description 7
- 239000002609 medium Substances 0.000 description 7
- 230000035772 mutation Effects 0.000 description 7
- 239000013612 plasmid Substances 0.000 description 7
- 238000002360 preparation method Methods 0.000 description 7
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 239000003963 antioxidant agent Substances 0.000 description 6
- 235000006708 antioxidants Nutrition 0.000 description 6
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 6
- 238000001514 detection method Methods 0.000 description 6
- 238000002474 experimental method Methods 0.000 description 6
- 239000005090 green fluorescent protein Substances 0.000 description 6
- 239000004615 ingredient Substances 0.000 description 6
- 239000000523 sample Substances 0.000 description 6
- 238000012360 testing method Methods 0.000 description 6
- 238000001890 transfection Methods 0.000 description 6
- 238000001262 western blot Methods 0.000 description 6
- 108090000955 Complement C2 Proteins 0.000 description 5
- 102000004381 Complement C2 Human genes 0.000 description 5
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 5
- 102000009112 Mannose-Binding Lectin Human genes 0.000 description 5
- 108010087870 Mannose-Binding Lectin Proteins 0.000 description 5
- 238000007792 addition Methods 0.000 description 5
- 238000003556 assay Methods 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 230000003993 interaction Effects 0.000 description 5
- 239000013642 negative control Substances 0.000 description 5
- 229920001184 polypeptide Polymers 0.000 description 5
- 230000004044 response Effects 0.000 description 5
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 4
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 4
- 239000004322 Butylated hydroxytoluene Substances 0.000 description 4
- NLZUEZXRPGMBCV-UHFFFAOYSA-N Butylhydroxytoluene Chemical compound CC1=CC(C(C)(C)C)=C(O)C(C(C)(C)C)=C1 NLZUEZXRPGMBCV-UHFFFAOYSA-N 0.000 description 4
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 4
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 4
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 4
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 4
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 4
- ZTHYODDOHIVTJV-UHFFFAOYSA-N Propyl gallate Chemical compound CCCOC(=O)C1=CC(O)=C(O)C(O)=C1 ZTHYODDOHIVTJV-UHFFFAOYSA-N 0.000 description 4
- 102100024952 Protein CBFA2T1 Human genes 0.000 description 4
- 238000010521 absorption reaction Methods 0.000 description 4
- 239000004480 active ingredient Substances 0.000 description 4
- 235000010354 butylated hydroxytoluene Nutrition 0.000 description 4
- 229940095259 butylated hydroxytoluene Drugs 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 4
- 150000001875 compounds Chemical class 0.000 description 4
- 238000013270 controlled release Methods 0.000 description 4
- 230000006378 damage Effects 0.000 description 4
- 230000007423 decrease Effects 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- 239000006185 dispersion Substances 0.000 description 4
- 238000009472 formulation Methods 0.000 description 4
- 238000001476 gene delivery Methods 0.000 description 4
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 4
- 239000000787 lecithin Substances 0.000 description 4
- 229940067606 lecithin Drugs 0.000 description 4
- 235000010445 lecithin Nutrition 0.000 description 4
- 230000001404 mediated effect Effects 0.000 description 4
- 108010068617 neonatal Fc receptor Proteins 0.000 description 4
- 239000000546 pharmaceutical excipient Substances 0.000 description 4
- 239000000843 powder Substances 0.000 description 4
- 230000002829 reductive effect Effects 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- GEHJYWRUCIMESM-UHFFFAOYSA-L sodium sulfite Chemical compound [Na+].[Na+].[O-]S([O-])=O GEHJYWRUCIMESM-UHFFFAOYSA-L 0.000 description 4
- 239000000600 sorbitol Substances 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- 230000004797 therapeutic response Effects 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- 241000283707 Capra Species 0.000 description 3
- 102000000989 Complement System Proteins Human genes 0.000 description 3
- 108010069112 Complement System Proteins Proteins 0.000 description 3
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 3
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 3
- 101100384399 Mus musculus C2 gene Proteins 0.000 description 3
- 102000035195 Peptidases Human genes 0.000 description 3
- 108091005804 Peptidases Proteins 0.000 description 3
- 102000012479 Serine Proteases Human genes 0.000 description 3
- 108010022999 Serine Proteases Proteins 0.000 description 3
- 239000002671 adjuvant Substances 0.000 description 3
- 238000013019 agitation Methods 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 239000000969 carrier Substances 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 3
- 229940093471 ethyl oleate Drugs 0.000 description 3
- 238000002744 homologous recombination Methods 0.000 description 3
- 230000006801 homologous recombination Effects 0.000 description 3
- 210000004408 hybridoma Anatomy 0.000 description 3
- 230000001900 immune effect Effects 0.000 description 3
- 229940072221 immunoglobulins Drugs 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 238000010253 intravenous injection Methods 0.000 description 3
- 238000011031 large-scale manufacturing process Methods 0.000 description 3
- 230000007935 neutral effect Effects 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 235000019833 protease Nutrition 0.000 description 3
- 102220311640 rs1382779104 Human genes 0.000 description 3
- 230000009870 specific binding Effects 0.000 description 3
- 238000010186 staining Methods 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- 231100000331 toxic Toxicity 0.000 description 3
- 230000002588 toxic effect Effects 0.000 description 3
- 239000013603 viral vector Substances 0.000 description 3
- 108010047303 von Willebrand Factor Proteins 0.000 description 3
- 102100036537 von Willebrand factor Human genes 0.000 description 3
- 229960001134 von willebrand factor Drugs 0.000 description 3
- 230000003442 weekly effect Effects 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- QIJRTFXNRTXDIP-UHFFFAOYSA-N (1-carboxy-2-sulfanylethyl)azanium;chloride;hydrate Chemical compound O.Cl.SCC(N)C(O)=O QIJRTFXNRTXDIP-UHFFFAOYSA-N 0.000 description 2
- GVJHHUAWPYXKBD-IEOSBIPESA-N (R)-alpha-Tocopherol Natural products OC1=C(C)C(C)=C2O[C@@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-IEOSBIPESA-N 0.000 description 2
- FJKROLUGYXJWQN-UHFFFAOYSA-N 4-hydroxybenzoic acid Chemical compound OC(=O)C1=CC=C(O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-N 0.000 description 2
- 102000008186 Collagen Human genes 0.000 description 2
- 108010035532 Collagen Proteins 0.000 description 2
- 108010034753 Complement Membrane Attack Complex Proteins 0.000 description 2
- 102000004127 Cytokines Human genes 0.000 description 2
- 108090000695 Cytokines Proteins 0.000 description 2
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 2
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 2
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 2
- 101001056015 Homo sapiens Mannan-binding lectin serine protease 2 Proteins 0.000 description 2
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 2
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 2
- 239000011786 L-ascorbyl-6-palmitate Substances 0.000 description 2
- QAQJMLQRFWZOBN-LAUBAEHRSA-N L-ascorbyl-6-palmitate Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](O)[C@H]1OC(=O)C(O)=C1O QAQJMLQRFWZOBN-LAUBAEHRSA-N 0.000 description 2
- 239000006137 Luria-Bertani broth Substances 0.000 description 2
- 102100026046 Mannan-binding lectin serine protease 2 Human genes 0.000 description 2
- 229930195725 Mannitol Natural products 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 230000004988 N-glycosylation Effects 0.000 description 2
- 241001494479 Pecora Species 0.000 description 2
- 229920002732 Polyanhydride Polymers 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 229920000954 Polyglycolide Polymers 0.000 description 2
- 229920001710 Polyorthoester Polymers 0.000 description 2
- 102000044437 S1 domains Human genes 0.000 description 2
- 108700036684 S1 domains Proteins 0.000 description 2
- 108010090804 Streptavidin Proteins 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 229940087168 alpha tocopherol Drugs 0.000 description 2
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 230000000844 anti-bacterial effect Effects 0.000 description 2
- 239000003429 antifungal agent Substances 0.000 description 2
- 229940121375 antifungal agent Drugs 0.000 description 2
- 239000008365 aqueous carrier Substances 0.000 description 2
- 235000010323 ascorbic acid Nutrition 0.000 description 2
- 229960005070 ascorbic acid Drugs 0.000 description 2
- 239000011668 ascorbic acid Substances 0.000 description 2
- 235000010385 ascorbyl palmitate Nutrition 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 229920000249 biocompatible polymer Polymers 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 2
- 235000019282 butylated hydroxyanisole Nutrition 0.000 description 2
- 239000005018 casein Substances 0.000 description 2
- BECPQYXYKAMYBN-UHFFFAOYSA-N casein, tech. Chemical compound NCCCCC(C(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(CC(C)C)N=C(O)C(CCC(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(C(C)O)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(COP(O)(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(N)CC1=CC=CC=C1 BECPQYXYKAMYBN-UHFFFAOYSA-N 0.000 description 2
- 235000021240 caseins Nutrition 0.000 description 2
- 239000002738 chelating agent Substances 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 229960004926 chlorobutanol Drugs 0.000 description 2
- 229920001436 collagen Polymers 0.000 description 2
- 239000013068 control sample Substances 0.000 description 2
- 229960001305 cysteine hydrochloride Drugs 0.000 description 2
- 230000001934 delay Effects 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 239000002270 dispersing agent Substances 0.000 description 2
- 239000002612 dispersion medium Substances 0.000 description 2
- 238000012377 drug delivery Methods 0.000 description 2
- 239000003995 emulsifying agent Substances 0.000 description 2
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 2
- 239000005038 ethylene vinyl acetate Substances 0.000 description 2
- 239000012894 fetal calf serum Substances 0.000 description 2
- 238000004108 freeze drying Methods 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 239000007943 implant Substances 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 238000012606 in vitro cell culture Methods 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- 238000009115 maintenance therapy Methods 0.000 description 2
- 239000000594 mannitol Substances 0.000 description 2
- 235000010355 mannitol Nutrition 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 239000011159 matrix material Substances 0.000 description 2
- 230000010534 mechanism of action Effects 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- 239000004530 micro-emulsion Substances 0.000 description 2
- 238000001471 micro-filtration Methods 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 230000031978 negative regulation of complement activation Effects 0.000 description 2
- 239000004006 olive oil Substances 0.000 description 2
- 235000008390 olive oil Nutrition 0.000 description 2
- 150000002895 organic esters Chemical class 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 210000001539 phagocyte Anatomy 0.000 description 2
- 239000012071 phase Substances 0.000 description 2
- 229960003742 phenol Drugs 0.000 description 2
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 2
- 229920000747 poly(lactic acid) Polymers 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 239000004633 polyglycolic acid Substances 0.000 description 2
- 239000004626 polylactic acid Substances 0.000 description 2
- 229920005862 polyol Polymers 0.000 description 2
- 150000003077 polyols Chemical class 0.000 description 2
- 238000011533 pre-incubation Methods 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 230000002035 prolonged effect Effects 0.000 description 2
- 239000000473 propyl gallate Substances 0.000 description 2
- 235000010388 propyl gallate Nutrition 0.000 description 2
- 229940075579 propyl gallate Drugs 0.000 description 2
- 230000005180 public health Effects 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 239000012146 running buffer Substances 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- WBHQBSYUUJJSRZ-UHFFFAOYSA-M sodium bisulfate Chemical compound [Na+].OS([O-])(=O)=O WBHQBSYUUJJSRZ-UHFFFAOYSA-M 0.000 description 2
- 229910000342 sodium bisulfate Inorganic materials 0.000 description 2
- 229940100996 sodium bisulfate Drugs 0.000 description 2
- HRZFUMHJMZEROT-UHFFFAOYSA-L sodium disulfite Chemical compound [Na+].[Na+].[O-]S(=O)S([O-])(=O)=O HRZFUMHJMZEROT-UHFFFAOYSA-L 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 229940001584 sodium metabisulfite Drugs 0.000 description 2
- 235000010262 sodium metabisulphite Nutrition 0.000 description 2
- 229940001482 sodium sulfite Drugs 0.000 description 2
- 235000010265 sodium sulphite Nutrition 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 235000010199 sorbic acid Nutrition 0.000 description 2
- 239000004334 sorbic acid Substances 0.000 description 2
- 229940075582 sorbic acid Drugs 0.000 description 2
- 230000001954 sterilising effect Effects 0.000 description 2
- 238000004659 sterilization and disinfection Methods 0.000 description 2
- 238000012414 sterilization procedure Methods 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 150000005846 sugar alcohols Polymers 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 230000002459 sustained effect Effects 0.000 description 2
- 238000013268 sustained release Methods 0.000 description 2
- 239000011975 tartaric acid Substances 0.000 description 2
- 235000002906 tartaric acid Nutrition 0.000 description 2
- AOBORMOPSGHCAX-DGHZZKTQSA-N tocofersolan Chemical compound OCCOC(=O)CCC(=O)OC1=C(C)C(C)=C2O[C@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C AOBORMOPSGHCAX-DGHZZKTQSA-N 0.000 description 2
- 229960000984 tocofersolan Drugs 0.000 description 2
- 238000003146 transient transfection Methods 0.000 description 2
- 239000010981 turquoise Substances 0.000 description 2
- 238000001291 vacuum drying Methods 0.000 description 2
- 238000009777 vacuum freeze-drying Methods 0.000 description 2
- 235000015112 vegetable and seed oil Nutrition 0.000 description 2
- 239000008158 vegetable oil Substances 0.000 description 2
- 239000000080 wetting agent Substances 0.000 description 2
- 239000002076 α-tocopherol Substances 0.000 description 2
- 235000004835 α-tocopherol Nutrition 0.000 description 2
- MMHMYFWOECSGDR-UHFFFAOYSA-N 2,5-dimethoxybenzenesulfonamide Chemical compound COC1=CC=C(OC)C(S(N)(=O)=O)=C1 MMHMYFWOECSGDR-UHFFFAOYSA-N 0.000 description 1
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 1
- 206010001052 Acute respiratory distress syndrome Diseases 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 108010089414 Anaphylatoxins Proteins 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 208000037187 Autoimmune Experimental Neuritis Diseases 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 102000004506 Blood Proteins Human genes 0.000 description 1
- 108010017384 Blood Proteins Proteins 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 102000000503 Collagen Type II Human genes 0.000 description 1
- 108010041390 Collagen Type II Proteins 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 101100338242 Drosophila virilis His1.1 gene Proteins 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 208000009386 Experimental Arthritis Diseases 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 206010018364 Glomerulonephritis Diseases 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 206010018910 Haemolysis Diseases 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 101000746783 Homo sapiens Cytochrome b-c1 complex subunit 6, mitochondrial Proteins 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 108010073807 IgG Receptors Proteins 0.000 description 1
- 102000009490 IgG Receptors Human genes 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 1
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 1
- 102000013463 Immunoglobulin Light Chains Human genes 0.000 description 1
- 108010065825 Immunoglobulin Light Chains Proteins 0.000 description 1
- 102000012745 Immunoglobulin Subunits Human genes 0.000 description 1
- 108010079585 Immunoglobulin Subunits Proteins 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical group C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- 102000043131 MHC class II family Human genes 0.000 description 1
- 108091054438 MHC class II family Proteins 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 208000004221 Multiple Trauma Diseases 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 102000008300 Mutant Proteins Human genes 0.000 description 1
- 108010021466 Mutant Proteins Proteins 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 101710167374 Peptidase 1 Proteins 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 229920002873 Polyethylenimine Polymers 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 206010063837 Reperfusion injury Diseases 0.000 description 1
- 208000013616 Respiratory Distress Syndrome Diseases 0.000 description 1
- 206010040047 Sepsis Diseases 0.000 description 1
- 206010040070 Septic Shock Diseases 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 1
- 208000006011 Stroke Diseases 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 238000010459 TALEN Methods 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Chemical group CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Chemical group 0.000 description 1
- 108010043645 Transcription Activator-Like Effector Nucleases Proteins 0.000 description 1
- 206010052779 Transplant rejections Diseases 0.000 description 1
- 239000007984 Tris EDTA buffer Substances 0.000 description 1
- 206010047115 Vasculitis Diseases 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 208000011341 adult acute respiratory distress syndrome Diseases 0.000 description 1
- 201000000028 adult respiratory distress syndrome Diseases 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 238000011316 allogeneic transplantation Methods 0.000 description 1
- 230000006229 amino acid addition Effects 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- YZXBAPSDXZZRGB-DOFZRALJSA-N arachidonic acid Chemical class CCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(O)=O YZXBAPSDXZZRGB-DOFZRALJSA-N 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 238000000429 assembly Methods 0.000 description 1
- 230000000712 assembly Effects 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 210000003651 basophil Anatomy 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000008512 biological response Effects 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 230000035605 chemotaxis Effects 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 230000000254 damaging effect Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 238000001493 electron microscopy Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 210000001163 endosome Anatomy 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 210000003743 erythrocyte Anatomy 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 102000034356 gene-regulatory proteins Human genes 0.000 description 1
- 108091006104 gene-regulatory proteins Proteins 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 230000008588 hemolysis Effects 0.000 description 1
- 208000007475 hemolytic anemia Diseases 0.000 description 1
- 230000002949 hemolytic effect Effects 0.000 description 1
- 210000003630 histaminocyte Anatomy 0.000 description 1
- 102000048638 human UQCRH Human genes 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 238000012405 in silico analysis Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 230000002101 lytic effect Effects 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 201000008350 membranous glomerulonephritis Diseases 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- 201000006417 multiple sclerosis Diseases 0.000 description 1
- 206010028417 myasthenia gravis Diseases 0.000 description 1
- 208000010125 myocardial infarction Diseases 0.000 description 1
- 210000004898 n-terminal fragment Anatomy 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 238000006213 oxygenation reaction Methods 0.000 description 1
- 238000012856 packing Methods 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 230000003285 pharmacodynamic effect Effects 0.000 description 1
- 230000004983 pleiotropic effect Effects 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 238000004064 recycling Methods 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000036303 septic shock Effects 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 239000012679 serum free medium Substances 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 230000016160 smooth muscle contraction Effects 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 238000012916 structural analysis Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 230000000451 tissue damage Effects 0.000 description 1
- 231100000827 tissue damage Toxicity 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 230000008728 vascular permeability Effects 0.000 description 1
- 238000002689 xenotransplantation Methods 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/472—Complement proteins, e.g. anaphylatoxin, C3a, C5a
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
- C07K2317/41—Glycosylation, sialylation, or fucosylation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
Definitions
- the present invention relates to the fields of immunology and molecular biology. More particularly, the present invention relates to compositions and methods for inhibiting the activation of the classical and lectin pathways of the complement system and use thereof in the treatment of human conditions.
- the invention in particular relates to binding molecules that bind to human complement factor C2 and methods of making and using same.
- the complement system involves a cascading series of plasma enzymes, regulatory proteins, and proteins capable of cell lysis. Prior to activation, various complement factors circulate as inactive precursor proteins. Activation of the system leads to an activation cascade where one factor activates the subsequent one by specific proteolysis of complement protein further downstream in the cascade.
- Activation of the complement system can occur via three pathways, the classical (or classic) pathway, the alternative pathway, and the lectin pathway.
- the classical pathway is activated by interaction of antigen and IgM, IgG1, IgG2, or IgG3 antibody to form immune complexes that bind Clq, a subunit of complement component C1.
- the alternative pathway is activated by IgA-containing immune complexes or recognition of bacteria and other activating surfaces.
- the lectin pathway is responsible for an antibody-independent pathway of complement activation that is initiated by binding of mannan-binding lectin (MBL), also known as mannose-binding lectin or mannan-binding protein (MBP), to certain carbohydrates on the surface of a variety of pathogens.
- MBL mannan-binding lectin
- MBP mannose-binding lectin or mannan-binding protein
- Activation of the classical pathway begins with sequential activation of C1, C4, and C2; C2 is in turn cleaved into C2a and C2b.
- Activation of the alternative pathway begins with sequential activation of complement components D, C3, and B.
- Each pathway cleaves and activates a common central component, C3 or the third complement factor, which results in the activation of a common terminal pathway leading to the formation of the membrane-attack complex (MAC, comprising complement components C5b-9; Muller-Eberhard, Annu Rev Biochem 1988, 57:321).
- MAC membrane-attack complex
- activation products elicit pleiotropic biological effects such as chemotaxis of leukocytes, degranulation of phagocytic cells, mast cells and basophils, smooth muscle contraction, increase of vascular permeability, and lysis of cells (Hugh, Complement 1986, 3:111).
- Complement activation products also induce the generation of toxic oxygen radicals and the synthesis and release of arachidonic acid metabolites and cytokines, in particular by phagocytes, which further amplifies the inflammatory response.
- complement is an important line of defense against pathogenic organisms, its activation can also confer damage to otherwise healthy host cells. Inhibition of complement activation is therefore thought to be beneficial in treating and preventing complement-mediated tissue damage. Accordingly, there remains an urgent need in the art for novel therapeutic agents that inhibit one or more key components of the complement cascade.
- novel monoclonal anti-human C2b antibodies and antigen-binding fragments thereof with improved features over existing antibodies.
- a feature of the novel antibodies is the deletion of a glycosylation site in framework region 3 (FR3) of the heavy chain variable domain (VH).
- the novel antibodies provide improved homogeneity and therefore improved manufacturability, as well as unexpectedly improved functional properties, compared to existing antibodies.
- the improved functional properties include, for example, increased pI and enhanced potential for so-called antigen sweeping.
- the antibodies and antigen-binding fragments thereof will find use in human therapy.
- An aspect of the invention is a monoclonal antibody or antigen-binding fragment thereof that specifically binds to human complement factor C2, wherein said monoclonal antibody or fragment thereof comprises:
- An aspect of the invention is a pharmaceutical composition
- a pharmaceutical composition comprising the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention, and a pharmaceutically acceptable carrier.
- An aspect of the invention is a nucleic acid molecule or plurality of nucleic acid molecules encoding the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention.
- An aspect of the invention is a vector or plurality of vectors comprising the nucleic acid molecule or the plurality of nucleic acid molecules in accordance with the invention.
- An aspect of the invention is a host cell comprising a nucleic acid molecule or plurality of nucleic acid molecules encoding the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention.
- An aspect of the invention is a host cell comprising a vector or plurality of vectors comprising the nucleic acid molecule or the plurality of nucleic acid molecules in accordance with the invention.
- An aspect of the invention is a method of making a monoclonal antibody or antigen-binding fragment thereof in accordance with the invention, the method comprising culturing a population of cells according to the invention under conditions permitting expression of the monoclonal antibody or antigen-binding fragment thereof.
- An aspect of the invention is a method of inhibiting activation of the classical or lectin pathway in a subject, comprising administering to a subject in need thereof an effective amount of the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention.
- X 1 X 2 X 3 consists of DX 2 S.
- X 1 X 2 X 3 consists of DKS.
- the VH domain comprises the amino acid sequence set forth in SEQ ID NO: 3.
- the VL domain comprises the amino acid sequence set forth in SEQ ID NO: 2.
- the VH domain comprises the amino acid sequence set forth in SEQ ID NO: 3
- the VL domain comprises the amino acid sequence set forth in SEQ ID NO: 2.
- the monoclonal antibody or antigen-binding fragment thereof comprises a full-length monoclonal antibody.
- the monoclonal antibody comprises a human IgG heavy chain constant domain.
- the heavy chain constant domain comprises a human IgG1 heavy chain constant domain.
- the human IgG1 heavy chain constant domain comprises the amino acid sequence set forth in SEQ ID NO: 4.
- the heavy chain constant domain comprises a human IgG4 heavy chain constant domain.
- the human IgG4 heavy chain constant domain comprises the amino acid sequence set forth in SEQ ID NO: 5.
- the monoclonal antibody comprises a heavy chain comprising the amino acid sequence set forth as SEQ ID NO: 6 and a light chain comprising the amino acid sequence set forth as SEQ ID NO: 7.
- the monoclonal antibody comprises a heavy chain comprising the amino acid sequence set forth as SEQ ID NO: 8 and a light chain comprising the amino acid sequence set forth as SEQ ID NO: 7.
- FIG. 1 depicts a polyacrylamide gel loaded with indicated samples. Larger molecular weight bands for samples in lanes 4, 5, 8, and 9 (arrows) show band splitting and shifting for antibodies with VH3 and VH4.
- FIG. 2 is a graph depicting total levels of indicated antibodies over the course of 31 days in cynomolgus monkeys. The following antibodies were tested: BRO2-glyc-IgG4 (monkeys 1 and 2, glycosylated VH) and BRO2-IgG4 (monkeys 5 and 6, non-glycosylated VH).
- FIGS. 3 A- 3 I are graphs depicting levels of free C2 (plotted as OD 450 nm over time) in serum over the course of 31 days from administration of various monoclonal antibodies to cynomolgus monkeys.
- the following antibodies were tested: BRO2-glyc-IgG4 ( FIG. 3 A ; monkeys 1 and 2), negative control ( FIG. 3 B ; monkeys 3 and 4), BRO2-IgG4 ( FIG. 3 C ; monkeys 5 and 6), BRO2-IgG4—NH ( FIG. 3 D ; monkeys 7 and 8), BRO2-IgG1-LALA-NH ( FIG. 3 E ; ARGX-117; monkeys 9 and 10), His1-IgG4 ( FIG.
- FIG. 4 is a graph depicting average free C2 levels (plotted as OD 450 nm over time) in serum over the course of 31 days from cynomolgus monkeys administered various indicated monoclonal antibodies.
- FIG. 5 is a graph depicting free C2 levels (plotted as OD 450 nm over time) in serum of cynomolgus monkeys treated with indicated non-glycosylated antibodies.
- FIGS. 6 A- 6 D are a series of graphs depicting free C2 levels (plotted as OD 450 nm) in cynomolgus monkeys as determined at indicated times prior to or following administration of antibodies. Monkeys are as in FIGS. 3 A- 3 I .
- FIG. 6 A pre versus pre plus 500 mg/ml BRO-2;
- FIG. 6 B 4 hours versus 1 day;
- FIG. 6 C 4 hours versus 2 days;
- FIG. 6 D day 11 versus day 27.
- ADA anti-drug antibody.
- FIGS. 7 A- 7 P are a series of graphs depicting immunogenicity (plotted as OD 450 nm) over 30 days of anti-C2 antibodies or negative control monoclonal antibody administered to cynomolgus monkeys. Monkeys are as in FIGS. 3 A- 3 I .
- FIG. 7 A monkey 1 ; FIG. 7 B , monkey 2 ; FIG. 7 C , monkey 5 ; FIG. 7 D , monkey 6 ; FIG. 7 E , monkey 7 ; FIG. 7 F , monkey 8 ; FIG. 7 G , monkey 9 ; FIG. 7 H , monkey 10 ; FIG. 71 , monkey 11 ; FIG. 7 J , monkey 12 ; FIG. 7 K , monkey 13 ; FIG. 7 L , monkey 14 ; FIG. 7 M , monkey 15 ; FIG. 7 N , monkey 16 ; FIG. 7 O , monkey 17 ; FIG. 7 P , monkey 18 .
- FIGS. 8 A- 8 F are a series of graphs depicting immunogenicity (plotted as OD 450 nm over time) over 60 days of anti-C2 monoclonal antibodies administered to cynomolgus monkeys. Monkeys are as in FIGS. 3 A- 3 I .
- FIG. 8 A monkey 5 ;
- FIG. 8 B monkey 6 ;
- FIG. 8 C monkey 9 ;
- FIG. 8 D monkey 10 ;
- FIG. 8 E monkey 15 ;
- FIG. 8 F monkey 16 .
- ADA anti-drug antibody.
- FIGS. 9 A- 9 D depict ARGX-117 binding to C2 assessed by Western blot analysis and surface plasmon resonance (SPR).
- FIG. 9 A depicts Western blot analysis of serum with ARGX-117 (representative result): Lane 1: MW size marker; Lane 2: recombinant human C2 control (size about 100 kDa); Lane 3: serum; Lane 4: induction of complement activation by addition of aggregated IgG to serum and incubation at 37° C.; Lane 5: C2-deficient serum.
- FIG. 9 B depicts SPR analysis with C2 immobilized on chip and different ARGX-117 Fabs as eluate.
- FIG. 9 C depicts SPR analysis with biotin-C4b immobilized to streptavidin-chip and human C2 with and without mAbs as eluate; black: no pre-incubation; grey: anti-FXI; control human IgG4 mAb; turquoise: non-inhibitory anti-C2 clone anti-C2-63, i.e., clone 63 recognizing the large subunit of C2 (C2a); red: ARGX-117; all at 5 to 1 molar ratios; curves were normalized to signal just before the injection of C2 on the C4b chips.
- FIG. 9 D depicts SPR analysis with biotin-C4b immobilized to streptavidin-chip and consecutively human C2 and mAbs as eluate; black: running buffer; grey: anti-FXI; control human IgG4 mAb; turquoise: non-inhibitory anti-C2 clone anti-C2-63; red: ARGX-117; curves were normalized just before the addition of the mAbs.
- FIG. 10 depicts a schematic representation of domain swap mutants between C2 (SEQ ID NO: 21) and complement Factor B (FB) (SEQ ID NO: 50).
- C2b in complement C2
- SEQ ID NO: 44 or FBa in complement Factor B; SEQ ID NO: 51 consists of three Sushi (or complement control protein (CCP)) domains, whereas the large fragment is composed of a von Willebrand Factor type A (VWFA) domain and a peptidase S 1 domain.
- VWFA von Willebrand Factor type A
- Additional sequences include C2a, SEQ ID NO: 43; C2b S1, SEQ ID NO: 45; C2b S2, SEQ ID NO: 46; C2b S3, SEQ ID NO: 47; C2 VWFA, SEQ ID NO: 48; C2 peptidase S 1 , SEQ ID NO: 49; FBb, SEQ ID NO: 52; FBa S1, SEQ ID NO: 53; FBa S2, SEQ ID NO: 54; FBa S3, SEQ ID NO: 55; FB VWFA, SEQ ID NO: 56; and FB peptidase 1, SEQ ID NO: 57.
- FIG. 11 depicts results obtained with an anti-FLAG ELISA performed on domain-swap mutants. Five-times diluted supernatants from transfected HEK293 cells were used for coating, and anti-FLAG mouse monoclonal Ab in combination with HRP-labeled anti-mouse IgG were used for detection.
- FIG. 12 depicts results obtained with a domain swap ELISA performed with anti-C2-Anti-C2-5F2.4 mAb (human IgG4 S241P VH4/VL3 LC-13/03-163A Bioceros) was used for coating, plates were incubated with 20 times diluted supernatant of HEK293 transfectants, and binding was detected by an anti-FLAG Ab. Representative results from two independent experiments with similar outcome.
- FIG. 13 depicts an amino acid sequence alignment of human and mouse Sushi 2 (S2) domain of C2b.
- FIG. 14 depicts results obtained with an anti-FLAG ELISA on fine mapping mutants. Undiluted supernatants from transfected HEK293 cells were used for coating, and biotin-labeled anti-FLAG mouse monoclonal Ab in combination with HRP-labeled SA conjugate were used for detection.
- FIG. 15 depicts results on fine mapping mutants.
- Anti-C2-5F2.4 mAb human IgG4 S241P VH4/VL3 LC-13/03-163A Bioceros
- was used for coating plates were incubated with 20 times diluted supernatant of HEK293 transfectants, and binding was detected by an anti-FLAG Ab.
- FIG. 16 depicts a plan of cluster mapping mutants using three amino acid mutations for each cluster, locations for which indicated with bold font in the human sequence. Each human sequence was mutated to substitute the corresponding mouse amino acid for the human amino acid shown in bold. Human S2, SEQ ID NO: 46; Mouse S2, SEQ ID NO: 58. Stars indicate sequence identity.
- FIGS. 17 A and 17 B depict anti-FLAG ELISA on cluster mapping mutants.
- FIG. 17 A depicts five-times diluted supernatants from transfected HEK293 cells were used for coating and anti-FLAG mouse monoclonal Ab in combination with HRP-labeled anti-mouse IgG as detection.
- GFP green fluorescent protein.
- FIG. 17 B depicts anti-C2-5F2.4 binding to cluster mutants.
- Anti-C2-5F2.4 mAb human IgG4 S241P VH4/VL3, LC-13/03-163A, Bioceros
- GFP green fluorescent protein
- antibody or “Immunoglobulin”—As used herein, the term “immunoglobulin” includes a polypeptide having a combination of two heavy and two light chains whether or not it possesses any relevant specific immunoreactivity. As used herein, the term “antibody” refers to such assemblies which have significant specific immunoreactive activity to an antigen of interest (e.g. the complex of complement proteins including C2).
- C2 antibodies is used herein to refer to antibodies which exhibit immunological specificity for the complex of complement proteins including C2, particularly the human C2 protein and the domains which are formed through cleavage of C2, and in some cases species homologues thereof.
- Antibodies and immunoglobulins comprise light and heavy chains, with or without an interchain covalent linkage between them. Basic immunoglobulin structures in vertebrate systems are relatively well understood.
- immunoglobulins typically comprise two identical light polypeptide chains of molecular weight approximately 23,000 Daltons, and two identical heavy chains of molecular weight 53,000-70,000. The four chains are joined by disulfide bonds in a “Y” configuration wherein the light chains bracket the heavy chains starting at the mouth of the “Y” and continuing through the variable region.
- the light chains of an antibody are classified as either kappa (x) or lambda ( ⁇ ). Each heavy chain class may be bound with either a kappa or lambda light chain.
- the light and heavy chains are covalently bonded to each other, and the “tail” portions of the two heavy chains are bonded to each other by covalent disulfide linkages or non-covalent linkages when the immunoglobulins are generated either by hybridomas, B cells or genetically engineered host cells.
- the amino acid sequences run from an N-terminus at the forked ends of the Y configuration to the C-terminus at the bottom of each chain.
- heavy chains are classified as gamma, mu, alpha, delta, or epsilon, ( ⁇ , ⁇ , ⁇ , ⁇ , or ⁇ ) with some subclasses among them (e.g., ⁇ 1- ⁇ 4). It is the nature of this chain that determines the “class” of the antibody as IgG, IgM, IgA, IgD or IgE, respectively.
- the immunoglobulin subclasses e.g., IgG1, IgG2, IgG3, IgG4, IgA1, etc., are well characterized and are known to confer functional specialization. Modified versions of each of these classes and isotypes are readily discernible to the skilled artisan in view of the instant disclosure and, accordingly, are within the scope of the instant invention.
- variable region of an antibody allows the antibody to selectively recognize and specifically bind epitopes on antigens. That is, the VL domain and VH domain of an antibody combine to form a variable region that defines a three-dimensional antigen-binding site.
- This quaternary antibody structure forms the antigen-binding site present at the end of each arm of the Y. More specifically, the antigen-binding site is defined by three complementary determining regions (CDRs) on each of the VH and VL chains.
- CDRs complementary determining regions
- Binding Molecule As used herein, the term “binding molecule” is a generic term intended to encompass the antibodies and antigen-binding fragments thereof in accordance with the present disclosure.
- Binding Site comprises a region of a polypeptide which is responsible for selectively binding to a target antigen of interest.
- Binding domains comprise at least one binding site.
- Exemplary binding domains include an antibody variable domain.
- the antibody molecules of the invention may comprise a single binding site or multiple (e.g., two, three or four) binding sites.
- variable region or “variable domain”—The term “variable” refers to the fact that certain portions of the variable domains VH and VL differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its target antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called “hypervariable loops” in each of the VL domain and the VH domain which form part of the antigen-binding site.
- the first, second and third hypervariable loops of the Vlambda light chain domain are referred to herein as L1( ⁇ ), L2( ⁇ ) and L3( ⁇ ) and may be defined as comprising residues 24-33 (L1(X), consisting of 9, 10 or 11 amino acid residues), 49-53 (L2( ⁇ ), consisting of 3 residues) and 90-96 (L3( ⁇ ), consisting of 5 residues) in the VL domain (Morea et al., Methods 20:267-279 (2000)).
- the first, second and third hypervariable loops of the Vkappa light chain domain are referred to herein as L1( ⁇ ), L2( ⁇ ) and L3( ⁇ ) and may be defined as comprising residues 25-33 (L1( ⁇ ), consisting of 6, 7, 8, 11, 12 or 13 residues), 49-53 (L2( ⁇ ), consisting of 3 residues) and 90-97 (L3( ⁇ ), consisting of 6 residues) in the VL domain (Morea et al., Methods 20:267-279 (2000)).
- the first, second and third hypervariable loops of the VH domain are referred to herein as H1, H2 and H3 and may be defined as comprising residues 25-33 (H1, consisting of 7, 8 or 9 residues), 52-56 (H2, consisting of 3 or 4 residues) and 91-105 (H3, highly variable in length) in the VH domain (Morea et al., Methods 20:267-279 (2000)).
- L1, L2 and L3 respectively refer to the first, second and third hypervariable loops of a VL domain, and encompass hypervariable loops obtained from both Vkappa and Vlambda isotypes.
- H1, H2 and H3 respectively refer to the first, second and third hypervariable loops of the VH domain, and encompass hypervariable loops obtained from any of the known heavy chain isotypes, including ⁇ , ⁇ , ⁇ , ⁇ or ⁇ .
- the hypervariable loops L1, L2, L3, H1, H2 and H3 may each comprise part of a “complementarity determining region” or “CDR”, as defined below.
- CDR complementarity determining region
- the terms “hypervariable loop” and “complementarity determining region” are not strictly synonymous, since the hypervariable loops (HVs) are defined on the basis of structure, whereas complementarity determining regions (CDRs) are defined based on sequence variability (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, M D., 1983) and the limits of the HVs and the CDRs may be different in some VH and VL domains.
- the CDRs of the VL and VH domains can typically be defined as comprising the following amino acids: residues 24-34 (LCDR1), 50-56 (LCDR2) and 89-97 (LCDR3) in the light chain variable domain, and residues 31-35 or 31-35b (HCDR1), 50-65 (HCDR2) and 95-102 (HCDR3) in the heavy chain variable domain; (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)).
- the HVs may be comprised within the corresponding CDRs and references herein to the “hypervariable loops” of VH and VL domains should be interpreted as also encompassing the corresponding CDRs, and vice versa, unless otherwise indicated.
- variable domains The more highly conserved portions of variable domains are called the framework region (FR), as defined below.
- the variable domains of native heavy and light chains each comprise four FRs (FR1, FR2, FR3 and FR4, respectively), largely adopting a (3-sheet configuration, connected by the three hypervariable loops.
- the hypervariable loops in each chain are held together in close proximity by the FRs and, with the hypervariable loops from the other chain, contribute to the formation of the antigen-binding site of antibodies.
- Structural analysis of antibodies revealed the relationship between the sequence and the shape of the binding site formed by the complementarity determining regions (Chothia et al., J. Mol. Biol.
- Framework region includes the amino acid residues that are part of the variable region, but are not part of the CDRs (e.g., using the Kabat definition of CDRs). Therefore, a variable region framework is between about 100-120 amino acids in length but includes only those amino acids outside of the CDRs.
- the framework regions for the light chain are similarly separated by each of the light chain variable region CDRs.
- the framework region boundaries are separated by the respective CDR termini as described above. In preferred embodiments the CDRs are as defined by Kabat.
- the six CDRs present on each monomeric antibody are short, non-contiguous sequences of amino acids that are specifically positioned to form the antigen-binding site as the antibody assumes its three-dimensional configuration in an aqueous environment.
- the remainder of the heavy and light variable domains show less inter-molecular variability in amino acid sequence and are termed the framework regions.
- the framework regions largely adopt a n-sheet conformation and the CDRs form loops which connect, and in some cases form part of, the n-sheet structure. Thus, these framework regions act to form a scaffold that provides for positioning the six CDRs in correct orientation by inter-chain, non-covalent interactions.
- the antigen-binding site formed by the positioned CDRs defines a surface complementary to the epitope on the immunoreactive antigen. This complementary surface promotes the non-covalent binding of the antibody to the immunoreactive antigen epitope.
- the position of CDRs can be readily identified by one of ordinary skill in the art.
- Non-glycosylated refers to a form of antibody or antigen-binding fragment thereof which lacks glycosylation at a potential glycosylation site in the antibody or antigen-binding fragment. In certain embodiments, the term “non-glycosylated” refers to a form of antibody or antigen-binding fragment thereof which lacks glycosylation at a potential N-linked glycosylation site in antibody or antigen-binding fragment. In certain embodiments, the term “non-glycosylated” refers to a form of antibody or antigen-binding fragment thereof which lacks glycosylation at a potential N-linked glycosylation site in the variable region of the heavy chain.
- Constant region refers to the portion of the antibody molecule outside of the variable domains or variable regions.
- Immunoglobulin light chains have a single domain “constant region”, typically referred to as the “CL or CL1 domain”. This domain lies C-terminal to the VL domain.
- Immunoglobulin heavy chains differ in their constant region depending on the class of immunoglobulin ( ⁇ , ⁇ , ⁇ , ⁇ , ⁇ ). Heavy chains ⁇ , ⁇ and ⁇ have a constant region consisting of three immunoglobulin domains (referred to as CH1, CH2 and CH3) with a flexible hinge region separating the CH1 and CH2 domains. Heavy chains ⁇ and ⁇ have a constant region consisting of four domains (CH1-CH4). The constant domains of the heavy chain are positioned C-terminal to the VH domain.
- the numbering of the amino acids in the heavy and light immunoglobulin chains run from the N-terminus at the forked ends of the Y configuration to the C-terminus at the bottom of each chain.
- Different numbering schemes are used to define the constant domains of the immunoglobulin heavy and light chains.
- the heavy chain constant domains of an IgG molecule are identified as follows: CH1—amino acid residues 118-215; CH2—amino acid residues 231-340; CH3—amino acid residues 341-446.
- the “hinge region” includes the portion of a heavy chain molecule that joins the CH1 domain to the CH2 domain.
- This hinge region comprises approximately residues and is flexible, thus allowing the two N-terminal antigen-binding regions to move independently. Hinge regions can be subdivided into three distinct domains: upper, middle, and lower hinge domains (Roux K. H. et al. J. Immunol. 161:4083-90 1998). Antibodies of the invention comprising a “fully human” hinge region may contain one of the hinge region sequences shown in Table 1 below.
- fragment refers to a part or portion of an antibody or antibody chain comprising fewer amino acid residues than an intact or complete antibody or antibody chain.
- antigen-binding fragment refers to a polypeptide fragment of an immunoglobulin or antibody that specifically binds antigen or competes with intact antibody (i.e., with the intact antibody from which they were derived) for antigen-specific binding (e.g., specific binding to the C2 protein or to a portion thereof).
- fragment of an antibody molecule includes antigen-binding fragments of antibodies, for example, an antibody light chain variable domain (VL), an antibody heavy chain variable domain (VH), a single chain antibody (scFv), a F(ab′)2 fragment, a Fab fragment, an Fd fragment, an Fv fragment, a one-armed (monovalent) antibody, diabodies, triabodies, tetrabodies or any antigen-binding molecule formed by combination, assembly or conjugation of such antigen-binding fragments.
- the term “antigen-binding fragment” as used herein is further intended to encompass antibody fragments selected from the group consisting of unibodies, domain antibodies and nanobodies. Fragments can be obtained, e.g., via chemical or enzymatic treatment of an intact or complete antibody or antibody chain, or by recombinant means.
- the second component of human complement is a 90-100 kDa glycoprotein which participates in the classical and lectin pathways of complement activation.
- C2 can be activated by C1s of the classical pathway or by activated MASP2 of the lectin pathway.
- C2 binds to surface-bound C4b (in the presence of Mg 2+) to form a C4bC2 complex, which then is cleaved by activated C1s or MASP2 into two fragments: a larger 70 kDa fragment, traditionally designated C2a, which remains attached to C4b to form a C3-convertase C4bC2a, and a smaller 30 kDa N-terminal fragment, traditionally designated C2b, which is released into the fluid phase.
- C2a and C2b Some authors have recently reversed designations of C2a and C2b, such that C2b refers to the bigger 70 kDa fragment, and C2a refers to the smaller 30 kDa fragment. As used herein, C2a shall refer to the bigger 70 kDa fragment, and C2b shall refer to the smaller 30 kDa fragment.
- C2a Once activated and bound to C4b, C2a constitutes the catalytic subunit of the C3 and C5 convertases which are able to cleave C3 and C5, respectively.
- the amino acid sequence of human C2 is known (GenBank Accession No. NM_000063) and shown as SEQ ID NO: 21.
- C2 has a modular structure. Starting from its N-terminus, C2 consists of three complement control protein modules (CCP1-3, also known as short consensus repeats (SCR) or sushi-domain repeats), a von Willebrand factor type A (vWFA) domain containing a metal-ion-dependent adhesion site, and a serine protease (SP) domain (Arlaud et al., Adv Immunol 1998, 69: 249). Electron microscopy studies have revealed that C2 consists of three domains. The three CCP modules (CCP1-3) together form the N-terminal domain, which corresponds to C2b. The vWFA domain constitutes the second domain, and the SP domain makes up the third domain. The second and third domains together constitute the larger C2a portion of the molecule.
- CCP1-3 complement control protein modules
- SCR short consensus repeats
- vWFA von Willebrand factor type A
- SP serine protease
- CCP modules are common structural motifs that occur in a number of proteins.
- An aspect of the invention is a monoclonal antibody or antigen-binding fragment thereof that specifically binds to human complement factor C2, wherein said monoclonal antibody or fragment thereof comprises:
- VH domain comprising the amino acid sequence set forth in SEQ ID NO: 1;
- VL domain comprising the amino acid sequence set forth in SEQ ID NO: 2;
- amino acid residues 72-74 (Kabat numbering) of the VH domain consist of X 1 X 2 X 3 , respectively, wherein X 2 is any amino acid, and X 1 X 2 X 3 is not NX 2 S or NX 2 T.
- the VH domain comprises complementarity determining regions (CDRs) HCDR1, HCDR2, and HCDR3.
- the VL domain comprises CDRs LCDR1, LCDR2, and LCDR3.
- the amino acid sequences of HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 are shown in Table 2.
- the monoclonal antibody or antigen-binding fragment thereof specifically binds to human complement factor C2b. In certain embodiments, the monoclonal antibody or antigen-binding fragment thereof specifically binds to an epitope in a portion of human complement factor C2 corresponding to human complement factor C2b.
- variable domain of the heavy chain is non-glycosylated.
- amino acid sequence of the variable domain of the heavy chain does not include a potential glycosylation site which is characterized by the sequence N-X-S/T, where N represents asparagine, X represents any amino acid, and S/T represents serine or threonine.
- antibodies with a VH domain comprising the sequence N-X-S/T can be modified so that these residues consist of X 1 X 2 X 3 , respectively, wherein X 2 is any amino acid, and X 1 X 2 X 3 is not NX 2 S or NX 2 T.
- X 1 can be any amino acid other than N
- X 3 can be any amino acid other than S or T.
- antibodies with a VH domain comprising the sequence N—X—S or N-X-T can be modified so that these three residues consist of D-X-S, respectively.
- antibodies with a VH domain comprising the sequence N—X—S or N-X-T can be modified so that these three residues consist of D-X-T, respectively.
- heavy chain amino acids at residues 72-74 consist of X 1 X 2 X 3 , respectively, wherein X 2 is any amino acid, and X 1 X 2 X 3 is not NX 2 S or NX 2 T.
- heavy chain amino acids at residues 72-74 consist of DX 2 S.
- heavy chain amino acids at residues 72-74 consist of DKS.
- the VH domain comprises the amino acid sequence set forth in SEQ ID NO: 3.
- amino acid sequence of the VH domain consists of the sequence set forth in SEQ ID NO: 3.
- the VL domain comprises the amino acid sequence set forth in SEQ ID NO: 2.
- amino acid sequence of the VL domain consists of the sequence set forth in SEQ ID NO: 2.
- the VH domain comprises the amino acid sequence set forth in SEQ ID NO: 3
- the VL domain comprises the amino acid sequence set forth in SEQ ID NO: 2.
- the amino acid sequence of the VH domain consists of the sequence set forth in SEQ ID NO: 3
- the amino acid sequence of the VL domain consists of the sequence set forth in SEQ ID NO: 2.
- SEQ ID NO: 3 corresponds to the VL (VK3) domain of humanized 5F2.4 (BRO2) disclosed in U.S. Pat. No. 9,944,717 to Broteio Pharma B.V.
- SEQ ID NO: 28 corresponds to the VH (VH4) domain of humanized 5F2.4 (BRO2) disclosed in U.S. Pat. No. 9,944,717 which is incorporated by reference herein.
- the monoclonal antibodies of the invention include the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human antibody, in particular human IgG1, IgG2, IgG3 or IgG4.
- the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG1 and includes the substitutions L234A and L235A in the CH2 domain.
- the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG1 and includes the substitutions H433K and N434F in the CH3 domain.
- the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG1 and includes the substitutions L234A and L235A in the CH2 domain, and the substitutions H433K and N434F in the CH3 domain.
- the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG4. In certain embodiments, the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG4 and includes the substitution S228P in the hinge domain.
- the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG4 and includes the substitution L445P in the CH3 domain.
- the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG4 and includes both the substitution S228P in the hinge domain and the substitution L445P in the CH3 domain.
- the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG4 and includes the substitutions H433K and N434F in the CH3 domain.
- the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG4 and includes the substitution S228P in the hinge domain, and the substitutions H433K and N434F in the CH3 domain.
- the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG4 and includes the substitutions H433K, N434F, and L445P in the CH3 domain.
- the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG4 and includes the substitution S228P in the hinge domain, and the substitutions H433K, N434F, and L445P in the CH3 domain.
- the monoclonal antibody comprises a human IgG heavy chain constant domain.
- the heavy chain constant domain comprises a human IgG1 heavy chain constant domain.
- the heavy chain constant domain consists of a human IgG1 heavy chain constant domain.
- the heavy chain constant domain comprises a human IgG1 heavy chain constant domain comprising the amino acid sequence set forth as SEQ ID NO: 29.
- the amino acid sequence of the heavy chain constant domain consists of the sequence set forth as SEQ ID NO: 29.
- the heavy chain constant domain comprises a human IgG1 heavy chain constant domain comprising the amino acid sequence set forth as SEQ ID NO: 4.
- the amino acid sequence of the heavy chain constant domain consists of the sequence set forth as SEQ ID NO: 4.
- the heavy chain constant domain comprises a human IgG4 heavy chain constant domain. In certain embodiments, the heavy chain constant domain consists of a human IgG4 heavy chain constant domain.
- the heavy chain constant domain comprises a human IgG4 heavy chain constant domain comprising the amino acid sequence set forth as SEQ ID NO: 30.
- the amino acid sequence of the heavy chain constant domain consists of the sequence set forth as SEQ ID NO: 30.
- the heavy chain constant domain comprises a human IgG4 heavy chain constant domain comprising the amino acid sequence set forth as SEQ ID NO: 31.
- the amino acid sequence of the heavy chain constant domain consists of the sequence set forth as SEQ ID NO: 31.
- the heavy chain constant domain comprises a human IgG4 heavy chain constant domain comprising the amino acid sequence set forth as SEQ ID NO: 5.
- the amino acid sequence of the heavy chain constant domain consists of the sequence set forth as SEQ ID NO: 5.
- amino acid sequences of SEQ ID Nos: 4, 5, and 29-31 are shown in Table 4.
- the monoclonal antibody or antigen-binding fragment thereof comprises a full-length monoclonal antibody.
- the monoclonal antibody or antigen-binding fragment thereof consists of a full-length monoclonal antibody.
- provided herein are monoclonal antibodies comprising a heavy chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 32. In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 32. In certain embodiments, provided herein are monoclonal antibodies comprising a light chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 7.
- provided herein are monoclonal antibodies comprising a light chain with at 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 7.
- monoclonal antibodies comprising a heavy chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 32, and a light chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 7.
- provided herein are monoclonal antibodies comprising a heavy chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 32, and a light chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 7.
- provided herein are monoclonal antibodies comprising a heavy chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 6. In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 6. In certain embodiments, provided herein are monoclonal antibodies comprising a light chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 7.
- provided herein are monoclonal antibodies comprising a light chain with at 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 7.
- monoclonal antibodies comprising a heavy chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 6, and a light chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 7.
- provided herein are monoclonal antibodies comprising a heavy chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 6, and a light chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 7.
- monoclonal antibodies comprising a heavy chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 33. In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 33.
- monoclonal antibodies comprising a heavy chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 33, and a light chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 7.
- monoclonal antibodies comprising a heavy chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 33, and a light chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 7.
- monoclonal antibodies comprising a heavy chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 34. In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 34.
- monoclonal antibodies comprising a heavy chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 34, and a light chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 7.
- monoclonal antibodies comprising a heavy chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 34, and a light chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 7.
- monoclonal antibodies comprising a heavy chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 8. In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 8.
- monoclonal antibodies comprising a heavy chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 8, and a light chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 7.
- monoclonal antibodies comprising a heavy chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 8, and a light chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 7.
- amino acid sequences of SEQ ID Nos: 6-8 and 32-34 are shown in Table 5.
- the heavy and/or light chains of the antibodies are defined by a particular percentage sequence identity to a reference sequence
- the heavy chain and/or light chain may retain identical CDR sequences to those present in the reference sequence such that the variation is present only outside the CDR regions.
- % sequence identity between two amino acid sequences may be determined by comparing these two sequences aligned in an optimum manner and in which the amino acid sequence to be compared can comprise additions or deletions with respect to the reference sequence for an optimum alignment between these two sequences.
- the percentage of identity is calculated by determining the number of identical positions for which the amino acid residue is identical between the two sequences, by dividing this number of identical positions by the total number of positions in the comparison window and by multiplying the result obtained by 100 in order to obtain the percentage of identity between these two sequences.
- BLAST 2 sequences (Tatusova et al, “Blast 2 sequences—a new tool for comparing protein and nucleotide sequences”, FEMS Microbiol Lett. 174:247-250), the parameters used being those given by default (in particular for the parameters “open gap penalty”: 5, and “extension gap penalty”: 2; the matrix chosen being, for example, the matrix “BLOSUM 62” proposed by the program), the percentage of identity between the two sequences to be compared being calculated directly by the program.
- the antibodies of the present invention may comprise CH1 domains and/or CL domains (from the heavy chain and light chain, respectively), the amino acid sequence of which is fully or substantially human.
- the antibody or antigen-binding fragment of the invention is an antibody intended for human therapeutic use, it is typical for the entire constant region of the antibody, or at least a part thereof, to have fully or substantially human amino acid sequence. Therefore, one or more or any combination of the CL domain, CH1 domain, hinge region, CH2 domain, CH3 domain and CH4 domain (if present) may be fully or substantially human with respect to its amino acid sequence.
- the CL domain, CH1 domain, hinge region, CH2 domain, CH3 domain and CH4 domain may all have fully or substantially human amino acid sequence.
- substantially human refers to an amino acid sequence identity of at least 90%, or at least 92%, or at least 95%, or at least 97%, or at least 99% with a human constant region.
- human amino acid sequence in this context refers to an amino acid sequence which is encoded by a human immunoglobulin gene, which includes germline, rearranged and somatically mutated genes.
- the invention also contemplates polypeptides comprising constant domains of “human” sequence which have been altered, by one or more amino acid additions, deletions or substitutions with respect to the human sequence, excepting those embodiments where the presence of a “fully human” hinge region is expressly required.
- the presence of a “fully human” hinge region in the C2-binding antibodies of the invention may be beneficial both to minimize immunogenicity and to optimize stability of the antibody.
- the C2 binding antibodies may be modified within the Fc region to increase binding affinity for the neonatal Fc receptor FcRn.
- the increased binding affinity may be measurable at acidic pH (for example from about approximately pH 5.5 to approximately pH 6.0).
- the increased binding affinity may also be measurable at neutral pH (for example from approximately pH 6.9 to approximately pH 7.4).
- by “increased binding affinity” is meant increased binding affinity to FcRn relative to binding affinity of unmodified Fc region.
- the unmodified Fc region will possess the wild-type amino acid sequence of human IgG1, IgG2, IgG3 or IgG4.
- the increased binding affinity to FcRn of the antibody molecule having the modified Fc region will be measured relative to the binding affinity of wild-type IgG1, IgG2, IgG3 or IgG4 for FcRn.
- the C2 binding antibodies may be modified within the Fc region to increase binding affinity for the human neonatal Fc receptor FcRn.
- the increased binding affinity may be measurable at acidic pH (for example from about approximately pH 5.5 to approximately pH 6.0).
- the increased binding affinity may also be measurable at neutral pH (for example from approximately pH 6.9 to approximately pH 7.4).
- by “increased binding affinity” is meant increased binding affinity to human FcRn relative to binding affinity of unmodified Fc region.
- the unmodified Fc region will possess the wild-type amino acid sequence of human IgG1, IgG2, IgG3 or IgG4.
- the increased binding affinity to human FcRn of the antibody molecule having the modified Fc region will be measured relative to the binding affinity of wild-type IgG1, IgG2, IgG3 or IgG4 for human FcRn.
- An aspect of the invention is a pharmaceutical composition
- a pharmaceutical composition of the invention may be formulated with pharmaceutically acceptable carriers or diluents as well as any other known adjuvants and excipients in accordance with conventional techniques such as those disclosed in (Remington: The Science and Practice of Pharmacy, 19th Edition, Gennaro, Ed., Mack Publishing Co., Easton, Pa., 1995).
- pharmaceutically acceptable carrier relates to carriers or excipients, which are inherently non-toxic.
- excipients are, but are not limited to, saline, Ringer's solution, dextrose solution and Hanks' solution.
- Non-aqueous excipients such as fixed oils and ethyl oleate may also be used.
- compositions typically must be sterile and stable under the conditions of manufacture and storage.
- the composition can be formulated as a solution, micro-emulsion, liposome, or other ordered structure suitable to high drug concentration.
- suitable aqueous and non-aqueous carriers which may be employed in the pharmaceutical compositions of the invention include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
- Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- the pharmaceutical compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol, sorbic acid, and the like. It may also be desirable to include isotonicity agents, such as sugars, polyalcohols such as mannitol, sorbitol, glycerol or sodium chloride in the compositions.
- adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol, sorbic acid, and the like. It may also be desirable to include isotonicity agents, such as sugars, polyalcohol
- antioxidants may also be included, for example (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
- water soluble antioxidants such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like
- oil-soluble antioxidants such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (
- Sterile injectable solutions can be prepared by incorporating the monoclonal antibody in the required amount in an appropriate solvent with one or a combination of ingredients, e.g., as enumerated above, as required, followed by sterilization microfiltration.
- dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients, e.g., from those enumerated above.
- the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- the pharmaceutical composition is preferably administered parenterally, preferably by intravenous (i.v.) or subcutaneous (s.c.) injection or infusion.
- parenteral administration and “administered parenterally” as used herein mean modes of administration other than enteral and topical administration, usually by injection, and include, without limitation, intravenous, intraperitoneal, subcutaneous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, transtracheal, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion.
- Prolonged absorption of the injectable anti-C2 mAbs or fragments thereof can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
- the mAbs or fragments thereof can be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems.
- a controlled release formulation including implants, transdermal patches, and microencapsulated delivery systems.
- Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for the preparation of such formulations are generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
- compositions can be administered with medical devices known in the art.
- Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time, or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation.
- Actual dosage levels of the mAbs or fragments thereof in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient without being toxic to the patient.
- the binding molecules, in particular antibodies, according to the invention can be administered by infusion in a weekly dosage of from 10 to 500 mg/m 2 , such as of from 200 to 400 mg/m 2 .
- Such administration can be repeated, e.g., 1 to 8 times, such as 3 to 5 times.
- the administration may be performed by continuous infusion over a period of from 1 to 24 hours, such as a period of from 2 to 12 hours.
- administration may be performed by one or more bolus injections.
- the binding molecules, in particular antibodies, according to the invention can be administered by infusion in a weekly dosage of from 1 to 50 mg per kg body weight (mg/kg), such as from 5 to 25 mg/kg. Such administration can be repeated, e.g., 1 to 8 times, such as 3 to 5 times.
- the administration may be performed by continuous infusion over a period of from 1 to 24 hours, such as a period of from 2 to 12 hours. In some embodiments, administration may be performed by one or more bolus injections.
- the mAbs or fragments thereof or any other binding molecules disclosed in this invention can be administered as maintenance therapy, such as, e.g., once a week for a period of 6 months or more.
- An aspect of the invention is a nucleic acid molecule or plurality of nucleic acid molecules encoding the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention.
- a single nucleic acid molecule encodes both the VH and the VL domains of the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention.
- a single nucleic acid molecule encodes both the heavy chain (HC) and the light chain (LC) of the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention.
- a first nucleic acid molecule encodes the VH domain
- a second nucleic acid molecule encodes the VL domain of the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention.
- a first nucleic acid molecule encodes the heavy chain (HC)
- a second nucleic acid molecule encodes the light chain (LC) of the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention.
- a nucleic acid molecule encoding the VH domain comprises the nucleic acid sequence set forth as SEQ ID NO: 35.
- a nucleic acid molecule encoding the VL domain comprises the nucleic acid sequence set forth as SEQ ID NO: 36.
- a nucleic acid molecule encoding the HC comprises the nucleic acid sequence set forth as SEQ ID NO: 37.
- a nucleic acid molecule encoding the HC comprises the nucleic acid sequence set forth as SEQ ID NO: 38.
- a nucleic acid molecule encoding the HC comprises the nucleic acid sequence set forth as SEQ ID NO: 39.
- a nucleic acid molecule encoding the HC comprises the nucleic acid sequence set forth as SEQ ID NO: 40.
- a nucleic acid molecule encoding the HC comprises the nucleic acid sequence set forth as SEQ ID NO: 41.
- a nucleic acid molecule encoding the LC domain comprises the nucleic acid sequence set forth as SEQ ID NO: 42.
- nucleic acid sequence of a nucleic acid molecule encoding the VH domain consists of the sequence set forth as SEQ ID NO: 35.
- nucleic acid sequence of a nucleic acid molecule encoding the VL domain consists of the sequence set forth as SEQ ID NO: 36.
- nucleic acid sequence of a nucleic acid molecule encoding the HC consists of the sequence set forth as SEQ ID NO: 37.
- nucleic acid sequence of a nucleic acid molecule encoding the HC consists of the sequence set forth as SEQ ID NO: 38.
- nucleic acid sequence of a nucleic acid molecule encoding the HC consists of the sequence set forth as SEQ ID NO: 39.
- nucleic acid sequence of a nucleic acid molecule encoding the HC consists of the sequence set forth as SEQ ID NO: 40.
- nucleic acid sequence of a nucleic acid molecule encoding the HC consists of the sequence set forth as SEQ ID NO: 41.
- nucleic acid sequence of a nucleic acid molecule encoding the LC domain consists of the sequence set forth as SEQ ID NO: 42.
- nucleic acid sequences corresponding to SEQ ID NOs: 35-42 are shown in Table 6.
- the invention further provides a gene delivery vehicle or vector comprising a nucleic acid molecule according to the invention.
- the gene delivery vehicle or vector can be a plasmid or other bacterially replicated nucleic acid. Such a gene delivery vehicle or vector can be easily transferred to, for instance, producer cells.
- the gene delivery vehicle can also be a viral vector.
- Preferred viral vectors are adenoviral vectors, lentiviral vectors, adeno-associated viral vectors and retroviral vectors.
- the invention further provides vectors comprising a nucleic acid molecule or a plurality of nucleic acid molecules in accordance with the invention.
- a single vector comprises a single nucleic acid molecule encoding both the VH and the VL domains of the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention.
- a single vector comprises a single nucleic acid molecule encoding both the heavy chain (HC) and the light chain (LC) of the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention.
- a first vector comprises a first nucleic acid molecule encoding the VH domain
- a second vector comprises a second nucleic acid molecule encoding the VL domain of the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention.
- a first vector comprises a nucleic acid molecule encoding the heavy chain (HC)
- a second vector comprises a second nucleic acid molecule encoding the light chain (LC) of the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention.
- Vectors in accordance with the invention include expression vectors suitable for use in expressing the monoclonal antibody or antigen-binding fragment thereof by a host cell.
- Host cells can be eukaryotic or prokaryotic.
- the invention provides a host cell comprising a nucleic acid molecule or plurality of nucleic acid molecules encoding an antibody or antigen-binding fragment thereof in accordance with the instant invention.
- the invention provides a host cell comprising a vector or plurality of vectors encoding an antibody or antigen-binding fragment thereof in accordance with the instant invention.
- the nucleic acid molecule or molecules, or similarly the vector or vectors can be introduced into the host cell using any suitable technique, including, for example and without limitation, transduction, transformation, transfection, and injection.
- Various forms of these methods are well known in the art, including, e.g., electroporation, calcium phosphate transfection, lipofection, cell squeezing, sonoporation, optical transfection, and gene gun.
- a host cell is a eukaryotic cell. In certain embodiments, a host cell is a yeast cell. In certain embodiments, a host cell is an insect cell. In certain embodiments, a host cell is a mammalian cell. In certain embodiments, a host cell is a human cell. In certain embodiments, a host cell is a mammalian cell selected from the group consisting of hybridoma cells, Chinese hamster ovary (CHO) cells, NS0 cells, human embryonic kidney (HEK293) cells, and PER.C6TM cells. The invention further contemplates other host cells in addition to those mentioned above. Host cells further include cell lines developed for commercial production of the antibodies and antigen-binding fragments thereof in accordance with the invention.
- Cell lines provided with the nucleic acid can produce the binding molecule/antibody in the laboratory or production plant.
- the nucleic acid is transferred to a cell in the body of an animal in need thereof and the binding molecule/antibody is produced in vivo by the transformed cell.
- the nucleic acid molecule of the invention is typically provided with regulatory sequences to the express the binding molecule in the cell.
- present day homologous recombination techniques have become much more efficient. These techniques involve for instance double stranded break assisted homologous recombination, using site-specific double stranded break inducing nucleases such as TALEN.
- Such or analogous homologous recombination systems can insert the nucleic acid molecule into a region that provides one or more of the in cis required regulatory sequences.
- the invention further provides an isolated or recombinant cell, or in vitro cell culture cell comprising a nucleic acid molecule or vector according to the invention.
- the invention further provides an isolated or recombinant cell, or in vitro cell culture cell comprising a binding molecule according to the invention.
- said cell produces said binding molecule.
- said cell secretes said binding molecule.
- said cell is a hybridoma cell, a CHO cell, an NS0 cell, a HEK293 cell, or a PER-C6TM cell.
- said cell is a CHO cell.
- a cell culture comprising a cell according to the invention.
- cell lines for the largescale production of antibodies for instance for clinical use.
- Non-limiting examples of such cell lines are CHO cells, NS0 cells or PER.C6TM cells. These cells are also used for other purposes such as the production of proteins.
- Cell lines developed for industrial scale production of proteins and antibodies are herein further referred to as industrial cell lines.
- the invention provides an industrial cell line comprising a nucleic acid molecule, a binding molecule and/or antibody according to the invention.
- the invention also provides a cell line developed for the largescale production of protein and/or antibody comprising a binding molecule or antibody of the invention.
- the invention also provides the use a cell line developed for the largescale production of a binding molecule and/or antibody of the invention.
- the invention further provides a method of making a monoclonal antibody or antigen-binding fragment thereof in accordance with the invention, comprising culturing a population of host cells according to the invention under conditions permitting expression of the monoclonal antibody or antigen-binding fragment thereof.
- the method further comprises harvesting said monoclonal antibody or antigen-binding fragment thereof from the culture.
- said cell is cultured in a serum-free medium.
- said cell is adapted for suspension growth.
- an antibody obtainable by a method for producing an antibody according to the invention.
- the antibody is preferably purified from the medium of the culture.
- said antibody is affinity purified.
- An aspect of the invention is a method of inhibiting activation of classical or lectin pathway in a subject, comprising administering to a subject in need thereof an effective amount of the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention.
- the subject is a mammal.
- the subject is a mouse, rat, hamster, Guinea pig, rabbit, goat, sheep, pig, cat, dog, horse, or cow.
- a subject is a non-human primate, e.g., a monkey.
- a subject is a human.
- the inhibitory effect of the antibody or antigen-binding fragment can be assessed using any suitable method, including, for example, measuring total complement activity, a test of hemolytic activity based on the ability of a serum sample to lyse sheep erythrocytes coated with anti-sheep antibodies. Decreased hemolysis compared to an untreated control sample indicates an inhibitory effect of the antibody or antigen-binding fragment.
- the untreated control sample can be a historical sample obtained prior to starting treatment with the antibody or antigen-binding fragment.
- a decrease in total complement activity of at least 5% compared to control is indicative of efficacy.
- a decrease in total complement activity of at least 10% compared to control is indicative of efficacy.
- autoimmune diseases such as experimental allergic neuritis, type II collagen-induced arthritis, myasthenia gravis, hemolytic anemia, glomerulonephritis, idiopathic membranous nephropathy, rheumatoid arthritis, systemic lupus erythematosus, immune complex-induced vasculitis, adult respiratory distress syndrome, stroke, xenotransplantation, allotransplantation, multiple sclerosis, burn injuries, extracorporeal dialysis and blood oxygenation, inflammatory disorders, including sepsis and septic shock, toxicity induced by the in vivo administration of cytokines or mAbs, antibody-mediated rejection of allografts such as kidney allografts, multiple trauma, ischemia-reperfusion injuries, and myocardial infarction.
- autoimmune diseases such as experimental allergic neuritis, type II collagen-induced arthritis, myasthenia gravis, hemolytic anemia, glomerulonephritis, idiopathic me
- an effective amount of a monoclonal antibody or antigen-binding fragment thereof in accordance with the invention can be treated by administering an effective amount of a monoclonal antibody or antigen-binding fragment thereof in accordance with the invention to an individual in need thereof.
- an effective amount is meant an amount sufficient to achieve a desired biological response.
- by “effective amount” is meant an amount of a monoclonal antibody or antigen-binding fragment thereof in accordance with the invention that is capable of inhibiting complement activation in the individual.
- Treatment will generally consist of administering the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention parenterally together with a pharmaceutical carrier, for example intravenously, subcutaneously, or locally.
- a pharmaceutical carrier for example intravenously, subcutaneously, or locally.
- the administering typically can be accomplished by injection or infusion.
- the dose and administration regimen of the monoclonal antibody or antigen-binding fragment thereof in accordance with invention will depend on the extent of inhibition of complement activation aimed at. Typically, for monoclonal antibodies of the invention, the amount will be in the range of 2 to 20 mg per kg of body weight.
- the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention will be formulated in an injectable form combined with a pharmaceutically acceptable parenteral vehicle.
- Such vehicles are well-known in the art and examples include saline, dextrose solution, Ringer's solution and solutions containing small amounts of human serum albumin.
- compositions typically must be sterile and stable under the conditions of manufacture and storage.
- the composition can be formulated as a solution, micro-emulsion, liposome, or other ordered structure suitable to high drug concentration.
- suitable aqueous and non-aqueous carriers which may be employed in the pharmaceutical compositions of the invention include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
- Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- the pharmaceutical compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol, sorbic acid, and the like. It may also be desirable to include isotonicity agents, such as sugars, polyalcohols such as mannitol, sorbitol, glycerol or sodium chloride in the compositions.
- adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol, sorbic acid, and the like. It may also be desirable to include isotonicity agents, such as sugars, polyalcohol
- antioxidants may also be included, for example (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
- water soluble antioxidants such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like
- oil-soluble antioxidants such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (
- Sterile injectable solutions can be prepared by incorporating the mAb or fragments thereof in the required amount in an appropriate solvent with one or a combination of ingredients e.g. as enumerated above, as required, followed by sterilization microfiltration.
- dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients e.g. from those enumerated above.
- the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- Prolonged absorption of the injectable anti-C2 mAbs or fragments thereof can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
- the mAbs of fragments thereof can be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems.
- a controlled release formulation including implants, transdermal patches, and microencapsulated delivery systems.
- Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for the preparation of such formulations are generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
- compositions can be administered with medical devices known in the art.
- Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time, or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation.
- Actual dosage levels of the mAbs or fragments thereof in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient without being toxic to the patient.
- the monoclonal antibodies according to the invention can be administered by infusion in a weekly dosage of from 10 to 500 mg/m 2 , such as of from 200 to 400 mg/m 2 .
- Such administration can be repeated, e.g., 1 to 8 times, such as 3 to 5 times.
- the administration may be performed by continuous infusion over a period of from 2 to 24 hours, such as of from 2 to 12 hours.
- the mAbs or fragments thereof or any other binding molecules disclosed in this invention can be administered by maintenance therapy, such as, e.g., once a week for a period of 6 months or more.
- U.S. Pat. No. 9,944,717 discloses a murine inhibitory anti-C2b monoclonal antibody (mAb). From this lead, four humanized variants, comprising different heavy chain variable domains (VH1, VH2, VH3, or VH4) and kappa light chain variable domains (VK1, VK2, VK3, or VK4), were generated using the Composite Human Antibody technology of Antitope Ltd (Cambridge, UK). Based on in silico analysis, the risk of immunogenicity for each of the humanized VH and VK sequences was predicted. As shown in Table 7, the lowest risk for immunogenicity, along with the highest percentage of identity to the closest human germline variant, was predicted when VH4 was paired with VK3 or VK4.
- VH4 was preferred because of its higher percentage of identity against the closest human germline.
- VH4/VK3 was selected as the anti-human C2b humanized lead antibody and is referred to herein as BRO2-glyc-IgG4.
- BRO2-glyc-IgG4 exhibited improved thermotolerance (Table 8).
- BRO2-glyc-IgG4 exhibited a TM50 of 64.0° C.
- VH4.2/VK3 also referred to herein as BRO2-IgG4
- VH4.2/VK4 exhibited a TM50 of 65.2 or 65.4° C. in two independent experiments.
- Antibodies with pH-dependent antigen binding dissociate bound antigen in acidic endosomes after internalization into cells. Consequently, released antigen is trafficked to the lysosome and degraded, whereas the dissociated antibody, free of antigen, is recycled back to plasma by FcRn. The recycled free antibody can bind to another target antigen.
- a pH-dependent antigen-binding antibody can bind to the target antigen more than once and therefore improve the neutralizing capacity of the antibody. This process can further be improved when an antibody is equipped with NHancet (NH) technology (argenx, Belgium) that enhances the binding of the antibody to FcRn at acidic endosomal pH (pH 6.0) but not at neutral pH (pH 7.4).
- NH NHancet
- BRO2-IgG4 amino acids in the Fc region of BRO2-IgG4 were mutated to alter pH-dependent binding to FcRn (H433K, N434F).
- the resulting antibody is referred to herein as BRO2-IgG4—NH.
- BRO2-IgG1—NH and BRO2-IgG1-LALA-NH The effect of immunoglobulin subclass on efficacy was also examined.
- a further NHance® variant was prepared in a human IgG1 background (BRO2-IgG1—NH).
- Antibody effector functions can be further diminished by mutations in the Fc region that alter binding of the antibody to Fc ⁇ receptors. Therefore, amino acid substitutions L234A and L235A (“LALA”) were incorporated into BRO2-IgG1—NH to yield BRO2-IgG1-LALA-NH, also referred to herein as ARGX-117.
- His1-IgG4—NH His1-IgG4—NH
- VH4.2m12 an amino acid of the VH4 of the BRO2-IgG4—NH antibody was mutated to histidine (K26H, VH mutant referred to herein as VH4.2m12). Additionally, the VK3 light chain of the BRO2-IgG4—NH antibody was replaced with the VK4 light chain mentioned above, and a second amino acid was mutated to histidine (G29H, VK4 mutant referred to herein as VK4m3). The resulting antibody (VH4.2m12NK4m3) is referred to herein as His2-IgG4—NH.
- a serum sample was obtained from each monkey one day prior to receiving test antibody (day ⁇ 1, or “PRE”). Then on day 1 (d1), each monkey received a single intravenous injection of 5 mg/kg test antibody in accordance with Table 9. Serum samples were then obtained from each monkey serially over up to 60 days (to d60).
- PK of total antibody a microtiter plate was coated overnight at 4° C. with 100 ⁇ L goat anti-human IgG (Bethyl; A80-319A) at 5 ⁇ g/mL. Plates were washed 3 times with at least 200 ⁇ L PBS-0.05% Tween20 and subsequently blocked with 200 IA PBS-2% BSA for 2 hours at room temperature (RT).
- RT room temperature
- HRP horseradish peroxidase
- Results are shown in Table 10 and a comparison of glycosylated BRO2-glyc-IgG4 with non-glycosylated BRO2-IgG4 is shown in FIG. 2 .
- concentrations of non-glycosylated BRO2-IgG4 were generally greater than those of glycosylated BRO2-glyc-IgG4. This improvement in total PK was completely unexpected and represents an important further advantage of the non-glycosylated antibody.
- a microtiter plate was coated overnight at 4° C. with 100 ⁇ L 2.5 ⁇ g/mL mouse anti-human C2 monoclonal antibody mAb32 (anti-C2 #32 m-IgG @ 3.31 mg/mL, 0.2 ⁇ m PBS, LC-12/05-166, 12-apr-13).
- mAb32 anti-C2 #32 m-IgG @ 3.31 mg/mL, 0.2 ⁇ m PBS, LC-12/05-166, 12-apr-13.
- This antibody binds to a different epitope on C2 than BRO2. Plates were washed 3 times with at least 200 ⁇ L PBS-0.05% Tween20 and subsequently blocked with 200 IA PBS-2% BSA (pH 7.4) for 2 hours at RT.
- samples frozen standard (specific for each antibody, prepared in pooled naive cynomolgus monkey serum) and frozen QC samples (prepared in pooled naive cynomolgus monkey serum) were thawed and diluted 6.7-fold in 80 IA PBS-0.2% BSA. 40 1,1L biotinylated anti-C2 VH4/VK3 was added at 0.6 ⁇ g/mL. Each sample was made in duplicate. 100 IA of the mixture was transferred immediately to the washed coated plate after addition of the biotinylated antibody.
- the plate was incubated for 2 hours at RT, washed 5 times with at least 200 ⁇ L PBS-0.02% Tween20, and 100 IA strep-HRP (Jackson, 016-030-084) was added at 300,000-fold dilution in PBS-0.2% BSA. After 1 hour incubation at RT, the plates were washed 5 times with at least 200 IA PBS-0.05% Tween20 and staining was done with 100 ⁇ L TMB (Calbiochem, CL07) and stopped after 10 minutes with 100 ⁇ L 0.5 M H2504 (CHEM LAB, Cat #CL05-2615-1000). The OD was measured at 450 nm and used to determine C2 levels.
- FIG. 4 shows a blow up (log scale) of the free C2 levels (OD 450 nm) for the average of the 2 monkeys of each group. Free C2 levels were lower for BRO2 variants than for His1 variants.
- Monkey 10 injected with BRO2-IgG1-LALA-NH (ARGX-117), had the lowest levels of C2 at all time points tested. Comparison of free C2 levels from monkeys 5 and 6, 9 and 10, and 15 and 16 out to 60 days can be seen in FIG. 5 . Monkey 10 also had the best total PK (see above). The raw data is shown in Table 11, and average data comparing the glycosylated and non-glycosylated variants is shown in Table 12.
- ADA anti-drug antibodies
- Immunogenicity was determined by coating a microtiter plate with 100 ⁇ l of 1 ⁇ g/mL of the respective antibody overnight at 4° C. Plates were washed 3 times with at least 200 ⁇ L PBS-0.05% Tween20 and subsequently blocked with 200 ⁇ L PBS-1% casein for 2 hours at RT. After washing the plates 3 times with at least 200 IA PBS-0.05% Tween20, serum samples were diluted 20-fold or more in 1004 PBS-0.1% casein and incubated in the coated wells for 2 hours at room temperature (RT).
- ADA was observed as of day 11; for monkey 8 ( FIG. 7 F ), as of day 15; and for monkey 14 ( FIG. 7 L ), as of day 19.
- Binding characteristics of ARGX-117 were assessed by Western blotting and by Surface Plasmon Resonance (SPR) analysis, as depicted in FIG. 1 .
- Western blotting results revealed that ARGX-117 binds to C2 and C2b, as depicted in FIG. 9 A .
- the binding characteristics of ARGX-117 were further studied by SPR, using the Biacore 300, by coating C2 (SEQ ID NO: 21) on the solid phase with different concentrations of Fabs of ARGX-117 used as eluate, as depicted in FIG. 9 B . Affinities were calculated assuming 1:1 binding between the Fab and C2 and yielded a Kd of about 0.3 nM.
- C2 was first allowed to bind to C4b immobilized on streptavidin chips, and after stabilization by flowing buffer only, samples were flown, as depicted in FIG. 9 D .
- Running buffer or control human IgG4 mAb targeting an irrelevant soluble antigen i.e., anti-Factor XI (anti-FXI)
- anti-FXI anti-FXI
- Injection of anti-C2-63 resulted in increased signal, suggesting that this mAb is able to bind to C3 convertase (C4bC2a).
- anti-C2-5F2.4 does not cross-react with Factor B (FB; SEQ ID NO: 50) and that C2 and FB are highly homologous proteins that have similar domain structure. Both proteins comprise a small fragment, and a large fragment.
- the small fragment in complement C2 is called C2b (SEQ ID NO:44), and the small fragment in Factor B is called FBa (SEQ ID NO: 51).
- the small fragment in each comprises three Sushi domains (CCP domains).
- the large fragment in each comprises a von Willebrand Factor type A domain (VWFA) and a Peptidase S 1 domain on, as shown in FIG. 10 .
- Domain swap mutants included a C-terminal FLAG tag.
- DNA constructs for C2, FB, and the ten domain swap mutants were obtained from GenScript.
- DNA was heat shock-transformed into competent E. coli cells (ThermoFisher). Cells were streaked on agar plates and grown for 16 hours at 37° C.
- Thirteen bottles of 200 mL LB (Luria Broth) medium were prepared (MP Bio) and autoclaved. 300 IA ampicillin (100 mg/mL) was added to each bottle.
- Pre-cultures were started with 3 mL LB medium for each construct. After 6 hours, the pre-cultures were transferred into the bottles and grown for 16 hours at 37° C. with agitation.
- DNA was purified from bacterial pellets by a plasmid DNA purification kit according the manufacturer's instructions (MaxiPrep, NucleoBond PC 500, Macherey-Nagel) and reconstituted in TE buffer. Plasmid DNA concentration was determined by NanoDrop and was set to 1 ⁇ g/ ⁇ L. The integrity of the plasmids was verified by restriction analysis. For each construct 1 ⁇ L plasmid DNA and 9 ⁇ L restriction enzyme-mix (PstI and PvuII) were mixed and incubated for 2 hours at 37° C. The DNA was analyzed on a 1% agarose gel after 1 hour running at 100
- the mutant proteins were generated by transient transfection in HEK293T cells.
- HEK cells were cultured in complete DMEM (DMEM (Gibco) supplemented with 10% fetal calf serum (FCS) and 1% penicillin/streptomycin (P/S)).
- FCS fetal calf serum
- P/S penicillin/streptomycin
- One day prior to transfection cells of two flasks were seeded into fifteen 10 cm 2 culture dishes (Greiner Bio-One). Before the transfection, 21 mL of empty DMEM medium was mixed with 630 4 polyethylenimine (P-Pei, Polysciences, Inc.). As controls an empty plasmid PF45 pcDNA3.1 and PF146 H2B GFP were transfected.
- an anti-FLAG-tag ELISA assay was carried out.
- Microplates Maxisorp, NUNC, Cat #439454
- 100 4/well of 1 ⁇ g/mL anti-FLAG Ab (clone M2, Sigma-Aldrich) in PBS and 0.1% Tween-(PBST) was added and incubated for 1 hour at room temperature (RT) with agitation.
- HRP horseradish peroxidase
- Anti-FLAG ELISA detected proteins in the supernatant for all mutants, except for C2-(FB-Pep1), as depicted in FIG. 11 .
- the variation between the mutants can be explained by the different production or by the different detection efficacy by anti-FLAG mAb after coating.
- microplates (Maxisorp, NUNC, Cat #439454) were coated overnight with 2 ⁇ g/mL anti-C2-5F2.4 in 100 4 PBS. Plates were washed 4 times with PBS with 0.05% Tween-20 and blocked with 200 4 PBS with 0.1% Tween-20 with 1% bovine serum albumin (BSA) (PBST-BSA) for 1 hour at RT. After washing, 100 4 culture supernatant containing mutants were added 20x diluted in PBST-BSA and incubated for 2 hours at RT with agitation.
- BSA bovine serum albumin
- biotinylated anti-FLAG (clone M2, Sigma-Aldrich) was added in PBST-BSA for 1 hour at RT.
- the plate was washed and 1 ⁇ g/mL streptavidin-POD conjugate (Roche, Cat #11089153001) was added and incubated in the dark for 30 minutes.
- the plate was washed and 100 4/well TMB (Invitrogen, Cat #5B02) was added as substrate, and reaction was stopped after a few minutes with 100 4/well HCl (Fischer, Cat #J/4320/15).
- Absorbance was measured at 450 nm on a microplate reader (BioRad, iMark Microplate reader).
- Wild type C2 showed clear binding, and loss of binding was only observed for C2-(FB-S2) in which the complement C2 S2 domain (SEQ ID NO: 46) was replaced by the Factor B S2 domain (SEQ ID NO: 54). In contrast, no binding was seen to wild type FB, however strong binding was detected for the mutant FB-(C2-S2) in which the Factor B S2 domain (SEQ ID NO: 54) was replaced by the complement C2 S2 domain (SEQ ID NO: 46), as depicted in FIG. 12 .
- These results clearly show that anti-C2-5F2.4 recognizes an epitope on S2 (Sushi domain 2) on C2b. This result also shows that C2-(FB-Pep1) is produced in sufficient quantity.
- Anti-C2-5F2.4 does not cross-react with mouse C2, and the mouse S2 domain (SEQ ID NO: 58) differs from the human S2 domain (SEQ ID NO: 46) at 10 amino acid positions, as depicted in FIG. 13 .
- the fine mapping constructs contained either the human C2b fragment (huC2b), huC2b with mouse S2 (huC2b-mS2), and ten mutants, each containing one amino acid back-mutation from the mouse sequence to the human sequence. Mutant C2b proteins were generated similar to the domain swap mutants by transient transfection into HEK293 cells.
- FIG. 16 By using the publicly available structural data for human C2b, the position of the ten possible amino acids that might contribute to the epitope of anti-C2-5F2.4 was analyzed, as depicted in FIG. 16 .
- This analysis revealed three possible clusters, each composed of three amino acids that could contribute to the epitope.
- DNA constructs for these cluster mutants were designed and obtained.
- the cluster mutants were generated by mutating the human C2b S2 amino acids to corresponding mouse C2b S2 amino acids. In each mutant three amino acids were changed. A loss of binding was expected if these three amino acids contributed to the epitope of anti-C2-5F2.4.
- FIG. 17 A shows that cluster 1 mutant was expressed well and the binding was not affected, and therefore these amino acids do not contribute to the binding.
- Cluster 2 mutant Based on the anti-FLAG ELISA, expression of the cluster 2 mutant was lower, and this resulted in lack of binding by anti-C2-5F2.4. Cluster 3 mutant also was not expressed well, and this most likely explains the lack of binding by anti-C2-5F2.4, as depicted in FIG. 17 B . Similar results were obtained when the binding was studied in the presence of 1.25 mM Ca ++ in the buffer. From this analysis, the amino acids in cluster 1 can be excluded, leaving four possible amino acids in cluster 2 and cluster 3.
- Domain swap mutants provided strong evidence that the epitope that is recognized by anti-C2-5F2.4 on C2 is located on the Sushi domain 2 on C2b. Additionally, these experiments suggest that the presence of that domain on FB is sufficient for recognition by anti-C2-5F2.4. Considering that anti-C2-5F2.4 does not react with mouse C2, one or more of the 10 amino acids that differ between human and mouse Sushi 2 domain should be essential for the epitope. By using single amino acid back-mutations, we show that a single amino acid in Sushi 2 cannot restore binding. From the experiments performed with the cluster mutants it was concluded that amino acids in cluster 1 do not contribute to the epitope of anti-C2-5F2.4.
- Amino acids of cluster 2 may contribute to the epitope of anti-C2-5F2.4, but since the expression of this mutant was lower than cluster 1 mutant, it cannot be excluded that the folding of cluster 2 mutant was not optimal. Since the cluster 3 mutant was not well expressed, it appears likely the mutations affected folding and so the role of the amino acids in cluster 3 remains elusive.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Transplantation (AREA)
- Endocrinology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
Provided are antibodies and antigen-binding fragments thereof that bind specifically to human complement factor C2 and are capable of inhibiting activation of the classical and lectin pathways of the complement system. The antibodies and antigen-binding fragment exhibit improved manufacturability, pharmacokinetics, and antigen sweeping. Also provided are pharmaceutical compositions comprising the antibodies and antigen-binding fragments, nucleic acids and vectors encoding the antibodies and antigen-binding fragments, host cells comprising the nucleic acids or vectors, and methods of making and using the antibodies and antigen-binding fragments. The antibodies and antigen-binding fragments can be used to inhibit the classical pathway of complement activation in a subject, e.g., a human. The antibodies and antigen-binding fragments can also be used to inhibit the lectin pathway of complement activation in a subject, e.g., a human.
Description
- This Application is a division of U.S. patent application Ser. No. 17/572,518, filed on Jan. 10, 2022, which is a division of U.S. patent application Ser. No. 17/491,656, filed on Oct. 1, 2021, now U.S. Pat. No. 11,591,386, which is a division of U.S. patent application Ser. No. 16/714,264, filed on Dec. 13, 2019, now U.S. Pat. No. 11,161,900, which claims the benefit of U.S. Provisional Application No. 62/779,102, filed on Dec. 13, 2018, the entire contents of which are incorporated herein by reference.
- The content of the electronically submitted sequence listing in ST.26 XML (Name: 199394_SL.xml; size: 67,412 bytes; created on Jun. 5, 2023) is incorporated herein by reference in its entirety.
- The present invention relates to the fields of immunology and molecular biology. More particularly, the present invention relates to compositions and methods for inhibiting the activation of the classical and lectin pathways of the complement system and use thereof in the treatment of human conditions. The invention in particular relates to binding molecules that bind to human complement factor C2 and methods of making and using same.
- The complement system involves a cascading series of plasma enzymes, regulatory proteins, and proteins capable of cell lysis. Prior to activation, various complement factors circulate as inactive precursor proteins. Activation of the system leads to an activation cascade where one factor activates the subsequent one by specific proteolysis of complement protein further downstream in the cascade.
- Activation of the complement system can occur via three pathways, the classical (or classic) pathway, the alternative pathway, and the lectin pathway. The classical pathway is activated by interaction of antigen and IgM, IgG1, IgG2, or IgG3 antibody to form immune complexes that bind Clq, a subunit of complement component C1. The alternative pathway is activated by IgA-containing immune complexes or recognition of bacteria and other activating surfaces. The lectin pathway is responsible for an antibody-independent pathway of complement activation that is initiated by binding of mannan-binding lectin (MBL), also known as mannose-binding lectin or mannan-binding protein (MBP), to certain carbohydrates on the surface of a variety of pathogens.
- Activation of the classical pathway begins with sequential activation of C1, C4, and C2; C2 is in turn cleaved into C2a and C2b. Activation of the alternative pathway begins with sequential activation of complement components D, C3, and B. Each pathway cleaves and activates a common central component, C3 or the third complement factor, which results in the activation of a common terminal pathway leading to the formation of the membrane-attack complex (MAC, comprising complement components C5b-9; Muller-Eberhard, Annu Rev Biochem 1988, 57:321). During complement activation, several inflammatory peptides like the anaphylatoxins C3a and C5a are generated as well as the MAC. These activation products elicit pleiotropic biological effects such as chemotaxis of leukocytes, degranulation of phagocytic cells, mast cells and basophils, smooth muscle contraction, increase of vascular permeability, and lysis of cells (Hugh, Complement 1986, 3:111). Complement activation products also induce the generation of toxic oxygen radicals and the synthesis and release of arachidonic acid metabolites and cytokines, in particular by phagocytes, which further amplifies the inflammatory response.
- Although complement is an important line of defense against pathogenic organisms, its activation can also confer damage to otherwise healthy host cells. Inhibition of complement activation is therefore thought to be beneficial in treating and preventing complement-mediated tissue damage. Accordingly, there remains an urgent need in the art for novel therapeutic agents that inhibit one or more key components of the complement cascade.
- Provided are novel monoclonal anti-human C2b antibodies and antigen-binding fragments thereof with improved features over existing antibodies. A feature of the novel antibodies is the deletion of a glycosylation site in framework region 3 (FR3) of the heavy chain variable domain (VH). Notably, the novel antibodies provide improved homogeneity and therefore improved manufacturability, as well as unexpectedly improved functional properties, compared to existing antibodies. The improved functional properties include, for example, increased pI and enhanced potential for so-called antigen sweeping. The antibodies and antigen-binding fragments thereof will find use in human therapy. An aspect of the invention is a monoclonal antibody or antigen-binding fragment thereof that specifically binds to human complement factor C2, wherein said monoclonal antibody or fragment thereof comprises:
-
- a VH domain comprising the amino acid sequence set forth in SEQ ID NO: 1; and
- a VL domain comprising the amino acid sequence set forth in SEQ ID NO: 2;
- wherein amino acid residues 72-74 (Kabat numbering) of the VH domain consist of X1X2X3, respectively, wherein X2 is any amino acid, and X1X2X3 is not NX2S or NX2T.
- An aspect of the invention is a pharmaceutical composition comprising the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention, and a pharmaceutically acceptable carrier.
- An aspect of the invention is a nucleic acid molecule or plurality of nucleic acid molecules encoding the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention.
- An aspect of the invention is a vector or plurality of vectors comprising the nucleic acid molecule or the plurality of nucleic acid molecules in accordance with the invention.
- An aspect of the invention is a host cell comprising a nucleic acid molecule or plurality of nucleic acid molecules encoding the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention.
- An aspect of the invention is a host cell comprising a vector or plurality of vectors comprising the nucleic acid molecule or the plurality of nucleic acid molecules in accordance with the invention.
- An aspect of the invention is a method of making a monoclonal antibody or antigen-binding fragment thereof in accordance with the invention, the method comprising culturing a population of cells according to the invention under conditions permitting expression of the monoclonal antibody or antigen-binding fragment thereof. An aspect of the invention is a method of inhibiting activation of the classical or lectin pathway in a subject, comprising administering to a subject in need thereof an effective amount of the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention.
- The following embodiments apply to all aspects of the invention.
- In certain embodiments, X1X2X3 consists of DX2S.
- In certain embodiments, X1X2X3 consists of DKS.
- In certain embodiments, the VH domain comprises the amino acid sequence set forth in SEQ ID NO: 3.
- In certain embodiments, the VL domain comprises the amino acid sequence set forth in SEQ ID NO: 2.
- In certain embodiments, the VH domain comprises the amino acid sequence set forth in SEQ ID NO: 3, and the VL domain comprises the amino acid sequence set forth in SEQ ID NO: 2.
- In certain embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a full-length monoclonal antibody.
- In certain embodiments, the monoclonal antibody comprises a human IgG heavy chain constant domain.
- In certain embodiments, the heavy chain constant domain comprises a human IgG1 heavy chain constant domain. In certain embodiments, the human IgG1 heavy chain constant domain comprises the amino acid sequence set forth in SEQ ID NO: 4.
- In certain embodiments, the heavy chain constant domain comprises a human IgG4 heavy chain constant domain. In some embodiments, the human IgG4 heavy chain constant domain comprises the amino acid sequence set forth in SEQ ID NO: 5.
- In certain embodiments, the monoclonal antibody comprises a heavy chain comprising the amino acid sequence set forth as SEQ ID NO: 6 and a light chain comprising the amino acid sequence set forth as SEQ ID NO: 7.
- In certain embodiments, the monoclonal antibody comprises a heavy chain comprising the amino acid sequence set forth as SEQ ID NO: 8 and a light chain comprising the amino acid sequence set forth as SEQ ID NO: 7.
-
FIG. 1 depicts a polyacrylamide gel loaded with indicated samples. Larger molecular weight bands for samples inlanes -
FIG. 2 is a graph depicting total levels of indicated antibodies over the course of 31 days in cynomolgus monkeys. The following antibodies were tested: BRO2-glyc-IgG4 (monkeys monkeys -
FIGS. 3A-3I are graphs depicting levels of free C2 (plotted as OD 450 nm over time) in serum over the course of 31 days from administration of various monoclonal antibodies to cynomolgus monkeys. The following antibodies were tested: BRO2-glyc-IgG4 (FIG. 3A ;monkeys 1 and 2), negative control (FIG. 3B ;monkeys 3 and 4), BRO2-IgG4 (FIG. 3C ;monkeys 5 and 6), BRO2-IgG4—NH (FIG. 3D ;monkeys 7 and 8), BRO2-IgG1-LALA-NH (FIG. 3E ; ARGX-117;monkeys 9 and 10), His1-IgG4 (FIG. 3F ;monkeys 11 and 12), His1-IgG4—NH (FIG. 3G ;monkeys 13 and 14), His1-IgG1-LALA-NH (FIG. 3H ;monkeys 15 and 16), and His2-IgG4 (FIG. 31 ;monkeys 17 and 18). -
FIG. 4 is a graph depicting average free C2 levels (plotted as OD 450 nm over time) in serum over the course of 31 days from cynomolgus monkeys administered various indicated monoclonal antibodies. -
FIG. 5 is a graph depicting free C2 levels (plotted as OD 450 nm over time) in serum of cynomolgus monkeys treated with indicated non-glycosylated antibodies. -
FIGS. 6A-6D are a series of graphs depicting free C2 levels (plotted as OD 450 nm) in cynomolgus monkeys as determined at indicated times prior to or following administration of antibodies. Monkeys are as inFIGS. 3A-3I .FIG. 6A , pre versus pre plus 500 mg/ml BRO-2;FIG. 6B , 4 hours versus 1 day;FIG. 6C , 4 hours versus 2 days;FIG. 6D ,day 11 versusday 27. ADA, anti-drug antibody. -
FIGS. 7A-7P are a series of graphs depicting immunogenicity (plotted as OD 450 nm) over 30 days of anti-C2 antibodies or negative control monoclonal antibody administered to cynomolgus monkeys. Monkeys are as inFIGS. 3A-3I .FIG. 7A ,monkey 1;FIG. 7B ,monkey 2;FIG. 7C ,monkey 5;FIG. 7D ,monkey 6;FIG. 7E ,monkey 7;FIG. 7F ,monkey 8;FIG. 7G ,monkey 9;FIG. 7H ,monkey 10;FIG. 71 ,monkey 11;FIG. 7J ,monkey 12;FIG. 7K ,monkey 13;FIG. 7L ,monkey 14;FIG. 7M ,monkey 15;FIG. 7N ,monkey 16;FIG. 7O ,monkey 17;FIG. 7P ,monkey 18. -
FIGS. 8A-8F are a series of graphs depicting immunogenicity (plotted as OD 450 nm over time) over 60 days of anti-C2 monoclonal antibodies administered to cynomolgus monkeys. Monkeys are as inFIGS. 3A-3I .FIG. 8A ,monkey 5;FIG. 8B ,monkey 6;FIG. 8C ,monkey 9;FIG. 8D ,monkey 10;FIG. 8E ,monkey 15;FIG. 8F ,monkey 16. ADA, anti-drug antibody. -
FIGS. 9A-9D depict ARGX-117 binding to C2 assessed by Western blot analysis and surface plasmon resonance (SPR).FIG. 9A depicts Western blot analysis of serum with ARGX-117 (representative result): Lane 1: MW size marker; Lane 2: recombinant human C2 control (size about 100 kDa); Lane 3: serum; Lane 4: induction of complement activation by addition of aggregated IgG to serum and incubation at 37° C.; Lane 5: C2-deficient serum. -
FIG. 9B depicts SPR analysis with C2 immobilized on chip and different ARGX-117 Fabs as eluate. -
FIG. 9C depicts SPR analysis with biotin-C4b immobilized to streptavidin-chip and human C2 with and without mAbs as eluate; black: no pre-incubation; grey: anti-FXI; control human IgG4 mAb; turquoise: non-inhibitory anti-C2 clone anti-C2-63, i.e., clone 63 recognizing the large subunit of C2 (C2a); red: ARGX-117; all at 5 to 1 molar ratios; curves were normalized to signal just before the injection of C2 on the C4b chips. -
FIG. 9D depicts SPR analysis with biotin-C4b immobilized to streptavidin-chip and consecutively human C2 and mAbs as eluate; black: running buffer; grey: anti-FXI; control human IgG4 mAb; turquoise: non-inhibitory anti-C2 clone anti-C2-63; red: ARGX-117; curves were normalized just before the addition of the mAbs. -
FIG. 10 depicts a schematic representation of domain swap mutants between C2 (SEQ ID NO: 21) and complement Factor B (FB) (SEQ ID NO: 50). In both proteins the small fragment (C2b in complement C2; SEQ ID NO: 44 or FBa in complement Factor B; SEQ ID NO: 51) consists of three Sushi (or complement control protein (CCP)) domains, whereas the large fragment is composed of a von Willebrand Factor type A (VWFA) domain and a peptidase S1 domain. Note that the sequences in between the individual domains were not taken along in these mutants but may also consist of epitopes. Additional sequences include C2a, SEQ ID NO: 43; C2b S1, SEQ ID NO: 45; C2b S2, SEQ ID NO: 46; C2b S3, SEQ ID NO: 47; C2 VWFA, SEQ ID NO: 48; C2 peptidase S1, SEQ ID NO: 49; FBb, SEQ ID NO: 52; FBa S1, SEQ ID NO: 53; FBa S2, SEQ ID NO: 54; FBa S3, SEQ ID NO: 55; FB VWFA, SEQ ID NO: 56; andFB peptidase 1, SEQ ID NO: 57. -
FIG. 11 depicts results obtained with an anti-FLAG ELISA performed on domain-swap mutants. Five-times diluted supernatants from transfected HEK293 cells were used for coating, and anti-FLAG mouse monoclonal Ab in combination with HRP-labeled anti-mouse IgG were used for detection. -
FIG. 12 depicts results obtained with a domain swap ELISA performed with anti-C2-Anti-C2-5F2.4 mAb (human IgG4 S241P VH4/VL3 LC-13/03-163A Bioceros) was used for coating, plates were incubated with 20 times diluted supernatant of HEK293 transfectants, and binding was detected by an anti-FLAG Ab. Representative results from two independent experiments with similar outcome. -
FIG. 13 depicts an amino acid sequence alignment of human and mouse Sushi 2 (S2) domain of C2b. Human S2, SEQ ID NO: 46; Mouse S2, SEQ ID NO: 58. Stars indicate sequence identity. -
FIG. 14 depicts results obtained with an anti-FLAG ELISA on fine mapping mutants. Undiluted supernatants from transfected HEK293 cells were used for coating, and biotin-labeled anti-FLAG mouse monoclonal Ab in combination with HRP-labeled SA conjugate were used for detection. -
FIG. 15 depicts results on fine mapping mutants. Anti-C2-5F2.4 mAb (human IgG4 S241P VH4/VL3 LC-13/03-163A Bioceros) was used for coating, plates were incubated with 20 times diluted supernatant of HEK293 transfectants, and binding was detected by an anti-FLAG Ab. -
FIG. 16 depicts a plan of cluster mapping mutants using three amino acid mutations for each cluster, locations for which indicated with bold font in the human sequence. Each human sequence was mutated to substitute the corresponding mouse amino acid for the human amino acid shown in bold. Human S2, SEQ ID NO: 46; Mouse S2, SEQ ID NO: 58. Stars indicate sequence identity. -
FIGS. 17A and 17B depict anti-FLAG ELISA on cluster mapping mutants.FIG. 17A depicts five-times diluted supernatants from transfected HEK293 cells were used for coating and anti-FLAG mouse monoclonal Ab in combination with HRP-labeled anti-mouse IgG as detection. GFP, green fluorescent protein. -
FIG. 17B depicts anti-C2-5F2.4 binding to cluster mutants. Anti-C2-5F2.4 mAb (human IgG4 S241P VH4/VL3, LC-13/03-163A, Bioceros) was used as coat, plates were incubated with 20-times diluted supernatant of HEK293 transfectants, and binding was detected by an anti-FLAG Ab. GFP, green fluorescent protein. - “Antibody” or “Immunoglobulin”—As used herein, the term “immunoglobulin” includes a polypeptide having a combination of two heavy and two light chains whether or not it possesses any relevant specific immunoreactivity. As used herein, the term “antibody” refers to such assemblies which have significant specific immunoreactive activity to an antigen of interest (e.g. the complex of complement proteins including C2). The term “C2 antibodies” is used herein to refer to antibodies which exhibit immunological specificity for the complex of complement proteins including C2, particularly the human C2 protein and the domains which are formed through cleavage of C2, and in some cases species homologues thereof. Antibodies and immunoglobulins comprise light and heavy chains, with or without an interchain covalent linkage between them. Basic immunoglobulin structures in vertebrate systems are relatively well understood.
- Five distinct classes of antibody (IgG, IgM, IgA, IgD, and IgE) can be distinguished biochemically. All five classes of antibodies are within the scope of the present invention. The following discussion will generally be directed to the IgG class of immunoglobulin molecules. With regard to IgG, immunoglobulins typically comprise two identical light polypeptide chains of molecular weight approximately 23,000 Daltons, and two identical heavy chains of molecular weight 53,000-70,000. The four chains are joined by disulfide bonds in a “Y” configuration wherein the light chains bracket the heavy chains starting at the mouth of the “Y” and continuing through the variable region.
- The light chains of an antibody are classified as either kappa (x) or lambda (λ). Each heavy chain class may be bound with either a kappa or lambda light chain. In general, the light and heavy chains are covalently bonded to each other, and the “tail” portions of the two heavy chains are bonded to each other by covalent disulfide linkages or non-covalent linkages when the immunoglobulins are generated either by hybridomas, B cells or genetically engineered host cells. In the heavy chain, the amino acid sequences run from an N-terminus at the forked ends of the Y configuration to the C-terminus at the bottom of each chain. Those skilled in the art will appreciate that heavy chains are classified as gamma, mu, alpha, delta, or epsilon, (γ, μ, α, δ, or ε) with some subclasses among them (e.g., γ1-γ4). It is the nature of this chain that determines the “class” of the antibody as IgG, IgM, IgA, IgD or IgE, respectively. The immunoglobulin subclasses (isotypes) e.g., IgG1, IgG2, IgG3, IgG4, IgA1, etc., are well characterized and are known to confer functional specialization. Modified versions of each of these classes and isotypes are readily discernible to the skilled artisan in view of the instant disclosure and, accordingly, are within the scope of the instant invention.
- As indicated above, the variable region of an antibody allows the antibody to selectively recognize and specifically bind epitopes on antigens. That is, the VL domain and VH domain of an antibody combine to form a variable region that defines a three-dimensional antigen-binding site. This quaternary antibody structure forms the antigen-binding site present at the end of each arm of the Y. More specifically, the antigen-binding site is defined by three complementary determining regions (CDRs) on each of the VH and VL chains.
- “Binding Molecule”—As used herein, the term “binding molecule” is a generic term intended to encompass the antibodies and antigen-binding fragments thereof in accordance with the present disclosure.
- “Binding Site”—As used herein, the term “binding site” comprises a region of a polypeptide which is responsible for selectively binding to a target antigen of interest.
- Binding domains comprise at least one binding site. Exemplary binding domains include an antibody variable domain. The antibody molecules of the invention may comprise a single binding site or multiple (e.g., two, three or four) binding sites.
- “Variable region” or “variable domain”—The term “variable” refers to the fact that certain portions of the variable domains VH and VL differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its target antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called “hypervariable loops” in each of the VL domain and the VH domain which form part of the antigen-binding site. The first, second and third hypervariable loops of the Vlambda light chain domain are referred to herein as L1(λ), L2(λ) and L3(λ) and may be defined as comprising residues 24-33 (L1(X), consisting of 9, 10 or 11 amino acid residues), 49-53 (L2(λ), consisting of 3 residues) and 90-96 (L3(λ), consisting of 5 residues) in the VL domain (Morea et al., Methods 20:267-279 (2000)). The first, second and third hypervariable loops of the Vkappa light chain domain are referred to herein as L1(κ), L2(κ) and L3(κ) and may be defined as comprising residues 25-33 (L1(κ), consisting of 6, 7, 8, 11, 12 or 13 residues), 49-53 (L2(κ), consisting of 3 residues) and 90-97 (L3(κ), consisting of 6 residues) in the VL domain (Morea et al., Methods 20:267-279 (2000)). The first, second and third hypervariable loops of the VH domain are referred to herein as H1, H2 and H3 and may be defined as comprising residues 25-33 (H1, consisting of 7, 8 or 9 residues), 52-56 (H2, consisting of 3 or 4 residues) and 91-105 (H3, highly variable in length) in the VH domain (Morea et al., Methods 20:267-279 (2000)).
- Unless otherwise indicated, the terms L1, L2 and L3 respectively refer to the first, second and third hypervariable loops of a VL domain, and encompass hypervariable loops obtained from both Vkappa and Vlambda isotypes. The terms H1, H2 and H3 respectively refer to the first, second and third hypervariable loops of the VH domain, and encompass hypervariable loops obtained from any of the known heavy chain isotypes, including γ, μ, α, δ or ε.
- The hypervariable loops L1, L2, L3, H1, H2 and H3 may each comprise part of a “complementarity determining region” or “CDR”, as defined below. The terms “hypervariable loop” and “complementarity determining region” are not strictly synonymous, since the hypervariable loops (HVs) are defined on the basis of structure, whereas complementarity determining regions (CDRs) are defined based on sequence variability (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, M D., 1983) and the limits of the HVs and the CDRs may be different in some VH and VL domains.
- The CDRs of the VL and VH domains can typically be defined as comprising the following amino acids: residues 24-34 (LCDR1), 50-56 (LCDR2) and 89-97 (LCDR3) in the light chain variable domain, and residues 31-35 or 31-35b (HCDR1), 50-65 (HCDR2) and 95-102 (HCDR3) in the heavy chain variable domain; (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)). Thus, the HVs may be comprised within the corresponding CDRs and references herein to the “hypervariable loops” of VH and VL domains should be interpreted as also encompassing the corresponding CDRs, and vice versa, unless otherwise indicated.
- The more highly conserved portions of variable domains are called the framework region (FR), as defined below. The variable domains of native heavy and light chains each comprise four FRs (FR1, FR2, FR3 and FR4, respectively), largely adopting a (3-sheet configuration, connected by the three hypervariable loops. The hypervariable loops in each chain are held together in close proximity by the FRs and, with the hypervariable loops from the other chain, contribute to the formation of the antigen-binding site of antibodies. Structural analysis of antibodies revealed the relationship between the sequence and the shape of the binding site formed by the complementarity determining regions (Chothia et al., J. Mol. Biol. 227: 799-817 (1992)); Tramontano et al., J. Mol. Biol, 215:175-182 (1990)). Despite their high sequence variability, five of the six loops adopt just a small repertoire of main-chain conformations, called “canonical structures”. These conformations are first of all determined by the length of the loops and secondly by the presence of key residues at certain positions in the loops and in the framework regions that determine the conformation through their packing, hydrogen bonding or the ability to assume unusual main-chain conformations.
- “Framework region”—The term “framework region” or “FR region” as used herein, includes the amino acid residues that are part of the variable region, but are not part of the CDRs (e.g., using the Kabat definition of CDRs). Therefore, a variable region framework is between about 100-120 amino acids in length but includes only those amino acids outside of the CDRs. For the specific example of a heavy chain variable domain and for the CDRs as defined by Kabat et al.,
framework region 1 corresponds to the domain of the variable region encompassing amino acids 1-30;framework region 2 corresponds to the domain of the variable region encompassing amino acids 36-49;framework region 3 corresponds to the domain of the variable region encompassing amino acids 66-94, andframework region 4 corresponds to the domain of the variable region from amino acids 103 to the end of the variable region. The framework regions for the light chain are similarly separated by each of the light chain variable region CDRs. Similarly, using the definition of CDRs by Chothia et al. or McCallum et al. the framework region boundaries are separated by the respective CDR termini as described above. In preferred embodiments the CDRs are as defined by Kabat. - In naturally occurring antibodies, the six CDRs present on each monomeric antibody are short, non-contiguous sequences of amino acids that are specifically positioned to form the antigen-binding site as the antibody assumes its three-dimensional configuration in an aqueous environment. The remainder of the heavy and light variable domains show less inter-molecular variability in amino acid sequence and are termed the framework regions. The framework regions largely adopt a n-sheet conformation and the CDRs form loops which connect, and in some cases form part of, the n-sheet structure. Thus, these framework regions act to form a scaffold that provides for positioning the six CDRs in correct orientation by inter-chain, non-covalent interactions. The antigen-binding site formed by the positioned CDRs defines a surface complementary to the epitope on the immunoreactive antigen. This complementary surface promotes the non-covalent binding of the antibody to the immunoreactive antigen epitope. The position of CDRs can be readily identified by one of ordinary skill in the art.
- “Non-glycosylated”—As used herein, the term “non-glycosylated” refers to a form of antibody or antigen-binding fragment thereof which lacks glycosylation at a potential glycosylation site in the antibody or antigen-binding fragment. In certain embodiments, the term “non-glycosylated” refers to a form of antibody or antigen-binding fragment thereof which lacks glycosylation at a potential N-linked glycosylation site in antibody or antigen-binding fragment. In certain embodiments, the term “non-glycosylated” refers to a form of antibody or antigen-binding fragment thereof which lacks glycosylation at a potential N-linked glycosylation site in the variable region of the heavy chain.
- “Constant region”—As used herein, the term “constant region” refers to the portion of the antibody molecule outside of the variable domains or variable regions. Immunoglobulin light chains have a single domain “constant region”, typically referred to as the “CL or CL1 domain”. This domain lies C-terminal to the VL domain. Immunoglobulin heavy chains differ in their constant region depending on the class of immunoglobulin (γ, μ, α, δ, ε). Heavy chains γ, α and δ have a constant region consisting of three immunoglobulin domains (referred to as CH1, CH2 and CH3) with a flexible hinge region separating the CH1 and CH2 domains. Heavy chains μ and ε have a constant region consisting of four domains (CH1-CH4). The constant domains of the heavy chain are positioned C-terminal to the VH domain.
- The numbering of the amino acids in the heavy and light immunoglobulin chains run from the N-terminus at the forked ends of the Y configuration to the C-terminus at the bottom of each chain. Different numbering schemes are used to define the constant domains of the immunoglobulin heavy and light chains. In accordance with the EU numbering scheme, the heavy chain constant domains of an IgG molecule are identified as follows: CH1—amino acid residues 118-215; CH2—amino acid residues 231-340; CH3—amino acid residues 341-446. The “hinge region” includes the portion of a heavy chain molecule that joins the CH1 domain to the CH2 domain. This hinge region comprises approximately residues and is flexible, thus allowing the two N-terminal antigen-binding regions to move independently. Hinge regions can be subdivided into three distinct domains: upper, middle, and lower hinge domains (Roux K. H. et al. J. Immunol. 161:4083-90 1998). Antibodies of the invention comprising a “fully human” hinge region may contain one of the hinge region sequences shown in Table 1 below.
-
TABLE 1 Human hinge sequences IgG Upper hinge Middle hinge Lower hinge IgG1 EPKSCDKTHT CPPCP APELLGGP (SEQ ID NO: 9) (SEQ ID NO: 10) (SEQ ID NO: 11) IgG2 ERK CCVECPPPCP APPVAGP (SEQ ID NO: 12) (SEQ ID NO: 13) (SEQ ID NO: 14) IgG3 ELKTPLGDTTHT CPRCP(EPKSCDTPPPCPRCP)3 APELLGGP (SEQ ID NO: 15) (SEQ ID NO: 16) (SEQ ID NO: 17) IgG4 ESKYGPP CPSCP APEFLGGP (SEQ ID NO: 18) (SEQ ID NO: 19) (SEQ ID NO: 20) - “Fragment”—The term “fragment”, as used in the context of antibodies of the invention, refers to a part or portion of an antibody or antibody chain comprising fewer amino acid residues than an intact or complete antibody or antibody chain. The term “antigen-binding fragment” refers to a polypeptide fragment of an immunoglobulin or antibody that specifically binds antigen or competes with intact antibody (i.e., with the intact antibody from which they were derived) for antigen-specific binding (e.g., specific binding to the C2 protein or to a portion thereof). As used herein, the term “fragment” of an antibody molecule includes antigen-binding fragments of antibodies, for example, an antibody light chain variable domain (VL), an antibody heavy chain variable domain (VH), a single chain antibody (scFv), a F(ab′)2 fragment, a Fab fragment, an Fd fragment, an Fv fragment, a one-armed (monovalent) antibody, diabodies, triabodies, tetrabodies or any antigen-binding molecule formed by combination, assembly or conjugation of such antigen-binding fragments. The term “antigen-binding fragment” as used herein is further intended to encompass antibody fragments selected from the group consisting of unibodies, domain antibodies and nanobodies. Fragments can be obtained, e.g., via chemical or enzymatic treatment of an intact or complete antibody or antibody chain, or by recombinant means.
- Complement Component C2
- The second component of human complement (C2) is a 90-100 kDa glycoprotein which participates in the classical and lectin pathways of complement activation. C2 can be activated by C1s of the classical pathway or by activated MASP2 of the lectin pathway. C2 binds to surface-bound C4b (in the presence of
Mg 2+) to form a C4bC2 complex, which then is cleaved by activated C1s or MASP2 into two fragments: a larger 70 kDa fragment, traditionally designated C2a, which remains attached to C4b to form a C3-convertase C4bC2a, and a smaller 30 kDa N-terminal fragment, traditionally designated C2b, which is released into the fluid phase. Some authors have recently reversed designations of C2a and C2b, such that C2b refers to the bigger 70 kDa fragment, and C2a refers to the smaller 30 kDa fragment. As used herein, C2a shall refer to the bigger 70 kDa fragment, and C2b shall refer to the smaller 30 kDa fragment. Once activated and bound to C4b, C2a constitutes the catalytic subunit of the C3 and C5 convertases which are able to cleave C3 and C5, respectively. - The amino acid sequence of human C2 is known (GenBank Accession No. NM_000063) and shown as SEQ ID NO: 21.
-
Amino Acid Sequence of human C2 (SEQ ID NO: 21): MGPLMVLFCLLFLYPGLADSAPSCPQNVNISGGTFTLSHGWAPGSLLTY SCPQGLYPSPASRLCKSSGQWQTPGATRSLSKAVCKPVRCPAPVSFENG IYTPRLGSYPVGGNVSFECEDGFILRGSPVRQCRPNGMWDGETAVCDNG AGHCPNPGISLGAVRTGFREGHGDKVRYRCSSNLVLTGSSERECQGNGV WSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKI QIQRSGHLNLYLLLDCSQSVSENDELIFKESASLMVDRIFSFEINVSVA IITFASEPKVLMSVLNDNSRDMTEVISSLENANYKDHENGTGTNTYAAL NSVYLMMNNQMRLLGMETMAWQEIRHAIILLTDGKSNMGGSPKTAVDHI REILNINQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQD TKALHQVFEHMLDVSKLTDTICGVGNMSANASDQERTPWHVTIKPKSQE TCRGALISDQWVLTAAHCFRDGNDHSLWRVNVGDPKSQWGKEFLIEKAV ISPGEDVFAKKNQGILEFYGDDIALLKLAQKVKMSTHARPICLPCTMEA NLALRRPQGSTCRDHENELLNKQSVPAHFVALNGSKLNINLKMGVEWTS CAEVVSQEKTMFPNLTDVREVVTDQFLCSGTQEDESPCKGESGGAVFLE RRFRFFQVGLVSWGLYNPCLGSADKNSRKRAPRSKVPPPRDFHINLFRM QPWLRQHLGDVLNFLPL - As with many other plasma proteins, C2 has a modular structure. Starting from its N-terminus, C2 consists of three complement control protein modules (CCP1-3, also known as short consensus repeats (SCR) or sushi-domain repeats), a von Willebrand factor type A (vWFA) domain containing a metal-ion-dependent adhesion site, and a serine protease (SP) domain (Arlaud et al., Adv Immunol 1998, 69: 249). Electron microscopy studies have revealed that C2 consists of three domains. The three CCP modules (CCP1-3) together form the N-terminal domain, which corresponds to C2b. The vWFA domain constitutes the second domain, and the SP domain makes up the third domain. The second and third domains together constitute the larger C2a portion of the molecule.
- CCP modules are common structural motifs that occur in a number of proteins.
- These globular units consist of approximately 60 amino acid residues and are folded into a compact six- to eight-stranded P-sheet structure built around four invariant disulfide-bonded cysteine residues (Norman et al., J Mol Biol 1991, 219: 717). Neighboring CCP modules are covalently attached by poorly conserved linkers.
- The initial binding of C2 to surface-bound C4b is mediated by two low-affinity sites, one on C2b (Xu & Volanakis, J Immunol 1997, 158: 5958) and the other on the vWFA domain of C2a (Horiuchi et al., J Immunol 1991, 47: 584). Though the crystal structure of C2b and C2a have been determined to 1.8 A resolution (Milder et al., Structure 2006, 14: 1587; Krishnan et al., J Mol Biol 2007, 367: 224; Krishnan et al., Acta Cristallogr D Biol Crystallogr 2009, D65: 266), the exact topology and structure of the amino acid residues constituting the contact site(s) for C4 and C3 on C2 are unknown. Thus the amino acid residues of C2 involved in the interaction with C4 remain to be established (Krishnan et al., Acta Cristallogr D Biol. Crystallogr 2009, D65: 266).
- An aspect of the invention is a monoclonal antibody or antigen-binding fragment thereof that specifically binds to human complement factor C2, wherein said monoclonal antibody or fragment thereof comprises:
- a VH domain comprising the amino acid sequence set forth in SEQ ID NO: 1; and
- a VL domain comprising the amino acid sequence set forth in SEQ ID NO: 2;
- wherein amino acid residues 72-74 (Kabat numbering) of the VH domain consist of X1X2X3, respectively, wherein X2 is any amino acid, and X1X2X3 is not NX2S or NX2T.
- The VH domain comprises complementarity determining regions (CDRs) HCDR1, HCDR2, and HCDR3. The VL domain comprises CDRs LCDR1, LCDR2, and LCDR3. The amino acid sequences of HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 are shown in Table 2.
-
TABLE 2 CDRs HCDR1 DYNMD (SEQ ID NO: 22) HCDR2 DINPNYESTGYNQKFKG (SEQ ID NO: 23) HCDR3 EDDHDAFAY (SEQ ID NO: 24) LCDR1 RASKSVRTSGYNYMH (SEQ ID NO: 25) LCDR2 LASNLKS (SEQ ID NO: 26) LCDR3 QHSRELPYT (SEQ ID NO: 27) - In certain embodiments, the monoclonal antibody or antigen-binding fragment thereof specifically binds to human complement factor C2b. In certain embodiments, the monoclonal antibody or antigen-binding fragment thereof specifically binds to an epitope in a portion of human complement factor C2 corresponding to human complement factor C2b.
- In certain embodiments, the variable domain of the heavy chain is non-glycosylated. In certain embodiments the amino acid sequence of the variable domain of the heavy chain does not include a potential glycosylation site which is characterized by the sequence N-X-S/T, where N represents asparagine, X represents any amino acid, and S/T represents serine or threonine. Accordingly, in certain embodiments, antibodies with a VH domain comprising the sequence N-X-S/T can be modified so that these residues consist of X1X2X3, respectively, wherein X2 is any amino acid, and X1X2X3 is not NX2S or NX2T. That is, X1 can be any amino acid other than N, and/or X3 can be any amino acid other than S or T. In certain embodiments, antibodies with a VH domain comprising the sequence N—X—S or N-X-T can be modified so that these three residues consist of D-X-S, respectively. In certain other embodiments, antibodies with a VH domain comprising the sequence N—X—S or N-X-T can be modified so that these three residues consist of D-X-T, respectively. In certain embodiments, heavy chain amino acids at residues 72-74 (Kabat numbering) consist of X1X2X3, respectively, wherein X2 is any amino acid, and X1X2X3 is not NX2S or NX2T.
- In certain embodiments, heavy chain amino acids at residues 72-74 (Kabat numbering) consist of DX2S.
- In certain embodiments, heavy chain amino acids at residues 72-74 (Kabat numbering) consist of DKS.
- In certain embodiments, the VH domain comprises the amino acid sequence set forth in SEQ ID NO: 3.
- In certain embodiments, the amino acid sequence of the VH domain consists of the sequence set forth in SEQ ID NO: 3.
- In certain embodiments, the VL domain comprises the amino acid sequence set forth in SEQ ID NO: 2.
- In certain embodiments, the amino acid sequence of the VL domain consists of the sequence set forth in SEQ ID NO: 2.
- In certain embodiments, the VH domain comprises the amino acid sequence set forth in SEQ ID NO: 3, and the VL domain comprises the amino acid sequence set forth in SEQ ID NO: 2.
- In certain embodiments, the amino acid sequence of the VH domain consists of the sequence set forth in SEQ ID NO: 3, and the amino acid sequence of the VL domain consists of the sequence set forth in SEQ ID NO: 2.
- The amino acid sequences of SEQ ID NO: 3 and SEQ ID NO: 2 are shown in Table 3. SEQ ID NO: 2 corresponds to the VL (VK3) domain of humanized 5F2.4 (BRO2) disclosed in U.S. Pat. No. 9,944,717 to Broteio Pharma B.V. Also shown in Table 3, SEQ ID NO: 28 corresponds to the VH (VH4) domain of humanized 5F2.4 (BRO2) disclosed in U.S. Pat. No. 9,944,717 which is incorporated by reference herein.
-
TABLE 3 VH and VL Domains SEQ ID ID Sequence NO: 5F2.4 EVQLVQSGAEVKKPGASVKVSCKASGYTFTDYNMDWVRQATGQGLEWIGD 28 VH4 INPNYESTGYNQKFKGRATMTVNKSISTAYMELSSLRSEDTAVYYCARED DHDAFAYWGQGTLVTVSS VH4.2 EVQLVQSGAEVKKPGASVKVSCKASGYTFTDYNMDWVRQATGQGLEWIGD 1 generic INPNYESTGYNQKFKGRATMTVX1X2X3ISTAYMELSSLRSEDTAVYYCAR EDDHDAFAYWGQGTLVTVSS VH4.2 EVQLVQSGAEVKKPGASVKVSCKASGYTFTDYNMDWVRQATGQGLEWIGD 3 ARGX-117 INPNYESTGYNQKFKGRATMTVDKSISTAYMELSSLRSEDTAVYYCARED DHDAFAYWGQGTLVTVSS 5F2.4 DNVLTQSPDSLAVSLGERATISCRASKSVRTSGYNYMHWYQQKPGQPPKL 2 VK3 LIYLASNLKSGVPDRESGSGSGTDFTLTISSLQAEDAATYYCQHSRELPY TFGQGTKLEIK - In certain embodiments, the monoclonal antibodies of the invention include the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human antibody, in particular human IgG1, IgG2, IgG3 or IgG4.
- In certain embodiments, the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG1 and includes the substitutions L234A and L235A in the CH2 domain.
- In certain embodiments, the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG1 and includes the substitutions H433K and N434F in the CH3 domain.
- In certain embodiments, the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG1 and includes the substitutions L234A and L235A in the CH2 domain, and the substitutions H433K and N434F in the CH3 domain.
- In certain embodiments, the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG4. In certain embodiments, the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG4 and includes the substitution S228P in the hinge domain.
- In certain embodiments, the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG4 and includes the substitution L445P in the CH3 domain.
- In certain embodiments, the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG4 and includes both the substitution S228P in the hinge domain and the substitution L445P in the CH3 domain.
- In certain embodiments, the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG4 and includes the substitutions H433K and N434F in the CH3 domain.
- In certain embodiments, the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG4 and includes the substitution S228P in the hinge domain, and the substitutions H433K and N434F in the CH3 domain.
- In certain embodiments, the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG4 and includes the substitutions H433K, N434F, and L445P in the CH3 domain.
- In certain embodiments, the antibody includes the CH1 domain, hinge domain, CH2 domain, and CH3 domain of a human IgG4 and includes the substitution S228P in the hinge domain, and the substitutions H433K, N434F, and L445P in the CH3 domain.
- In certain embodiments, the monoclonal antibody comprises a human IgG heavy chain constant domain. In certain embodiments, the heavy chain constant domain comprises a human IgG1 heavy chain constant domain. In certain embodiments, the heavy chain constant domain consists of a human IgG1 heavy chain constant domain.
- In certain embodiments, the heavy chain constant domain comprises a human IgG1 heavy chain constant domain comprising the amino acid sequence set forth as SEQ ID NO: 29. In certain embodiments, the amino acid sequence of the heavy chain constant domain consists of the sequence set forth as SEQ ID NO: 29.
- In certain embodiments, the heavy chain constant domain comprises a human IgG1 heavy chain constant domain comprising the amino acid sequence set forth as SEQ ID NO: 4. In certain embodiments, the amino acid sequence of the heavy chain constant domain consists of the sequence set forth as SEQ ID NO: 4.
- In certain embodiments, the heavy chain constant domain comprises a human IgG4 heavy chain constant domain. In certain embodiments, the heavy chain constant domain consists of a human IgG4 heavy chain constant domain.
- In certain embodiments, the heavy chain constant domain comprises a human IgG4 heavy chain constant domain comprising the amino acid sequence set forth as SEQ ID NO: 30. In certain embodiments, the amino acid sequence of the heavy chain constant domain consists of the sequence set forth as SEQ ID NO: 30.
- In certain embodiments, the heavy chain constant domain comprises a human IgG4 heavy chain constant domain comprising the amino acid sequence set forth as SEQ ID NO: 31. In certain embodiments, the amino acid sequence of the heavy chain constant domain consists of the sequence set forth as SEQ ID NO: 31.
- In certain embodiments, the heavy chain constant domain comprises a human IgG4 heavy chain constant domain comprising the amino acid sequence set forth as SEQ ID NO: 5. In certain embodiments, the amino acid sequence of the heavy chain constant domain consists of the sequence set forth as SEQ ID NO: 5.
- The amino acid sequences of SEQ ID NOs: 4, 5, and 29-31 are shown in Table 4.
-
TABLE 4 Heavy Chain Constant Domains SEQ ID ID Sequence NO: Human ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV 29 IgG1 HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP (UniProt) KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK Human ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV 4 IgG1 HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP LALA KSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS NHance HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK (ARGX- EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTC 117) LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALKFHYTQKSLSLSPG Human ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGV 30 IgG4 HTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES (UniProt) KYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQED PEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEG NVFSCSVMHEALHNHYTQKSLSLSLGK Human ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGV 31 IgG4 HTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES S228P KYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQED L445P PEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEG NVFSCSVMHEALHNHYTQKSLSLSPGK Human ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGV 5 IgG4 HTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES S228P KYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQED NHance PEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYK L445P CKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEG NVFSCSVMHEALKFHYTQKSLSLSPGK - In certain embodiments, the monoclonal antibody or antigen-binding fragment thereof comprises a full-length monoclonal antibody.
- In certain embodiments, the monoclonal antibody or antigen-binding fragment thereof consists of a full-length monoclonal antibody.
- In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 32. In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 32. In certain embodiments, provided herein are monoclonal antibodies comprising a light chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 7. In certain embodiments, provided herein are monoclonal antibodies comprising a light chain with at 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 7. In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 32, and a light chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 7. In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 32, and a light chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 7.
- In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 6. In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 6. In certain embodiments, provided herein are monoclonal antibodies comprising a light chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 7. In certain embodiments, provided herein are monoclonal antibodies comprising a light chain with at 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 7. In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 6, and a light chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 7. In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 6, and a light chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 7.
- In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 33. In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 33. In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 33, and a light chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 7. In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 33, and a light chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 7.
- In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 34. In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 34. In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 34, and a light chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 7. In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 34, and a light chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 7.
- In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 8. In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 8. In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 8, and a light chain with at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence shown as SEQ ID NO: 7. In certain embodiments, provided herein are monoclonal antibodies comprising a heavy chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 8, and a light chain with 100% sequence identity to the amino acid sequence shown as SEQ ID NO: 7.
- The amino acid sequences of SEQ ID NOs: 6-8 and 32-34 are shown in Table 5.
-
TABLE 5 Heavy Chains and Light Chains SEQ ID ID Sequence NO: Human EVQLVQSGAEVKKPGASVKVSCKASGYTFTDYNMDWVRQATGQGLEWIGD 32 IgG1 INPNYESTGYNQKFKGRATMTVDKSISTAYMELSSLRSEDTAVYYCARED (UniProt) DHDAFAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI CNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Human EVQLVQSGAEVKKPGASVKVSCKASGYTFTDYNMDWVRQATGQGLEWIGD 6 IgG1 INPNYESTGYNQKFKGRATMTVDKSISTAYMELSSLRSEDTAVYYCARED LALA DHDAFAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY NHance FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI (ARGX- CNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKD 117) TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALKFHYTQKSLSLSPG Human EVQLVQSGAEVKKPGASVKVSCKASGYTFTDYNMDWVRQATGQGLEWIGD 33 IgG4 INPNYESTGYNQKFKGRATMTVDKSISTAYMELSSLRSEDTAVYYCARED (UniProt) DHDAFAYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDY FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYT CNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLP PSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK Human EVQLVQSGAEVKKPGASVKVSCKASGYTFTDYNMDWVRQATGQGLEWIGD 34 IgG4 INPNYESTGYNQKFKGRATMTVDKSISTAYMELSSLRSEDTAVYYCARED S228P DHDAFAYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDY L445P FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYT CNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLP PSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSPGK Human EVQLVQSGAEVKKPGASVKVSCKASGYTFTDYNMDWVRQATGQGLEWIGD 8 IgG4 INPNYESTGYNQKFKGRATMTVDKSISTAYMELSSLRSEDTAVYYCARED S228P DHDAFAYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDY NHance FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYT L445P CNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLP PSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSRLTVDKSRWQEGNVFSCSVMHEALKFHYTQKSLSLSPGK Light DNVLTQSPDSLAVSLGERATISCRASKSVRTSGYNYMHWYQQKPGQPPKL 7 Chain LIYLASNLKSGVPDRFSGSGSGTDFTLTISSLQAEDAATYYCQHSRELPY (ARGX- TFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV 117) QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV THQGLSSPVTKSENRGEC - For embodiments wherein the heavy and/or light chains of the antibodies are defined by a particular percentage sequence identity to a reference sequence, the heavy chain and/or light chain may retain identical CDR sequences to those present in the reference sequence such that the variation is present only outside the CDR regions.
- Unless otherwise stated in the present application, % sequence identity between two amino acid sequences may be determined by comparing these two sequences aligned in an optimum manner and in which the amino acid sequence to be compared can comprise additions or deletions with respect to the reference sequence for an optimum alignment between these two sequences. The percentage of identity is calculated by determining the number of identical positions for which the amino acid residue is identical between the two sequences, by dividing this number of identical positions by the total number of positions in the comparison window and by multiplying the result obtained by 100 in order to obtain the percentage of identity between these two sequences. For example, it is possible to use the BLAST program, “
BLAST 2 sequences” (Tatusova et al, “Blast 2 sequences—a new tool for comparing protein and nucleotide sequences”, FEMS Microbiol Lett. 174:247-250), the parameters used being those given by default (in particular for the parameters “open gap penalty”: 5, and “extension gap penalty”: 2; the matrix chosen being, for example, the matrix “BLOSUM 62” proposed by the program), the percentage of identity between the two sequences to be compared being calculated directly by the program. - In non-limiting embodiments, the antibodies of the present invention may comprise CH1 domains and/or CL domains (from the heavy chain and light chain, respectively), the amino acid sequence of which is fully or substantially human. Where the antibody or antigen-binding fragment of the invention is an antibody intended for human therapeutic use, it is typical for the entire constant region of the antibody, or at least a part thereof, to have fully or substantially human amino acid sequence. Therefore, one or more or any combination of the CL domain, CH1 domain, hinge region, CH2 domain, CH3 domain and CH4 domain (if present) may be fully or substantially human with respect to its amino acid sequence.
- Advantageously, the CL domain, CH1 domain, hinge region, CH2 domain, CH3 domain and CH4 domain (if present) may all have fully or substantially human amino acid sequence. In the context of the constant region of a humanized or chimeric antibody, or an antibody fragment, the term “substantially human” refers to an amino acid sequence identity of at least 90%, or at least 92%, or at least 95%, or at least 97%, or at least 99% with a human constant region. The term “human amino acid sequence” in this context refers to an amino acid sequence which is encoded by a human immunoglobulin gene, which includes germline, rearranged and somatically mutated genes. The invention also contemplates polypeptides comprising constant domains of “human” sequence which have been altered, by one or more amino acid additions, deletions or substitutions with respect to the human sequence, excepting those embodiments where the presence of a “fully human” hinge region is expressly required.
- The presence of a “fully human” hinge region in the C2-binding antibodies of the invention may be beneficial both to minimize immunogenicity and to optimize stability of the antibody.
- The C2 binding antibodies may be modified within the Fc region to increase binding affinity for the neonatal Fc receptor FcRn. The increased binding affinity may be measurable at acidic pH (for example from about approximately pH 5.5 to approximately pH 6.0). The increased binding affinity may also be measurable at neutral pH (for example from approximately pH 6.9 to approximately pH 7.4). In this embodiment, by “increased binding affinity” is meant increased binding affinity to FcRn relative to binding affinity of unmodified Fc region. Typically the unmodified Fc region will possess the wild-type amino acid sequence of human IgG1, IgG2, IgG3 or IgG4. In such embodiments, the increased binding affinity to FcRn of the antibody molecule having the modified Fc region will be measured relative to the binding affinity of wild-type IgG1, IgG2, IgG3 or IgG4 for FcRn.
- The C2 binding antibodies may be modified within the Fc region to increase binding affinity for the human neonatal Fc receptor FcRn. The increased binding affinity may be measurable at acidic pH (for example from about approximately pH 5.5 to approximately pH 6.0). The increased binding affinity may also be measurable at neutral pH (for example from approximately pH 6.9 to approximately pH 7.4). In this embodiment, by “increased binding affinity” is meant increased binding affinity to human FcRn relative to binding affinity of unmodified Fc region. Typically the unmodified Fc region will possess the wild-type amino acid sequence of human IgG1, IgG2, IgG3 or IgG4. In such embodiments, the increased binding affinity to human FcRn of the antibody molecule having the modified Fc region will be measured relative to the binding affinity of wild-type IgG1, IgG2, IgG3 or IgG4 for human FcRn.
- An aspect of the invention is a pharmaceutical composition comprising a monoclonal antibody or antigen-binding fragment thereof that specifically binds to human complement factor C2, and a pharmaceutically acceptable carrier, wherein said monoclonal antibody or fragment thereof comprises:
-
- a VH domain comprising the amino acid sequence set forth in SEQ ID NO: 1; and
- a VL domain comprising the amino acid sequence set forth in SEQ ID NO: 2;
- wherein amino acid residues 72-74 (Kabat numbering) of the VH domain consist of X1X2X3, respectively, wherein X2 is any amino acid, and X1X2X3 is not NX2S or NX2T.
- A pharmaceutical composition of the invention may be formulated with pharmaceutically acceptable carriers or diluents as well as any other known adjuvants and excipients in accordance with conventional techniques such as those disclosed in (Remington: The Science and Practice of Pharmacy, 19th Edition, Gennaro, Ed., Mack Publishing Co., Easton, Pa., 1995).
- The term “pharmaceutically acceptable carrier” relates to carriers or excipients, which are inherently non-toxic. Examples of such excipients are, but are not limited to, saline, Ringer's solution, dextrose solution and Hanks' solution. Non-aqueous excipients such as fixed oils and ethyl oleate may also be used.
- Pharmaceutical compositions typically must be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, micro-emulsion, liposome, or other ordered structure suitable to high drug concentration. Examples of suitable aqueous and non-aqueous carriers which may be employed in the pharmaceutical compositions of the invention include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate. Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- The pharmaceutical compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol, sorbic acid, and the like. It may also be desirable to include isotonicity agents, such as sugars, polyalcohols such as mannitol, sorbitol, glycerol or sodium chloride in the compositions. Pharmaceutically-acceptable antioxidants may also be included, for example (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
- Sterile injectable solutions can be prepared by incorporating the monoclonal antibody in the required amount in an appropriate solvent with one or a combination of ingredients, e.g., as enumerated above, as required, followed by sterilization microfiltration. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients, e.g., from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- The pharmaceutical composition is preferably administered parenterally, preferably by intravenous (i.v.) or subcutaneous (s.c.) injection or infusion.
- The phrases “parenteral administration” and “administered parenterally” as used herein mean modes of administration other than enteral and topical administration, usually by injection, and include, without limitation, intravenous, intraperitoneal, subcutaneous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, transtracheal, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion.
- Prolonged absorption of the injectable anti-C2 mAbs or fragments thereof can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
- The mAbs or fragments thereof can be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for the preparation of such formulations are generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
- The pharmaceutical compositions can be administered with medical devices known in the art.
- Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time, or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation.
- Actual dosage levels of the mAbs or fragments thereof in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient without being toxic to the patient.
- In one embodiment, the binding molecules, in particular antibodies, according to the invention can be administered by infusion in a weekly dosage of from 10 to 500 mg/m2, such as of from 200 to 400 mg/m2. Such administration can be repeated, e.g., 1 to 8 times, such as 3 to 5 times. The administration may be performed by continuous infusion over a period of from 1 to 24 hours, such as a period of from 2 to 12 hours. In some embodiments, administration may be performed by one or more bolus injections.
- In one embodiment, the binding molecules, in particular antibodies, according to the invention can be administered by infusion in a weekly dosage of from 1 to 50 mg per kg body weight (mg/kg), such as from 5 to 25 mg/kg. Such administration can be repeated, e.g., 1 to 8 times, such as 3 to 5 times. The administration may be performed by continuous infusion over a period of from 1 to 24 hours, such as a period of from 2 to 12 hours. In some embodiments, administration may be performed by one or more bolus injections.
- In yet another embodiment, the mAbs or fragments thereof or any other binding molecules disclosed in this invention, can be administered as maintenance therapy, such as, e.g., once a week for a period of 6 months or more.
- An aspect of the invention is a nucleic acid molecule or plurality of nucleic acid molecules encoding the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention. In certain embodiments, a single nucleic acid molecule encodes both the VH and the VL domains of the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention. In certain embodiments, a single nucleic acid molecule encodes both the heavy chain (HC) and the light chain (LC) of the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention. In certain embodiments, a first nucleic acid molecule encodes the VH domain, and a second nucleic acid molecule encodes the VL domain of the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention. In certain embodiments, a first nucleic acid molecule encodes the heavy chain (HC), and a second nucleic acid molecule encodes the light chain (LC) of the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention.
- In certain embodiments, a nucleic acid molecule encoding the VH domain comprises the nucleic acid sequence set forth as SEQ ID NO: 35.
- In certain embodiments, a nucleic acid molecule encoding the VL domain comprises the nucleic acid sequence set forth as SEQ ID NO: 36.
- In certain embodiments, a nucleic acid molecule encoding the HC comprises the nucleic acid sequence set forth as SEQ ID NO: 37.
- In certain embodiments, a nucleic acid molecule encoding the HC comprises the nucleic acid sequence set forth as SEQ ID NO: 38.
- In certain embodiments, a nucleic acid molecule encoding the HC comprises the nucleic acid sequence set forth as SEQ ID NO: 39.
- In certain embodiments, a nucleic acid molecule encoding the HC comprises the nucleic acid sequence set forth as SEQ ID NO: 40.
- In certain embodiments, a nucleic acid molecule encoding the HC comprises the nucleic acid sequence set forth as SEQ ID NO: 41.
- In certain embodiments, a nucleic acid molecule encoding the LC domain comprises the nucleic acid sequence set forth as SEQ ID NO: 42.
- In certain embodiments, the nucleic acid sequence of a nucleic acid molecule encoding the VH domain consists of the sequence set forth as SEQ ID NO: 35.
- In certain embodiments, the nucleic acid sequence of a nucleic acid molecule encoding the VL domain consists of the sequence set forth as SEQ ID NO: 36.
- In certain embodiments, the nucleic acid sequence of a nucleic acid molecule encoding the HC consists of the sequence set forth as SEQ ID NO: 37.
- In certain embodiments, the nucleic acid sequence of a nucleic acid molecule encoding the HC consists of the sequence set forth as SEQ ID NO: 38.
- In certain embodiments, the nucleic acid sequence of a nucleic acid molecule encoding the HC consists of the sequence set forth as SEQ ID NO: 39.
- In certain embodiments, the nucleic acid sequence of a nucleic acid molecule encoding the HC consists of the sequence set forth as SEQ ID NO: 40.
- In certain embodiments, the nucleic acid sequence of a nucleic acid molecule encoding the HC consists of the sequence set forth as SEQ ID NO: 41.
- In certain embodiments, the nucleic acid sequence of a nucleic acid molecule encoding the LC domain consists of the sequence set forth as SEQ ID NO: 42.
- The nucleic acid sequences corresponding to SEQ ID NOs: 35-42 are shown in Table 6.
-
TABLE 6 Nucleic Acid Sequences of VH, VL, HC, and LC SEQ ID ID Sequence NO: BRO2- gaagtgcagctggtgcagtctggcgccgaagtgaagaaacctggcgcctc 35 IgG4 cgtgaaggtgtcctgcaaggcttccggctacacctttaccgactacaaca VH4.2 tggactgggtgcgacaggctaccggccagggcctggaatggatcggcgac atcaaccccaactacgagtccaccggctacaaccagaagttcaagggcag agccaccatgaccgtggacaagtccatctccaccgcctacatggaactgt cctccctgcggagcgaggacaccgccgtgtactactgcgccagagaggac gaccacgacgcctttgcttattggggccagggcaccctcgtgaccgtgtc ctct BRO2 VL gacaacgtgctgacccagtcccctgactccctggctgtgtctctgggcga 36 gagagccaccatctcttgccgggcctctaagtccgtgcggacctccggct acaactacatgcactggtatcagcagaagcccggccagccccccaagctg ctgatctacctggcctccaacctgaagtccggcgtgcccgacagattctc cggctctggctctggcaccgactttaccctgaccatcagctccctgcagg ccgaggatgccgccacctactactgccagcactccagagagctgccctac acctttggccagggcaccaagctggaaatcaag BRO2- gaagttcagctggttcagtctggcgccgaagtgaagaaacctggcgcctc 37 hIgG1 HC tgtgaaggtgtcctgcaaggcttctggctacacctttaccgactacaaca tggactgggtccgacaggctaccggacagggacttgagtggatcggcgac atcaaccccaactacgagtccaccggctacaaccagaagttcaagggcag agccaccatgaccgtggacaagtccatctccaccgcctacatggaactgt ccagcctgagatctgaggacaccgccgtgtactactgcgccagagaggat gatcacgacgcctttgcttattggggccagggcacactggtcaccgtgtc ctctgccagtacaaaaggtccaagtgtgttccctcttgctccctcatcca agagtaccagtggaggcaccgccgctcttggctgcttggttaaggattat ttcccagagcctgtcactgtttcatggaactccggcgccttgacatctgg tgtgcatacctttccagccgtgctgcagtcaagtggcctctacagcctca gtagcgtggtcactgtgcccagcagctctctcggcacacaaacttatatc tgtaatgtgaatcataagccttcaaataccaaggtggataagaaagtgga accaaaatcatgtgacaagacacacacctgccctccttgtccagcccccg aactgctgggtgggcccagcgtgttcctgtttcctcctaaacccaaagac actctgatgattagtaggaccccagaagtcacttgcgtggtggttgacgt gtcacatgaagatcccgaggtcaagttcaattggtatgttgacggggtcg aagttcacaacgctaaaactaaaccaagagaggaacagtataactctacc taccgggtggtgagtgttctgactgtcctccatcaagactggctgaatgg caaagaatacaagtgtaaggtgagcaacaaagccctgcccgctcctatag agaaaacaatatccaaagccaaaggtcaacctcgcgagccacaggtgtac accctcccaccaagccgcgatgaacttactaagaaccaagtctctcttac ttgcctggttaaggggttctatccatccgacattgcagtcgagtgggagt ctaatggacagcctgagaacaactacaaaaccacccctcctgttctggat tctgacggatctttcttcctttattctaaactcaccgtggataaaagcag gtggcagcagggcaacgtgttcagctgttccgttatgcatgaggccctgc ataaccattatacccagaagtctttgtccctcagtccaggaaag BRO2- gaagttcagctggttcagtctggcgccgaagtgaagaaacctggcgcctc 38 hIgG1- tgtgaaggtgtcctgcaaggcttctggctacacctttaccgactacaaca LALA-NH tggactgggtccgacaggctaccggacagggacttgagtggatcggcgac HC atcaaccccaactacgagtccaccggctacaaccagaagttcaagggcag agccaccatgaccgtggacaagtccatctccaccgcctacatggaactgt ccagcctgagatctgaggacaccgccgtgtactactgcgccagagaggat gatcacgacgcctttgcttattggggccagggcacactggtcaccgtgtc ctctgcttctaccaagggacccagcgtgttccctctggctccttccagca agtctacctctggcggaacagctgctctgggctgcctggtcaaggactac tttcctgagcctgtgaccgtgtcttggaactctggcgctctgacatctgg cgtgcacacctttccagctgtgctgcagtcctccggcctgtactctctgt cctctgtcgtgaccgtgccttccagctctctgggaacccagacctacatc tgcaatgtgaaccacaagccttccaacaccaaggtggacaagaaggtgga acccaagtcctgcgacaagacccacacctgtcctccatgtcctgctccag aagctgctggcggcccttccgtgtttctgttccctccaaagcctaaggac accctgatgatctctcggacccctgaagtgacctgcgtggtggtggatgt gtctcacgaggacccagaagtgaagttcaattggtacgtggacggcgtgg aagtgcacaacgccaagaccaagcctagagaggaacagtacaactccacc tacagagtggtgtccgtgctgaccgtgctgcaccaggattggctgaacgg caaagagtacaagtgcaaggtgtccaacaaggccctgcctgctcctatcg aaaagaccatctccaaggccaagggccagcctagggaaccccaggtttac accttgcctccatctcgggacgagctgaccaagaaccaggtgtccctgac ctgtctcgtgaagggcttctacccctccgatatcgccgtggaatgggagt ctaatggccagccagagaacaactacaagacaacccctcctgtgctggac tccgacggctcattctttctgtactccaagctgacagtggataagtcccg gtggcagcagggcaacgtgttctcctgttctgtgatgcacgaggccctga agttccactacacacagaagtctctgtctctgagccccggc BRO2- gaagtgcagctggtgcagtctggcgccgaagtgaagaaacctggcgcctc 39 hIgG4 HC cgtgaaggtgtcctgcaaggcttccggctacacctttaccgactacaaca tggactgggtgcgacaggctaccggccagggcctggaatggatcggcgac atcaaccccaactacgagtccaccggctacaaccagaagttcaagggcag agccaccatgaccgtggacaagtccatctccaccgcctacatggaactgt cctccctgcggagcgaggacaccgccgtgtactactgcgccagagaggac gaccacgacgcctttgcttattggggccagggcaccctcgtgaccgtgtc ctctgcttctaccaagggcccctccgtgttccctctggccccttgctcca gatccacctccgagtctaccgccgctctgggctgcctcgtgaaggactac ttccccgagcccgtgacagtgtcttggaactctggcgccctgacctccgg cgtgcacacctttccagctgtgctgcagtcctccggcctgtactccctgt cctccgtcgtgactgtgccctccagctctctgggcaccaagacctacacc tgtaacgtggaccacaagccctccaacaccaaggtggacaagcgggtgga atctaagtacggccctccctgccctccttgcccagcccctgaatttctgg gcggacccagcgtgttcctgttccccccaaagcccaaggacaccctgatg atctcccggacccccgaagtgacctgcgtggtggtggatgtgtcccagga agatcccgaggtgcagttcaattggtacgtggacggcgtggaagtgcaca acgccaagaccaagcctagagaggaacagttcaactccacctaccgggtg gtgtccgtgctgaccgtgctgcaccaggattggctgaacggcaaagagta caagtgcaaggtgtccaacaagggcctgccttccagcatcgaaaagacca tctccaaggccaagggccagccccgggaaccccaggtgtacacactgcct ccaagccaggaagagatgaccaagaaccaggtgtccctgacctgtctcgt gaaaggcttctacccctccgatatcgccgtggaatgggagtccaacggcc agcctgagaacaactacaagaccaccccccctgtgctggactccgacggc tccttcttcctgtactctcgcctgaccgtggataagtcccggtggcagga aggcaacgtgttctcctgctccgtgatgcacgaggccctgcacaaccact atacccagaagtccctgtccctgtctctgggaaag BRO2- gaagtgcagctggtgcagtctggcgccgaagtgaaaaaacctggcgcctc 40 hIgG4- cgtgaaggtgtcctgcaaggctagcggctacacctttaccgactacaaca S228P- tggactgggtccgacaggccacaggacagggactcgagtggatcggcgac L445P HC atcaaccccaactacgagagcaccggctacaaccagaagttcaagggcag agccaccatgaccgtggacaagagcatcagcaccgcctacatggaactga gcagcctgagaagcgaggacaccgccgtgtactactgcgccagagaggat gatcacgacgcctttgcctattggggccagggcacactggtcaccgttag ctctgctagcaccaagggcccatcggtcttccccctggcgccctgctcca ggagcacctccgagagcacagccgccctgggctgcctggtcaaggactac ttccccgaaccggtgacggtgtcgtggaactcaggcgccctgaccagcgg cgtgcacaccttcccggctgtcctacagtcctcaggactctactccctca gcagcgtggtgaccgtgccctccagcagcttgggcacgaagacctacacc tgcaacgtagatcacaagcccagcaacaccaaggtggacaagagagttga gtccaaatatggtcccccatgcccaccatgcccagcacctgagttcctgg ggggaccatcagtcttcctgttccccccaaaacccaaggacactctcatg atctcccggacccctgaggtcacgtgcgtggtggtggacgtgagccagga agaccccgaggtccagttcaactggtacgtggatggcgtggaggtgcata atgccaagacaaagccgcgggaggagcagttcaacagcacgtaccgtgtg gtcagcgtcctcaccgtcctgcaccaggactggctgaacggcaaggagta caagtgcaaggtctccaacaaaggcctcccgtcctccatcgagaaaacca tctccaaagccaaagggcagccccgagagccacaggtgtacaccctgccc ccatcccaggaggagatgaccaagaaccaggtcagcctgacctgcctggt caaaggcttctaccccagcgacatcgccgtggagtgggagagcaatgggc agccggagaacaactacaagaccacgcctcccgtgctggactccgacggc tccttcttcctctacagcaggctcaccgtggacaagagcaggtggcagga ggggaatgtcttctcatgctccgtgatgcatgaggctctgcacaaccact acacacagaagagcctctccctgtctccgggtaaatgagtcctagctgg BRO2- gaagtgcagctggtgcagtctggcgccgaagtgaaaaaacctggcgcctc 41 hIgG4- cgtgaaggtgtcctgcaaggctagcggctacacctttaccgactacaaca S228P-NH- tggactgggtccgacaggccacaggacagggactcgagtggatcggcgac L445P HC atcaaccccaactacgagagcaccggctacaaccagaagttcaagggcag agccaccatgaccgtggacaagagcatcagcaccgcctacatggaactga gcagcctgagaagcgaggacaccgccgtgtactactgcgccagagaggat gatcacgacgcctttgcctattggggccagggcacactggtcaccgttag ctctgctagcaccaagggcccatcggtcttccccctggcgccctgctcca ggagcacctccgagagcacagccgccctgggctgcctggtcaaggactac ttccccgaaccggtgacggtgtcgtggaactcaggcgccctgaccagcgg cgtgcacaccttcccggctgtcctacagtcctcaggactctactccctca gcagcgtggtgaccgtgccctccagcagcttgggcacgaagacctacacc tgcaacgtagatcacaagcccagcaacaccaaggtggacaagagagttga gtccaaatatggtcccccatgcccaccatgcccagcacctgagttcctgg ggggaccatcagtcttcctgttccccccaaaacccaaggacactctcatg atctcccggacccctgaggtcacgtgcgtggtggtggacgtgagccagga agaccccgaggtccagttcaactggtacgtggatggcgtggaggtgcata atgccaagacaaagccgcgggaggagcagttcaacagcacgtaccgtgtg gtcagcgtcctcaccgtcctgcaccaggactggctgaacggcaaggagta caagtgcaaggtctccaacaaaggcctcccgtcctccatcgagaaaacca tctccaaagccaaagggcagccccgagagccacaggtgtacaccctgccc ccatcccaggaggagatgaccaagaaccaggtcagcctgacctgcctggt caaaggcttctaccccagcgacatcgccgtggagtgggagagcaatgggc agccggagaacaactacaagaccacgcctcccgtgctggactccgacggc tccttcttcctctacagcaggctcaccgtggacaagagcaggtggcagga ggggaatgtcttctcatgctccgtgatgcatgaggctctgaagttccact acacacagaagagcctctccctgtctccgggtaaa BRO2 LC gacaacgtgctgacccagtcccctgactccctggctgtgtctctgggcga 42 gagagccaccatctcttgccgggcctctaagtccgtgcggacctccggct acaactacatgcactggtatcagcagaagcccggccagccccccaagctg ctgatctacctggcctccaacctgaagtccggcgtgcccgacagattctc cggctctggctctggcaccgactttaccctgaccatcagctccctgcagg ccgaggatgccgccacctactactgccagcactccagagagctgccctac acctttggccagggcaccaagctggaaatcaagcggaccgtggccgctcc ctccgtgttcatcttcccaccttccgacgagcagctgaagtctggcacag cctccgtcgtgtgcctgctgaacaacttctacccccgcgaggccaaggtg cagtggaaggtggacaacgccctgcagtccggcaactcccaggaatccgt gaccgagcaggactccaaggacagcacctactccctgtcctccaccctga ccctgtccaaggccgactacgagaagcacaaggtgtacgcctgcgaagtg acccaccagggcctgtctagccccgtgaccaagtctttcaaccggggcga gtgc For SEQ ID NOs: 35 and 39, a217g creates N72D mutation - The invention further provides a gene delivery vehicle or vector comprising a nucleic acid molecule according to the invention. The gene delivery vehicle or vector can be a plasmid or other bacterially replicated nucleic acid. Such a gene delivery vehicle or vector can be easily transferred to, for instance, producer cells. The gene delivery vehicle can also be a viral vector. Preferred viral vectors are adenoviral vectors, lentiviral vectors, adeno-associated viral vectors and retroviral vectors.
- The invention further provides vectors comprising a nucleic acid molecule or a plurality of nucleic acid molecules in accordance with the invention. In certain embodiments, a single vector comprises a single nucleic acid molecule encoding both the VH and the VL domains of the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention. In certain embodiments, a single vector comprises a single nucleic acid molecule encoding both the heavy chain (HC) and the light chain (LC) of the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention.
- In certain embodiments, a first vector comprises a first nucleic acid molecule encoding the VH domain, and a second vector comprises a second nucleic acid molecule encoding the VL domain of the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention. In certain embodiments, a first vector comprises a nucleic acid molecule encoding the heavy chain (HC), and a second vector comprises a second nucleic acid molecule encoding the light chain (LC) of the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention.
- Vectors in accordance with the invention include expression vectors suitable for use in expressing the monoclonal antibody or antigen-binding fragment thereof by a host cell. Host cells can be eukaryotic or prokaryotic.
- The invention provides a host cell comprising a nucleic acid molecule or plurality of nucleic acid molecules encoding an antibody or antigen-binding fragment thereof in accordance with the instant invention. Alternatively or in addition, the invention provides a host cell comprising a vector or plurality of vectors encoding an antibody or antigen-binding fragment thereof in accordance with the instant invention. The nucleic acid molecule or molecules, or similarly the vector or vectors, can be introduced into the host cell using any suitable technique, including, for example and without limitation, transduction, transformation, transfection, and injection. Various forms of these methods are well known in the art, including, e.g., electroporation, calcium phosphate transfection, lipofection, cell squeezing, sonoporation, optical transfection, and gene gun.
- In certain embodiments, a host cell is a eukaryotic cell. In certain embodiments, a host cell is a yeast cell. In certain embodiments, a host cell is an insect cell. In certain embodiments, a host cell is a mammalian cell. In certain embodiments, a host cell is a human cell. In certain embodiments, a host cell is a mammalian cell selected from the group consisting of hybridoma cells, Chinese hamster ovary (CHO) cells, NS0 cells, human embryonic kidney (HEK293) cells, and PER.C6™ cells. The invention further contemplates other host cells in addition to those mentioned above. Host cells further include cell lines developed for commercial production of the antibodies and antigen-binding fragments thereof in accordance with the invention.
- Cell lines provided with the nucleic acid can produce the binding molecule/antibody in the laboratory or production plant. Alternatively, the nucleic acid is transferred to a cell in the body of an animal in need thereof and the binding molecule/antibody is produced in vivo by the transformed cell. The nucleic acid molecule of the invention is typically provided with regulatory sequences to the express the binding molecule in the cell. However, present day homologous recombination techniques have become much more efficient. These techniques involve for instance double stranded break assisted homologous recombination, using site-specific double stranded break inducing nucleases such as TALEN. Such or analogous homologous recombination systems can insert the nucleic acid molecule into a region that provides one or more of the in cis required regulatory sequences.
- The invention further provides an isolated or recombinant cell, or in vitro cell culture cell comprising a nucleic acid molecule or vector according to the invention. The invention further provides an isolated or recombinant cell, or in vitro cell culture cell comprising a binding molecule according to the invention. Preferably said cell produces said binding molecule. In certain embodiments, said cell secretes said binding molecule. In a preferred embodiment said cell is a hybridoma cell, a CHO cell, an NS0 cell, a HEK293 cell, or a PER-C6™ cell. In a particularly preferred embodiment said cell is a CHO cell. Further provided is a cell culture comprising a cell according to the invention. Various institutions and companies have developed cell lines for the largescale production of antibodies, for instance for clinical use. Non-limiting examples of such cell lines are CHO cells, NS0 cells or PER.C6™ cells. These cells are also used for other purposes such as the production of proteins. Cell lines developed for industrial scale production of proteins and antibodies are herein further referred to as industrial cell lines. The invention provides an industrial cell line comprising a nucleic acid molecule, a binding molecule and/or antibody according to the invention. The invention also provides a cell line developed for the largescale production of protein and/or antibody comprising a binding molecule or antibody of the invention. The invention also provides the use a cell line developed for the largescale production of a binding molecule and/or antibody of the invention.
- The invention further provides a method of making a monoclonal antibody or antigen-binding fragment thereof in accordance with the invention, comprising culturing a population of host cells according to the invention under conditions permitting expression of the monoclonal antibody or antigen-binding fragment thereof. In certain embodiments, the method further comprises harvesting said monoclonal antibody or antigen-binding fragment thereof from the culture. Preferably said cell is cultured in a serum-free medium. Preferably said cell is adapted for suspension growth. Further provided is an antibody obtainable by a method for producing an antibody according to the invention. The antibody is preferably purified from the medium of the culture. Preferably said antibody is affinity purified.
- An aspect of the invention is a method of inhibiting activation of classical or lectin pathway in a subject, comprising administering to a subject in need thereof an effective amount of the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention. In certain embodiments, the subject is a mammal. In certain embodiments, the subject is a mouse, rat, hamster, Guinea pig, rabbit, goat, sheep, pig, cat, dog, horse, or cow. In certain embodiments, a subject is a non-human primate, e.g., a monkey. In certain embodiments, a subject is a human.
- The inhibitory effect of the antibody or antigen-binding fragment can be assessed using any suitable method, including, for example, measuring total complement activity, a test of hemolytic activity based on the ability of a serum sample to lyse sheep erythrocytes coated with anti-sheep antibodies. Decreased hemolysis compared to an untreated control sample indicates an inhibitory effect of the antibody or antigen-binding fragment. In an embodiment, the untreated control sample can be a historical sample obtained prior to starting treatment with the antibody or antigen-binding fragment. Generally, a decrease in total complement activity of at least 5% compared to control is indicative of efficacy. In certain embodiments, a decrease in total complement activity of at least 10% compared to control is indicative of efficacy.
- Diseases that can be treated or prevented by a method or monoclonal antibody or antigen-binding fragment thereof in accordance with the invention are autoimmune diseases such as experimental allergic neuritis, type II collagen-induced arthritis, myasthenia gravis, hemolytic anemia, glomerulonephritis, idiopathic membranous nephropathy, rheumatoid arthritis, systemic lupus erythematosus, immune complex-induced vasculitis, adult respiratory distress syndrome, stroke, xenotransplantation, allotransplantation, multiple sclerosis, burn injuries, extracorporeal dialysis and blood oxygenation, inflammatory disorders, including sepsis and septic shock, toxicity induced by the in vivo administration of cytokines or mAbs, antibody-mediated rejection of allografts such as kidney allografts, multiple trauma, ischemia-reperfusion injuries, and myocardial infarction.
- Individuals suffering from a disease involving complement-mediated damage or at risk of developing such complement-mediated damage can be treated by administering an effective amount of a monoclonal antibody or antigen-binding fragment thereof in accordance with the invention to an individual in need thereof. Thereby the biologically active complement-derived peptides are reduced in the individual and the lytic and other damaging effects of complement on cells and tissues is attenuated or prevented. By “effective amount” is meant an amount sufficient to achieve a desired biological response. In an embodiment, by “effective amount” is meant an amount of a monoclonal antibody or antigen-binding fragment thereof in accordance with the invention that is capable of inhibiting complement activation in the individual.
- Treatment (prophylactic or therapeutic) will generally consist of administering the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention parenterally together with a pharmaceutical carrier, for example intravenously, subcutaneously, or locally. The administering typically can be accomplished by injection or infusion. The dose and administration regimen of the monoclonal antibody or antigen-binding fragment thereof in accordance with invention will depend on the extent of inhibition of complement activation aimed at. Typically, for monoclonal antibodies of the invention, the amount will be in the range of 2 to 20 mg per kg of body weight. For parenteral administration, the monoclonal antibody or antigen-binding fragment thereof in accordance with the invention will be formulated in an injectable form combined with a pharmaceutically acceptable parenteral vehicle. Such vehicles are well-known in the art and examples include saline, dextrose solution, Ringer's solution and solutions containing small amounts of human serum albumin.
- Pharmaceutical compositions typically must be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, micro-emulsion, liposome, or other ordered structure suitable to high drug concentration. Examples of suitable aqueous and non-aqueous carriers which may be employed in the pharmaceutical compositions of the invention include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate. Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- The pharmaceutical compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol, sorbic acid, and the like. It may also be desirable to include isotonicity agents, such as sugars, polyalcohols such as mannitol, sorbitol, glycerol or sodium chloride in the compositions. Pharmaceutically-acceptable antioxidants may also be included, for example (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
- Sterile injectable solutions can be prepared by incorporating the mAb or fragments thereof in the required amount in an appropriate solvent with one or a combination of ingredients e.g. as enumerated above, as required, followed by sterilization microfiltration. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients e.g. from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- Prolonged absorption of the injectable anti-C2 mAbs or fragments thereof can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
- The mAbs of fragments thereof can be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for the preparation of such formulations are generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
- The pharmaceutical compositions can be administered with medical devices known in the art.
- Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time, or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation.
- Actual dosage levels of the mAbs or fragments thereof in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient without being toxic to the patient.
- In one embodiment, the monoclonal antibodies according to the invention can be administered by infusion in a weekly dosage of from 10 to 500 mg/m2, such as of from 200 to 400 mg/m2. Such administration can be repeated, e.g., 1 to 8 times, such as 3 to 5 times. The administration may be performed by continuous infusion over a period of from 2 to 24 hours, such as of from 2 to 12 hours.
- In yet another embodiment, the mAbs or fragments thereof or any other binding molecules disclosed in this invention, can be administered by maintenance therapy, such as, e.g., once a week for a period of 6 months or more.
- The present invention will now be illustrated with reference to the following examples, which set forth particularly advantageous embodiments. However, it should be noted that these embodiments are merely illustrative and are not to be construed as restricting the invention in any way.
- BRO2-glyc-IgG4
- U.S. Pat. No. 9,944,717 discloses a murine inhibitory anti-C2b monoclonal antibody (mAb). From this lead, four humanized variants, comprising different heavy chain variable domains (VH1, VH2, VH3, or VH4) and kappa light chain variable domains (VK1, VK2, VK3, or VK4), were generated using the Composite Human Antibody technology of Antitope Ltd (Cambridge, UK). Based on in silico analysis, the risk of immunogenicity for each of the humanized VH and VK sequences was predicted. As shown in Table 7, the lowest risk for immunogenicity, along with the highest percentage of identity to the closest human germline variant, was predicted when VH4 was paired with VK3 or VK4. This observation was based on the lowest number of promiscuous binding peptides to human MHC class II. VH4 was preferred because of its higher percentage of identity against the closest human germline. In addition, based on binding and potency, VH4/VK3 was selected as the anti-human C2b humanized lead antibody and is referred to herein as BRO2-glyc-IgG4.
-
TABLE 7 Risk for immunogenicity ranked 1 (= lowest) to 5 (= highest) (high affinity priority over moderate affinity) and sequence identity to the closest human germline Identity to Identity to High Moderate IGHV1- High Moderate IGKV4- VH Affinity Affinity Ranking 8*01 VL Affinity Affinity Ranking 1*01 WT 1 2 5 79.3 % WT 6 5 5 80.0 % VH1 0 3 4 86.2 % VK1 3 3 3 92.5 % VH2 0 2 1 90.8 % VK2 3 3 3 95.0 % VH3 0 2 1 93.1 % VK3 3 2 1 96.3 % VH4 0 2 1 95.4 % VK4 3 2 1 97.5% - SDS-PAGE analysis of variants of BRO2-glyc-IgG4 revealed a double band and band shift in the VH3 and VH4 variants. This shift was hypothesized to arise from a potential glycosylation site (motif NXS) at residues 72-74 (Kabat numbering) in framework region 3 (FR3) of VH3 and VH4. Because this potential glycosylation site could result in heterogeneity not only of antibody product expressed from mammalian cell lines, but also of antibody function, the potential glycosylation site was removed. The glycosylation site was removed by site-directed mutagenesis to generate an N72D variant of the VH, referred to herein as either VH3.2 or VH4.2. The N72D mutation removed the altered band pattern observed in VH3 and VH4 (
FIG. 1 ), confirming that the double band and band shift was caused by glycosylation and heterogeneity in the heavy chain. - To further determine whether variant VH4.2, which is the same VH as BRO2-glyc-IgG4 but without the glycosylation site in FR3, demonstrated improved characteristics compared to the heterogeneously glycosylated parent mAb BRO2-glyc-IgG4, thermotolerance of each antibody was determined.
- To test thermotolerance, humanized variants were treated with an increasing temperature from 55° C. up to 75° C. with Thermocycler (Biometra). Residual binding capacity was analyzed on Biacore 3000 on a CMS Chip directly coated with human C2 purified from serum (3500 RU, Complement Technologies Cat #A112, lot #20). Data were analyzed using the BIAevaluation software. The slope of specific binding of each variant was determined with the BIAevaluation software, general fit from the linear phase of the sensorgram (started at 5 seconds after the start of injection and stopped after 11 seconds). Then percentage of activity was calculated, using the mean of the slope obtained for the 59° C., 56.9° C., 55° C. and 4° C. temperatures as 100% activity. Finally, the percentage of activity was plotted in GraphPad Prism (Log (agonist) vs response, variable slope (4 parameters)). The temperature where the antibody lost 50% of its binding capacity (TM50) is shown in Table 8 below.
- BRO2-IgG4
- Both variants without the glycosylation site present in BRO2-glyc-IgG4 demonstrated improved thermotolerance (Table 8). BRO2-glyc-IgG4 exhibited a TM50 of 64.0° C. VH4.2/VK3 (also referred to herein as BRO2-IgG4) exhibited a TM50 of 65.0 or ° C. in two independent experiments. VH4.2/VK4 exhibited a TM50 of 65.2 or 65.4° C. in two independent experiments.
-
TABLE 8 Percent Identity to closest human germline sequences and thermotolerance of Anti-C2b Monoclonal Antibodies BRO2-glyc- VH4.2/VK3 IgG4 (BRO2-IgG4) VH4.2/VK4 % Identity to closest 95.8 95.3 95.9 human germline sequences % Homology to 97.0 97.0 97.6 closest human germline sequences Thermotolerance 64.0 65.0; 65.1 65.2; 65.4 (TM50, ° C.) - BRO2-IgG4—NH
- Antibodies with pH-dependent antigen binding dissociate bound antigen in acidic endosomes after internalization into cells. Consequently, released antigen is trafficked to the lysosome and degraded, whereas the dissociated antibody, free of antigen, is recycled back to plasma by FcRn. The recycled free antibody can bind to another target antigen. By repeating this cycle, a pH-dependent antigen-binding antibody can bind to the target antigen more than once and therefore improve the neutralizing capacity of the antibody. This process can further be improved when an antibody is equipped with NHancet (NH) technology (argenx, Belgium) that enhances the binding of the antibody to FcRn at acidic endosomal pH (pH 6.0) but not at neutral pH (pH 7.4). Therefore, amino acids in the Fc region of BRO2-IgG4 were mutated to alter pH-dependent binding to FcRn (H433K, N434F). The resulting antibody is referred to herein as BRO2-IgG4—NH.
- BRO2-IgG1—NH and BRO2-IgG1-LALA-NH (ARGX-117) The effect of immunoglobulin subclass on efficacy was also examined. A further NHance® variant was prepared in a human IgG1 background (BRO2-IgG1—NH). Antibody effector functions can be further diminished by mutations in the Fc region that alter binding of the antibody to Fcγ receptors. Therefore, amino acid substitutions L234A and L235A (“LALA”) were incorporated into BRO2-IgG1—NH to yield BRO2-IgG1-LALA-NH, also referred to herein as ARGX-117.
- His 1-IgG1-LALA-NH
- To determine if pH dependency of BRO2-IgG1-LALA-NH could be improved to extend its pharmacokinetic and pharmacodynamic (PK/PD) effects in vivo, an amino acid in the VK of the BRO2-IgG1-LALA-NH antibody was mutated to histidine (G29H, mutant VK referred to herein as Vk3m3). The resulting antibody is referred to herein as His1-IgG1-LALA-NH.
- His1-IgG4
- Similarly, to determine if pH dependency of BRO2-IgG4 could be improved to extend its PK/PD effects in vivo, an amino acid in the VK of the BRO2-IgG4 antibody was mutated to histidine (G29H, mutant VK referred to herein as Vk3m3). The resulting antibody (VH4.2/Vk3m3) is referred to herein as His1-IgG4.
- His1-IgG4—NH
- To examine the effect of recycling on antibody efficacy, the NHance® mutations were incorporated into the His1-IgG4 (VH4.2/Vk3m3) antibody. The resulting antibody is referred to herein as His1-IgG4—NH.
- His2-IgG4—NH
- To determine if pH dependency of BRO2-IgG4—NH could be improved to extend its PK/PD effects in vivo, an amino acid of the VH4 of the BRO2-IgG4—NH antibody was mutated to histidine (K26H, VH mutant referred to herein as VH4.2m12). Additionally, the VK3 light chain of the BRO2-IgG4—NH antibody was replaced with the VK4 light chain mentioned above, and a second amino acid was mutated to histidine (G29H, VK4 mutant referred to herein as VK4m3). The resulting antibody (VH4.2m12NK4m3) is referred to herein as His2-IgG4—NH.
- Total Pharmacokinetics (PK)
- Cynomolgus monkeys (n=2, 1 male and 1 female per group) were randomly assigned into separate treatment groups in accordance with Table 9 below.
-
TABLE 9 Treatment Group Assignments Animal Group Antibody No. 1 BRO2 glyc- IgG4 1 2 2 Negative Control 3 4 3 BRO2- IgG4 5 6 4 BRO2-IgG4- NH 7 8 5 BRO2-IgG1-LALA- NH 9 10 6 His1- IgG4 11 12 7 His1-IgG4- NH 13 14 8 His1-IgG1-LALA- NH 15 16 9 His2-IgG4- NH 17 18 - A serum sample was obtained from each monkey one day prior to receiving test antibody (day −1, or “PRE”). Then on day 1 (d1), each monkey received a single intravenous injection of 5 mg/kg test antibody in accordance with Table 9. Serum samples were then obtained from each monkey serially over up to 60 days (to d60).
- For PK of total antibody (total PK), a microtiter plate was coated overnight at 4° C. with 100 μL goat anti-human IgG (Bethyl; A80-319A) at 5 μg/mL. Plates were washed 3 times with at least 200 μL PBS-0.05% Tween20 and subsequently blocked with 200 IA PBS-2% BSA for 2 hours at room temperature (RT). After washing the
plates 3 times with at least 200 IA PBS-0.05% Tween20, serum samples, standard and QC samples (prepared in pooled naive cynomolgus monkey serum) were applied in duplicate at 100-fold dilution or more and diluted in 100 μL PBS-0.2% BSA-1% pooled naive cynomolgus monkey serum. For each antibody, its own frozen standards and QC samples were applied in duplicate (the same batch of antibody was used as the batch that was injected in the monkeys). The negative control antibody is an antibody that binds a non-C2 complement component. Incubation was done at RT for 2 hours whilst shaking the plate. After washing theplates 5 times with at least 200 μL PBS-0.05% Tween20, 100 IA horseradish peroxidase (HRP)-labeled mouse anti-human IgG kappa (Southern Biotech, 9230-05) was diluted 260,000-fold in PBS 0.2% BSA and applied to the wells for 1 hour at RT. The plates were washed 5 times with at least 2004 PBS-0.05% Tween20 and staining was done with 100μL - Results are shown in Table 10 and a comparison of glycosylated BRO2-glyc-IgG4 with non-glycosylated BRO2-IgG4 is shown in
FIG. 2 . In the total PK assay, concentrations of non-glycosylated BRO2-IgG4 were generally greater than those of glycosylated BRO2-glyc-IgG4. This improvement in total PK was completely unexpected and represents an important further advantage of the non-glycosylated antibody. -
TABLE 10 Total PK Total PK (μg/mL) BRO2-glyc-IgG4 BRO2-IgG4 average average Monkey 1 Monkey 2M1&M2 Std Dev Monkey 5 Monkey 6M5&M6 Std Dev 15 min 107.1 99.9 103.4 5.3 167.0 166.7 162.5 5.6 1 h 103.9 99.9 102.2 1.7 172.9 158.4 168.1 13.3 2 h 95.4 89.0 94.8 2.8 151.1 150.9 147.6 3.8 4 h 91.4 92.2 90.0 2.5 134.6 132.3 132.7 1.2 6 h 86.5 86.0 85.4 1.6 134.3 128.9 133.6 5.5 24 h 56.1 55.5 58.3 1.2 99.6 97.6 85.9 1.9 Day 247.9 47.2 47.3 0.6 77.6 78.3 68.7 9.3 Day 434.8 39.8 34.1 2.7 58.4 55.8 60.8 4.8 Day 726.6 25.1 26.0 0.6 41.5 33.6 34.9 7.6 Day 1116.3 14.1 16.2 1.3 28.1 20.9 24.5 5.1 Day 159.8 8.1 9.3 0.9 18.1 11.2 13.0 5.1 Day 6.7 5.1 6.5 1.1 12.8 6.5 8.3 2.5 19 Day 4.4 3.2 4.4 0.8 9.8 4.3 7.1 3.9 23 Day 3.2 1.9 3.1 0.7 6.5 2.2 3.9 3.0 27 Day 2.2 1.5 2.3 0.4 4.7 1.0 2.9 2.6 31 - Free C2
- Cynomolgus monkeys (n=2, 1 male and 1 female per group) received a single intravenous injection of 5 mg/kg test antibody, as described above.
- In this assay a microtiter plate was coated overnight at 4° C. with 100 μL 2.5 μg/mL mouse anti-human C2 monoclonal antibody mAb32 (anti-C2 #32 m-IgG @ 3.31 mg/mL, 0.2 μm PBS, LC-12/05-166, 12-apr-13). This antibody binds to a different epitope on C2 than BRO2. Plates were washed 3 times with at least 200 μL PBS-0.05% Tween20 and subsequently blocked with 200 IA PBS-2% BSA (pH 7.4) for 2 hours at RT. In the meantime, samples, frozen standard (specific for each antibody, prepared in pooled naive cynomolgus monkey serum) and frozen QC samples (prepared in pooled naive cynomolgus monkey serum) were thawed and diluted 6.7-fold in 80 IA PBS-0.2% BSA. 40 1,1L biotinylated anti-C2 VH4/VK3 was added at 0.6 μg/mL. Each sample was made in duplicate. 100 IA of the mixture was transferred immediately to the washed coated plate after addition of the biotinylated antibody. The plate was incubated for 2 hours at RT, washed 5 times with at least 200 μL PBS-0.02% Tween20, and 100 IA strep-HRP (Jackson, 016-030-084) was added at 300,000-fold dilution in PBS-0.2% BSA. After 1 hour incubation at RT, the plates were washed 5 times with at least 200 IA PBS-0.05% Tween20 and staining was done with 100 μL TMB (Calbiochem, CL07) and stopped after 10 minutes with 100 μL 0.5 M H2504 (CHEM LAB, Cat #CL05-2615-1000). The OD was measured at 450 nm and used to determine C2 levels.
- Sera from the following monkeys were first tested together using the free C2 assay performed on different days:
monkeys monkeys monkeys monkeys monkeys monkeys - The levels of free C2 for all monkeys are shown in
FIGS. 3A-3I and in Table 11. - As expected, for
monkeys day 2. - For the monkeys receiving BRO2-glyc-IgG4 (
monkeys 1 and 2) and BRO2-IgG4 (monkeys 5 and 6), C2 levels went back up beginning atday 4 and were back to baseline levels byday 31.Monkeys FIG. 3C , Table 11). - For all other monkeys, excluding those with anti-drug antibodies (ADA, marked by a * in
FIGS. 3D-3I ), C2 levels increased much more slowly, and C2 levels did not return to baseline even byday 31. -
FIG. 4 shows a blow up (log scale) of the free C2 levels (OD 450 nm) for the average of the 2 monkeys of each group. Free C2 levels were lower for BRO2 variants than for His1 variants. -
Monkey 10, injected with BRO2-IgG1-LALA-NH (ARGX-117), had the lowest levels of C2 at all time points tested. Comparison of free C2 levels frommonkeys FIG. 5 .Monkey 10 also had the best total PK (see above). The raw data is shown in Table 11, and average data comparing the glycosylated and non-glycosylated variants is shown in Table 12. -
TABLE 11 Free C2 (OD450 nm) for all antibodies Time Point M 1 M 2 M 3 M 4 M 5 M 6 M 7 M 8 M 9 M 10 M 11 M 12 M 13 M 14 M 15 M 16 M 17 M 18 Day −5 0.773 0.770 0.797 0.930 0.696 0.705 0.439 0.532 0.602 0.626 0.656 0.643 0.824 0.805 0.756 0.755 0.789 0.935 Day 0 0.707 0.716 0.813 0.907 0.740 0.657 0.507 0.531 0.578 0.604 0.620 0.687 0.847 0.792 0.772 0.750 0.834 1.043 15 m 0.031 0.028 0.879 0.979 0.016 0.018 0.016 0.014 0.015 0.013 0.029 0.033 0.032 0.038 0.033 0.028 0.050 0.055 1 h 0.033 0.028 0.914 1.055 0.017 0.021 0.014 0.013 0.014 0.013 0.030 0.033 0.035 0.037 0.034 0.031 0.050 0.062 2 h 0.034 0.030 0.874 0.997 0.018 0.020 0.016 0.014 0.015 0.015 0.031 0.031 0.034 0.043 0.034 0.030 0.052 0.063 4 h 0.033 0.027 0.887 1.000 0.017 0.020 0.017 0.015 0.016 0.016 0.037 0.034 0.036 0.044 0.037 0.032 0.054 0.062 6 h 0.034 0.030 0.958 1.035 0.015 0.019 0.015 0.014 0.015 0.017 0.032 0.034 0.035 0.043 0.034 0.034 0.052 0.071 Day 1 0.046 0.045 0.917 0.923 0.021 0.025 0.019 0.018 0.020 0.020 0.041 0.038 0.046 0.054 0.048 0.044 0.064 0.084 Day 2 0.060 0.061 0.872 0.920 0.027 0.030 0.021 0.018 0.023 0.022 0.075 0.040 0.050 0.052 0.053 0.043 0.068 0.090 Day 4 0.125 0.102 0.833 0.886 0.037 0.048 0.026 0.021 0.035 0.024 0.088 0.056 0.063 0.064 0.056 0.055 0.080 0.096 Day 7 0.174 0.169 0.853 0.899 0.072 0.110 0.033 0.025 0.050 0.028 0.119 0.085 0.075 0.075 0.070 0.071 0.080 0.099 Day 11 0.257 0.265 0.862 0.847 0.127 0.193 0.050 0.033 0.092 0.033 0.172 0.105 0.088 0.088 0.090 0.087 0.102 0.134 Day 15 0.364 0.375 0.840 0.834 0.177 0.290 0.065 0.043 0.138 0.043 0.315 0.138 0.086 0.096 0.094 0.109 0.133 0.147 Day 19 0.418 0.471 0.807 0.864 0.256 0.406 0.083 0.031 0.194 0.051 0.289 0.157 0.157 0.106 0.113 0.127 0.143 0.167 Day 23 0.517 0.562 0.820 0.897 0.327 0.469 0.100 0.059 0.255 0.062 0.351 0.225 0.339 0.133 0.126 0.148 0.176 0.192 Day 27 0.597 0.633 0.818 0.921 0.378 0.537 0.124 0.146 0.292 0.071 0.418 0.230 0.492 0.255 0.140 0.170 0.199 0.231 Day 31 0.633 0.663 0.841 0.934 0.431 0.599 0.153 0.125 0.364 0.098 0.511 0.280 0.605 0.522 0.163 0.205 0.238 0.244 -
TABLE 12 Average Free C2 of Glycosylated and Non-Glycosylated Antibodies Free C2 ( OD 450 nm)BRO2-glyc-IgG4 BRO2-IgG4 average Standard average Standard Monkey 1 Monkey 2M1&M2 Deviation Monkey 5 Monkey 6M5&M6 Deviation Day −5 0.773 0.77 0.772 0.002 0.696 0.705 0.701 0.006 Day 00.707 0.716 0.712 0.006 0.74 0.657 0.699 0.059 15 min 0.031 0.028 0.030 0.002 0.016 0.018 0.017 0.001 1 h 0.033 0.028 0.031 0.004 0.017 0.021 0.019 0.003 2 h 0.034 0.03 0.032 0.003 0.018 0.02 0.019 0.001 4 h 0.033 0.027 0.030 0.004 0.017 0.02 0.019 0.002 6 h 0.034 0.03 0.032 0.003 0.015 0.019 0.017 0.003 Day 10.046 0.045 0.046 0.001 0.021 0.025 0.023 0.003 Day 20.06 0.061 0.061 0.001 0.027 0.03 0.029 0.002 Day 40.125 0.102 0.114 0.016 0.037 0.048 0.043 0.008 Day 70.174 0.169 0.172 0.004 0.072 0.11 0.091 0.027 Day 110.257 0.265 0.261 0.006 0.127 0.193 0.160 0.047 Day 150.364 0.375 0.370 0.008 0.177 0.29 0.234 0.080 Day 190.418 0.471 0.445 0.037 0.256 0.406 0.331 0.106 Day 230.517 0.562 0.540 0.032 0.327 0.469 0.398 0.100 - As these assays for the different monkeys just described were run on different days, the analysis was repeated for a select number of time points (pre, 4 hours,
days FIGS. 6A-6D ). The pre-samples were also tested with and without addition of excess BRO2 (500 μg/mL). - The ODs of the pre-samples were comparable for all monkeys, indicating that free C2 levels in the different monkeys were comparable (
FIG. 6A ). When the pre-samples were pre-incubated with 500 μg/mL BRO2, all signals dropped to an OD of 0.013-0.015 (FIGS. 6A and 6B ). Such low OD values were not obtained for any of the PK samples, indicating that at no time point was free C2 completely depleted. The lowest levels were obtained at 4 hours, and they were the lowest (OD between 0.02 and 0.03) for the BRO2 variants (monkeys FIG. 6C ). Interpretation of the results atday 11 andday 27 was hampered by ADA (anti-drug antibodies) that was observed in several of the monkeys (FIG. 6D ). - Immunogenicity
- Cynomolgus monkeys (n=2, 1 male and 1 female per group) received a single intravenous injection of 5 mg/kg test antibody, as described above. Serum samples obtained from all monkeys were tested for ADA (anti-drug antibodies) from baseline (pre-exposure) until day 31 (
FIGS. 7A-7P ), and serum samples obtained frommonkeys FIGS. 8A-8F ). - Immunogenicity was determined by coating a microtiter plate with 100 μl of 1 μg/mL of the respective antibody overnight at 4° C. Plates were washed 3 times with at least 200 μL PBS-0.05% Tween20 and subsequently blocked with 200 μL PBS-1% casein for 2 hours at RT. After washing the
plates 3 times with at least 200 IA PBS-0.05% Tween20, serum samples were diluted 20-fold or more in 1004 PBS-0.1% casein and incubated in the coated wells for 2 hours at room temperature (RT). After washing theplates 5 times with at least 200 IA PBS-0.05% Tween20, 100 IA anti-monkey IgG-HRP (Southern Biotech #4700-05) was added to the wells at a 8000-fold dilution for 1 hour at RT. The plates were washed 5 times with at least 2004 PBS-0.05% Tween20 and staining was done with 100 IA TMB and stopped after 10 minutes with 100 μL 0.5 M H2SO4 (CHEM LAB, Cat #CL05-2615-1000). The OD was measured at 450 nm. Representative results are shown inFIGS. 7A-7P . - A clear ADA response was observed for monkeys 8 (BRO2-IgG4—NH), 11 (His1-IgG4), 13 and 14 (His1-IgG4—NH), and 16 (His1-IgG1-LALA-NH) (
FIGS. 7F, 7I, 7K and 7L , and 7N, respectively). Indeed, the signal obtained in ELISA after injection of the antibody as compared to the baseline (“PRE”) signal (before injection of the antibody) was increased at least 2-fold. - For
monkeys FIGS. 71, 7K, and 7N , respectively), ADA was observed as ofday 11; for monkey 8 (FIG. 7F ), as ofday 15; and for monkey 14 (FIG. 7L ), as ofday 19. - For monkey 9 (BRO2-IgG1-LALA-NH) (
FIG. 7G ), an increase in signal was observed for all samples post injection of the antibody, but the signal in the baseline sample was already high and the increase over time was low (about 1.5-fold). - For monkey 5 (
FIG. 7C ) an unusually high signal was observed in the baseline sample before injection of the antibody. This signal was also higher than the signals of the later timepoints. This may be explained by the interference of the antibody (present in the serum) with the assay. It was therefore not possible to determine if there was an ADA response in this monkey. - Igawa et al. (Protein Eng Des Sel 2010, 23(5):385-392), studying VH mutants of certain IgG1 monoclonal antibodies, reported a strong positive correlation between isoelectric point (pI) and monoclonal antibody clearance and a negative correlation between pI and monoclonal antibody half-life. In this example, the pI of various forms of anti-human C2b were determined. Results are shown in Table 13.
-
TABLE 13 Apparent pI of Anti-human C2b Monoclonal Antibodies VH4.2-IgG1- LALA-HN- VH4.2-IgG4- VH4.2-IgG4- IAP2VK3 Peak IAP2VK3 HN-IAP2VK3 (ARGX-117) Calculated Acidic 3 7.02 7.14 Apparent pI Acidic 2 7.10 7.24 n = 3 Acidic 1 7.16 7.32 8.29 Main Peak 7.20 7.35 8.43 Basic 1 7.30 7.45 8.57 Basic 2 7.42 7.58
All three antibodies tested are without glycosylation in VH. As shown in Table 13, the pI of ARGX-117 was found to be significantly greater than the pI of closely related IgG4 antibodies. The observed pI of ARGX-117 is expected to be manifested as enhanced potential for so-called antigen sweeping. - Binding characteristics of ARGX-117 were assessed by Western blotting and by Surface Plasmon Resonance (SPR) analysis, as depicted in
FIG. 1 . Western blotting results revealed that ARGX-117 binds to C2 and C2b, as depicted inFIG. 9A . The binding characteristics of ARGX-117 were further studied by SPR, using theBiacore 300, by coating C2 (SEQ ID NO: 21) on the solid phase with different concentrations of Fabs of ARGX-117 used as eluate, as depicted inFIG. 9B . Affinities were calculated assuming 1:1 binding between the Fab and C2 and yielded a Kd of about 0.3 nM. In order to study the mechanism of action by ARGX-117, SPR analysis was performed, mimicking the formation of C3 convertase (C4bC2a) with biotinylated C4 immobilized to streptavidin-coated chips, as depicted inFIG. 9C . When C2 was added in flowing buffer, alone or preincubated with the control mAb, C2 binding was observed on the chip. Pre-incubation with anti-C2 clone 63 (i.e., anti-C2-63) resulted in higher signal, presumably because this mAb form complexed to C2 and C2:mAb complexes bind together resulting in higher molecular mass and higher SPR signal. When C2 was pre-incubated with ARGX-117, binding of C2 to C4b was greatly reduced. The initial interaction of C2 to C4b is thought to be initiated by the C2b domain (SEQ ID NO: 44). Thereafter the large C2a domain (SEQ ID NO: 43) takes over and this interaction is crucial in the formation of the C3 convertase complex. The results from this experiment suggest that ARGX-117 inhibits C2 by inhibiting binding to C4b. - To further understand the mechanism of action of C2 inhibition by ARGX-117, C2 was first allowed to bind to C4b immobilized on streptavidin chips, and after stabilization by flowing buffer only, samples were flown, as depicted in
FIG. 9D . Running buffer or control human IgG4 mAb targeting an irrelevant soluble antigen (i.e., anti-Factor XI (anti-FXI)) resulted in some signal decrease, which normalized after injection ceased. Injection of anti-C2-63 resulted in increased signal, suggesting that this mAb is able to bind to C3 convertase (C4bC2a). This is in line with the predicted binding model of C2 to C4b, which suggests that after binding on C2, the C2a domain is still largely available. Interestingly, ARGX-117 demonstrated a strong binding to C3 convertase that was followed by a rapid dissociation. These results suggest that ARGX-117 is able to bind C2, but that this binding is very unstable, likely affecting C2 in a way that facilitates activation. These results also suggest that ARGX-117 would be released together with C2b from the C2 molecule. - In order to map the epitope of anti-C2-5F2.4, advantage was taken of the fact that anti-C2-5F2.4 does not cross-react with Factor B (FB; SEQ ID NO: 50) and that C2 and FB are highly homologous proteins that have similar domain structure. Both proteins comprise a small fragment, and a large fragment. The small fragment in complement C2 is called C2b (SEQ ID NO:44), and the small fragment in Factor B is called FBa (SEQ ID NO: 51). The small fragment in each comprises three Sushi domains (CCP domains). The large fragment in each comprises a von Willebrand Factor type A domain (VWFA) and a Peptidase S1 domain on, as shown in
FIG. 10 . Domain swap mutants included a C-terminal FLAG tag. - To generate the various swap mutants, DNA constructs for C2, FB, and the ten domain swap mutants were obtained from GenScript. DNA was heat shock-transformed into competent E. coli cells (ThermoFisher). Cells were streaked on agar plates and grown for 16 hours at 37° C. Thirteen bottles of 200 mL LB (Luria Broth) medium were prepared (MP Bio) and autoclaved. 300 IA ampicillin (100 mg/mL) was added to each bottle. Pre-cultures were started with 3 mL LB medium for each construct. After 6 hours, the pre-cultures were transferred into the bottles and grown for 16 hours at 37° C. with agitation. DNA was purified from bacterial pellets by a plasmid DNA purification kit according the manufacturer's instructions (MaxiPrep,
NucleoBond PC 500, Macherey-Nagel) and reconstituted in TE buffer. Plasmid DNA concentration was determined by NanoDrop and was set to 1 μg/μL. The integrity of the plasmids was verified by restriction analysis. For eachconstruct 1 μL plasmid DNA and 9 μL restriction enzyme-mix (PstI and PvuII) were mixed and incubated for 2 hours at 37° C. The DNA was analyzed on a 1% agarose gel after 1 hour running at 100 - V using Bio-Rad ChemiDoc MP system. DNA constructs for the fine mapping (see below) were handled the same way but their integrity was checked by sequencing.
- The mutant proteins were generated by transient transfection in HEK293T cells. HEK cells were cultured in complete DMEM (DMEM (Gibco) supplemented with 10% fetal calf serum (FCS) and 1% penicillin/streptomycin (P/S)). One day prior to transfection, cells of two flasks were seeded into fifteen 10
cm 2 culture dishes (Greiner Bio-One). Before the transfection, 21 mL of empty DMEM medium was mixed with 630 4 polyethylenimine (P-Pei, Polysciences, Inc.). As controls an empty plasmid PF45 pcDNA3.1 and PF146 H2B GFP were transfected. 15 μg plasmid DNA was incubated in 1500 4 empty medium-P-Pei mix for 20 minutes in Eppendorf-tubes. The transfection mix was carefully added to the cells and the medium was mixed by pipetting up and down. After 8 hours the medium was changed to mL empty medium. After 3 days the cells were checked for GFP expression with a fluorescence microscope. Supernatants were collected onday 4 and were filter-sterilized by a μm filter (Sartorius) and concentrated with a Vivaspin column (Sartorius) to approximately one-third of the original volume. Domain swap mutants were concentrated with 30,000 MWCO columns, and C2b mutants for fine mapping were concentrated with MWCO columns. All supernatants were stored at −20° C. and were analyzed also by SDS-PAGE and anti-FLAG Western Blot. - To verify expression of the various constructs, an anti-FLAG-tag ELISA assay was carried out. Microplates (Maxisorp, NUNC, Cat #439454) were coated overnight with 100 4 of HEK293T supernatants 5x diluted in PBS or undiluted (for domain swap mutants and fine mapping mutants, respectively). After washing 4 times with PBS and 0.05% Tween-20, 100 4/well of 1 μg/mL anti-FLAG Ab (clone M2, Sigma-Aldrich) in PBS and 0.1% Tween-(PBST) was added and incubated for 1 hour at room temperature (RT) with agitation. As detection Ab, 100 4/well of horseradish peroxidase (HRP)-labeled goat anti-mouse-IgG (Santa Cruz Biotechnology, Cat #sc-2005, 1000x dil.) was added in PBST and incubated for 1 hour at RT. After a final washing step, 100 4/well TMB (Invitrogen, Cat #5B02) was added as substrate, the reaction was stopped after a few minutes with 100 4/well HCl (Fischer, Cat #J/4320/15) and the absorbance was read at 450 nm (BioRad, iMark Microplate reader).
- Anti-FLAG ELISA detected proteins in the supernatant for all mutants, except for C2-(FB-Pep1), as depicted in
FIG. 11 . The variation between the mutants can be explained by the different production or by the different detection efficacy by anti-FLAG mAb after coating. - Next, the recognition of the swap mutants by the anti-C2-5F2.4 antibody was investigated. To this effect, microplates (Maxisorp, NUNC, Cat #439454) were coated overnight with 2 μg/mL anti-C2-5F2.4 in 100 4 PBS. Plates were washed 4 times with PBS with 0.05% Tween-20 and blocked with 200 4 PBS with 0.1% Tween-20 with 1% bovine serum albumin (BSA) (PBST-BSA) for 1 hour at RT. After washing, 100 4 culture supernatant containing mutants were added 20x diluted in PBST-BSA and incubated for 2 hours at RT with agitation. After washing, as
detection antibody 1 μg/mL biotinylated anti-FLAG (clone M2, Sigma-Aldrich) was added in PBST-BSA for 1 hour at RT. The plate was washed and 1 μg/mL streptavidin-POD conjugate (Roche, Cat #11089153001) was added and incubated in the dark for 30 minutes. The plate was washed and 100 4/well TMB (Invitrogen, Cat #5B02) was added as substrate, and reaction was stopped after a few minutes with 100 4/well HCl (Fischer, Cat #J/4320/15). Absorbance was measured at 450 nm on a microplate reader (BioRad, iMark Microplate reader). - Wild type C2 showed clear binding, and loss of binding was only observed for C2-(FB-S2) in which the complement C2 S2 domain (SEQ ID NO: 46) was replaced by the Factor B S2 domain (SEQ ID NO: 54). In contrast, no binding was seen to wild type FB, however strong binding was detected for the mutant FB-(C2-S2) in which the Factor B S2 domain (SEQ ID NO: 54) was replaced by the complement C2 S2 domain (SEQ ID NO: 46), as depicted in
FIG. 12 . These results clearly show that anti-C2-5F2.4 recognizes an epitope on S2 (Sushi domain 2) on C2b. This result also shows that C2-(FB-Pep1) is produced in sufficient quantity. Similar results were obtained when using the mouse IgG2a anti-C2-5F2.4. In addition, similar results were obtained when binding was studied in the presence of 1.25 mM Ca++ in the buffer. Epitope mapping performed by Bioceros BV, using domain swap mutants between human C2 and mouse C2, also led to a similar conclusion. Furthermore, the amino acid sequence ofSushi domain 2 of cynomolgus C2 is completely identical toSushi domain 2 of human C2. - Anti-C2-5F2.4 does not cross-react with mouse C2, and the mouse S2 domain (SEQ ID NO: 58) differs from the human S2 domain (SEQ ID NO: 46) at 10 amino acid positions, as depicted in
FIG. 13 . To investigate which of these ten amino acids is responsible for the mAb binding, fine mapping mutants were generated. The fine mapping constructs contained either the human C2b fragment (huC2b), huC2b with mouse S2 (huC2b-mS2), and ten mutants, each containing one amino acid back-mutation from the mouse sequence to the human sequence. Mutant C2b proteins were generated similar to the domain swap mutants by transient transfection into HEK293 cells. - All mutants were produced and detected by anti-FLAG ELISA, as depicted in
FIG. 14 . Anti-C2-5F2.4 bound to huC2b but not to huC2b with a mouse S2 (huC2b-mS2), as expected. None of the reverse point mutations restored binding of anti-C2-5F2.4, suggesting that the epitope of this mAb is composed of at least two amino acids on the S2 domain, as depicted inFIG. 15 . Similar results were obtained when binding was studied in the presence of 1.25 mM Ca++ in the buffer. - By using the publicly available structural data for human C2b, the position of the ten possible amino acids that might contribute to the epitope of anti-C2-5F2.4 was analyzed, as depicted in
FIG. 16 . This analysis revealed three possible clusters, each composed of three amino acids that could contribute to the epitope. DNA constructs for these cluster mutants were designed and obtained. The cluster mutants were generated by mutating the human C2b S2 amino acids to corresponding mouse C2b S2 amino acids. In each mutant three amino acids were changed. A loss of binding was expected if these three amino acids contributed to the epitope of anti-C2-5F2.4.FIG. 17A shows thatcluster 1 mutant was expressed well and the binding was not affected, and therefore these amino acids do not contribute to the binding. Based on the anti-FLAG ELISA, expression of thecluster 2 mutant was lower, and this resulted in lack of binding by anti-C2-5F2.4.Cluster 3 mutant also was not expressed well, and this most likely explains the lack of binding by anti-C2-5F2.4, as depicted inFIG. 17B . Similar results were obtained when the binding was studied in the presence of 1.25 mM Ca++ in the buffer. From this analysis, the amino acids incluster 1 can be excluded, leaving four possible amino acids incluster 2 andcluster 3. - Domain swap mutants provided strong evidence that the epitope that is recognized by anti-C2-5F2.4 on C2 is located on the
Sushi domain 2 on C2b. Additionally, these experiments suggest that the presence of that domain on FB is sufficient for recognition by anti-C2-5F2.4. Considering that anti-C2-5F2.4 does not react with mouse C2, one or more of the 10 amino acids that differ between human andmouse Sushi 2 domain should be essential for the epitope. By using single amino acid back-mutations, we show that a single amino acid inSushi 2 cannot restore binding. From the experiments performed with the cluster mutants it was concluded that amino acids incluster 1 do not contribute to the epitope of anti-C2-5F2.4. Amino acids ofcluster 2 may contribute to the epitope of anti-C2-5F2.4, but since the expression of this mutant was lower thancluster 1 mutant, it cannot be excluded that the folding ofcluster 2 mutant was not optimal. Since thecluster 3 mutant was not well expressed, it appears likely the mutations affected folding and so the role of the amino acids incluster 3 remains elusive. - All publications and patent documents cited herein are incorporated herein by reference in their entirety.
Claims (21)
1. A monoclonal antibody or antigen-binding fragment thereof that specifically binds to human complement factor C2, wherein said monoclonal antibody or fragment thereof comprises:
a VH domain comprising the amino acid sequence set forth in SEQ ID NO: 3; and
a VL domain comprising the amino acid sequence set forth in SEQ ID NO: 2.
2. The monoclonal antibody or antigen-binding fragment thereof of claim 1 , wherein the monoclonal antibody or antigen-binding fragment thereof comprises a full-length monoclonal antibody.
3. The monoclonal antibody or antigen-binding fragment thereof of claim 1 or claim 2 , wherein the monoclonal antibody comprises a human IgG heavy chain constant domain.
4. The monoclonal antibody or antigen-binding fragment thereof of claim 3 , wherein the heavy chain constant domain comprises a human IgG1 heavy chain constant domain.
5. The monoclonal antibody or antigen-binding fragment thereof of claim 4 , wherein the human IgG1 heavy chain constant domain comprises the amino acid sequence set forth in SEQ ID NO: 4.
6. The monoclonal antibody or antigen-binding fragment thereof of claim 3 , wherein the heavy chain constant domain comprises a human IgG4 heavy chain constant domain.
7. The monoclonal antibody or antigen-binding fragment thereof of claim 6 , wherein the human IgG4 heavy chain constant domain comprises the amino acid sequence set forth in SEQ ID NO: 5.
8. The monoclonal antibody or antigen-binding fragment thereof of claim 3 , wherein the monoclonal antibody comprises a heavy chain comprising the amino acid sequence set forth as SEQ ID NO: 6 and a light chain comprising the amino acid sequence set forth as SEQ ID NO: 7.
9. The monoclonal antibody or antigen-binding fragment thereof of claim 3 , wherein the monoclonal antibody comprises a heavy chain comprising the amino acid sequence set forth as SEQ ID NO: 8 and a light chain comprising the amino acid sequence set forth as SEQ ID NO: 7.
10. A pharmaceutical composition comprising a monoclonal antibody or antigen-binding fragment thereof that specifically binds to human complement factor C2, and a pharmaceutically acceptable carrier, wherein said monoclonal antibody or fragment thereof comprises:
a VH domain comprising the amino acid sequence set forth in SEQ ID NO: 3; and
a VL domain comprising the amino acid sequence set forth in SEQ ID NO: 2.
11. The pharmaceutical composition of claim 10 , wherein the monoclonal antibody or antigen-binding fragment thereof comprises a full-length monoclonal antibody.
12. The pharmaceutical composition of claim 10 or claim 11 , wherein the monoclonal antibody comprises a human IgG heavy chain constant domain.
13. A nucleic acid molecule or plurality of nucleic acid molecules encoding the monoclonal antibody or antigen-binding fragment of any one of claims 1 to 9 .
14. A vector or plurality of vectors comprising the nucleic acid molecule or plurality of nucleic acid molecules of claim 13 .
15. A host cell comprising the nucleic acid molecule or plurality of nucleic acid molecules of claim 13 .
16. A host cell comprising the vector or plurality of vectors of claim 14 .
17. The host cell of any one of claims 14 to 16 , wherein the host cell is a mammalian cell.
18. A method of making a monoclonal antibody or antigen-binding fragment thereof, comprising
culturing a population of host cells of any one of claims 15 to 17 under conditions suitable for expression of the monoclonal antibody or antigen-binding fragment thereof; and
isolating the monoclonal antibody or antigen-binding fragment from the cells.
19. A method of inhibiting classical pathway of complement activation in a subject, comprising administering to a subject in need thereof an effective amount of the monoclonal antibody or antigen-binding fragment thereof of any one of claims 1 to 9 .
20. A method of inhibiting lectin pathway of complement activation in a subject, comprising administering to a subject in need thereof an effective amount of the monoclonal antibody or antigen-binding fragment thereof of any one of claims 1 to 9 .
21. The method of claim 19 or claim 20 , wherein the subject is a human.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US18/330,903 US20240002484A1 (en) | 2018-12-13 | 2023-06-07 | ANTIBODIES TO HUMAN COMPLEMENT FACTOR C2b AND METHODS OF USE |
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201862779102P | 2018-12-13 | 2018-12-13 | |
US16/714,264 US11161900B2 (en) | 2018-12-13 | 2019-12-13 | Antibodies that specifically bind to human complement factor C2b |
US17/491,656 US11591386B2 (en) | 2018-12-13 | 2021-10-01 | Antibodies to human complement C2B |
US17/572,518 US11708403B2 (en) | 2018-12-13 | 2022-01-10 | Antibodies to human complement factor C2B and methods of use |
US18/330,903 US20240002484A1 (en) | 2018-12-13 | 2023-06-07 | ANTIBODIES TO HUMAN COMPLEMENT FACTOR C2b AND METHODS OF USE |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US17/572,518 Division US11708403B2 (en) | 2018-12-13 | 2022-01-10 | Antibodies to human complement factor C2B and methods of use |
Publications (1)
Publication Number | Publication Date |
---|---|
US20240002484A1 true US20240002484A1 (en) | 2024-01-04 |
Family
ID=69143627
Family Applications (4)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/714,264 Active 2040-03-03 US11161900B2 (en) | 2018-12-13 | 2019-12-13 | Antibodies that specifically bind to human complement factor C2b |
US17/491,656 Active US11591386B2 (en) | 2018-12-13 | 2021-10-01 | Antibodies to human complement C2B |
US17/572,518 Active US11708403B2 (en) | 2018-12-13 | 2022-01-10 | Antibodies to human complement factor C2B and methods of use |
US18/330,903 Pending US20240002484A1 (en) | 2018-12-13 | 2023-06-07 | ANTIBODIES TO HUMAN COMPLEMENT FACTOR C2b AND METHODS OF USE |
Family Applications Before (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/714,264 Active 2040-03-03 US11161900B2 (en) | 2018-12-13 | 2019-12-13 | Antibodies that specifically bind to human complement factor C2b |
US17/491,656 Active US11591386B2 (en) | 2018-12-13 | 2021-10-01 | Antibodies to human complement C2B |
US17/572,518 Active US11708403B2 (en) | 2018-12-13 | 2022-01-10 | Antibodies to human complement factor C2B and methods of use |
Country Status (16)
Country | Link |
---|---|
US (4) | US11161900B2 (en) |
EP (2) | EP3893924B1 (en) |
JP (2) | JP7110491B2 (en) |
KR (1) | KR20210100688A (en) |
CN (1) | CN113260375B (en) |
AU (2) | AU2019397614B2 (en) |
BR (1) | BR112021011107A2 (en) |
CA (1) | CA3119655A1 (en) |
EA (1) | EA202191658A1 (en) |
FI (1) | FI3893924T3 (en) |
IL (1) | IL283916A (en) |
LT (1) | LT3893924T (en) |
MX (1) | MX2021006864A (en) |
NZ (1) | NZ776117A (en) |
SG (1) | SG11202105195PA (en) |
WO (1) | WO2020121282A1 (en) |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11161900B2 (en) | 2018-12-13 | 2021-11-02 | Argenx Bvba | Antibodies that specifically bind to human complement factor C2b |
GB2584105B (en) * | 2019-05-21 | 2023-08-02 | Argenx Bvba | Methods of treating neuropathy |
Family Cites Families (33)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU2001249410A1 (en) | 2000-03-23 | 2001-10-03 | Tanox, Inc. | Anti-c2/c2a inhibitors of complement activation |
US8501705B2 (en) | 2003-09-11 | 2013-08-06 | The Board Of Regents Of The University Of Texas System | Methods and materials for treating autoimmune and/or complement mediated diseases and conditions |
WO2006130834A2 (en) | 2005-05-31 | 2006-12-07 | Board Of Regents, The University Of Texas System | IGGl ANTIBODIES WITH MUTATED FC PORTION FOR INCREASED BINDING TO FCRN RECEPTOR AND USES THEREOF |
US9399061B2 (en) | 2006-04-10 | 2016-07-26 | Abbvie Biotechnology Ltd | Methods for determining efficacy of TNF-α inhibitors for treatment of rheumatoid arthritis |
CA2654317A1 (en) * | 2006-06-12 | 2007-12-21 | Trubion Pharmaceuticals, Inc. | Single-chain multivalent binding proteins with effector function |
PL3028716T3 (en) | 2006-10-10 | 2021-03-08 | Regenesance B.V. | Complement inhibition for improved nerve regeneration |
US20090317400A1 (en) * | 2008-05-05 | 2009-12-24 | Krzysztof Masternak | Anti-IL 17A/IL-17F Cross-Reactive Antibodies and Methods of Use Thereof |
AR072999A1 (en) * | 2008-08-11 | 2010-10-06 | Medarex Inc | HUMAN ANTIBODIES THAT JOIN GEN 3 OF LYMPHOCYTARY ACTIVATION (LAG-3) AND THE USES OF THESE |
WO2010056399A1 (en) | 2008-11-17 | 2010-05-20 | Incode Biopharmaceutics, Inc. | Method and composition for modulating the immune system and various inflammatory conditions comprising complement depletors |
WO2011163412A1 (en) * | 2010-06-22 | 2011-12-29 | The Regents Of The University Of Colorado, A Body Corporate | Antibodies to the c3d fragment of complement component 3 |
CN103596985B (en) * | 2011-04-19 | 2016-06-08 | 美国政府(由卫生和人类服务部的部长所代表) | The human monoclonal antibodies special to glypican-3 and purposes thereof |
CN107011443B (en) * | 2011-05-04 | 2021-04-30 | 奥默罗斯公司 | Compositions for inhibiting MASP-2 dependent complement activation |
ES2766755T3 (en) | 2011-09-07 | 2020-06-15 | Univ Pennsylvania | Compstatin analogues with improved pharmacokinetic properties |
WO2014096958A1 (en) | 2012-11-02 | 2014-06-26 | Academisch Medisch Centrum | Inosine monophosphate and salts thereof for use in the treatment of complement-related disorders |
CA2889197A1 (en) * | 2012-11-02 | 2014-05-08 | True North Therapeutics, Inc. | Anti-complement c1s antibodies and uses thereof |
EP2997045A4 (en) | 2013-05-15 | 2016-11-23 | Annexon Inc | Anti-complement factor c1s antibodies and uses thereof |
LT2999714T (en) * | 2013-05-23 | 2020-07-10 | Broteio Pharma B.V. | Binding molecules that bind human complement factor c2 and uses thereof |
CA2859114A1 (en) | 2013-08-29 | 2015-02-28 | International Automotive Components Group North America, Inc. | Formed articles comprising carbon and natural fibers, methods of manufacture and use thereof |
ES2837392T3 (en) * | 2013-10-02 | 2021-06-30 | Medimmune Llc | Neutralizing anti-influenza A antibodies and their uses |
ES2829913T3 (en) * | 2013-10-17 | 2021-06-02 | Omeros Corp | Treatment procedures for conditions associated with MASP-2-dependent complement activation |
SG11201604692UA (en) | 2013-12-12 | 2016-07-28 | Alnylam Pharmaceuticals Inc | Complement component irna compositions and methods of use thereof |
CN107207587B (en) | 2014-11-05 | 2022-04-19 | 安尼艾克松股份有限公司 | Humanized anti-complement factor C1Q antibodies and uses thereof |
US20180327506A1 (en) | 2015-11-19 | 2018-11-15 | Abbvie Stemcentrx Llc | Novel anti-emr2 antibodies and methods of use |
US10723788B2 (en) | 2015-11-24 | 2020-07-28 | Annexon, Inc. | Anti-complement factor C1q Fab fragments and uses thereof |
WO2017132259A1 (en) | 2016-01-25 | 2017-08-03 | Shire Human Genetic Therapies, Inc. | Anti-c5 antibodies with enhanced ph switch |
SG10201911561SA (en) | 2016-01-27 | 2020-02-27 | CSL Behring Lengnau AG | Recombinant igg fc multimers |
WO2017196960A1 (en) | 2016-05-10 | 2017-11-16 | Annexon, Inc. | Anti-complement factor c4/c4b antibodies and uses thereof |
WO2018107109A1 (en) | 2016-12-09 | 2018-06-14 | Abbvie Stemcentrx Llc | Novel anti-kremen2 antibodies and methods of use |
AU2018236267A1 (en) | 2017-03-14 | 2019-09-26 | Bioverativ Usa Inc. | Methods for treating complement-mediated diseases and disorders |
AU2018255938A1 (en) | 2017-04-21 | 2019-10-31 | Staten Biotechnology B.V. | Anti-ApoC3 antibodies and methods of use thereof |
EP3704252A1 (en) | 2017-11-01 | 2020-09-09 | Alnylam Pharmaceuticals, Inc. | Complement component c3 irna compositions and methods of use thereof |
US11161900B2 (en) * | 2018-12-13 | 2021-11-02 | Argenx Bvba | Antibodies that specifically bind to human complement factor C2b |
GB2584105B (en) * | 2019-05-21 | 2023-08-02 | Argenx Bvba | Methods of treating neuropathy |
-
2019
- 2019-12-13 US US16/714,264 patent/US11161900B2/en active Active
- 2019-12-13 CN CN201980082826.8A patent/CN113260375B/en active Active
- 2019-12-13 FI FIEP19832737.1T patent/FI3893924T3/en active
- 2019-12-13 MX MX2021006864A patent/MX2021006864A/en unknown
- 2019-12-13 EP EP19832737.1A patent/EP3893924B1/en active Active
- 2019-12-13 EP EP24164880.7A patent/EP4375297A2/en active Pending
- 2019-12-13 EA EA202191658A patent/EA202191658A1/en unknown
- 2019-12-13 BR BR112021011107A patent/BR112021011107A2/en unknown
- 2019-12-13 SG SG11202105195PA patent/SG11202105195PA/en unknown
- 2019-12-13 NZ NZ776117A patent/NZ776117A/en unknown
- 2019-12-13 CA CA3119655A patent/CA3119655A1/en active Pending
- 2019-12-13 AU AU2019397614A patent/AU2019397614B2/en active Active
- 2019-12-13 JP JP2021533300A patent/JP7110491B2/en active Active
- 2019-12-13 KR KR1020217021353A patent/KR20210100688A/en not_active Application Discontinuation
- 2019-12-13 WO PCT/IB2019/060802 patent/WO2020121282A1/en unknown
- 2019-12-13 LT LTEPPCT/IB2019/060802T patent/LT3893924T/en unknown
-
2021
- 2021-06-10 IL IL283916A patent/IL283916A/en unknown
- 2021-10-01 US US17/491,656 patent/US11591386B2/en active Active
-
2022
- 2022-01-10 US US17/572,518 patent/US11708403B2/en active Active
- 2022-07-20 JP JP2022115252A patent/JP2022160479A/en active Pending
- 2022-12-15 AU AU2022287637A patent/AU2022287637A1/en active Pending
-
2023
- 2023-06-07 US US18/330,903 patent/US20240002484A1/en active Pending
Also Published As
Publication number | Publication date |
---|---|
US20220267424A1 (en) | 2022-08-25 |
US11591386B2 (en) | 2023-02-28 |
JP7110491B2 (en) | 2022-08-01 |
JP2022512223A (en) | 2022-02-02 |
FI3893924T3 (en) | 2024-10-04 |
KR20210100688A (en) | 2021-08-17 |
EP4375297A2 (en) | 2024-05-29 |
NZ776117A (en) | 2024-07-26 |
CN113260375A (en) | 2021-08-13 |
LT3893924T (en) | 2024-10-10 |
JP2022160479A (en) | 2022-10-19 |
WO2020121282A1 (en) | 2020-06-18 |
MX2021006864A (en) | 2021-07-02 |
EP3893924A1 (en) | 2021-10-20 |
EA202191658A1 (en) | 2021-11-03 |
AU2022287637A1 (en) | 2023-02-02 |
US11708403B2 (en) | 2023-07-25 |
SG11202105195PA (en) | 2021-06-29 |
US20220119509A1 (en) | 2022-04-21 |
CA3119655A1 (en) | 2020-06-18 |
US20200239554A1 (en) | 2020-07-30 |
AU2019397614B2 (en) | 2022-09-15 |
EP3893924B1 (en) | 2024-08-21 |
IL283916A (en) | 2021-07-29 |
BR112021011107A2 (en) | 2021-12-14 |
US11161900B2 (en) | 2021-11-02 |
CN113260375B (en) | 2024-10-01 |
AU2019397614A1 (en) | 2021-06-03 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11053306B2 (en) | Fusion protein constructs comprising anti-C3d antibody and factor H | |
US11732047B2 (en) | FcRn antibodies and methods of use thereof | |
TWI837084B (en) | Procoagulant antibodies | |
US20240002484A1 (en) | ANTIBODIES TO HUMAN COMPLEMENT FACTOR C2b AND METHODS OF USE | |
US20140227259A1 (en) | Modified proteins and peptides | |
US20240301043A1 (en) | METHODS OF TREATING COMPLEMENT MEDIATED DISEASES WITH FUSION PROTEIN CONSTRUCTS COMPRISING ANTI-C3d ANTIBODY AND A COMPLEMENT MODULATOR | |
US20210230310A1 (en) | Antibodies binding to phosphorylcholine (pc) and/or pc conjugates | |
KR20210040389A (en) | Improved clotting-promoting antibodies | |
CA3141778A1 (en) | Soluble complement receptor type 1 variant conjugates and uses thereof | |
JP2022545925A (en) | Anti-TFPI monoclonal antibody | |
EA046598B1 (en) | ANTIBODIES AGAINST HUMAN COMPLEMENT FACTOR C2B AND METHODS OF APPLICATION |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: ARGENX BV, BELGIUM Free format text: CHANGE OF NAME;ASSIGNOR:ARGENX BVBA;REEL/FRAME:065972/0185 Effective date: 20200603 Owner name: ARGENX BVBA, BELGIUM Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:BLANCHETOT, CHRISTOPHE;DE HAARD, HANS;SIGNING DATES FROM 20200106 TO 20200121;REEL/FRAME:065972/0135 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |