US20230357347A1 - Modulators of g-protein coupled receptors - Google Patents
Modulators of g-protein coupled receptors Download PDFInfo
- Publication number
- US20230357347A1 US20230357347A1 US18/087,063 US202218087063A US2023357347A1 US 20230357347 A1 US20230357347 A1 US 20230357347A1 US 202218087063 A US202218087063 A US 202218087063A US 2023357347 A1 US2023357347 A1 US 2023357347A1
- Authority
- US
- United States
- Prior art keywords
- compound
- independently selected
- ring
- formula
- group
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 title description 13
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 title description 13
- 150000001875 compounds Chemical class 0.000 claims abstract description 186
- 238000000034 method Methods 0.000 claims abstract description 54
- 150000003839 salts Chemical class 0.000 claims abstract description 52
- 125000006413 ring segment Chemical group 0.000 claims description 131
- 125000004169 (C1-C6) alkyl group Chemical group 0.000 claims description 80
- 150000001413 amino acids Chemical group 0.000 claims description 79
- 229910052757 nitrogen Inorganic materials 0.000 claims description 75
- 229910052760 oxygen Inorganic materials 0.000 claims description 48
- 229910052717 sulfur Inorganic materials 0.000 claims description 46
- 125000002950 monocyclic group Chemical group 0.000 claims description 44
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 44
- 125000004178 (C1-C4) alkyl group Chemical group 0.000 claims description 43
- 229920006395 saturated elastomer Polymers 0.000 claims description 42
- 208000008589 Obesity Diseases 0.000 claims description 33
- 235000020824 obesity Nutrition 0.000 claims description 32
- 229910052799 carbon Inorganic materials 0.000 claims description 29
- 125000004432 carbon atom Chemical group C* 0.000 claims description 29
- 208000001072 type 2 diabetes mellitus Diseases 0.000 claims description 26
- 125000000229 (C1-C4)alkoxy group Chemical group 0.000 claims description 21
- 125000001433 C-terminal amino-acid group Chemical group 0.000 claims description 20
- 125000002252 acyl group Chemical group 0.000 claims description 20
- 125000005842 heteroatom Chemical group 0.000 claims description 20
- 125000004767 (C1-C4) haloalkoxy group Chemical group 0.000 claims description 19
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 17
- 125000004093 cyano group Chemical group *C#N 0.000 claims description 15
- 125000004765 (C1-C4) haloalkyl group Chemical group 0.000 claims description 13
- 125000004433 nitrogen atom Chemical group N* 0.000 claims description 10
- 239000008194 pharmaceutical composition Substances 0.000 claims description 10
- 235000005911 diet Nutrition 0.000 claims description 6
- 230000037213 diet Effects 0.000 claims description 6
- 238000002560 therapeutic procedure Methods 0.000 claims description 4
- 238000009207 exercise therapy Methods 0.000 claims description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 126
- 108010086246 Glucagon-Like Peptide-1 Receptor Proteins 0.000 abstract description 106
- 108010036598 gastric inhibitory polypeptide receptor Proteins 0.000 abstract description 82
- 150000005829 chemical entities Chemical class 0.000 abstract description 75
- 102100032882 Glucagon-like peptide 1 receptor Human genes 0.000 abstract description 74
- 208000035475 disorder Diseases 0.000 abstract description 67
- 201000010099 disease Diseases 0.000 abstract description 59
- 239000000203 mixture Substances 0.000 abstract description 38
- 230000000694 effects Effects 0.000 abstract description 37
- 102000000072 beta-Arrestins Human genes 0.000 abstract description 36
- 108010080367 beta-Arrestins Proteins 0.000 abstract description 36
- 230000011664 signaling Effects 0.000 abstract description 28
- 238000011282 treatment Methods 0.000 abstract description 18
- 208000024891 symptom Diseases 0.000 abstract description 17
- 230000009286 beneficial effect Effects 0.000 abstract description 11
- 239000003446 ligand Substances 0.000 abstract description 10
- 230000007170 pathology Effects 0.000 abstract description 10
- 102100039997 Gastric inhibitory polypeptide receptor Human genes 0.000 abstract description 9
- 230000008484 agonism Effects 0.000 abstract description 8
- 230000036961 partial effect Effects 0.000 abstract description 6
- 230000002265 prevention Effects 0.000 abstract description 6
- 230000008485 antagonism Effects 0.000 abstract description 5
- 229940002612 prodrug Drugs 0.000 abstract description 5
- 239000000651 prodrug Substances 0.000 abstract description 5
- 101000886866 Homo sapiens Gastric inhibitory polypeptide receptor Proteins 0.000 abstract 3
- 239000011541 reaction mixture Substances 0.000 description 132
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 123
- 235000001014 amino acid Nutrition 0.000 description 88
- 229940024606 amino acid Drugs 0.000 description 88
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 83
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 70
- 238000002330 electrospray ionisation mass spectrometry Methods 0.000 description 69
- 239000000243 solution Substances 0.000 description 65
- 230000015572 biosynthetic process Effects 0.000 description 55
- -1 carrier Substances 0.000 description 55
- 238000003786 synthesis reaction Methods 0.000 description 51
- 239000003814 drug Substances 0.000 description 47
- 229910001868 water Inorganic materials 0.000 description 47
- 235000002639 sodium chloride Nutrition 0.000 description 43
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 43
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical class CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 42
- 206010012812 Diffuse cutaneous mastocytosis Diseases 0.000 description 40
- DTQVDTLACAAQTR-UHFFFAOYSA-N trifluoroacetic acid Substances OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 39
- FUOOLUPWFVMBKG-UHFFFAOYSA-N 2-Aminoisobutyric acid Chemical compound CC(C)(N)C(O)=O FUOOLUPWFVMBKG-UHFFFAOYSA-N 0.000 description 38
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 37
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 37
- 238000010898 silica gel chromatography Methods 0.000 description 37
- 239000000556 agonist Substances 0.000 description 35
- 229940124597 therapeutic agent Drugs 0.000 description 32
- 229920001223 polyethylene glycol Chemical group 0.000 description 31
- 208000008338 non-alcoholic fatty liver disease Diseases 0.000 description 29
- 239000002202 Polyethylene glycol Chemical group 0.000 description 28
- RAHZWNYVWXNFOC-UHFFFAOYSA-N Sulphur dioxide Chemical compound O=S=O RAHZWNYVWXNFOC-UHFFFAOYSA-N 0.000 description 28
- 239000000284 extract Substances 0.000 description 28
- 239000003112 inhibitor Substances 0.000 description 28
- 239000007787 solid Substances 0.000 description 28
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 27
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 27
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 27
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 27
- 239000012267 brine Substances 0.000 description 26
- 206010012601 diabetes mellitus Diseases 0.000 description 26
- 238000002360 preparation method Methods 0.000 description 26
- HPALAKNZSZLMCH-UHFFFAOYSA-M sodium;chloride;hydrate Chemical compound O.[Na+].[Cl-] HPALAKNZSZLMCH-UHFFFAOYSA-M 0.000 description 26
- 108010004460 Gastric Inhibitory Polypeptide Proteins 0.000 description 24
- 102100039994 Gastric inhibitory polypeptide Human genes 0.000 description 24
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 24
- 239000012230 colorless oil Substances 0.000 description 24
- 238000002953 preparative HPLC Methods 0.000 description 24
- PMZURENOXWZQFD-UHFFFAOYSA-L Sodium Sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O PMZURENOXWZQFD-UHFFFAOYSA-L 0.000 description 23
- 239000003795 chemical substances by application Substances 0.000 description 23
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 23
- 229910052938 sodium sulfate Inorganic materials 0.000 description 23
- RIIUAPMWDSRBSH-UHFFFAOYSA-N 1,4-oxathiane-2,6-dione Chemical compound O=C1CSCC(=O)O1 RIIUAPMWDSRBSH-UHFFFAOYSA-N 0.000 description 22
- 125000002619 bicyclic group Chemical group 0.000 description 22
- 125000000623 heterocyclic group Chemical group 0.000 description 22
- DTHNMHAUYICORS-KTKZVXAJSA-N Glucagon-like peptide 1 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 DTHNMHAUYICORS-KTKZVXAJSA-N 0.000 description 21
- 125000002947 alkylene group Chemical group 0.000 description 21
- 230000000670 limiting effect Effects 0.000 description 21
- LMDZBCPBFSXMTL-UHFFFAOYSA-N 1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide Substances CCN=C=NCCCN(C)C LMDZBCPBFSXMTL-UHFFFAOYSA-N 0.000 description 20
- 102100040918 Pro-glucagon Human genes 0.000 description 20
- 125000000217 alkyl group Chemical group 0.000 description 20
- 125000001072 heteroaryl group Chemical group 0.000 description 20
- IXCSERBJSXMMFS-UHFFFAOYSA-N hydrogen chloride Substances Cl.Cl IXCSERBJSXMMFS-UHFFFAOYSA-N 0.000 description 20
- 229910000041 hydrogen chloride Inorganic materials 0.000 description 20
- 125000005913 (C3-C6) cycloalkyl group Chemical group 0.000 description 19
- KXDHJXZQYSOELW-UHFFFAOYSA-M Carbamate Chemical compound NC([O-])=O KXDHJXZQYSOELW-UHFFFAOYSA-M 0.000 description 19
- 125000003118 aryl group Chemical group 0.000 description 19
- 101710198884 GATA-type zinc finger protein 1 Proteins 0.000 description 18
- WYURNTSHIVDZCO-UHFFFAOYSA-N Tetrahydrofuran Chemical compound C1CCOC1 WYURNTSHIVDZCO-UHFFFAOYSA-N 0.000 description 18
- 230000004048 modification Effects 0.000 description 18
- 238000012986 modification Methods 0.000 description 18
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 17
- 239000008103 glucose Substances 0.000 description 17
- XKJCHHZQLQNZHY-UHFFFAOYSA-N phthalimide Chemical compound C1=CC=C2C(=O)NC(=O)C2=C1 XKJCHHZQLQNZHY-UHFFFAOYSA-N 0.000 description 17
- 230000002829 reductive effect Effects 0.000 description 17
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 16
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 16
- 239000007832 Na2SO4 Substances 0.000 description 16
- 150000001721 carbon Chemical group 0.000 description 16
- 150000005690 diesters Chemical class 0.000 description 16
- 206010053219 non-alcoholic steatohepatitis Diseases 0.000 description 16
- 125000006273 (C1-C3) alkyl group Chemical group 0.000 description 15
- 238000006467 substitution reaction Methods 0.000 description 15
- 125000006376 (C3-C10) cycloalkyl group Chemical group 0.000 description 14
- 125000006586 (C3-C10) cycloalkylene group Chemical group 0.000 description 14
- 125000006585 (C6-C10) arylene group Chemical group 0.000 description 14
- PAQZWJGSJMLPMG-UHFFFAOYSA-N 2,4,6-tripropyl-1,3,5,2$l^{5},4$l^{5},6$l^{5}-trioxatriphosphinane 2,4,6-trioxide Chemical compound CCCP1(=O)OP(=O)(CCC)OP(=O)(CCC)O1 PAQZWJGSJMLPMG-UHFFFAOYSA-N 0.000 description 14
- 239000005557 antagonist Substances 0.000 description 14
- 210000004899 c-terminal region Anatomy 0.000 description 14
- 229940079593 drug Drugs 0.000 description 14
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 14
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 13
- 102000004877 Insulin Human genes 0.000 description 13
- 108090001061 Insulin Proteins 0.000 description 13
- 239000002253 acid Substances 0.000 description 13
- 229940125396 insulin Drugs 0.000 description 13
- 238000000746 purification Methods 0.000 description 13
- 125000001424 substituent group Chemical group 0.000 description 13
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 12
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 12
- 150000001412 amines Chemical class 0.000 description 12
- 229910052739 hydrogen Inorganic materials 0.000 description 12
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 12
- 125000006588 heterocycloalkylene group Chemical group 0.000 description 11
- 239000004031 partial agonist Substances 0.000 description 11
- 239000002002 slurry Substances 0.000 description 11
- XBNGYFFABRKICK-UHFFFAOYSA-N 2,3,4,5,6-pentafluorophenol Chemical compound OC1=C(F)C(F)=C(F)C(F)=C1F XBNGYFFABRKICK-UHFFFAOYSA-N 0.000 description 10
- 125000004215 2,4-difluorophenyl group Chemical group [H]C1=C([H])C(*)=C(F)C([H])=C1F 0.000 description 10
- 206010006895 Cachexia Diseases 0.000 description 10
- 206010022489 Insulin Resistance Diseases 0.000 description 10
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 10
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 10
- 230000004913 activation Effects 0.000 description 10
- 150000001408 amides Chemical class 0.000 description 10
- 230000008878 coupling Effects 0.000 description 10
- 238000010168 coupling process Methods 0.000 description 10
- 238000005859 coupling reaction Methods 0.000 description 10
- 150000002148 esters Chemical class 0.000 description 10
- 208000010706 fatty liver disease Diseases 0.000 description 10
- IZUPBVBPLAPZRR-UHFFFAOYSA-N pentachloro-phenol Natural products OC1=C(Cl)C(Cl)=C(Cl)C(Cl)=C1Cl IZUPBVBPLAPZRR-UHFFFAOYSA-N 0.000 description 10
- 235000018102 proteins Nutrition 0.000 description 10
- 102000004169 proteins and genes Human genes 0.000 description 10
- 108090000623 proteins and genes Proteins 0.000 description 10
- 239000000725 suspension Substances 0.000 description 10
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 9
- 206010063659 Aversion Diseases 0.000 description 9
- 208000010392 Bone Fractures Diseases 0.000 description 9
- 125000000041 C6-C10 aryl group Chemical group 0.000 description 9
- 102000016622 Dipeptidyl Peptidase 4 Human genes 0.000 description 9
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 9
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 9
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 9
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 9
- 208000018737 Parkinson disease Diseases 0.000 description 9
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 9
- 239000006185 dispersion Substances 0.000 description 9
- 150000003949 imides Chemical class 0.000 description 9
- 239000012074 organic phase Substances 0.000 description 9
- 208000024827 Alzheimer disease Diseases 0.000 description 8
- NLXLAEXVIDQMFP-UHFFFAOYSA-N Ammonia chloride Chemical compound [NH4+].[Cl-] NLXLAEXVIDQMFP-UHFFFAOYSA-N 0.000 description 8
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 8
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 8
- 208000001145 Metabolic Syndrome Diseases 0.000 description 8
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 8
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 8
- 125000004429 atom Chemical group 0.000 description 8
- 238000006243 chemical reaction Methods 0.000 description 8
- 125000000753 cycloalkyl group Chemical group 0.000 description 8
- 239000002552 dosage form Substances 0.000 description 8
- 239000012634 fragment Substances 0.000 description 8
- 239000000543 intermediate Substances 0.000 description 8
- 230000001404 mediated effect Effects 0.000 description 8
- 239000003921 oil Substances 0.000 description 8
- 125000000843 phenylene group Chemical group C1(=C(C=CC=C1)*)* 0.000 description 8
- HYAFETHFCAUJAY-UHFFFAOYSA-N pioglitazone Chemical compound N1=CC(CC)=CC=C1CCOC(C=C1)=CC=C1CC1C(=O)NC(=O)S1 HYAFETHFCAUJAY-UHFFFAOYSA-N 0.000 description 8
- 210000001519 tissue Anatomy 0.000 description 8
- RYHBNJHYFVUHQT-UHFFFAOYSA-N 1,4-Dioxane Chemical compound C1COCCO1 RYHBNJHYFVUHQT-UHFFFAOYSA-N 0.000 description 7
- OFOBLEOULBTSOW-UHFFFAOYSA-N Malonic acid Chemical compound OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 7
- 206010028813 Nausea Diseases 0.000 description 7
- 206010028980 Neoplasm Diseases 0.000 description 7
- 201000000690 abdominal obesity-metabolic syndrome Diseases 0.000 description 7
- 125000000539 amino acid group Chemical group 0.000 description 7
- 125000006295 amino methylene group Chemical group [H]N(*)C([H])([H])* 0.000 description 7
- 239000002775 capsule Substances 0.000 description 7
- 208000026106 cerebrovascular disease Diseases 0.000 description 7
- 208000010877 cognitive disease Diseases 0.000 description 7
- 208000029078 coronary artery disease Diseases 0.000 description 7
- VFRSADQPWYCXDG-LEUCUCNGSA-N ethyl (2s,5s)-5-methylpyrrolidine-2-carboxylate;2,2,2-trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F.CCOC(=O)[C@@H]1CC[C@H](C)N1 VFRSADQPWYCXDG-LEUCUCNGSA-N 0.000 description 7
- 235000019197 fats Nutrition 0.000 description 7
- 208000014674 injury Diseases 0.000 description 7
- 230000008693 nausea Effects 0.000 description 7
- 235000019198 oils Nutrition 0.000 description 7
- 102000004196 processed proteins & peptides Human genes 0.000 description 7
- 230000007115 recruitment Effects 0.000 description 7
- 235000011152 sodium sulphate Nutrition 0.000 description 7
- 238000003756 stirring Methods 0.000 description 7
- 230000001225 therapeutic effect Effects 0.000 description 7
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 6
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 6
- 150000008574 D-amino acids Chemical class 0.000 description 6
- 208000002705 Glucose Intolerance Diseases 0.000 description 6
- 239000007821 HATU Substances 0.000 description 6
- 208000031226 Hyperlipidaemia Diseases 0.000 description 6
- 206010020772 Hypertension Diseases 0.000 description 6
- 206010061218 Inflammation Diseases 0.000 description 6
- PVNIIMVLHYAWGP-UHFFFAOYSA-N Niacin Chemical compound OC(=O)C1=CC=CN=C1 PVNIIMVLHYAWGP-UHFFFAOYSA-N 0.000 description 6
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical class OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 6
- YASAKCUCGLMORW-UHFFFAOYSA-N Rosiglitazone Chemical compound C=1C=CC=NC=1N(C)CCOC(C=C1)=CC=C1CC1SC(=O)NC1=O YASAKCUCGLMORW-UHFFFAOYSA-N 0.000 description 6
- 229940100389 Sulfonylurea Drugs 0.000 description 6
- 230000009471 action Effects 0.000 description 6
- 238000003556 assay Methods 0.000 description 6
- 210000004369 blood Anatomy 0.000 description 6
- 239000008280 blood Substances 0.000 description 6
- 230000004097 bone metabolism Effects 0.000 description 6
- 201000011510 cancer Diseases 0.000 description 6
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 6
- 230000004891 conditioned taste aversion Effects 0.000 description 6
- GVJHHUAWPYXKBD-UHFFFAOYSA-N d-alpha-tocopherol Natural products OC1=C(C)C(C)=C2OC(CCCC(C)CCCC(C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-UHFFFAOYSA-N 0.000 description 6
- 238000009472 formulation Methods 0.000 description 6
- 125000005843 halogen group Chemical group 0.000 description 6
- 210000004185 liver Anatomy 0.000 description 6
- SCVFZCLFOSHCOH-UHFFFAOYSA-M potassium acetate Chemical compound [K+].CC([O-])=O SCVFZCLFOSHCOH-UHFFFAOYSA-M 0.000 description 6
- 102000005962 receptors Human genes 0.000 description 6
- 108020003175 receptors Proteins 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- 208000011580 syndromic disease Diseases 0.000 description 6
- 239000003826 tablet Substances 0.000 description 6
- AOCSUUGBCMTKJH-UHFFFAOYSA-N tert-butyl n-(2-aminoethyl)carbamate Chemical compound CC(C)(C)OC(=O)NCCN AOCSUUGBCMTKJH-UHFFFAOYSA-N 0.000 description 6
- QAEDZJGFFMLHHQ-UHFFFAOYSA-N trifluoroacetic anhydride Chemical compound FC(F)(F)C(=O)OC(=O)C(F)(F)F QAEDZJGFFMLHHQ-UHFFFAOYSA-N 0.000 description 6
- RIOQSEWOXXDEQQ-UHFFFAOYSA-N triphenylphosphine Chemical compound C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1 RIOQSEWOXXDEQQ-UHFFFAOYSA-N 0.000 description 6
- 241000283690 Bos taurus Species 0.000 description 5
- 229920000858 Cyclodextrin Polymers 0.000 description 5
- 108010010803 Gelatin Proteins 0.000 description 5
- 101000930822 Giardia intestinalis Dipeptidyl-peptidase 4 Proteins 0.000 description 5
- 239000004471 Glycine Substances 0.000 description 5
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 5
- 208000001132 Osteoporosis Diseases 0.000 description 5
- 239000008346 aqueous phase Substances 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- 230000004071 biological effect Effects 0.000 description 5
- 210000000988 bone and bone Anatomy 0.000 description 5
- 239000001913 cellulose Substances 0.000 description 5
- 229920002678 cellulose Polymers 0.000 description 5
- 235000010980 cellulose Nutrition 0.000 description 5
- 239000006071 cream Substances 0.000 description 5
- 235000014113 dietary fatty acids Nutrition 0.000 description 5
- 229930195729 fatty acid Natural products 0.000 description 5
- 239000000194 fatty acid Substances 0.000 description 5
- 239000008273 gelatin Substances 0.000 description 5
- 229920000159 gelatin Polymers 0.000 description 5
- 235000019322 gelatine Nutrition 0.000 description 5
- 235000011852 gelatine desserts Nutrition 0.000 description 5
- 235000011187 glycerol Nutrition 0.000 description 5
- 125000005549 heteroarylene group Chemical group 0.000 description 5
- 230000001771 impaired effect Effects 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 230000001965 increasing effect Effects 0.000 description 5
- 230000004054 inflammatory process Effects 0.000 description 5
- 239000004615 ingredient Substances 0.000 description 5
- 239000007788 liquid Substances 0.000 description 5
- 208000019423 liver disease Diseases 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 239000002480 mineral oil Substances 0.000 description 5
- 235000010446 mineral oil Nutrition 0.000 description 5
- 210000000496 pancreas Anatomy 0.000 description 5
- 239000012071 phase Substances 0.000 description 5
- 239000000843 powder Substances 0.000 description 5
- 201000009104 prediabetes syndrome Diseases 0.000 description 5
- 230000004044 response Effects 0.000 description 5
- 229910000104 sodium hydride Inorganic materials 0.000 description 5
- 231100000240 steatosis hepatitis Toxicity 0.000 description 5
- 125000003831 tetrazolyl group Chemical group 0.000 description 5
- UIRMSBGEEQIABR-UHFFFAOYSA-N 2-(2-aminoethyl)isoindole-1,3-dione;hydrochloride Chemical compound Cl.C1=CC=C2C(=O)N(CCN)C(=O)C2=C1 UIRMSBGEEQIABR-UHFFFAOYSA-N 0.000 description 4
- VHYFNPMBLIVWCW-UHFFFAOYSA-N 4-Dimethylaminopyridine Chemical compound CN(C)C1=CC=NC=C1 VHYFNPMBLIVWCW-UHFFFAOYSA-N 0.000 description 4
- 208000023275 Autoimmune disease Diseases 0.000 description 4
- GJSURZIOUXUGAL-UHFFFAOYSA-N Clonidine Chemical compound ClC1=CC=CC(Cl)=C1NC1=NCCN1 GJSURZIOUXUGAL-UHFFFAOYSA-N 0.000 description 4
- QOSSAOTZNIDXMA-UHFFFAOYSA-N Dicylcohexylcarbodiimide Chemical compound C1CCCCC1N=C=NC1CCCCC1 QOSSAOTZNIDXMA-UHFFFAOYSA-N 0.000 description 4
- 108010067722 Dipeptidyl Peptidase 4 Proteins 0.000 description 4
- 208000032928 Dyslipidaemia Diseases 0.000 description 4
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 4
- 108010011459 Exenatide Proteins 0.000 description 4
- 208000004930 Fatty Liver Diseases 0.000 description 4
- 206010051066 Gastrointestinal stromal tumour Diseases 0.000 description 4
- 102000030595 Glucokinase Human genes 0.000 description 4
- 108010021582 Glucokinase Proteins 0.000 description 4
- 206010019280 Heart failures Diseases 0.000 description 4
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical compound Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 4
- 206010056997 Impaired fasting glucose Diseases 0.000 description 4
- 208000017170 Lipid metabolism disease Diseases 0.000 description 4
- YSDQQAXHVYUZIW-QCIJIYAXSA-N Liraglutide Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCNC(=O)CC[C@H](NC(=O)CCCCCCCCCCCCCCC)C(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=C(O)C=C1 YSDQQAXHVYUZIW-QCIJIYAXSA-N 0.000 description 4
- 108010019598 Liraglutide Proteins 0.000 description 4
- 239000004472 Lysine Substances 0.000 description 4
- 208000029725 Metabolic bone disease Diseases 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 4
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 4
- 208000012902 Nervous system disease Diseases 0.000 description 4
- 206010049088 Osteopenia Diseases 0.000 description 4
- 102000001708 Protein Isoforms Human genes 0.000 description 4
- 108010029485 Protein Isoforms Proteins 0.000 description 4
- JUJWROOIHBZHMG-UHFFFAOYSA-N Pyridine Chemical compound C1=CC=NC=C1 JUJWROOIHBZHMG-UHFFFAOYSA-N 0.000 description 4
- KEAYESYHFKHZAL-UHFFFAOYSA-N Sodium Chemical compound [Na] KEAYESYHFKHZAL-UHFFFAOYSA-N 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 4
- 208000030886 Traumatic Brain injury Diseases 0.000 description 4
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 4
- 230000002378 acidificating effect Effects 0.000 description 4
- WNLRTRBMVRJNCN-UHFFFAOYSA-N adipic acid Chemical compound OC(=O)CCCCC(O)=O WNLRTRBMVRJNCN-UHFFFAOYSA-N 0.000 description 4
- 206010002022 amyloidosis Diseases 0.000 description 4
- 206010002026 amyotrophic lateral sclerosis Diseases 0.000 description 4
- 239000002585 base Substances 0.000 description 4
- 239000002876 beta blocker Substances 0.000 description 4
- 229940097320 beta blocking agent Drugs 0.000 description 4
- 230000037396 body weight Effects 0.000 description 4
- 230000009992 cAMP activation Effects 0.000 description 4
- 229960002896 clonidine Drugs 0.000 description 4
- 230000006378 damage Effects 0.000 description 4
- 230000003247 decreasing effect Effects 0.000 description 4
- 238000010511 deprotection reaction Methods 0.000 description 4
- KPUWHANPEXNPJT-UHFFFAOYSA-N disiloxane Chemical compound [SiH3]O[SiH3] KPUWHANPEXNPJT-UHFFFAOYSA-N 0.000 description 4
- 238000009826 distribution Methods 0.000 description 4
- 229960001519 exenatide Drugs 0.000 description 4
- 150000004665 fatty acids Chemical class 0.000 description 4
- 239000000706 filtrate Substances 0.000 description 4
- 238000003818 flash chromatography Methods 0.000 description 4
- 230000037406 food intake Effects 0.000 description 4
- BTCSSZJGUNDROE-UHFFFAOYSA-N gamma-aminobutyric acid Chemical compound NCCCC(O)=O BTCSSZJGUNDROE-UHFFFAOYSA-N 0.000 description 4
- 201000011243 gastrointestinal stromal tumor Diseases 0.000 description 4
- 210000001035 gastrointestinal tract Anatomy 0.000 description 4
- MASNOZXLGMXCHN-ZLPAWPGGSA-N glucagon Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 MASNOZXLGMXCHN-ZLPAWPGGSA-N 0.000 description 4
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 4
- 125000004438 haloalkoxy group Chemical group 0.000 description 4
- 238000004128 high performance liquid chromatography Methods 0.000 description 4
- 239000012456 homogeneous solution Substances 0.000 description 4
- 229940088597 hormone Drugs 0.000 description 4
- 239000005556 hormone Substances 0.000 description 4
- CGIGDMFJXJATDK-UHFFFAOYSA-N indomethacin Chemical compound CC1=C(CC(O)=O)C2=CC(OC)=CC=C2N1C(=O)C1=CC=C(Cl)C=C1 CGIGDMFJXJATDK-UHFFFAOYSA-N 0.000 description 4
- 208000015181 infectious disease Diseases 0.000 description 4
- 230000005764 inhibitory process Effects 0.000 description 4
- 229910052740 iodine Inorganic materials 0.000 description 4
- 208000017169 kidney disease Diseases 0.000 description 4
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 4
- NRYBAZVQPHGZNS-ZSOCWYAHSA-N leptin Chemical compound O=C([C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC(C)C)CCSC)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CS)C(O)=O NRYBAZVQPHGZNS-ZSOCWYAHSA-N 0.000 description 4
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 4
- 229960002701 liraglutide Drugs 0.000 description 4
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 4
- 208000027061 mild cognitive impairment Diseases 0.000 description 4
- 210000005036 nerve Anatomy 0.000 description 4
- 235000001968 nicotinic acid Nutrition 0.000 description 4
- 239000011664 nicotinic acid Substances 0.000 description 4
- 208000030613 peripheral artery disease Diseases 0.000 description 4
- DHHVAGZRUROJKS-UHFFFAOYSA-N phentermine Chemical compound CC(C)(N)CC1=CC=CC=C1 DHHVAGZRUROJKS-UHFFFAOYSA-N 0.000 description 4
- 229960005095 pioglitazone Drugs 0.000 description 4
- 102000040430 polynucleotide Human genes 0.000 description 4
- 108091033319 polynucleotide Proteins 0.000 description 4
- 239000002157 polynucleotide Substances 0.000 description 4
- 229920001184 polypeptide Polymers 0.000 description 4
- BWHMMNNQKKPAPP-UHFFFAOYSA-L potassium carbonate Chemical compound [K+].[K+].[O-]C([O-])=O BWHMMNNQKKPAPP-UHFFFAOYSA-L 0.000 description 4
- 230000003389 potentiating effect Effects 0.000 description 4
- VVWRJUBEIPHGQF-MDZDMXLPSA-N propan-2-yl (ne)-n-propan-2-yloxycarbonyliminocarbamate Chemical compound CC(C)OC(=O)\N=N\C(=O)OC(C)C VVWRJUBEIPHGQF-MDZDMXLPSA-N 0.000 description 4
- 229960004063 propylene glycol Drugs 0.000 description 4
- 230000004224 protection Effects 0.000 description 4
- 229910052703 rhodium Inorganic materials 0.000 description 4
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 4
- WBHQBSYUUJJSRZ-UHFFFAOYSA-M sodium bisulfate Chemical compound [Na+].OS([O-])(=O)=O WBHQBSYUUJJSRZ-UHFFFAOYSA-M 0.000 description 4
- 229910000342 sodium bisulfate Inorganic materials 0.000 description 4
- 239000012312 sodium hydride Substances 0.000 description 4
- 239000007909 solid dosage form Substances 0.000 description 4
- 208000011117 substance-related disease Diseases 0.000 description 4
- 229940124530 sulfonamide Drugs 0.000 description 4
- YROXIXLRRCOBKF-UHFFFAOYSA-N sulfonylurea Chemical compound OC(=N)N=S(=O)=O YROXIXLRRCOBKF-UHFFFAOYSA-N 0.000 description 4
- 239000006228 supernatant Substances 0.000 description 4
- 238000001356 surgical procedure Methods 0.000 description 4
- TZRQZPMQUXEZMC-UHFFFAOYSA-N tert-butyl n-(2-bromoethyl)carbamate Chemical compound CC(C)(C)OC(=O)NCCBr TZRQZPMQUXEZMC-UHFFFAOYSA-N 0.000 description 4
- FPGGTKZVZWFYPV-UHFFFAOYSA-M tetrabutylammonium fluoride Chemical compound [F-].CCCC[N+](CCCC)(CCCC)CCCC FPGGTKZVZWFYPV-UHFFFAOYSA-M 0.000 description 4
- UMGDCJDMYOKAJW-UHFFFAOYSA-N thiourea Chemical compound NC(N)=S UMGDCJDMYOKAJW-UHFFFAOYSA-N 0.000 description 4
- 230000008733 trauma Effects 0.000 description 4
- 229910052720 vanadium Inorganic materials 0.000 description 4
- 239000003981 vehicle Substances 0.000 description 4
- 229910052727 yttrium Inorganic materials 0.000 description 4
- NWZSZGALRFJKBT-KNIFDHDWSA-N (2s)-2,6-diaminohexanoic acid;(2s)-2-hydroxybutanedioic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O.NCCCC[C@H](N)C(O)=O NWZSZGALRFJKBT-KNIFDHDWSA-N 0.000 description 3
- 125000000027 (C1-C10) alkoxy group Chemical group 0.000 description 3
- 125000003161 (C1-C6) alkylene group Chemical group 0.000 description 3
- QCQCHGYLTSGIGX-GHXANHINSA-N 4-[[(3ar,5ar,5br,7ar,9s,11ar,11br,13as)-5a,5b,8,8,11a-pentamethyl-3a-[(5-methylpyridine-3-carbonyl)amino]-2-oxo-1-propan-2-yl-4,5,6,7,7a,9,10,11,11b,12,13,13a-dodecahydro-3h-cyclopenta[a]chrysen-9-yl]oxy]-2,2-dimethyl-4-oxobutanoic acid Chemical compound N([C@@]12CC[C@@]3(C)[C@]4(C)CC[C@H]5C(C)(C)[C@@H](OC(=O)CC(C)(C)C(O)=O)CC[C@]5(C)[C@H]4CC[C@@H]3C1=C(C(C2)=O)C(C)C)C(=O)C1=CN=CC(C)=C1 QCQCHGYLTSGIGX-GHXANHINSA-N 0.000 description 3
- 208000004611 Abdominal Obesity Diseases 0.000 description 3
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 3
- 208000019901 Anxiety disease Diseases 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 3
- BSYNRYMUTXBXSQ-UHFFFAOYSA-N Aspirin Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O BSYNRYMUTXBXSQ-UHFFFAOYSA-N 0.000 description 3
- 208000020084 Bone disease Diseases 0.000 description 3
- 108090000715 Brain-derived neurotrophic factor Proteins 0.000 description 3
- 102000004219 Brain-derived neurotrophic factor Human genes 0.000 description 3
- GHOSNRCGJFBJIB-UHFFFAOYSA-N Candesartan cilexetil Chemical compound C=12N(CC=3C=CC(=CC=3)C=3C(=CC=CC=3)C3=NNN=N3)C(OCC)=NC2=CC=CC=1C(=O)OC(C)OC(=O)OC1CCCCC1 GHOSNRCGJFBJIB-UHFFFAOYSA-N 0.000 description 3
- 208000024172 Cardiovascular disease Diseases 0.000 description 3
- 206010009944 Colon cancer Diseases 0.000 description 3
- 102000002148 Diacylglycerol O-acyltransferase Human genes 0.000 description 3
- 108010001348 Diacylglycerol O-acyltransferase Proteins 0.000 description 3
- 206010012735 Diarrhoea Diseases 0.000 description 3
- 208000010228 Erectile Dysfunction Diseases 0.000 description 3
- 108090000376 Fibroblast growth factor 21 Proteins 0.000 description 3
- 102000003973 Fibroblast growth factor 21 Human genes 0.000 description 3
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 3
- 206010018429 Glucose tolerance impaired Diseases 0.000 description 3
- 229940121710 HMGCoA reductase inhibitor Drugs 0.000 description 3
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 3
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 3
- 150000008575 L-amino acids Chemical class 0.000 description 3
- 102000016267 Leptin Human genes 0.000 description 3
- 108010092277 Leptin Proteins 0.000 description 3
- 206010027476 Metastases Diseases 0.000 description 3
- 208000025966 Neurological disease Diseases 0.000 description 3
- 208000010191 Osteitis Deformans Diseases 0.000 description 3
- 206010031240 Osteodystrophy Diseases 0.000 description 3
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 3
- 208000027868 Paget disease Diseases 0.000 description 3
- 208000001647 Renal Insufficiency Diseases 0.000 description 3
- 208000017442 Retinal disease Diseases 0.000 description 3
- 206010038923 Retinopathy Diseases 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 229920002472 Starch Polymers 0.000 description 3
- 229930006000 Sucrose Natural products 0.000 description 3
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 3
- 241000282898 Sus scrofa Species 0.000 description 3
- 229940123464 Thiazolidinedione Drugs 0.000 description 3
- YXFVVABEGXRONW-UHFFFAOYSA-N Toluene Chemical compound CC1=CC=CC=C1 YXFVVABEGXRONW-UHFFFAOYSA-N 0.000 description 3
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 3
- 208000025865 Ulcer Diseases 0.000 description 3
- 208000027418 Wounds and injury Diseases 0.000 description 3
- 229960001138 acetylsalicylic acid Drugs 0.000 description 3
- 150000007513 acids Chemical class 0.000 description 3
- 239000012190 activator Substances 0.000 description 3
- 230000001154 acute effect Effects 0.000 description 3
- 230000032683 aging Effects 0.000 description 3
- 125000004450 alkenylene group Chemical group 0.000 description 3
- 125000004419 alkynylene group Chemical group 0.000 description 3
- 239000003146 anticoagulant agent Substances 0.000 description 3
- 229940030600 antihypertensive agent Drugs 0.000 description 3
- 239000002220 antihypertensive agent Substances 0.000 description 3
- 239000003963 antioxidant agent Substances 0.000 description 3
- 235000006708 antioxidants Nutrition 0.000 description 3
- 229960004676 antithrombotic agent Drugs 0.000 description 3
- 230000036506 anxiety Effects 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- 229960005070 ascorbic acid Drugs 0.000 description 3
- 235000010323 ascorbic acid Nutrition 0.000 description 3
- 239000011668 ascorbic acid Substances 0.000 description 3
- 230000037118 bone strength Effects 0.000 description 3
- 210000004556 brain Anatomy 0.000 description 3
- 229940077737 brain-derived neurotrophic factor Drugs 0.000 description 3
- PFKFTWBEEFSNDU-UHFFFAOYSA-N carbonyldiimidazole Chemical compound C1=CN=CN1C(=O)N1C=CN=C1 PFKFTWBEEFSNDU-UHFFFAOYSA-N 0.000 description 3
- 239000001768 carboxy methyl cellulose Substances 0.000 description 3
- 239000000969 carrier Substances 0.000 description 3
- 230000015556 catabolic process Effects 0.000 description 3
- 210000004027 cell Anatomy 0.000 description 3
- 235000012000 cholesterol Nutrition 0.000 description 3
- 230000001684 chronic effect Effects 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 125000004122 cyclic group Chemical group 0.000 description 3
- 238000006731 degradation reaction Methods 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 239000002934 diuretic Substances 0.000 description 3
- 206010013663 drug dependence Diseases 0.000 description 3
- 239000003995 emulsifying agent Substances 0.000 description 3
- 239000000945 filler Substances 0.000 description 3
- 125000001153 fluoro group Chemical group F* 0.000 description 3
- 235000012631 food intake Nutrition 0.000 description 3
- 238000001631 haemodialysis Methods 0.000 description 3
- 125000001475 halogen functional group Chemical group 0.000 description 3
- 229920000669 heparin Polymers 0.000 description 3
- 208000006454 hepatitis Diseases 0.000 description 3
- IKDUDTNKRLTJSI-UHFFFAOYSA-N hydrazine monohydrate Substances O.NN IKDUDTNKRLTJSI-UHFFFAOYSA-N 0.000 description 3
- 150000002430 hydrocarbons Chemical group 0.000 description 3
- 230000002209 hydrophobic effect Effects 0.000 description 3
- 239000002471 hydroxymethylglutaryl coenzyme A reductase inhibitor Substances 0.000 description 3
- 208000006575 hypertriglyceridemia Diseases 0.000 description 3
- 230000002218 hypoglycaemic effect Effects 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 201000001881 impotence Diseases 0.000 description 3
- 238000010348 incorporation Methods 0.000 description 3
- 208000027866 inflammatory disease Diseases 0.000 description 3
- 230000003914 insulin secretion Effects 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 238000011835 investigation Methods 0.000 description 3
- 210000003734 kidney Anatomy 0.000 description 3
- 201000006370 kidney failure Diseases 0.000 description 3
- 239000008101 lactose Substances 0.000 description 3
- 229940039781 leptin Drugs 0.000 description 3
- 150000002632 lipids Chemical class 0.000 description 3
- 235000018977 lysine Nutrition 0.000 description 3
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 3
- 208000027202 mammary Paget disease Diseases 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 230000009401 metastasis Effects 0.000 description 3
- 229960003105 metformin Drugs 0.000 description 3
- XZWYZXLIPXDOLR-UHFFFAOYSA-N metformin Chemical compound CN(C)C(=N)NC(N)=N XZWYZXLIPXDOLR-UHFFFAOYSA-N 0.000 description 3
- 244000005700 microbiome Species 0.000 description 3
- 239000002808 molecular sieve Substances 0.000 description 3
- 206010028417 myasthenia gravis Diseases 0.000 description 3
- 208000015122 neurodegenerative disease Diseases 0.000 description 3
- 201000001119 neuropathy Diseases 0.000 description 3
- 230000007823 neuropathy Effects 0.000 description 3
- 229960003512 nicotinic acid Drugs 0.000 description 3
- 239000002767 noradrenalin uptake inhibitor Substances 0.000 description 3
- 239000002674 ointment Substances 0.000 description 3
- 235000020660 omega-3 fatty acid Nutrition 0.000 description 3
- 229940012843 omega-3 fatty acid Drugs 0.000 description 3
- 210000000056 organ Anatomy 0.000 description 3
- 201000008482 osteoarthritis Diseases 0.000 description 3
- 230000000010 osteolytic effect Effects 0.000 description 3
- 208000033808 peripheral neuropathy Diseases 0.000 description 3
- 239000006187 pill Substances 0.000 description 3
- 229920001983 poloxamer Polymers 0.000 description 3
- 229920000642 polymer Polymers 0.000 description 3
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 3
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 3
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 3
- 208000001685 postmenopausal osteoporosis Diseases 0.000 description 3
- 235000011056 potassium acetate Nutrition 0.000 description 3
- 230000035935 pregnancy Effects 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 229940044601 receptor agonist Drugs 0.000 description 3
- 239000000018 receptor agonist Substances 0.000 description 3
- 229940044551 receptor antagonist Drugs 0.000 description 3
- 239000002464 receptor antagonist Substances 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- 229960004586 rosiglitazone Drugs 0.000 description 3
- 230000028327 secretion Effects 0.000 description 3
- 229910052708 sodium Inorganic materials 0.000 description 3
- 239000011734 sodium Substances 0.000 description 3
- URGAHOPLAPQHLN-UHFFFAOYSA-N sodium aluminosilicate Chemical compound [Na+].[Al+3].[O-][Si]([O-])=O.[O-][Si]([O-])=O URGAHOPLAPQHLN-UHFFFAOYSA-N 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- 235000019698 starch Nutrition 0.000 description 3
- 230000007863 steatosis Effects 0.000 description 3
- 230000004936 stimulating effect Effects 0.000 description 3
- 239000005720 sucrose Substances 0.000 description 3
- 150000003456 sulfonamides Chemical class 0.000 description 3
- 125000005309 thioalkoxy group Chemical group 0.000 description 3
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 3
- 231100000397 ulcer Toxicity 0.000 description 3
- 229940088594 vitamin Drugs 0.000 description 3
- 229930003231 vitamin Natural products 0.000 description 3
- 235000013343 vitamin Nutrition 0.000 description 3
- 239000011782 vitamin Substances 0.000 description 3
- 235000019786 weight gain Nutrition 0.000 description 3
- KWGRBVOPPLSCSI-WPRPVWTQSA-N (-)-ephedrine Chemical compound CN[C@@H](C)[C@H](O)C1=CC=CC=C1 KWGRBVOPPLSCSI-WPRPVWTQSA-N 0.000 description 2
- VLPIATFUUWWMKC-SNVBAGLBSA-N (2r)-1-(2,6-dimethylphenoxy)propan-2-amine Chemical compound C[C@@H](N)COC1=C(C)C=CC=C1C VLPIATFUUWWMKC-SNVBAGLBSA-N 0.000 description 2
- QCVNMNYRNIMDKV-QGZVFWFLSA-N (3r)-2'-[(4-bromo-2-fluorophenyl)methyl]spiro[pyrrolidine-3,4'-pyrrolo[1,2-a]pyrazine]-1',2,3',5-tetrone Chemical compound FC1=CC(Br)=CC=C1CN1C(=O)[C@@]2(C(NC(=O)C2)=O)N2C=CC=C2C1=O QCVNMNYRNIMDKV-QGZVFWFLSA-N 0.000 description 2
- 125000006645 (C3-C4) cycloalkyl group Chemical group 0.000 description 2
- METKIMKYRPQLGS-GFCCVEGCSA-N (R)-atenolol Chemical compound CC(C)NC[C@@H](O)COC1=CC=C(CC(N)=O)C=C1 METKIMKYRPQLGS-GFCCVEGCSA-N 0.000 description 2
- RTHCYVBBDHJXIQ-MRXNPFEDSA-N (R)-fluoxetine Chemical compound O([C@H](CCNC)C=1C=CC=CC=1)C1=CC=C(C(F)(F)F)C=C1 RTHCYVBBDHJXIQ-MRXNPFEDSA-N 0.000 description 2
- ZOBPZXTWZATXDG-UHFFFAOYSA-N 1,3-thiazolidine-2,4-dione Chemical compound O=C1CSC(=O)N1 ZOBPZXTWZATXDG-UHFFFAOYSA-N 0.000 description 2
- HHEKNWQXFVOUNJ-UHFFFAOYSA-N 1-(2-aminoethyl)pyrrolidin-2-one Chemical compound NCCN1CCCC1=O HHEKNWQXFVOUNJ-UHFFFAOYSA-N 0.000 description 2
- BOVGTQGAOIONJV-BETUJISGSA-N 1-[(3ar,6as)-3,3a,4,5,6,6a-hexahydro-1h-cyclopenta[c]pyrrol-2-yl]-3-(4-methylphenyl)sulfonylurea Chemical compound C1=CC(C)=CC=C1S(=O)(=O)NC(=O)NN1C[C@H]2CCC[C@H]2C1 BOVGTQGAOIONJV-BETUJISGSA-N 0.000 description 2
- UUUHXMGGBIUAPW-UHFFFAOYSA-N 1-[1-[2-[[5-amino-2-[[1-[5-(diaminomethylideneamino)-2-[[1-[3-(1h-indol-3-yl)-2-[(5-oxopyrrolidine-2-carbonyl)amino]propanoyl]pyrrolidine-2-carbonyl]amino]pentanoyl]pyrrolidine-2-carbonyl]amino]-5-oxopentanoyl]amino]-3-methylpentanoyl]pyrrolidine-2-carbon Chemical compound C1CCC(C(=O)N2C(CCC2)C(O)=O)N1C(=O)C(C(C)CC)NC(=O)C(CCC(N)=O)NC(=O)C1CCCN1C(=O)C(CCCN=C(N)N)NC(=O)C1CCCN1C(=O)C(CC=1C2=CC=CC=C2NC=1)NC(=O)C1CCC(=O)N1 UUUHXMGGBIUAPW-UHFFFAOYSA-N 0.000 description 2
- VBICKXHEKHSIBG-UHFFFAOYSA-N 1-monostearoylglycerol Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)CO VBICKXHEKHSIBG-UHFFFAOYSA-N 0.000 description 2
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 2
- JYWKEVKEKOTYEX-UHFFFAOYSA-N 2,6-dibromo-4-chloroiminocyclohexa-2,5-dien-1-one Chemical compound ClN=C1C=C(Br)C(=O)C(Br)=C1 JYWKEVKEKOTYEX-UHFFFAOYSA-N 0.000 description 2
- FALRKNHUBBKYCC-UHFFFAOYSA-N 2-(chloromethyl)pyridine-3-carbonitrile Chemical compound ClCC1=NC=CC=C1C#N FALRKNHUBBKYCC-UHFFFAOYSA-N 0.000 description 2
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 2
- ZVKUKBNZGQJCFJ-UHFFFAOYSA-N 2-aminoethyl(benzyl)carbamic acid;hydrochloride Chemical compound Cl.NCCN(C(O)=O)CC1=CC=CC=C1 ZVKUKBNZGQJCFJ-UHFFFAOYSA-N 0.000 description 2
- JBKINHFZTVLNEM-UHFFFAOYSA-N 2-bromoethoxy-tert-butyl-dimethylsilane Chemical compound CC(C)(C)[Si](C)(C)OCCBr JBKINHFZTVLNEM-UHFFFAOYSA-N 0.000 description 2
- NEAQRZUHTPSBBM-UHFFFAOYSA-N 2-hydroxy-3,3-dimethyl-7-nitro-4h-isoquinolin-1-one Chemical class C1=C([N+]([O-])=O)C=C2C(=O)N(O)C(C)(C)CC2=C1 NEAQRZUHTPSBBM-UHFFFAOYSA-N 0.000 description 2
- XXSVYLLONFKJSO-UHFFFAOYSA-N 3-(2-aminoethyl)-1,3-thiazolidine-2,4-dione;hydrochloride Chemical compound Cl.NCCN1C(=O)CSC1=O XXSVYLLONFKJSO-UHFFFAOYSA-N 0.000 description 2
- BMYNFMYTOJXKLE-UHFFFAOYSA-N 3-azaniumyl-2-hydroxypropanoate Chemical compound NCC(O)C(O)=O BMYNFMYTOJXKLE-UHFFFAOYSA-N 0.000 description 2
- SWLAMJPTOQZTAE-UHFFFAOYSA-N 4-[2-[(5-chloro-2-methoxybenzoyl)amino]ethyl]benzoic acid Chemical class COC1=CC=C(Cl)C=C1C(=O)NCCC1=CC=C(C(O)=O)C=C1 SWLAMJPTOQZTAE-UHFFFAOYSA-N 0.000 description 2
- MGICRVTUCPFQQZ-UHFFFAOYSA-N 4-methyloxane-2,6-dione Chemical compound CC1CC(=O)OC(=O)C1 MGICRVTUCPFQQZ-UHFFFAOYSA-N 0.000 description 2
- PTXFGUVCXVEZET-UHFFFAOYSA-N 5-methyl-1,3-thiazolidine-2,4-dione Chemical compound CC1SC(=O)NC1=O PTXFGUVCXVEZET-UHFFFAOYSA-N 0.000 description 2
- ZOXBWJMCXHTKNU-UHFFFAOYSA-N 5-methyl-2-benzofuran-1,3-dione Chemical compound CC1=CC=C2C(=O)OC(=O)C2=C1 ZOXBWJMCXHTKNU-UHFFFAOYSA-N 0.000 description 2
- 208000030507 AIDS Diseases 0.000 description 2
- RZVAJINKPMORJF-UHFFFAOYSA-N Acetaminophen Chemical compound CC(=O)NC1=CC=C(O)C=C1 RZVAJINKPMORJF-UHFFFAOYSA-N 0.000 description 2
- 102000000452 Acetyl-CoA carboxylase Human genes 0.000 description 2
- 108010016219 Acetyl-CoA carboxylase Proteins 0.000 description 2
- 108700028369 Alleles Proteins 0.000 description 2
- 229940077274 Alpha glucosidase inhibitor Drugs 0.000 description 2
- 206010002383 Angina Pectoris Diseases 0.000 description 2
- 206010003571 Astrocytoma Diseases 0.000 description 2
- 206010003591 Ataxia Diseases 0.000 description 2
- 208000036864 Attention deficit/hyperactivity disease Diseases 0.000 description 2
- 210000002237 B-cell of pancreatic islet Anatomy 0.000 description 2
- 239000005552 B01AC04 - Clopidogrel Substances 0.000 description 2
- 208000008035 Back Pain Diseases 0.000 description 2
- 206010004593 Bile duct cancer Diseases 0.000 description 2
- 108010018763 Biotin carboxylase Proteins 0.000 description 2
- 206010006187 Breast cancer Diseases 0.000 description 2
- 208000026310 Breast neoplasm Diseases 0.000 description 2
- 208000032841 Bulimia Diseases 0.000 description 2
- 239000002083 C09CA01 - Losartan Substances 0.000 description 2
- 239000002053 C09CA06 - Candesartan Substances 0.000 description 2
- KCGKYAORRXGWMN-UHFFFAOYSA-N CNS(=O)=O Chemical compound CNS(=O)=O KCGKYAORRXGWMN-UHFFFAOYSA-N 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 2
- 229940127291 Calcium channel antagonist Drugs 0.000 description 2
- XTNGUQKDFGDXSJ-ZXGKGEBGSA-N Canagliflozin Chemical compound CC1=CC=C([C@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O)C=C1CC(S1)=CC=C1C1=CC=C(F)C=C1 XTNGUQKDFGDXSJ-ZXGKGEBGSA-N 0.000 description 2
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 2
- 206010007559 Cardiac failure congestive Diseases 0.000 description 2
- 206010065941 Central obesity Diseases 0.000 description 2
- 206010008111 Cerebral haemorrhage Diseases 0.000 description 2
- VGCXGMAHQTYDJK-UHFFFAOYSA-N Chloroacetyl chloride Chemical compound ClCC(Cl)=O VGCXGMAHQTYDJK-UHFFFAOYSA-N 0.000 description 2
- 108010061846 Cholesterol Ester Transfer Proteins Proteins 0.000 description 2
- 102000012336 Cholesterol Ester Transfer Proteins Human genes 0.000 description 2
- 229920001268 Cholestyramine Polymers 0.000 description 2
- 108010005939 Ciliary Neurotrophic Factor Proteins 0.000 description 2
- 102100031614 Ciliary neurotrophic factor Human genes 0.000 description 2
- 208000015943 Coeliac disease Diseases 0.000 description 2
- 208000035473 Communicable disease Diseases 0.000 description 2
- 208000020406 Creutzfeldt Jacob disease Diseases 0.000 description 2
- 208000003407 Creutzfeldt-Jakob Syndrome Diseases 0.000 description 2
- 208000010859 Creutzfeldt-Jakob disease Diseases 0.000 description 2
- 102000004127 Cytokines Human genes 0.000 description 2
- 108090000695 Cytokines Proteins 0.000 description 2
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 2
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 2
- 206010012289 Dementia Diseases 0.000 description 2
- 208000002249 Diabetes Complications Diseases 0.000 description 2
- 206010012655 Diabetic complications Diseases 0.000 description 2
- 235000019739 Dicalciumphosphate Nutrition 0.000 description 2
- 201000010374 Down Syndrome Diseases 0.000 description 2
- DVJAMEIQRSHVKC-BDAKNGLRSA-N Dutogliptin Chemical compound OB(O)[C@@H]1CCCN1C(=O)CN[C@H]1CNCC1 DVJAMEIQRSHVKC-BDAKNGLRSA-N 0.000 description 2
- 241000792859 Enema Species 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- QUSNBJAOOMFDIB-UHFFFAOYSA-N Ethylamine Chemical compound CCN QUSNBJAOOMFDIB-UHFFFAOYSA-N 0.000 description 2
- HTQBXNHDCUEHJF-XWLPCZSASA-N Exenatide Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 HTQBXNHDCUEHJF-XWLPCZSASA-N 0.000 description 2
- UGJMXCAKCUNAIE-UHFFFAOYSA-N Gabapentin Chemical compound OC(=O)CC1(CN)CCCCC1 UGJMXCAKCUNAIE-UHFFFAOYSA-N 0.000 description 2
- 101800001586 Ghrelin Proteins 0.000 description 2
- 102400000442 Ghrelin-28 Human genes 0.000 description 2
- 208000010412 Glaucoma Diseases 0.000 description 2
- 102000051325 Glucagon Human genes 0.000 description 2
- 108060003199 Glucagon Proteins 0.000 description 2
- 102100040880 Glucokinase regulatory protein Human genes 0.000 description 2
- 101710148430 Glucokinase regulatory protein Proteins 0.000 description 2
- 108010024636 Glutathione Proteins 0.000 description 2
- 201000005569 Gout Diseases 0.000 description 2
- 206010019708 Hepatic steatosis Diseases 0.000 description 2
- 101000976075 Homo sapiens Insulin Proteins 0.000 description 2
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical compound O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 2
- 208000035150 Hypercholesterolemia Diseases 0.000 description 2
- 206010060378 Hyperinsulinaemia Diseases 0.000 description 2
- 206010020651 Hyperkinesia Diseases 0.000 description 2
- 208000000269 Hyperkinesis Diseases 0.000 description 2
- 208000013016 Hypoglycemia Diseases 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- 229940122355 Insulin sensitizer Drugs 0.000 description 2
- 102000014150 Interferons Human genes 0.000 description 2
- 108010050904 Interferons Proteins 0.000 description 2
- 108010063738 Interleukins Proteins 0.000 description 2
- 102000015696 Interleukins Human genes 0.000 description 2
- 208000007766 Kaposi sarcoma Diseases 0.000 description 2
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- ZGUNAGUHMKGQNY-ZETCQYMHSA-N L-alpha-phenylglycine zwitterion Chemical compound OC(=O)[C@@H](N)C1=CC=CC=C1 ZGUNAGUHMKGQNY-ZETCQYMHSA-N 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 208000008930 Low Back Pain Diseases 0.000 description 2
- 108010075639 MAP Kinase Kinase Kinase 5 Proteins 0.000 description 2
- 208000002720 Malnutrition Diseases 0.000 description 2
- 206010026749 Mania Diseases 0.000 description 2
- 101710151321 Melanostatin Proteins 0.000 description 2
- BAVYZALUXZFZLV-UHFFFAOYSA-N Methylamine Chemical compound NC BAVYZALUXZFZLV-UHFFFAOYSA-N 0.000 description 2
- 102100033127 Mitogen-activated protein kinase kinase kinase 5 Human genes 0.000 description 2
- 229940123685 Monoamine oxidase inhibitor Drugs 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- QIAFMBKCNZACKA-UHFFFAOYSA-N N-benzoylglycine Chemical compound OC(=O)CNC(=O)C1=CC=CC=C1 QIAFMBKCNZACKA-UHFFFAOYSA-N 0.000 description 2
- 238000005481 NMR spectroscopy Methods 0.000 description 2
- FACKDRLGDZNQPH-USDQMPFESA-N N[C@@H](CC1=CC=CC=C1)C(=O)O.N[C@@H]([C@H](O)C)C(=O)O.NCC(=O)O Chemical compound N[C@@H](CC1=CC=CC=C1)C(=O)O.N[C@@H]([C@H](O)C)C(=O)O.NCC(=O)O FACKDRLGDZNQPH-USDQMPFESA-N 0.000 description 2
- 108010025020 Nerve Growth Factor Proteins 0.000 description 2
- 102400000064 Neuropeptide Y Human genes 0.000 description 2
- GRYLNZFGIOXLOG-UHFFFAOYSA-N Nitric acid Chemical compound O[N+]([O-])=O GRYLNZFGIOXLOG-UHFFFAOYSA-N 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 description 2
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 description 2
- 206010033128 Ovarian cancer Diseases 0.000 description 2
- 102400000319 Oxyntomodulin Human genes 0.000 description 2
- 101800001388 Oxyntomodulin Proteins 0.000 description 2
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 2
- 102000004270 Peptidyl-Dipeptidase A Human genes 0.000 description 2
- 108090000882 Peptidyl-Dipeptidase A Proteins 0.000 description 2
- 239000004264 Petrolatum Substances 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- LGRFSURHDFAFJT-UHFFFAOYSA-N Phthalic anhydride Natural products C1=CC=C2C(=O)OC(=O)C2=C1 LGRFSURHDFAFJT-UHFFFAOYSA-N 0.000 description 2
- 206010035004 Pickwickian syndrome Diseases 0.000 description 2
- 206010036018 Pollakiuria Diseases 0.000 description 2
- 206010060862 Prostate cancer Diseases 0.000 description 2
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 2
- 102000053067 Pyruvate Dehydrogenase Acetyl-Transferring Kinase Human genes 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 206010039491 Sarcoma Diseases 0.000 description 2
- 206010039966 Senile dementia Diseases 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 206010049416 Short-bowel syndrome Diseases 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- 229920002125 Sokalan® Polymers 0.000 description 2
- 229940127504 Somatostatin Receptor Agonists Drugs 0.000 description 2
- 201000002661 Spondylitis Diseases 0.000 description 2
- 206010043118 Tardive Dyskinesia Diseases 0.000 description 2
- KKEYFWRCBNTPAC-UHFFFAOYSA-N Terephthalic acid Chemical compound OC(=O)C1=CC=C(C(O)=O)C=C1 KKEYFWRCBNTPAC-UHFFFAOYSA-N 0.000 description 2
- 108090000373 Tissue Plasminogen Activator Proteins 0.000 description 2
- 102000003978 Tissue Plasminogen Activator Human genes 0.000 description 2
- 206010044688 Trisomy 21 Diseases 0.000 description 2
- 206010046543 Urinary incontinence Diseases 0.000 description 2
- 208000018756 Variant Creutzfeldt-Jakob disease Diseases 0.000 description 2
- 229930003427 Vitamin E Natural products 0.000 description 2
- 208000010399 Wasting Syndrome Diseases 0.000 description 2
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 2
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 2
- 101710159466 [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial Proteins 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 230000005856 abnormality Effects 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 235000011054 acetic acid Nutrition 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 239000008186 active pharmaceutical agent Substances 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 230000010933 acylation Effects 0.000 description 2
- 238000005917 acylation reaction Methods 0.000 description 2
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 2
- 239000001361 adipic acid Substances 0.000 description 2
- 235000011037 adipic acid Nutrition 0.000 description 2
- 239000000443 aerosol Substances 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 239000003288 aldose reductase inhibitor Substances 0.000 description 2
- 229940090865 aldose reductase inhibitors used in diabetes Drugs 0.000 description 2
- 235000010443 alginic acid Nutrition 0.000 description 2
- 229920000615 alginic acid Polymers 0.000 description 2
- 125000003342 alkenyl group Chemical group 0.000 description 2
- 125000000304 alkynyl group Chemical group 0.000 description 2
- 239000003888 alpha glucosidase inhibitor Substances 0.000 description 2
- 229940124308 alpha-adrenoreceptor antagonist Drugs 0.000 description 2
- 230000009435 amidation Effects 0.000 description 2
- 238000007112 amidation reaction Methods 0.000 description 2
- 150000003863 ammonium salts Chemical class 0.000 description 2
- 229940035676 analgesics Drugs 0.000 description 2
- 239000002333 angiotensin II receptor antagonist Substances 0.000 description 2
- 150000008064 anhydrides Chemical class 0.000 description 2
- 239000000730 antalgic agent Substances 0.000 description 2
- 239000000883 anti-obesity agent Substances 0.000 description 2
- 230000000692 anti-sense effect Effects 0.000 description 2
- 229940125710 antiobesity agent Drugs 0.000 description 2
- 229940127218 antiplatelet drug Drugs 0.000 description 2
- VMWNQDUVQKEIOC-CYBMUJFWSA-N apomorphine Chemical compound C([C@H]1N(C)CC2)C3=CC=C(O)C(O)=C3C3=C1C2=CC=C3 VMWNQDUVQKEIOC-CYBMUJFWSA-N 0.000 description 2
- 229960004046 apomorphine Drugs 0.000 description 2
- 230000006907 apoptotic process Effects 0.000 description 2
- 239000002830 appetite depressant Substances 0.000 description 2
- 238000010936 aqueous wash Methods 0.000 description 2
- KXNPVXPOPUZYGB-XYVMCAHJSA-N argatroban Chemical compound OC(=O)[C@H]1C[C@H](C)CCN1C(=O)[C@H](CCCN=C(N)N)NS(=O)(=O)C1=CC=CC2=C1NC[C@H](C)C2 KXNPVXPOPUZYGB-XYVMCAHJSA-N 0.000 description 2
- 229960003856 argatroban Drugs 0.000 description 2
- 229960002274 atenolol Drugs 0.000 description 2
- 208000015802 attention deficit-hyperactivity disease Diseases 0.000 description 2
- 210000000227 basophil cell of anterior lobe of hypophysis Anatomy 0.000 description 2
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 2
- QMMFTRJQCCVPCE-UHFFFAOYSA-N benzyl n-(2-aminoethyl)carbamate Chemical compound NCCNC(=O)OCC1=CC=CC=C1 QMMFTRJQCCVPCE-UHFFFAOYSA-N 0.000 description 2
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 2
- UCMIRNVEIXFBKS-UHFFFAOYSA-N beta-alanine Chemical compound NCCC(O)=O UCMIRNVEIXFBKS-UHFFFAOYSA-N 0.000 description 2
- 229920000080 bile acid sequestrant Polymers 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 208000005881 bovine spongiform encephalopathy Diseases 0.000 description 2
- 208000025698 brain inflammatory disease Diseases 0.000 description 2
- 125000001246 bromo group Chemical group Br* 0.000 description 2
- JHIWVOJDXOSYLW-UHFFFAOYSA-N butyl 2,2-difluorocyclopropane-1-carboxylate Chemical compound CCCCOC(=O)C1CC1(F)F JHIWVOJDXOSYLW-UHFFFAOYSA-N 0.000 description 2
- 229910052791 calcium Inorganic materials 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 229960000932 candesartan Drugs 0.000 description 2
- YKPUWZUDDOIDPM-SOFGYWHQSA-N capsaicin Chemical compound COC1=CC(CNC(=O)CCCC\C=C\C(C)C)=CC=C1O YKPUWZUDDOIDPM-SOFGYWHQSA-N 0.000 description 2
- 239000011203 carbon fibre reinforced carbon Substances 0.000 description 2
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 2
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 2
- 229940082638 cardiac stimulant phosphodiesterase inhibitors Drugs 0.000 description 2
- 210000003169 central nervous system Anatomy 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 230000002490 cerebral effect Effects 0.000 description 2
- 206010008118 cerebral infarction Diseases 0.000 description 2
- 229960000541 cetyl alcohol Drugs 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- JUFFVKRROAPVBI-PVOYSMBESA-N chembl1210015 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N[C@H]1[C@@H]([C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO[C@]3(O[C@@H](C[C@H](O)[C@H](O)CO)[C@H](NC(C)=O)[C@@H](O)C3)C(O)=O)O2)O)[C@@H](CO)O1)NC(C)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 JUFFVKRROAPVBI-PVOYSMBESA-N 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 125000001309 chloro group Chemical group Cl* 0.000 description 2
- KQIADDMXRMTWHZ-UHFFFAOYSA-N chloro-tri(propan-2-yl)silane Chemical compound CC(C)[Si](Cl)(C(C)C)C(C)C KQIADDMXRMTWHZ-UHFFFAOYSA-N 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 230000001906 cholesterol absorption Effects 0.000 description 2
- 208000020832 chronic kidney disease Diseases 0.000 description 2
- 229960004588 cilostazol Drugs 0.000 description 2
- RRGUKTPIGVIEKM-UHFFFAOYSA-N cilostazol Chemical compound C=1C=C2NC(=O)CCC2=CC=1OCCCCC1=NN=NN1C1CCCCC1 RRGUKTPIGVIEKM-UHFFFAOYSA-N 0.000 description 2
- 229960003009 clopidogrel Drugs 0.000 description 2
- GKTWGGQPFAXNFI-HNNXBMFYSA-N clopidogrel Chemical compound C1([C@H](N2CC=3C=CSC=3CC2)C(=O)OC)=CC=CC=C1Cl GKTWGGQPFAXNFI-HNNXBMFYSA-N 0.000 description 2
- 229940110456 cocoa butter Drugs 0.000 description 2
- 235000019868 cocoa butter Nutrition 0.000 description 2
- 238000002648 combination therapy Methods 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 125000002993 cycloalkylene group Chemical group 0.000 description 2
- 229940097362 cyclodextrins Drugs 0.000 description 2
- 230000003111 delayed effect Effects 0.000 description 2
- CYQFCXCEBYINGO-IAGOWNOFSA-N delta1-THC Chemical compound C1=C(C)CC[C@H]2C(C)(C)OC3=CC(CCCCC)=CC(O)=C3[C@@H]21 CYQFCXCEBYINGO-IAGOWNOFSA-N 0.000 description 2
- NEFBYIFKOOEVPA-UHFFFAOYSA-K dicalcium phosphate Chemical compound [Ca+2].[Ca+2].[O-]P([O-])([O-])=O NEFBYIFKOOEVPA-UHFFFAOYSA-K 0.000 description 2
- 229940038472 dicalcium phosphate Drugs 0.000 description 2
- 229910000390 dicalcium phosphate Inorganic materials 0.000 description 2
- XBDQKXXYIPTUBI-UHFFFAOYSA-N dimethylselenoniopropionate Natural products CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 2
- 239000002270 dispersing agent Substances 0.000 description 2
- 239000002612 dispersion medium Substances 0.000 description 2
- 229940030606 diuretics Drugs 0.000 description 2
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Natural products OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 2
- ADEBPBSSDYVVLD-UHFFFAOYSA-N donepezil Chemical compound O=C1C=2C=C(OC)C(OC)=CC=2CC1CC(CC1)CCN1CC1=CC=CC=C1 ADEBPBSSDYVVLD-UHFFFAOYSA-N 0.000 description 2
- VYFYYTLLBUKUHU-UHFFFAOYSA-N dopamine Chemical compound NCCC1=CC=C(O)C(O)=C1 VYFYYTLLBUKUHU-UHFFFAOYSA-N 0.000 description 2
- 206010013990 dysuria Diseases 0.000 description 2
- 230000002526 effect on cardiovascular system Effects 0.000 description 2
- 206010014599 encephalitis Diseases 0.000 description 2
- 229940095399 enema Drugs 0.000 description 2
- 239000007920 enema Substances 0.000 description 2
- 239000002532 enzyme inhibitor Substances 0.000 description 2
- CHNUOJQWGUIOLD-NFZZJPOKSA-N epalrestat Chemical compound C=1C=CC=CC=1\C=C(/C)\C=C1/SC(=S)N(CC(O)=O)C1=O CHNUOJQWGUIOLD-NFZZJPOKSA-N 0.000 description 2
- 229950010170 epalrestat Drugs 0.000 description 2
- CHNUOJQWGUIOLD-UHFFFAOYSA-N epalrestate Natural products C=1C=CC=CC=1C=C(C)C=C1SC(=S)N(CC(O)=O)C1=O CHNUOJQWGUIOLD-UHFFFAOYSA-N 0.000 description 2
- CCIVGXIOQKPBKL-UHFFFAOYSA-M ethanesulfonate Chemical compound CCS([O-])(=O)=O CCIVGXIOQKPBKL-UHFFFAOYSA-M 0.000 description 2
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 2
- SSQPWTVBQMWLSZ-AAQCHOMXSA-N ethyl (5Z,8Z,11Z,14Z,17Z)-icosapentaenoate Chemical compound CCOC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/C\C=C/CC SSQPWTVBQMWLSZ-AAQCHOMXSA-N 0.000 description 2
- 229960002464 fluoxetine Drugs 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 125000002541 furyl group Chemical group 0.000 description 2
- ASUTZQLVASHGKV-JDFRZJQESA-N galanthamine Chemical compound O1C(=C23)C(OC)=CC=C2CN(C)CC[C@]23[C@@H]1C[C@@H](O)C=C2 ASUTZQLVASHGKV-JDFRZJQESA-N 0.000 description 2
- 229960003692 gamma aminobutyric acid Drugs 0.000 description 2
- FODTZLFLDFKIQH-FSVGXZBPSA-N gamma-Oryzanol (TN) Chemical compound C1=C(O)C(OC)=CC(\C=C\C(=O)O[C@@H]2C([C@@H]3CC[C@H]4[C@]5(C)CC[C@@H]([C@@]5(C)CC[C@@]54C[C@@]53CC2)[C@H](C)CCC=C(C)C)(C)C)=C1 FODTZLFLDFKIQH-FSVGXZBPSA-N 0.000 description 2
- WIGCFUFOHFEKBI-UHFFFAOYSA-N gamma-tocopherol Natural products CC(C)CCCC(C)CCCC(C)CCCC1CCC2C(C)C(O)C(C)C(C)C2O1 WIGCFUFOHFEKBI-UHFFFAOYSA-N 0.000 description 2
- 230000027119 gastric acid secretion Effects 0.000 description 2
- 230000002496 gastric effect Effects 0.000 description 2
- AFLFKFHDSCQHOL-IZZDOVSWSA-N gft505 Chemical compound C1=CC(SC)=CC=C1C(=O)\C=C\C1=CC(C)=C(OC(C)(C)C(O)=O)C(C)=C1 AFLFKFHDSCQHOL-IZZDOVSWSA-N 0.000 description 2
- BGHSOEHUOOAYMY-JTZMCQEISA-N ghrelin Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)CN)C1=CC=CC=C1 BGHSOEHUOOAYMY-JTZMCQEISA-N 0.000 description 2
- 229960004580 glibenclamide Drugs 0.000 description 2
- 229960000346 gliclazide Drugs 0.000 description 2
- 229960004666 glucagon Drugs 0.000 description 2
- 238000007446 glucose tolerance test Methods 0.000 description 2
- VANNPISTIUFMLH-UHFFFAOYSA-N glutaric anhydride Chemical compound O=C1CCCC(=O)O1 VANNPISTIUFMLH-UHFFFAOYSA-N 0.000 description 2
- 229960003180 glutathione Drugs 0.000 description 2
- 235000003969 glutathione Nutrition 0.000 description 2
- ZNNLBTZKUZBEKO-UHFFFAOYSA-N glyburide Chemical compound COC1=CC=C(Cl)C=C1C(=O)NCCC1=CC=C(S(=O)(=O)NC(=O)NC2CCCCC2)C=C1 ZNNLBTZKUZBEKO-UHFFFAOYSA-N 0.000 description 2
- 230000002641 glycemic effect Effects 0.000 description 2
- 125000005456 glyceride group Chemical group 0.000 description 2
- BEBCJVAWIBVWNZ-UHFFFAOYSA-N glycinamide Chemical compound NCC(N)=O BEBCJVAWIBVWNZ-UHFFFAOYSA-N 0.000 description 2
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 2
- 239000008187 granular material Substances 0.000 description 2
- 229960002897 heparin Drugs 0.000 description 2
- 231100000283 hepatitis Toxicity 0.000 description 2
- BXWNKGSJHAJOGX-UHFFFAOYSA-N hexadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCO BXWNKGSJHAJOGX-UHFFFAOYSA-N 0.000 description 2
- 239000003906 humectant Substances 0.000 description 2
- 125000004356 hydroxy functional group Chemical group O* 0.000 description 2
- 229960002591 hydroxyproline Drugs 0.000 description 2
- 201000001421 hyperglycemia Diseases 0.000 description 2
- 230000003451 hyperinsulinaemic effect Effects 0.000 description 2
- 201000008980 hyperinsulinism Diseases 0.000 description 2
- 229960002600 icosapent ethyl Drugs 0.000 description 2
- 239000002955 immunomodulating agent Substances 0.000 description 2
- 239000012535 impurity Substances 0.000 description 2
- MGXWVYUBJRZYPE-YUGYIWNOSA-N incretin Chemical class C([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)[C@@H](C)O)[C@@H](C)CC)C1=CC=C(O)C=C1 MGXWVYUBJRZYPE-YUGYIWNOSA-N 0.000 description 2
- 239000000859 incretin Substances 0.000 description 2
- 229960000905 indomethacin Drugs 0.000 description 2
- 229940090044 injection Drugs 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- PBGKTOXHQIOBKM-FHFVDXKLSA-N insulin (human) Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@H]1CSSC[C@H]2C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@H](C(N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3C=CC(O)=CC=3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3NC=NC=3)NC(=O)[C@H](CO)NC(=O)CNC1=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O)=O)CSSC[C@@H](C(N2)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](NC(=O)CN)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC=1C=CC=CC=1)C(C)C)C1=CN=CN1 PBGKTOXHQIOBKM-FHFVDXKLSA-N 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- 230000002601 intratumoral effect Effects 0.000 description 2
- 230000007794 irritation Effects 0.000 description 2
- 125000000842 isoxazolyl group Chemical group 0.000 description 2
- 229960002623 lacosamide Drugs 0.000 description 2
- VPPJLAIAVCUEMN-GFCCVEGCSA-N lacosamide Chemical compound COC[C@@H](NC(C)=O)C(=O)NCC1=CC=CC=C1 VPPJLAIAVCUEMN-GFCCVEGCSA-N 0.000 description 2
- 235000014655 lactic acid Nutrition 0.000 description 2
- 239000004310 lactic acid Substances 0.000 description 2
- 239000000787 lecithin Substances 0.000 description 2
- 229940067606 lecithin Drugs 0.000 description 2
- 235000010445 lecithin Nutrition 0.000 description 2
- 235000019136 lipoic acid Nutrition 0.000 description 2
- AGBQKNBQESQNJD-UHFFFAOYSA-N lipoic acid Chemical compound OC(=O)CCCCC1CCSS1 AGBQKNBQESQNJD-UHFFFAOYSA-N 0.000 description 2
- 201000007270 liver cancer Diseases 0.000 description 2
- 239000000314 lubricant Substances 0.000 description 2
- 235000019359 magnesium stearate Nutrition 0.000 description 2
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 2
- 230000001071 malnutrition Effects 0.000 description 2
- 235000000824 malnutrition Nutrition 0.000 description 2
- 229950004994 meglitinide Drugs 0.000 description 2
- 201000001441 melanoma Diseases 0.000 description 2
- 230000004060 metabolic process Effects 0.000 description 2
- 229940098779 methanesulfonic acid Drugs 0.000 description 2
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 2
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 2
- 229940016409 methylsulfonylmethane Drugs 0.000 description 2
- 229960003404 mexiletine Drugs 0.000 description 2
- 108091005601 modified peptides Proteins 0.000 description 2
- PXZWGQLGAKCNKD-DPNMSELWSA-N molport-023-276-326 Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O)[C@@H](C)O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 PXZWGQLGAKCNKD-DPNMSELWSA-N 0.000 description 2
- 239000002899 monoamine oxidase inhibitor Substances 0.000 description 2
- BQJCRHHNABKAKU-KBQPJGBKSA-N morphine Chemical compound O([C@H]1[C@H](C=C[C@H]23)O)C4=C5[C@@]12CCN(C)[C@@H]3CC5=CC=C4O BQJCRHHNABKAKU-KBQPJGBKSA-N 0.000 description 2
- 208000010125 myocardial infarction Diseases 0.000 description 2
- 229960001597 nifedipine Drugs 0.000 description 2
- HYIMSNHJOBLJNT-UHFFFAOYSA-N nifedipine Chemical compound COC(=O)C1=C(C)NC(C)=C(C(=O)OC)C1C1=CC=CC=C1[N+]([O-])=O HYIMSNHJOBLJNT-UHFFFAOYSA-N 0.000 description 2
- 229910017604 nitric acid Inorganic materials 0.000 description 2
- 231100000344 non-irritating Toxicity 0.000 description 2
- 102000039446 nucleic acids Human genes 0.000 description 2
- 108020004707 nucleic acids Proteins 0.000 description 2
- 150000007523 nucleic acids Chemical class 0.000 description 2
- URPYMXQQVHTUDU-OFGSCBOVSA-N nucleopeptide y Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 URPYMXQQVHTUDU-OFGSCBOVSA-N 0.000 description 2
- 208000015380 nutritional deficiency disease Diseases 0.000 description 2
- GLDOVTGHNKAZLK-UHFFFAOYSA-N octadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCCCO GLDOVTGHNKAZLK-UHFFFAOYSA-N 0.000 description 2
- 239000006186 oral dosage form Substances 0.000 description 2
- 150000007530 organic bases Chemical class 0.000 description 2
- 229960001243 orlistat Drugs 0.000 description 2
- AHLBNYSZXLDEJQ-FWEHEUNISA-N orlistat Chemical compound CCCCCCCCCCC[C@H](OC(=O)[C@H](CC(C)C)NC=O)C[C@@H]1OC(=O)[C@H]1CCCCCC AHLBNYSZXLDEJQ-FWEHEUNISA-N 0.000 description 2
- 229960003104 ornithine Drugs 0.000 description 2
- 201000002528 pancreatic cancer Diseases 0.000 description 2
- 208000008443 pancreatic carcinoma Diseases 0.000 description 2
- 108091008725 peroxisome proliferator-activated receptors alpha Proteins 0.000 description 2
- 229940066842 petrolatum Drugs 0.000 description 2
- 235000019271 petrolatum Nutrition 0.000 description 2
- 229940124531 pharmaceutical excipient Drugs 0.000 description 2
- 230000000144 pharmacologic effect Effects 0.000 description 2
- 229960003562 phentermine Drugs 0.000 description 2
- 239000002571 phosphodiesterase inhibitor Substances 0.000 description 2
- 229940068065 phytosterols Drugs 0.000 description 2
- KNCYXPMJDCCGSJ-UHFFFAOYSA-N piperidine-2,6-dione Chemical compound O=C1CCCC(=O)N1 KNCYXPMJDCCGSJ-UHFFFAOYSA-N 0.000 description 2
- 229940096701 plain lipid modifying drug hmg coa reductase inhibitors Drugs 0.000 description 2
- 239000000106 platelet aggregation inhibitor Substances 0.000 description 2
- 229910052700 potassium Inorganic materials 0.000 description 2
- 229910000027 potassium carbonate Inorganic materials 0.000 description 2
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- AYXYPKUFHZROOJ-ZETCQYMHSA-N pregabalin Chemical compound CC(C)C[C@H](CN)CC(O)=O AYXYPKUFHZROOJ-ZETCQYMHSA-N 0.000 description 2
- 229960001233 pregabalin Drugs 0.000 description 2
- 230000000770 proinflammatory effect Effects 0.000 description 2
- 230000002035 prolonged effect Effects 0.000 description 2
- FBZULTVJWVCJQV-UHFFFAOYSA-N propan-2-yl n-(propan-2-yloxycarbonylamino)carbamate Chemical compound CC(C)OC(=O)NNC(=O)OC(C)C FBZULTVJWVCJQV-UHFFFAOYSA-N 0.000 description 2
- AQHHHDLHHXJYJD-UHFFFAOYSA-N propranolol Chemical compound C1=CC=C2C(OCC(O)CNC(C)C)=CC=CC2=C1 AQHHHDLHHXJYJD-UHFFFAOYSA-N 0.000 description 2
- 239000002599 prostaglandin synthase inhibitor Substances 0.000 description 2
- 125000006239 protecting group Chemical group 0.000 description 2
- 208000020016 psychiatric disease Diseases 0.000 description 2
- UMJSCPRVCHMLSP-UHFFFAOYSA-N pyridine Natural products COC1=CC=CN=C1 UMJSCPRVCHMLSP-UHFFFAOYSA-N 0.000 description 2
- NHZMQXZHNVQTQA-UHFFFAOYSA-N pyridoxamine Chemical compound CC1=NC=C(CO)C(CN)=C1O NHZMQXZHNVQTQA-UHFFFAOYSA-N 0.000 description 2
- 150000003254 radicals Chemical class 0.000 description 2
- 229950004123 ranirestat Drugs 0.000 description 2
- 230000033300 receptor internalization Effects 0.000 description 2
- 238000010992 reflux Methods 0.000 description 2
- 230000000241 respiratory effect Effects 0.000 description 2
- 206010039073 rheumatoid arthritis Diseases 0.000 description 2
- 238000007363 ring formation reaction Methods 0.000 description 2
- 229960000672 rosuvastatin Drugs 0.000 description 2
- BPRHUIZQVSMCRT-VEUZHWNKSA-N rosuvastatin Chemical compound CC(C)C1=NC(N(C)S(C)(=O)=O)=NC(C=2C=CC(F)=CC=2)=C1\C=C\[C@@H](O)C[C@@H](O)CC(O)=O BPRHUIZQVSMCRT-VEUZHWNKSA-N 0.000 description 2
- CVHZOJJKTDOEJC-UHFFFAOYSA-N saccharin Chemical compound C1=CC=C2C(=O)NS(=O)(=O)C2=C1 CVHZOJJKTDOEJC-UHFFFAOYSA-N 0.000 description 2
- 239000000901 saccharin and its Na,K and Ca salt Substances 0.000 description 2
- YGSDEFSMJLZEOE-UHFFFAOYSA-N salicylic acid Chemical compound OC(=O)C1=CC=CC=C1O YGSDEFSMJLZEOE-UHFFFAOYSA-N 0.000 description 2
- FSYKKLYZXJSNPZ-UHFFFAOYSA-N sarcosine Chemical compound C[NH2+]CC([O-])=O FSYKKLYZXJSNPZ-UHFFFAOYSA-N 0.000 description 2
- 229940124834 selective serotonin reuptake inhibitor Drugs 0.000 description 2
- 239000012896 selective serotonin reuptake inhibitor Substances 0.000 description 2
- QZAYGJVTTNCVMB-UHFFFAOYSA-N serotonin Chemical compound C1=C(O)C=C2C(CCN)=CNC2=C1 QZAYGJVTTNCVMB-UHFFFAOYSA-N 0.000 description 2
- 239000003772 serotonin uptake inhibitor Substances 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- UNAANXDKBXWMLN-UHFFFAOYSA-N sibutramine Chemical compound C=1C=C(Cl)C=CC=1C1(C(N(C)C)CC(C)C)CCC1 UNAANXDKBXWMLN-UHFFFAOYSA-N 0.000 description 2
- 229960004425 sibutramine Drugs 0.000 description 2
- BNRNXUUZRGQAQC-UHFFFAOYSA-N sildenafil Chemical compound CCCC1=NN(C)C(C(N2)=O)=C1N=C2C(C(=CC=1)OCC)=CC=1S(=O)(=O)N1CCN(C)CC1 BNRNXUUZRGQAQC-UHFFFAOYSA-N 0.000 description 2
- 201000002859 sleep apnea Diseases 0.000 description 2
- WXMKPNITSTVMEF-UHFFFAOYSA-M sodium benzoate Chemical compound [Na+].[O-]C(=O)C1=CC=CC=C1 WXMKPNITSTVMEF-UHFFFAOYSA-M 0.000 description 2
- 235000010234 sodium benzoate Nutrition 0.000 description 2
- 239000004299 sodium benzoate Substances 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 229960002668 sodium chloride Drugs 0.000 description 2
- 235000010199 sorbic acid Nutrition 0.000 description 2
- 239000004334 sorbic acid Substances 0.000 description 2
- 229940075582 sorbic acid Drugs 0.000 description 2
- 239000000600 sorbitol Substances 0.000 description 2
- 235000010356 sorbitol Nutrition 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 230000006641 stabilisation Effects 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 230000001954 sterilising effect Effects 0.000 description 2
- 238000004659 sterilization and disinfection Methods 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 210000002784 stomach Anatomy 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 2
- 229940014800 succinic anhydride Drugs 0.000 description 2
- KZNICNPSHKQLFF-UHFFFAOYSA-N succinimide Chemical compound O=C1CCC(=O)N1 KZNICNPSHKQLFF-UHFFFAOYSA-N 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- HHVIBTZHLRERCL-UHFFFAOYSA-N sulfonyldimethane Chemical compound CS(C)(=O)=O HHVIBTZHLRERCL-UHFFFAOYSA-N 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 230000002194 synthesizing effect Effects 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- RMMXLENWKUUMAY-UHFFFAOYSA-N telmisartan Chemical compound CCCC1=NC2=C(C)C=C(C=3N(C4=CC=CC=C4N=3)C)C=C2N1CC(C=C1)=CC=C1C1=CC=CC=C1C(O)=O RMMXLENWKUUMAY-UHFFFAOYSA-N 0.000 description 2
- DOMTZTVJNZKUNX-UHFFFAOYSA-N tert-butyl 3-aminopropanoate;hydrochloride Chemical compound Cl.CC(C)(C)OC(=O)CCN DOMTZTVJNZKUNX-UHFFFAOYSA-N 0.000 description 2
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 2
- BCNZYOJHNLTNEZ-UHFFFAOYSA-N tert-butyldimethylsilyl chloride Chemical compound CC(C)(C)[Si](C)(C)Cl BCNZYOJHNLTNEZ-UHFFFAOYSA-N 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- JRMUNVKIHCOMHV-UHFFFAOYSA-M tetrabutylammonium bromide Chemical compound [Br-].CCCC[N+](CCCC)(CCCC)CCCC JRMUNVKIHCOMHV-UHFFFAOYSA-M 0.000 description 2
- DPKBAXPHAYBPRL-UHFFFAOYSA-M tetrabutylazanium;iodide Chemical compound [I-].CCCC[N+](CCCC)(CCCC)CCCC DPKBAXPHAYBPRL-UHFFFAOYSA-M 0.000 description 2
- 150000003536 tetrazoles Chemical class 0.000 description 2
- 125000001544 thienyl group Chemical group 0.000 description 2
- 238000004809 thin layer chromatography Methods 0.000 description 2
- 229960002663 thioctic acid Drugs 0.000 description 2
- 229960000984 tocofersolan Drugs 0.000 description 2
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- FGMPLJWBKKVCDB-UHFFFAOYSA-N trans-L-hydroxy-proline Natural products ON1CCCC1C(O)=O FGMPLJWBKKVCDB-UHFFFAOYSA-N 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- 238000000844 transformation Methods 0.000 description 2
- 230000009529 traumatic brain injury Effects 0.000 description 2
- 150000003626 triacylglycerols Chemical class 0.000 description 2
- 125000000025 triisopropylsilyl group Chemical group C(C)(C)[Si](C(C)C)(C(C)C)* 0.000 description 2
- GXPHKUHSUJUWKP-UHFFFAOYSA-N troglitazone Chemical compound C1CC=2C(C)=C(O)C(C)=C(C)C=2OC1(C)COC(C=C1)=CC=C1CC1SC(=O)NC1=O GXPHKUHSUJUWKP-UHFFFAOYSA-N 0.000 description 2
- 229960001641 troglitazone Drugs 0.000 description 2
- GXPHKUHSUJUWKP-NTKDMRAZSA-N troglitazone Natural products C([C@@]1(OC=2C(C)=C(C(=C(C)C=2CC1)O)C)C)OC(C=C1)=CC=C1C[C@H]1SC(=O)NC1=O GXPHKUHSUJUWKP-NTKDMRAZSA-N 0.000 description 2
- 229910052721 tungsten Inorganic materials 0.000 description 2
- 208000022934 urinary frequency Diseases 0.000 description 2
- 230000036318 urination frequency Effects 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 230000002792 vascular Effects 0.000 description 2
- 235000015112 vegetable and seed oil Nutrition 0.000 description 2
- 239000008158 vegetable oil Substances 0.000 description 2
- 235000019165 vitamin E Nutrition 0.000 description 2
- 229940046009 vitamin E Drugs 0.000 description 2
- 239000011709 vitamin E Substances 0.000 description 2
- 229960005080 warfarin Drugs 0.000 description 2
- PJVWKTKQMONHTI-UHFFFAOYSA-N warfarin Chemical compound OC=1C2=CC=CC=C2OC(=O)C=1C(CC(=O)C)C1=CC=CC=C1 PJVWKTKQMONHTI-UHFFFAOYSA-N 0.000 description 2
- 239000001993 wax Substances 0.000 description 2
- 230000004584 weight gain Effects 0.000 description 2
- 239000000080 wetting agent Substances 0.000 description 2
- 230000029663 wound healing Effects 0.000 description 2
- JIAARYAFYJHUJI-UHFFFAOYSA-L zinc dichloride Chemical compound [Cl-].[Cl-].[Zn+2] JIAARYAFYJHUJI-UHFFFAOYSA-L 0.000 description 2
- 239000002076 α-tocopherol Substances 0.000 description 2
- 235000004835 α-tocopherol Nutrition 0.000 description 2
- GVJHHUAWPYXKBD-IEOSBIPESA-N α-tocopherol Chemical compound OC1=C(C)C(C)=C2O[C@@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-IEOSBIPESA-N 0.000 description 2
- NOOLISFMXDJSKH-UTLUCORTSA-N (+)-Neomenthol Chemical compound CC(C)[C@@H]1CC[C@@H](C)C[C@@H]1O NOOLISFMXDJSKH-UTLUCORTSA-N 0.000 description 1
- NHTGHBARYWONDQ-UHFFFAOYSA-N (+-)-α-methyl-tyrosine Chemical compound OC(=O)C(N)(C)CC1=CC=C(O)C=C1 NHTGHBARYWONDQ-UHFFFAOYSA-N 0.000 description 1
- OGNSCSPNOLGXSM-UHFFFAOYSA-N (+/-)-DABA Natural products NCCC(N)C(O)=O OGNSCSPNOLGXSM-UHFFFAOYSA-N 0.000 description 1
- PROQIPRRNZUXQM-UHFFFAOYSA-N (16alpha,17betaOH)-Estra-1,3,5(10)-triene-3,16,17-triol Natural products OC1=CC=C2C3CCC(C)(C(C(O)C4)O)C4C3CCC2=C1 PROQIPRRNZUXQM-UHFFFAOYSA-N 0.000 description 1
- QYYZXEPEVBXNNA-QGZVFWFLSA-N (1R)-2-acetyl-N-[4-(1,1,1,3,3,3-hexafluoro-2-hydroxypropan-2-yl)phenyl]-5-methylsulfonyl-1,3-dihydroisoindole-1-carboxamide Chemical compound C(C)(=O)N1[C@H](C2=CC=C(C=C2C1)S(=O)(=O)C)C(=O)NC1=CC=C(C=C1)C(C(F)(F)F)(C(F)(F)F)O QYYZXEPEVBXNNA-QGZVFWFLSA-N 0.000 description 1
- ZRMYHUFDVLRYPN-WSOKHJQSSA-N (1s,5r)-3-oxabicyclo[3.1.0]hexane-2,4-dione Chemical compound O=C1OC(=O)[C@@H]2C[C@H]12 ZRMYHUFDVLRYPN-WSOKHJQSSA-N 0.000 description 1
- VCQURUZYYSOUHP-UHFFFAOYSA-N (2,3,4,5,6-pentafluorophenyl) 2,2,2-trifluoroacetate Chemical compound FC1=C(F)C(F)=C(OC(=O)C(F)(F)F)C(F)=C1F VCQURUZYYSOUHP-UHFFFAOYSA-N 0.000 description 1
- XUFXOAAUWZOOIT-SXARVLRPSA-N (2R,3R,4R,5S,6R)-5-[[(2R,3R,4R,5S,6R)-5-[[(2R,3R,4S,5S,6R)-3,4-dihydroxy-6-methyl-5-[[(1S,4R,5S,6S)-4,5,6-trihydroxy-3-(hydroxymethyl)-1-cyclohex-2-enyl]amino]-2-oxanyl]oxy]-3,4-dihydroxy-6-(hydroxymethyl)-2-oxanyl]oxy]-6-(hydroxymethyl)oxane-2,3,4-triol Chemical compound O([C@H]1O[C@H](CO)[C@H]([C@@H]([C@H]1O)O)O[C@H]1O[C@@H]([C@H]([C@H](O)[C@H]1O)N[C@@H]1[C@@H]([C@@H](O)[C@H](O)C(CO)=C1)O)C)[C@@H]1[C@@H](CO)O[C@@H](O)[C@H](O)[C@H]1O XUFXOAAUWZOOIT-SXARVLRPSA-N 0.000 description 1
- XMAYWYJOQHXEEK-OZXSUGGESA-N (2R,4S)-ketoconazole Chemical compound C1CN(C(=O)C)CCN1C(C=C1)=CC=C1OC[C@@H]1O[C@@](CN2C=NC=C2)(C=2C(=CC(Cl)=CC=2)Cl)OC1 XMAYWYJOQHXEEK-OZXSUGGESA-N 0.000 description 1
- KSDDQEGWVBODMD-OULINLAESA-N (2S)-2-[[(2S,3S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-6-amino-2-[[(2S)-4-amino-2-[[(2S)-4-amino-2-[[(2S)-2-[[(2S,3S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2R)-2-amino-3-sulfanylpropanoyl]amino]-4-carboxybutanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]-3-methylbutanoyl]amino]hexanoyl]amino]-4-carboxybutanoyl]amino]-3-methylbutanoyl]amino]-3-hydroxybutanoyl]amino]hexanoyl]amino]-4-methylpentanoyl]amino]-3-methylpentanoyl]amino]-3-carboxypropanoyl]amino]-4-oxobutanoyl]amino]-4-oxobutanoyl]amino]hexanoyl]amino]-3-hydroxybutanoyl]amino]-4-carboxybutanoyl]amino]hexanoyl]amino]-4-carboxybutanoyl]amino]-3-methylpentanoyl]amino]-4-methylpentanoic acid Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CS)CC1=CC=CC=C1 KSDDQEGWVBODMD-OULINLAESA-N 0.000 description 1
- XEANIURBPHCHMG-SWLSCSKDSA-N (2r)-2-(3-chloro-4-methylsulfonylphenyl)-3-[(1r)-3-oxocyclopentyl]-n-pyrazin-2-ylpropanamide Chemical compound C1=C(Cl)C(S(=O)(=O)C)=CC=C1[C@H](C(=O)NC=1N=CC=NC=1)C[C@@H]1CC(=O)CC1 XEANIURBPHCHMG-SWLSCSKDSA-N 0.000 description 1
- SEFSGUQSMFDYPA-YFKPBYRVSA-N (2r)-2-(difluoroamino)-2-fluoro-3-methylbutanoic acid Chemical compound CC(C)[C@](F)(N(F)F)C(O)=O SEFSGUQSMFDYPA-YFKPBYRVSA-N 0.000 description 1
- WDQLRUYAYXDIFW-RWKIJVEZSA-N (2r,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-3,5-dihydroxy-4-[(2r,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-6-[[(2r,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxymethyl]oxan-2-yl]oxy-6-(hydroxymethyl)oxane-2,3,5-triol Chemical compound O[C@@H]1[C@@H](CO)O[C@@H](O)[C@H](O)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O)[C@H](O)[C@@H](CO[C@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O)O1 WDQLRUYAYXDIFW-RWKIJVEZSA-N 0.000 description 1
- BVAUMRCGVHUWOZ-ZETCQYMHSA-N (2s)-2-(cyclohexylazaniumyl)propanoate Chemical compound OC(=O)[C@H](C)NC1CCCCC1 BVAUMRCGVHUWOZ-ZETCQYMHSA-N 0.000 description 1
- LEVLUBIPMJQYHH-QMMMGPOBSA-N (2s)-2-(difluoroamino)-3-phenylpropanoic acid Chemical compound OC(=O)[C@@H](N(F)F)CC1=CC=CC=C1 LEVLUBIPMJQYHH-QMMMGPOBSA-N 0.000 description 1
- IYKLZBIWFXPUCS-VIFPVBQESA-N (2s)-2-(naphthalen-1-ylamino)propanoic acid Chemical compound C1=CC=C2C(N[C@@H](C)C(O)=O)=CC=CC2=C1 IYKLZBIWFXPUCS-VIFPVBQESA-N 0.000 description 1
- NPDBDJFLKKQMCM-SCSAIBSYSA-N (2s)-2-amino-3,3-dimethylbutanoic acid Chemical compound CC(C)(C)[C@H](N)C(O)=O NPDBDJFLKKQMCM-SCSAIBSYSA-N 0.000 description 1
- YLOCGHYTXIINAI-XKUOMLDTSA-N (2s)-2-amino-3-(4-hydroxyphenyl)propanoic acid;(2s)-2-aminopentanedioic acid;(2s)-2-aminopropanoic acid;(2s)-2,6-diaminohexanoic acid Chemical compound C[C@H](N)C(O)=O.NCCCC[C@H](N)C(O)=O.OC(=O)[C@@H](N)CCC(O)=O.OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 YLOCGHYTXIINAI-XKUOMLDTSA-N 0.000 description 1
- WAMWSIDTKSNDCU-ZETCQYMHSA-N (2s)-2-azaniumyl-2-cyclohexylacetate Chemical compound OC(=O)[C@@H](N)C1CCCCC1 WAMWSIDTKSNDCU-ZETCQYMHSA-N 0.000 description 1
- HBJGLYBWNNQMOW-LURJTMIESA-N (2s)-2-azaniumyl-2-methylpentanoate Chemical compound CCC[C@](C)(N)C(O)=O HBJGLYBWNNQMOW-LURJTMIESA-N 0.000 description 1
- MNZLMQYCEWHPPS-REOHCLBHSA-N (2s)-2-azaniumyl-5,5,5-trifluoro-4-(trifluoromethyl)pentanoate Chemical compound OC(=O)[C@@H](N)CC(C(F)(F)F)C(F)(F)F MNZLMQYCEWHPPS-REOHCLBHSA-N 0.000 description 1
- AQYCMVICBNBXNA-BYPYZUCNSA-N (2s)-2-methylpentanedioic acid Chemical compound OC(=O)[C@@H](C)CCC(O)=O AQYCMVICBNBXNA-BYPYZUCNSA-N 0.000 description 1
- QNLWMPLUWMWDMQ-YTTGMZPUSA-N (2s)-3-[4-(2-carbazol-9-ylethoxy)phenyl]-2-[2-(4-fluorobenzoyl)anilino]propanoic acid Chemical compound N([C@@H](CC=1C=CC(OCCN2C3=CC=CC=C3C3=CC=CC=C32)=CC=1)C(=O)O)C1=CC=CC=C1C(=O)C1=CC=C(F)C=C1 QNLWMPLUWMWDMQ-YTTGMZPUSA-N 0.000 description 1
- CQYBNXGHMBNGCG-FXQIFTODSA-N (2s,3as,7as)-2,3,3a,4,5,6,7,7a-octahydro-1h-indol-1-ium-2-carboxylate Chemical compound C1CCC[C@@H]2[NH2+][C@H](C(=O)[O-])C[C@@H]21 CQYBNXGHMBNGCG-FXQIFTODSA-N 0.000 description 1
- LJRDOKAZOAKLDU-UDXJMMFXSA-N (2s,3s,4r,5r,6r)-5-amino-2-(aminomethyl)-6-[(2r,3s,4r,5s)-5-[(1r,2r,3s,5r,6s)-3,5-diamino-2-[(2s,3r,4r,5s,6r)-3-amino-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-6-hydroxycyclohexyl]oxy-4-hydroxy-2-(hydroxymethyl)oxolan-3-yl]oxyoxane-3,4-diol;sulfuric ac Chemical compound OS(O)(=O)=O.N[C@@H]1[C@@H](O)[C@H](O)[C@H](CN)O[C@@H]1O[C@H]1[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](N)C[C@@H](N)[C@@H]2O)O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)N)O[C@@H]1CO LJRDOKAZOAKLDU-UDXJMMFXSA-N 0.000 description 1
- HSINOMROUCMIEA-FGVHQWLLSA-N (2s,4r)-4-[(3r,5s,6r,7r,8s,9s,10s,13r,14s,17r)-6-ethyl-3,7-dihydroxy-10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1h-cyclopenta[a]phenanthren-17-yl]-2-methylpentanoic acid Chemical compound C([C@@]12C)C[C@@H](O)C[C@H]1[C@@H](CC)[C@@H](O)[C@@H]1[C@@H]2CC[C@]2(C)[C@@H]([C@H](C)C[C@H](C)C(O)=O)CC[C@H]21 HSINOMROUCMIEA-FGVHQWLLSA-N 0.000 description 1
- JSYGLDMGERSRPC-FQUUOJAGSA-N (2s,4s)-4-fluoro-1-[2-[[(1r,3s)-3-(1,2,4-triazol-1-ylmethyl)cyclopentyl]amino]acetyl]pyrrolidine-2-carbonitrile Chemical compound C1[C@@H](F)C[C@@H](C#N)N1C(=O)CN[C@H]1C[C@@H](CN2N=CN=C2)CC1 JSYGLDMGERSRPC-FQUUOJAGSA-N 0.000 description 1
- ZGGHKIMDNBDHJB-NRFPMOEYSA-M (3R,5S)-fluvastatin sodium Chemical compound [Na+].C12=CC=CC=C2N(C(C)C)C(\C=C\[C@@H](O)C[C@@H](O)CC([O-])=O)=C1C1=CC=C(F)C=C1 ZGGHKIMDNBDHJB-NRFPMOEYSA-M 0.000 description 1
- FRKGSNOMLIYPSH-VKHMYHEASA-N (3s)-3-hydroxypyrrolidin-2-one Chemical compound O[C@H]1CCNC1=O FRKGSNOMLIYPSH-VKHMYHEASA-N 0.000 description 1
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- SIFQWEJOHACJOL-SYDPRGILSA-N (3s,5r)-3,5-dimethyloxane-2,6-dione Chemical compound C[C@H]1C[C@@H](C)C(=O)OC1=O SIFQWEJOHACJOL-SYDPRGILSA-N 0.000 description 1
- AGBQKNBQESQNJD-SSDOTTSWSA-N (R)-lipoic acid Chemical compound OC(=O)CCCC[C@@H]1CCSS1 AGBQKNBQESQNJD-SSDOTTSWSA-N 0.000 description 1
- WXUAQHNMJWJLTG-GSVOUGTGSA-N (R)-methylsuccinic acid Chemical compound OC(=O)[C@H](C)CC(O)=O WXUAQHNMJWJLTG-GSVOUGTGSA-N 0.000 description 1
- XJLSEXAGTJCILF-RXMQYKEDSA-N (R)-nipecotic acid zwitterion Chemical compound OC(=O)[C@@H]1CCCNC1 XJLSEXAGTJCILF-RXMQYKEDSA-N 0.000 description 1
- TVYLLZQTGLZFBW-ZBFHGGJFSA-N (R,R)-tramadol Chemical compound COC1=CC=CC([C@]2(O)[C@H](CCCC2)CN(C)C)=C1 TVYLLZQTGLZFBW-ZBFHGGJFSA-N 0.000 description 1
- ZEUITGRIYCTCEM-KRWDZBQOSA-N (S)-duloxetine Chemical compound C1([C@@H](OC=2C3=CC=CC=C3C=CC=2)CCNC)=CC=CS1 ZEUITGRIYCTCEM-KRWDZBQOSA-N 0.000 description 1
- BJEPYKJPYRNKOW-REOHCLBHSA-N (S)-malic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O BJEPYKJPYRNKOW-REOHCLBHSA-N 0.000 description 1
- TYAFIFFKPSWZRM-HYXAFXHYSA-N (z)-2-amino-4-methylpent-2-enoic acid Chemical compound CC(C)\C=C(/N)C(O)=O TYAFIFFKPSWZRM-HYXAFXHYSA-N 0.000 description 1
- OXFGRWIKQDSSLY-UHFFFAOYSA-N 1,2,3,4-tetrahydroisoquinolin-2-ium-1-carboxylate Chemical compound C1=CC=C2C(C(=O)O)NCCC2=C1 OXFGRWIKQDSSLY-UHFFFAOYSA-N 0.000 description 1
- FHGWEHGZBUBQKL-UHFFFAOYSA-N 1,2-benzothiazepine Chemical compound S1N=CC=CC2=CC=CC=C12 FHGWEHGZBUBQKL-UHFFFAOYSA-N 0.000 description 1
- SLYRGJDSFOCAAI-UHFFFAOYSA-N 1,3-thiazolidin-2-one Chemical compound O=C1NCCS1 SLYRGJDSFOCAAI-UHFFFAOYSA-N 0.000 description 1
- PIYNUZCGMLCXKJ-UHFFFAOYSA-N 1,4-dioxane-2,6-dione Chemical compound O=C1COCC(=O)O1 PIYNUZCGMLCXKJ-UHFFFAOYSA-N 0.000 description 1
- WORJRXHJTUTINR-UHFFFAOYSA-N 1,4-dioxane;hydron;chloride Chemical compound Cl.C1COCCO1 WORJRXHJTUTINR-UHFFFAOYSA-N 0.000 description 1
- GJFNRSDCSTVPCJ-UHFFFAOYSA-N 1,8-bis(dimethylamino)naphthalene Chemical compound C1=CC(N(C)C)=C2C(N(C)C)=CC=CC2=C1 GJFNRSDCSTVPCJ-UHFFFAOYSA-N 0.000 description 1
- KZJHLERAPCHKAI-UHFFFAOYSA-N 1-(2-hydroxyethyl)azepan-2-one Chemical compound OCCN1CCCCCC1=O KZJHLERAPCHKAI-UHFFFAOYSA-N 0.000 description 1
- UNMBLVOFOAGGCG-UHFFFAOYSA-N 1-(3-tert-butyl-4-methoxy-5-morpholin-4-ylphenyl)-2-(5,6-diethoxy-4-fluoro-3-imino-1h-isoindol-2-yl)ethanone;hydrobromide Chemical compound Br.N=C1C=2C(F)=C(OCC)C(OCC)=CC=2CN1CC(=O)C(C=C(C=1OC)C(C)(C)C)=CC=1N1CCOCC1 UNMBLVOFOAGGCG-UHFFFAOYSA-N 0.000 description 1
- WOXWUZCRWJWTRT-UHFFFAOYSA-N 1-amino-1-cyclohexanecarboxylic acid Chemical compound OC(=O)C1(N)CCCCC1 WOXWUZCRWJWTRT-UHFFFAOYSA-N 0.000 description 1
- NILQLFBWTXNUOE-UHFFFAOYSA-N 1-aminocyclopentanecarboxylic acid Chemical compound OC(=O)C1(N)CCCC1 NILQLFBWTXNUOE-UHFFFAOYSA-N 0.000 description 1
- WJFKNYWRSNBZNX-UHFFFAOYSA-N 10H-phenothiazine Chemical compound C1=CC=C2NC3=CC=CC=C3SC2=C1 WJFKNYWRSNBZNX-UHFFFAOYSA-N 0.000 description 1
- 102000004277 11-beta-hydroxysteroid dehydrogenases Human genes 0.000 description 1
- 108090000874 11-beta-hydroxysteroid dehydrogenases Proteins 0.000 description 1
- FPIPGXGPPPQFEQ-UHFFFAOYSA-N 13-cis retinol Natural products OCC=C(C)C=CC=C(C)C=CC1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-UHFFFAOYSA-N 0.000 description 1
- DUHQBKLTAVUXFF-FERBBOLQSA-N 192050-59-2 Chemical compound CS(O)(=O)=O.O=C1NC(=O)C2=C1C(C1=CC=CC=C11)=CN1CCO[C@H](CN(C)C)CCN1C3=CC=CC=C3C2=C1 DUHQBKLTAVUXFF-FERBBOLQSA-N 0.000 description 1
- KIPSRYDSZQRPEA-UHFFFAOYSA-N 2,2,2-trifluoroethanamine Chemical compound NCC(F)(F)F KIPSRYDSZQRPEA-UHFFFAOYSA-N 0.000 description 1
- BLCJBICVQSYOIF-UHFFFAOYSA-N 2,2-diaminobutanoic acid Chemical compound CCC(N)(N)C(O)=O BLCJBICVQSYOIF-UHFFFAOYSA-N 0.000 description 1
- CHHHXKFHOYLYRE-UHFFFAOYSA-M 2,4-Hexadienoic acid, potassium salt (1:1), (2E,4E)- Chemical compound [K+].CC=CC=CC([O-])=O CHHHXKFHOYLYRE-UHFFFAOYSA-M 0.000 description 1
- JSLFGFBQFKCNSQ-UHFFFAOYSA-N 2,4-bis[3-methoxy-4-(thiophene-2-carbonyloxy)phenyl]-1,3-bis[[4-[(2-methylpropan-2-yl)oxycarbonylamino]benzoyl]amino]cyclobutane-1,3-dicarboxylic acid Chemical compound COC1=CC(C2C(C(C=3C=C(OC)C(OC(=O)C=4SC=CC=4)=CC=3)C2(NC(=O)C=2C=CC(NC(=O)OC(C)(C)C)=CC=2)C(O)=O)(NC(=O)C=2C=CC(NC(=O)OC(C)(C)C)=CC=2)C(O)=O)=CC=C1OC(=O)C1=CC=CS1 JSLFGFBQFKCNSQ-UHFFFAOYSA-N 0.000 description 1
- NMRWDFUZLLQSBN-UHFFFAOYSA-N 2,4-dichloro-n-(3,5-dichloro-4-quinolin-3-yloxyphenyl)benzenesulfonamide Chemical compound ClC1=CC(Cl)=CC=C1S(=O)(=O)NC(C=C1Cl)=CC(Cl)=C1OC1=CN=C(C=CC=C2)C2=C1 NMRWDFUZLLQSBN-UHFFFAOYSA-N 0.000 description 1
- SGTNSNPWRIOYBX-UHFFFAOYSA-N 2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile Chemical compound C1=C(OC)C(OC)=CC=C1CCN(C)CCCC(C#N)(C(C)C)C1=CC=C(OC)C(OC)=C1 SGTNSNPWRIOYBX-UHFFFAOYSA-N 0.000 description 1
- GEFZFHTWRMQGOO-UHFFFAOYSA-N 2-(3-aminopropyl)isoindole-1,3-dione;hydrochloride Chemical compound Cl.C1=CC=C2C(=O)N(CCCN)C(=O)C2=C1 GEFZFHTWRMQGOO-UHFFFAOYSA-N 0.000 description 1
- DDTQLPXXNHLBAB-UHFFFAOYSA-N 2-(4-chlorophenyl)-2-[3-(trifluoromethyl)phenoxy]acetic acid Chemical compound C=1C=C(Cl)C=CC=1C(C(=O)O)OC1=CC=CC(C(F)(F)F)=C1 DDTQLPXXNHLBAB-UHFFFAOYSA-N 0.000 description 1
- TXHAHOVNFDVCCC-UHFFFAOYSA-N 2-(tert-butylazaniumyl)acetate Chemical compound CC(C)(C)NCC(O)=O TXHAHOVNFDVCCC-UHFFFAOYSA-N 0.000 description 1
- QWCKQJZIFLGMSD-UHFFFAOYSA-N 2-Aminobutanoic acid Natural products CCC(N)C(O)=O QWCKQJZIFLGMSD-UHFFFAOYSA-N 0.000 description 1
- IUVCFHHAEHNCFT-INIZCTEOSA-N 2-[(1s)-1-[4-amino-3-(3-fluoro-4-propan-2-yloxyphenyl)pyrazolo[3,4-d]pyrimidin-1-yl]ethyl]-6-fluoro-3-(3-fluorophenyl)chromen-4-one Chemical compound C1=C(F)C(OC(C)C)=CC=C1C(C1=C(N)N=CN=C11)=NN1[C@@H](C)C1=C(C=2C=C(F)C=CC=2)C(=O)C2=CC(F)=CC=C2O1 IUVCFHHAEHNCFT-INIZCTEOSA-N 0.000 description 1
- NCDZABJPWMBMIQ-INIZCTEOSA-N 2-[(3s)-1-[5-(cyclohexylcarbamoyl)-6-propylsulfanylpyridin-2-yl]piperidin-3-yl]acetic acid Chemical compound CCCSC1=NC(N2C[C@H](CC(O)=O)CCC2)=CC=C1C(=O)NC1CCCCC1 NCDZABJPWMBMIQ-INIZCTEOSA-N 0.000 description 1
- NFTMKHWBOINJGM-UHFFFAOYSA-N 2-[1-(5-ethylpyrimidin-2-yl)piperidin-4-yl]-4-[[4-(tetrazol-1-yl)phenoxy]methyl]-1,3-thiazole Chemical compound N1=CC(CC)=CN=C1N1CCC(C=2SC=C(COC=3C=CC(=CC=3)N3N=NN=C3)N=2)CC1 NFTMKHWBOINJGM-UHFFFAOYSA-N 0.000 description 1
- CMLUGNQVANVZHY-POURPWNDSA-N 2-[1-[2-[(3r,5s)-1-(3-acetyloxy-2,2-dimethylpropyl)-7-chloro-5-(2,3-dimethoxyphenyl)-2-oxo-5h-4,1-benzoxazepin-3-yl]acetyl]piperidin-4-yl]acetic acid Chemical compound COC1=CC=CC([C@@H]2C3=CC(Cl)=CC=C3N(CC(C)(C)COC(C)=O)C(=O)[C@@H](CC(=O)N3CCC(CC(O)=O)CC3)O2)=C1OC CMLUGNQVANVZHY-POURPWNDSA-N 0.000 description 1
- NSVFSAJIGAJDMR-UHFFFAOYSA-N 2-[benzyl(phenyl)amino]ethyl 5-(5,5-dimethyl-2-oxido-1,3,2-dioxaphosphinan-2-yl)-2,6-dimethyl-4-(3-nitrophenyl)-1,4-dihydropyridine-3-carboxylate Chemical compound CC=1NC(C)=C(C(=O)OCCN(CC=2C=CC=CC=2)C=2C=CC=CC=2)C(C=2C=C(C=CC=2)[N+]([O-])=O)C=1P1(=O)OCC(C)(C)CO1 NSVFSAJIGAJDMR-UHFFFAOYSA-N 0.000 description 1
- CXOWHCCVISNMIX-UHFFFAOYSA-N 2-aminonaphthalene-1-carboxylic acid Chemical compound C1=CC=CC2=C(C(O)=O)C(N)=CC=C21 CXOWHCCVISNMIX-UHFFFAOYSA-N 0.000 description 1
- KWOMLHIFHFWBSB-UHFFFAOYSA-N 2-azaniumyl-2-ethylbutanoate Chemical compound CCC(N)(CC)C(O)=O KWOMLHIFHFWBSB-UHFFFAOYSA-N 0.000 description 1
- HBJGLYBWNNQMOW-UHFFFAOYSA-N 2-azaniumyl-2-methylpentanoate Chemical compound CCCC(C)(N)C(O)=O HBJGLYBWNNQMOW-UHFFFAOYSA-N 0.000 description 1
- WTOFYLAWDLQMBZ-UHFFFAOYSA-N 2-azaniumyl-3-thiophen-2-ylpropanoate Chemical compound OC(=O)C(N)CC1=CC=CS1 WTOFYLAWDLQMBZ-UHFFFAOYSA-N 0.000 description 1
- JCCBZCMSYUSCFM-UHFFFAOYSA-N 2-chlorobenzenesulfonamide Chemical compound NS(=O)(=O)C1=CC=CC=C1Cl JCCBZCMSYUSCFM-UHFFFAOYSA-N 0.000 description 1
- SGUAFYQXFOLMHL-UHFFFAOYSA-N 2-hydroxy-5-{1-hydroxy-2-[(4-phenylbutan-2-yl)amino]ethyl}benzamide Chemical compound C=1C=C(O)C(C(N)=O)=CC=1C(O)CNC(C)CCC1=CC=CC=C1 SGUAFYQXFOLMHL-UHFFFAOYSA-N 0.000 description 1
- YZQLWPMZQVHJED-UHFFFAOYSA-N 2-methylpropanethioic acid S-[2-[[[1-(2-ethylbutyl)cyclohexyl]-oxomethyl]amino]phenyl] ester Chemical compound C=1C=CC=C(SC(=O)C(C)C)C=1NC(=O)C1(CC(CC)CC)CCCCC1 YZQLWPMZQVHJED-UHFFFAOYSA-N 0.000 description 1
- WPHUUIODWRNJLO-UHFFFAOYSA-N 2-nitrobenzenesulfonyl chloride Chemical compound [O-][N+](=O)C1=CC=CC=C1S(Cl)(=O)=O WPHUUIODWRNJLO-UHFFFAOYSA-N 0.000 description 1
- QCDWFXQBSFUVSP-UHFFFAOYSA-N 2-phenoxyethanol Chemical compound OCCOC1=CC=CC=C1 QCDWFXQBSFUVSP-UHFFFAOYSA-N 0.000 description 1
- PAVNZLVXYJDFNR-UHFFFAOYSA-N 3,3-dimethyloxane-2,6-dione Chemical compound CC1(C)CCC(=O)OC1=O PAVNZLVXYJDFNR-UHFFFAOYSA-N 0.000 description 1
- KQJVDEBWHJRJBT-UHFFFAOYSA-N 3,4-dihydro-1h-1,8-naphthyridin-2-one Chemical compound C1=CN=C2NC(=O)CCC2=C1 KQJVDEBWHJRJBT-UHFFFAOYSA-N 0.000 description 1
- BCSVCWVQNOXFGL-UHFFFAOYSA-N 3,4-dihydro-4-oxo-3-((5-trifluoromethyl-2-benzothiazolyl)methyl)-1-phthalazine acetic acid Chemical compound O=C1C2=CC=CC=C2C(CC(=O)O)=NN1CC1=NC2=CC(C(F)(F)F)=CC=C2S1 BCSVCWVQNOXFGL-UHFFFAOYSA-N 0.000 description 1
- FPQQSJJWHUJYPU-UHFFFAOYSA-N 3-(dimethylamino)propyliminomethylidene-ethylazanium;chloride Chemical compound Cl.CCN=C=NCCCN(C)C FPQQSJJWHUJYPU-UHFFFAOYSA-N 0.000 description 1
- WUXOJNUZYOFBMI-UHFFFAOYSA-N 3-[(2-methylpropan-2-yl)oxycarbonylamino]propylazanium;chloride Chemical compound Cl.CC(C)(C)OC(=O)NCCCN WUXOJNUZYOFBMI-UHFFFAOYSA-N 0.000 description 1
- RIIDAVMUCMIWKP-AWEZNQCLSA-N 3-[(2s)-1-hydroxypropan-2-yl]oxy-n-(1-methylpyrazol-3-yl)-5-(4-methylsulfonylphenoxy)benzamide Chemical compound C=1C(C(=O)NC2=NN(C)C=C2)=CC(O[C@H](CO)C)=CC=1OC1=CC=C(S(C)(=O)=O)C=C1 RIIDAVMUCMIWKP-AWEZNQCLSA-N 0.000 description 1
- FJEJHJINOKKDCW-INIZCTEOSA-N 3-[5-(azetidine-1-carbonyl)pyrazin-2-yl]oxy-5-[(2s)-1-methoxypropan-2-yl]oxy-n-(5-methylpyrazin-2-yl)benzamide Chemical compound C=1C(C(=O)NC=2N=CC(C)=NC=2)=CC(O[C@@H](C)COC)=CC=1OC(N=C1)=CN=C1C(=O)N1CCC1 FJEJHJINOKKDCW-INIZCTEOSA-N 0.000 description 1
- WZFZJEPHYDDFCT-UHFFFAOYSA-N 3-chloro-2-methyl-n-[4-[2-(3-oxomorpholin-4-yl)ethyl]-1,3-thiazol-2-yl]benzenesulfonamide Chemical compound CC1=C(Cl)C=CC=C1S(=O)(=O)NC1=NC(CCN2C(COCC2)=O)=CS1 WZFZJEPHYDDFCT-UHFFFAOYSA-N 0.000 description 1
- BXRLWGXPSRYJDZ-UHFFFAOYSA-N 3-cyanoalanine Chemical compound OC(=O)C(N)CC#N BXRLWGXPSRYJDZ-UHFFFAOYSA-N 0.000 description 1
- RUXHWBMJNBBYNL-UHFFFAOYSA-N 3-hydroxy-1,2-dihydropyrrol-5-one Chemical compound OC1=CC(=O)NC1 RUXHWBMJNBBYNL-UHFFFAOYSA-N 0.000 description 1
- HDFKMLFDDYWABF-UHFFFAOYSA-N 3-phenyloxolane-2,5-dione Chemical compound O=C1OC(=O)CC1C1=CC=CC=C1 HDFKMLFDDYWABF-UHFFFAOYSA-N 0.000 description 1
- YMPALHOKRBVHOJ-UHFFFAOYSA-N 3-{5-methoxy-1-[(4-methoxyphenyl)sulfonyl]-1h-indol-3-yl}propanoic acid Chemical compound C1=CC(OC)=CC=C1S(=O)(=O)N1C2=CC=C(OC)C=C2C(CCC(O)=O)=C1 YMPALHOKRBVHOJ-UHFFFAOYSA-N 0.000 description 1
- ZAKUXPKAPWYKQK-UHFFFAOYSA-N 3h-oxathiadiazole Chemical class N1SOC=N1 ZAKUXPKAPWYKQK-UHFFFAOYSA-N 0.000 description 1
- 239000003477 4 aminobutyric acid receptor stimulating agent Substances 0.000 description 1
- HIJQFTSZBHDYKW-UHFFFAOYSA-N 4,4-dimethyloxane-2,6-dione Chemical compound CC1(C)CC(=O)OC(=O)C1 HIJQFTSZBHDYKW-UHFFFAOYSA-N 0.000 description 1
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 1
- UZKXVFBKGNVTFE-UHFFFAOYSA-N 4-(4-chlorophenyl)-2-(2-methylimidazol-1-yl)-5-[3-(2-methylphenoxy)propyl]-1,3-oxazole Chemical compound CC1=NC=CN1C(O1)=NC(C=2C=CC(Cl)=CC=2)=C1CCCOC1=CC=CC=C1C UZKXVFBKGNVTFE-UHFFFAOYSA-N 0.000 description 1
- ACUIFAAXWDLLTR-UHFFFAOYSA-N 4-(9h-fluoren-9-ylmethoxycarbonylamino)butanoic acid Chemical compound C1=CC=C2C(COC(=O)NCCCC(=O)O)C3=CC=CC=C3C2=C1 ACUIFAAXWDLLTR-UHFFFAOYSA-N 0.000 description 1
- ASUWOMDZJCFFDR-UHFFFAOYSA-N 4-(9h-fluoren-9-ylmethoxycarbonylamino)pentanoic acid Chemical compound C1=CC=C2C(COC(=O)NC(CCC(O)=O)C)C3=CC=CC=C3C2=C1 ASUWOMDZJCFFDR-UHFFFAOYSA-N 0.000 description 1
- UKOOBSDARBTSHN-NGOMLPPMSA-M 4-(azulen-2-ylmethyl)-2-[(2s,3r,4r,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]phenolate;2-hydroxyethyl(trimethyl)azanium Chemical compound C[N+](C)(C)CCO.O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1C1=CC(CC=2C=C3C=CC=CC=C3C=2)=CC=C1[O-] UKOOBSDARBTSHN-NGOMLPPMSA-M 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- CMUHFUGDYMFHEI-QMMMGPOBSA-N 4-amino-L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N)C=C1 CMUHFUGDYMFHEI-QMMMGPOBSA-N 0.000 description 1
- ALYNCZNDIQEVRV-UHFFFAOYSA-N 4-aminobenzoic acid Chemical compound NC1=CC=C(C(O)=O)C=C1 ALYNCZNDIQEVRV-UHFFFAOYSA-N 0.000 description 1
- 229960000549 4-dimethylaminophenol Drugs 0.000 description 1
- XWHHYOYVRVGJJY-UHFFFAOYSA-N 4-fluorophenylalanine Chemical compound OC(=O)C(N)CC1=CC=C(F)C=C1 XWHHYOYVRVGJJY-UHFFFAOYSA-N 0.000 description 1
- ROFZMKDROVBLNY-UHFFFAOYSA-N 4-nitro-2-benzofuran-1,3-dione Chemical compound [O-][N+](=O)C1=CC=CC2=C1C(=O)OC2=O ROFZMKDROVBLNY-UHFFFAOYSA-N 0.000 description 1
- RXSFZYSNXZGVCU-UHFFFAOYSA-N 4h-oxadiazole-5-thione Chemical class S=C1CN=NO1 RXSFZYSNXZGVCU-UHFFFAOYSA-N 0.000 description 1
- XMBRHWVCMOPSRW-UHFFFAOYSA-N 4h-thiadiazol-5-one Chemical class O=C1CN=NS1 XMBRHWVCMOPSRW-UHFFFAOYSA-N 0.000 description 1
- UWXNEBLQDNYFMR-UHFFFAOYSA-N 5,5-dimethyl-1,3-thiazolidine-2,4-dione Chemical compound CC1(C)SC(=O)NC1=O UWXNEBLQDNYFMR-UHFFFAOYSA-N 0.000 description 1
- MXUNKHLAEDCYJL-UHFFFAOYSA-N 5-(hydroxymethyl)-3-(3-methylphenyl)-1,3-oxazolidin-2-one Chemical compound CC1=CC=CC(N2C(OC(CO)C2)=O)=C1 MXUNKHLAEDCYJL-UHFFFAOYSA-N 0.000 description 1
- MVDXXGIBARMXSA-PYUWXLGESA-N 5-[[(2r)-2-benzyl-3,4-dihydro-2h-chromen-6-yl]methyl]-1,3-thiazolidine-2,4-dione Chemical compound S1C(=O)NC(=O)C1CC1=CC=C(O[C@@H](CC=2C=CC=CC=2)CC2)C2=C1 MVDXXGIBARMXSA-PYUWXLGESA-N 0.000 description 1
- JCPWIGCGJUGLJQ-OGFXRTJISA-N 5-[[(2r)-azetidin-2-yl]methoxy]-2-chloropyridine;4-methylbenzenesulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1.C1=NC(Cl)=CC=C1OC[C@@H]1NCC1 JCPWIGCGJUGLJQ-OGFXRTJISA-N 0.000 description 1
- IETKPTYAGKZLKY-UHFFFAOYSA-N 5-[[4-[(3-methyl-4-oxoquinazolin-2-yl)methoxy]phenyl]methyl]-1,3-thiazolidine-2,4-dione Chemical compound N=1C2=CC=CC=C2C(=O)N(C)C=1COC(C=C1)=CC=C1CC1SC(=O)NC1=O IETKPTYAGKZLKY-UHFFFAOYSA-N 0.000 description 1
- 102000040125 5-hydroxytryptamine receptor family Human genes 0.000 description 1
- 108091032151 5-hydroxytryptamine receptor family Proteins 0.000 description 1
- MMVIDXVHQANYAE-UHFFFAOYSA-N 5-nitro-2-benzofuran-1,3-dione Chemical compound [O-][N+](=O)C1=CC=C2C(=O)OC(=O)C2=C1 MMVIDXVHQANYAE-UHFFFAOYSA-N 0.000 description 1
- BKYKPTRYDKTTJY-UHFFFAOYSA-N 6-chloro-3-(cyclopentylmethyl)-1,1-dioxo-3,4-dihydro-2H-1$l^{6},2,4-benzothiadiazine-7-sulfonamide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC(S(N2)(=O)=O)=C1NC2CC1CCCC1 BKYKPTRYDKTTJY-UHFFFAOYSA-N 0.000 description 1
- YTWPGUQMZQRYGM-UHFFFAOYSA-N 7-hydroxy-1,2,3,4-tetrahydroisoquinoline-1-carboxylic acid Chemical compound C1=C(O)C=C2C(C(=O)O)NCCC2=C1 YTWPGUQMZQRYGM-UHFFFAOYSA-N 0.000 description 1
- LRFVTYWOQMYALW-UHFFFAOYSA-N 9H-xanthine Chemical class O=C1NC(=O)NC2=C1NC=N2 LRFVTYWOQMYALW-UHFFFAOYSA-N 0.000 description 1
- 239000005541 ACE inhibitor Substances 0.000 description 1
- 229940127110 AZD1656 Drugs 0.000 description 1
- 206010000060 Abdominal distension Diseases 0.000 description 1
- 244000215068 Acacia senegal Species 0.000 description 1
- 235000006491 Acacia senegal Nutrition 0.000 description 1
- 229940100578 Acetylcholinesterase inhibitor Drugs 0.000 description 1
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 1
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 1
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 1
- 102000011690 Adiponectin Human genes 0.000 description 1
- 108010076365 Adiponectin Proteins 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 208000007848 Alcoholism Diseases 0.000 description 1
- JBMKAUGHUNFTOL-UHFFFAOYSA-N Aldoclor Chemical class C1=C(Cl)C(S(=O)(=O)N)=CC2=C1NC=NS2(=O)=O JBMKAUGHUNFTOL-UHFFFAOYSA-N 0.000 description 1
- 229920001450 Alpha-Cyclodextrin Polymers 0.000 description 1
- 239000005995 Aluminium silicate Substances 0.000 description 1
- 201000000736 Amenorrhea Diseases 0.000 description 1
- 206010001928 Amenorrhoea Diseases 0.000 description 1
- USFZMSVCRYTOJT-UHFFFAOYSA-N Ammonium acetate Chemical compound N.CC(O)=O USFZMSVCRYTOJT-UHFFFAOYSA-N 0.000 description 1
- 244000144725 Amygdalus communis Species 0.000 description 1
- 235000011437 Amygdalus communis Nutrition 0.000 description 1
- 208000003120 Angiofibroma Diseases 0.000 description 1
- 229940123413 Angiotensin II antagonist Drugs 0.000 description 1
- 206010002556 Ankylosing Spondylitis Diseases 0.000 description 1
- QNZCBYKSOIHPEH-UHFFFAOYSA-N Apixaban Chemical compound C1=CC(OC)=CC=C1N1C(C(=O)N(CC2)C=3C=CC(=CC=3)N3C(CCCC3)=O)=C2C(C(N)=O)=N1 QNZCBYKSOIHPEH-UHFFFAOYSA-N 0.000 description 1
- 206010003210 Arteriosclerosis Diseases 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- XUKUURHRXDUEBC-KAYWLYCHSA-N Atorvastatin Chemical compound C=1C=CC=CC=1C1=C(C=2C=CC(F)=CC=2)N(CC[C@@H](O)C[C@@H](O)CC(O)=O)C(C(C)C)=C1C(=O)NC1=CC=CC=C1 XUKUURHRXDUEBC-KAYWLYCHSA-N 0.000 description 1
- XUKUURHRXDUEBC-UHFFFAOYSA-N Atorvastatin Natural products C=1C=CC=CC=1C1=C(C=2C=CC(F)=CC=2)N(CCC(O)CC(O)CC(O)=O)C(C(C)C)=C1C(=O)NC1=CC=CC=C1 XUKUURHRXDUEBC-UHFFFAOYSA-N 0.000 description 1
- 208000032116 Autoimmune Experimental Encephalomyelitis Diseases 0.000 description 1
- 239000005485 Azilsartan Substances 0.000 description 1
- 239000005465 B01AC22 - Prasugrel Substances 0.000 description 1
- 108010028845 BIM 23190 Proteins 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 102100021334 Bcl-2-related protein A1 Human genes 0.000 description 1
- 208000035821 Benign schwannoma Diseases 0.000 description 1
- 239000005711 Benzoic acid Substances 0.000 description 1
- BWSSMIJUDVUASQ-UHFFFAOYSA-N Benzylhydrochlorothiazide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC(S(N2)(=O)=O)=C1NC2CC1=CC=CC=C1 BWSSMIJUDVUASQ-UHFFFAOYSA-N 0.000 description 1
- 229940123208 Biguanide Drugs 0.000 description 1
- 206010004716 Binge eating Diseases 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 102000004506 Blood Proteins Human genes 0.000 description 1
- 108010017384 Blood Proteins Proteins 0.000 description 1
- 208000019838 Blood disease Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 206010006550 Bulimia nervosa Diseases 0.000 description 1
- 229910014033 C-OH Inorganic materials 0.000 description 1
- 108010074051 C-Reactive Protein Proteins 0.000 description 1
- 102100032752 C-reactive protein Human genes 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- 239000002080 C09CA02 - Eprosartan Substances 0.000 description 1
- 239000004072 C09CA03 - Valsartan Substances 0.000 description 1
- 239000002947 C09CA04 - Irbesartan Substances 0.000 description 1
- 239000002081 C09CA05 - Tasosartan Substances 0.000 description 1
- 239000005537 C09CA07 - Telmisartan Substances 0.000 description 1
- 239000002051 C09CA08 - Olmesartan medoxomil Substances 0.000 description 1
- 239000003861 C09CA09 - Azilsartan medoxomil Substances 0.000 description 1
- 229940122820 Cannabinoid receptor antagonist Drugs 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 206010007733 Catabolic state Diseases 0.000 description 1
- 208000002177 Cataract Diseases 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- RKWGIWYCVPQPMF-UHFFFAOYSA-N Chloropropamide Chemical compound CCCNC(=O)NS(=O)(=O)C1=CC=C(Cl)C=C1 RKWGIWYCVPQPMF-UHFFFAOYSA-N 0.000 description 1
- JZUFKLXOESDKRF-UHFFFAOYSA-N Chlorothiazide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC2=C1NCNS2(=O)=O JZUFKLXOESDKRF-UHFFFAOYSA-N 0.000 description 1
- 101800001982 Cholecystokinin Proteins 0.000 description 1
- 102100025841 Cholecystokinin Human genes 0.000 description 1
- 108010009685 Cholinergic Receptors Proteins 0.000 description 1
- KJEBULYHNRNJTE-DHZHZOJOSA-N Cinalong Chemical compound COCCOC(=O)C1=C(C)NC(C)=C(C(=O)OC\C=C\C=2C=CC=CC=2)C1C1=CC=CC([N+]([O-])=O)=C1 KJEBULYHNRNJTE-DHZHZOJOSA-N 0.000 description 1
- BMOVQUBVGICXQN-UHFFFAOYSA-N Clinofibrate Chemical compound C1=CC(OC(C)(CC)C(O)=O)=CC=C1C1(C=2C=CC(OC(C)(CC)C(O)=O)=CC=2)CCCCC1 BMOVQUBVGICXQN-UHFFFAOYSA-N 0.000 description 1
- 206010009900 Colitis ulcerative Diseases 0.000 description 1
- 102000007644 Colony-Stimulating Factors Human genes 0.000 description 1
- 108010071942 Colony-Stimulating Factors Proteins 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 206010010071 Coma Diseases 0.000 description 1
- 102000034534 Cotransporters Human genes 0.000 description 1
- 108020003264 Cotransporters Proteins 0.000 description 1
- 229920000742 Cotton Polymers 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- 208000014311 Cushing syndrome Diseases 0.000 description 1
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 1
- 108010036949 Cyclosporine Proteins 0.000 description 1
- 229910014570 C—OH Inorganic materials 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- QWCKQJZIFLGMSD-GSVOUGTGSA-N D-alpha-aminobutyric acid Chemical compound CC[C@@H](N)C(O)=O QWCKQJZIFLGMSD-GSVOUGTGSA-N 0.000 description 1
- VVNCNSJFMMFHPL-VKHMYHEASA-N D-penicillamine Chemical compound CC(C)(S)[C@@H](N)C(O)=O VVNCNSJFMMFHPL-VKHMYHEASA-N 0.000 description 1
- NOOLISFMXDJSKH-UHFFFAOYSA-N DL-menthol Natural products CC(C)C1CCC(C)CC1O NOOLISFMXDJSKH-UHFFFAOYSA-N 0.000 description 1
- JVHXJTBJCFBINQ-ADAARDCZSA-N Dapagliflozin Chemical compound C1=CC(OCC)=CC=C1CC1=CC([C@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O)=CC=C1Cl JVHXJTBJCFBINQ-ADAARDCZSA-N 0.000 description 1
- HCYAFALTSJYZDH-UHFFFAOYSA-N Desimpramine Chemical compound C1CC2=CC=CC=C2N(CCCNC)C2=CC=CC=C21 HCYAFALTSJYZDH-UHFFFAOYSA-N 0.000 description 1
- YZCKVEUIGOORGS-OUBTZVSYSA-N Deuterium Chemical compound [2H] YZCKVEUIGOORGS-OUBTZVSYSA-N 0.000 description 1
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 1
- 208000007342 Diabetic Nephropathies Diseases 0.000 description 1
- 208000032781 Diabetic cardiomyopathy Diseases 0.000 description 1
- 208000002230 Diabetic coma Diseases 0.000 description 1
- 206010070901 Diabetic dyslipidaemia Diseases 0.000 description 1
- 206010012665 Diabetic gangrene Diseases 0.000 description 1
- XBPCUCUWBYBCDP-UHFFFAOYSA-N Dicyclohexylamine Chemical compound C1CCCCC1NC1CCCCC1 XBPCUCUWBYBCDP-UHFFFAOYSA-N 0.000 description 1
- 208000021994 Diffuse astrocytoma Diseases 0.000 description 1
- 229940123900 Direct thrombin inhibitor Drugs 0.000 description 1
- QXNVGIXVLWOKEQ-UHFFFAOYSA-N Disodium Chemical compound [Na][Na] QXNVGIXVLWOKEQ-UHFFFAOYSA-N 0.000 description 1
- XIQVNETUBQGFHX-UHFFFAOYSA-N Ditropan Chemical compound C=1C=CC=CC=1C(O)(C(=O)OCC#CCN(CC)CC)C1CCCCC1 XIQVNETUBQGFHX-UHFFFAOYSA-N 0.000 description 1
- 206010013654 Drug abuse Diseases 0.000 description 1
- 206010061825 Duodenal neoplasm Diseases 0.000 description 1
- ZGTMUACCHSMWAC-UHFFFAOYSA-L EDTA disodium salt (anhydrous) Chemical compound [Na+].[Na+].OC(=O)CN(CC([O-])=O)CCN(CC(O)=O)CC([O-])=O ZGTMUACCHSMWAC-UHFFFAOYSA-L 0.000 description 1
- 208000030814 Eating disease Diseases 0.000 description 1
- 102100021587 Embryonic testis differentiation protein homolog A Human genes 0.000 description 1
- 108010061435 Enalapril Proteins 0.000 description 1
- 208000017701 Endocrine disease Diseases 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 229940118365 Endothelin receptor antagonist Drugs 0.000 description 1
- 208000004232 Enteritis Diseases 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 102000003951 Erythropoietin Human genes 0.000 description 1
- 108090000394 Erythropoietin Proteins 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- VXLCNTLWWUDBSO-UHFFFAOYSA-N Ethiazide Chemical compound ClC1=C(S(N)(=O)=O)C=C2S(=O)(=O)NC(CC)NC2=C1 VXLCNTLWWUDBSO-UHFFFAOYSA-N 0.000 description 1
- IAYPIBMASNFSPL-UHFFFAOYSA-N Ethylene oxide Chemical compound C1CO1 IAYPIBMASNFSPL-UHFFFAOYSA-N 0.000 description 1
- 208000006168 Ewing Sarcoma Diseases 0.000 description 1
- 208000017259 Extragonadal germ cell tumor Diseases 0.000 description 1
- 229940082863 Factor VIIa inhibitor Drugs 0.000 description 1
- 229940123583 Factor Xa inhibitor Drugs 0.000 description 1
- BZCALJIHZVNMGJ-HSZRJFAPSA-N Fasiglifam Chemical compound CC1=CC(OCCCS(C)(=O)=O)=CC(C)=C1C1=CC=CC(COC=2C=C3OC[C@@H](CC(O)=O)C3=CC=2)=C1 BZCALJIHZVNMGJ-HSZRJFAPSA-N 0.000 description 1
- 208000019454 Feeding and Eating disease Diseases 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 108010049003 Fibrinogen Proteins 0.000 description 1
- 102000008946 Fibrinogen Human genes 0.000 description 1
- 206010016654 Fibrosis Diseases 0.000 description 1
- 206010053717 Fibrous histiocytoma Diseases 0.000 description 1
- 239000004606 Fillers/Extenders Substances 0.000 description 1
- 208000010235 Food Addiction Diseases 0.000 description 1
- 102100023374 Forkhead box protein M1 Human genes 0.000 description 1
- 208000036119 Frailty Diseases 0.000 description 1
- 102100026148 Free fatty acid receptor 1 Human genes 0.000 description 1
- 108010017464 Fructose-Bisphosphatase Proteins 0.000 description 1
- 102000027487 Fructose-Bisphosphatase Human genes 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 239000003691 GABA modulator Substances 0.000 description 1
- 229940100607 GPR119 agonist Drugs 0.000 description 1
- 108091007911 GSKs Proteins 0.000 description 1
- 206010017964 Gastrointestinal infection Diseases 0.000 description 1
- 206010064147 Gastrointestinal inflammation Diseases 0.000 description 1
- 241000206672 Gelidium Species 0.000 description 1
- HEMJJKBWTPKOJG-UHFFFAOYSA-N Gemfibrozil Chemical compound CC1=CC=C(C)C(OCCCC(C)(C)C(O)=O)=C1 HEMJJKBWTPKOJG-UHFFFAOYSA-N 0.000 description 1
- ZWPRRQZNBDYKLH-VIFPVBQESA-N Gemigliptin Chemical compound C([C@@H](N)CC(=O)N1CC2=C(C(=NC(=N2)C(F)(F)F)C(F)(F)F)CC1)N1CC(F)(F)CCC1=O ZWPRRQZNBDYKLH-VIFPVBQESA-N 0.000 description 1
- 108010016122 Ghrelin Receptors Proteins 0.000 description 1
- 108010072051 Glatiramer Acetate Proteins 0.000 description 1
- 206010018364 Glomerulonephritis Diseases 0.000 description 1
- 101800000224 Glucagon-like peptide 1 Proteins 0.000 description 1
- 229940089838 Glucagon-like peptide 1 receptor agonist Drugs 0.000 description 1
- 206010018404 Glucagonoma Diseases 0.000 description 1
- FAEKWTJYAYMJKF-QHCPKHFHSA-N GlucoNorm Chemical compound C1=C(C(O)=O)C(OCC)=CC(CC(=O)N[C@@H](CC(C)C)C=2C(=CC=CC=2)N2CCCCC2)=C1 FAEKWTJYAYMJKF-QHCPKHFHSA-N 0.000 description 1
- NMWQEPCLNXHPDX-UHFFFAOYSA-N Glybuzole Chemical compound S1C(C(C)(C)C)=NN=C1NS(=O)(=O)C1=CC=CC=C1 NMWQEPCLNXHPDX-UHFFFAOYSA-N 0.000 description 1
- 102000007390 Glycogen Phosphorylase Human genes 0.000 description 1
- 108010046163 Glycogen Phosphorylase Proteins 0.000 description 1
- 102000004103 Glycogen Synthase Kinases Human genes 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 239000004378 Glycyrrhizin Substances 0.000 description 1
- 208000009329 Graft vs Host Disease Diseases 0.000 description 1
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 1
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 1
- 208000003807 Graves Disease Diseases 0.000 description 1
- 208000015023 Graves' disease Diseases 0.000 description 1
- 102100039256 Growth hormone secretagogue receptor type 1 Human genes 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 208000008051 Hereditary Nonpolyposis Colorectal Neoplasms Diseases 0.000 description 1
- 208000017095 Hereditary nonpolyposis colon cancer Diseases 0.000 description 1
- 239000004705 High-molecular-weight polyethylene Substances 0.000 description 1
- 208000007353 Hip Osteoarthritis Diseases 0.000 description 1
- 102000004384 Histamine H3 receptors Human genes 0.000 description 1
- 108090000981 Histamine H3 receptors Proteins 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000677540 Homo sapiens Acetyl-CoA carboxylase 2 Proteins 0.000 description 1
- 101000894929 Homo sapiens Bcl-2-related protein A1 Proteins 0.000 description 1
- 101000898120 Homo sapiens Embryonic testis differentiation protein homolog A Proteins 0.000 description 1
- 101000846529 Homo sapiens Fibroblast growth factor 21 Proteins 0.000 description 1
- 101000907578 Homo sapiens Forkhead box protein M1 Proteins 0.000 description 1
- 101000912510 Homo sapiens Free fatty acid receptor 1 Proteins 0.000 description 1
- 101000788682 Homo sapiens GATA-type zinc finger protein 1 Proteins 0.000 description 1
- 101000886868 Homo sapiens Gastric inhibitory polypeptide Proteins 0.000 description 1
- 206010071119 Hormone-dependent prostate cancer Diseases 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- 206010020710 Hyperphagia Diseases 0.000 description 1
- 201000001431 Hyperuricemia Diseases 0.000 description 1
- 206010058359 Hypogonadism Diseases 0.000 description 1
- 206010021042 Hypopharyngeal cancer Diseases 0.000 description 1
- 206010056305 Hypopharyngeal neoplasm Diseases 0.000 description 1
- 239000003458 I kappa b kinase inhibitor Substances 0.000 description 1
- XQFRJNBWHJMXHO-RRKCRQDMSA-N IDUR Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(I)=C1 XQFRJNBWHJMXHO-RRKCRQDMSA-N 0.000 description 1
- 102100021711 Ileal sodium/bile acid cotransporter Human genes 0.000 description 1
- 101710156096 Ileal sodium/bile acid cotransporter Proteins 0.000 description 1
- 102000000521 Immunophilins Human genes 0.000 description 1
- 108010016648 Immunophilins Proteins 0.000 description 1
- 208000005726 Inflammatory Breast Neoplasms Diseases 0.000 description 1
- 206010021980 Inflammatory carcinoma of the breast Diseases 0.000 description 1
- 229940079288 Insulin receptor agonist Drugs 0.000 description 1
- 229940122199 Insulin secretagogue Drugs 0.000 description 1
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 1
- 102000004218 Insulin-Like Growth Factor I Human genes 0.000 description 1
- 102100026720 Interferon beta Human genes 0.000 description 1
- 108090000467 Interferon-beta Proteins 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 102000000588 Interleukin-2 Human genes 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102000010789 Interleukin-2 Receptors Human genes 0.000 description 1
- 108010038453 Interleukin-2 Receptors Proteins 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 102000004889 Interleukin-6 Human genes 0.000 description 1
- 208000005016 Intestinal Neoplasms Diseases 0.000 description 1
- 201000001429 Intracranial Thrombosis Diseases 0.000 description 1
- SFBODOKJTYAUCM-UHFFFAOYSA-N Ipriflavone Chemical compound C=1C(OC(C)C)=CC=C(C2=O)C=1OC=C2C1=CC=CC=C1 SFBODOKJTYAUCM-UHFFFAOYSA-N 0.000 description 1
- 108010041872 Islet Amyloid Polypeptide Proteins 0.000 description 1
- 102000036770 Islet Amyloid Polypeptide Human genes 0.000 description 1
- 102000005237 Isophane Insulin Human genes 0.000 description 1
- 108010081368 Isophane Insulin Proteins 0.000 description 1
- KLDXJTOLSGUMSJ-JGWLITMVSA-N Isosorbide Chemical compound O[C@@H]1CO[C@@H]2[C@@H](O)CO[C@@H]21 KLDXJTOLSGUMSJ-JGWLITMVSA-N 0.000 description 1
- 208000012659 Joint disease Diseases 0.000 description 1
- 208000008839 Kidney Neoplasms Diseases 0.000 description 1
- 208000003947 Knee Osteoarthritis Diseases 0.000 description 1
- SNDPXSYFESPGGJ-BYPYZUCNSA-N L-2-aminopentanoic acid Chemical compound CCC[C@H](N)C(O)=O SNDPXSYFESPGGJ-BYPYZUCNSA-N 0.000 description 1
- 235000019766 L-Lysine Nutrition 0.000 description 1
- FFFHZYDWPBMWHY-VKHMYHEASA-N L-homocysteine Chemical compound OC(=O)[C@@H](N)CCS FFFHZYDWPBMWHY-VKHMYHEASA-N 0.000 description 1
- JTTHKOPSMAVJFE-VIFPVBQESA-N L-homophenylalanine Chemical compound OC(=O)[C@@H](N)CCC1=CC=CC=C1 JTTHKOPSMAVJFE-VIFPVBQESA-N 0.000 description 1
- HKXLAGBDJVHRQG-YFKPBYRVSA-N L-lysinamide Chemical group NCCCC[C@H](N)C(N)=O HKXLAGBDJVHRQG-YFKPBYRVSA-N 0.000 description 1
- 125000001176 L-lysyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C([H])([H])C([H])([H])C([H])([H])C(N([H])[H])([H])[H] 0.000 description 1
- SNDPXSYFESPGGJ-UHFFFAOYSA-N L-norVal-OH Natural products CCCC(N)C(O)=O SNDPXSYFESPGGJ-UHFFFAOYSA-N 0.000 description 1
- HXEACLLIILLPRG-YFKPBYRVSA-N L-pipecolic acid Chemical compound [O-]C(=O)[C@@H]1CCCC[NH2+]1 HXEACLLIILLPRG-YFKPBYRVSA-N 0.000 description 1
- DGYHPLMPMRKMPD-UHFFFAOYSA-N L-propargyl glycine Natural products OC(=O)C(N)CC#C DGYHPLMPMRKMPD-UHFFFAOYSA-N 0.000 description 1
- NHTGHBARYWONDQ-JTQLQIEISA-N L-α-methyl-Tyrosine Chemical compound OC(=O)[C@](N)(C)CC1=CC=C(O)C=C1 NHTGHBARYWONDQ-JTQLQIEISA-N 0.000 description 1
- 208000008972 Laurence-Moon syndrome Diseases 0.000 description 1
- 208000018142 Leiomyosarcoma Diseases 0.000 description 1
- 229920001491 Lentinan Polymers 0.000 description 1
- 240000007472 Leucaena leucocephala Species 0.000 description 1
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 1
- 102100032352 Leukemia inhibitory factor Human genes 0.000 description 1
- 108090000581 Leukemia inhibitory factor Proteins 0.000 description 1
- LTXREWYXXSTFRX-QGZVFWFLSA-N Linagliptin Chemical compound N=1C=2N(C)C(=O)N(CC=3N=C4C=CC=CC4=C(C)N=3)C(=O)C=2N(CC#CC)C=1N1CCC[C@@H](N)C1 LTXREWYXXSTFRX-QGZVFWFLSA-N 0.000 description 1
- 239000000232 Lipid Bilayer Substances 0.000 description 1
- 206010049287 Lipodystrophy acquired Diseases 0.000 description 1
- 108010007859 Lisinopril Proteins 0.000 description 1
- 206010067125 Liver injury Diseases 0.000 description 1
- XVVOERDUTLJJHN-UHFFFAOYSA-N Lixisenatide Chemical compound C=1NC2=CC=CC=C2C=1CC(C(=O)NC(CC(C)C)C(=O)NC(CCCCN)C(=O)NC(CC(N)=O)C(=O)NCC(=O)NCC(=O)N1C(CCC1)C(=O)NC(CO)C(=O)NC(CO)C(=O)NCC(=O)NC(C)C(=O)N1C(CCC1)C(=O)N1C(CCC1)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)CC)NC(=O)C(NC(=O)C(CC(C)C)NC(=O)C(CCCNC(N)=N)NC(=O)C(NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(CCC(O)=O)NC(=O)C(CCC(O)=O)NC(=O)C(CCSC)NC(=O)C(CCC(N)=O)NC(=O)C(CCCCN)NC(=O)C(CO)NC(=O)C(CC(C)C)NC(=O)C(CC(O)=O)NC(=O)C(CO)NC(=O)C(NC(=O)C(CC=1C=CC=CC=1)NC(=O)C(NC(=O)CNC(=O)C(CCC(O)=O)NC(=O)CNC(=O)C(N)CC=1NC=NC=1)C(C)O)C(C)O)C(C)C)CC1=CC=CC=C1 XVVOERDUTLJJHN-UHFFFAOYSA-N 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 201000005027 Lynch syndrome Diseases 0.000 description 1
- 206010054805 Macroangiopathy Diseases 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 206010025476 Malabsorption Diseases 0.000 description 1
- 208000004155 Malabsorption Syndromes Diseases 0.000 description 1
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 1
- 240000003183 Manihot esculenta Species 0.000 description 1
- 235000016735 Manihot esculenta subsp esculenta Nutrition 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 208000005450 Maxillary Sinus Neoplasms Diseases 0.000 description 1
- ZPXSCAKFGYXMGA-UHFFFAOYSA-N Mazindol Chemical compound N12CCN=C2C2=CC=CC=C2C1(O)C1=CC=C(Cl)C=C1 ZPXSCAKFGYXMGA-UHFFFAOYSA-N 0.000 description 1
- 208000009018 Medullary thyroid cancer Diseases 0.000 description 1
- SMNOERSLNYGGOU-UHFFFAOYSA-N Mefruside Chemical compound C=1C=C(Cl)C(S(N)(=O)=O)=CC=1S(=O)(=O)N(C)CC1(C)CCCO1 SMNOERSLNYGGOU-UHFFFAOYSA-N 0.000 description 1
- 102000001796 Melanocortin 4 receptors Human genes 0.000 description 1
- 208000019255 Menstrual disease Diseases 0.000 description 1
- 208000002030 Merkel cell carcinoma Diseases 0.000 description 1
- CESYKOGBSMNBPD-UHFFFAOYSA-N Methyclothiazide Chemical compound ClC1=C(S(N)(=O)=O)C=C2S(=O)(=O)N(C)C(CCl)NC2=C1 CESYKOGBSMNBPD-UHFFFAOYSA-N 0.000 description 1
- 229940127308 Microsomal Triglyceride Transfer Protein Inhibitors Drugs 0.000 description 1
- IBAQFPQHRJAVAV-ULAWRXDQSA-N Miglitol Chemical compound OCCN1C[C@H](O)[C@@H](O)[C@H](O)[C@H]1CO IBAQFPQHRJAVAV-ULAWRXDQSA-N 0.000 description 1
- 102000003979 Mineralocorticoid Receptors Human genes 0.000 description 1
- 108090000375 Mineralocorticoid Receptors Proteins 0.000 description 1
- 102000015494 Mitochondrial Uncoupling Proteins Human genes 0.000 description 1
- 108010050258 Mitochondrial Uncoupling Proteins Proteins 0.000 description 1
- PCZOHLXUXFIOCF-UHFFFAOYSA-N Monacolin X Natural products C12C(OC(=O)C(C)CC)CC(C)C=C2C=CC(C)C1CCC1CC(O)CC(=O)O1 PCZOHLXUXFIOCF-UHFFFAOYSA-N 0.000 description 1
- 206010028116 Mucosal inflammation Diseases 0.000 description 1
- 201000010927 Mucositis Diseases 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 1
- 150000007945 N-acyl ureas Chemical class 0.000 description 1
- AHLBNYSZXLDEJQ-UHFFFAOYSA-N N-formyl-L-leucylester Natural products CCCCCCCCCCCC(OC(=O)C(CC(C)C)NC=O)CC1OC(=O)C1CCCCCC AHLBNYSZXLDEJQ-UHFFFAOYSA-N 0.000 description 1
- MBBZMMPHUWSWHV-BDVNFPICSA-N N-methylglucamine Chemical compound CNC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO MBBZMMPHUWSWHV-BDVNFPICSA-N 0.000 description 1
- 229940127523 NMDA Receptor Antagonists Drugs 0.000 description 1
- SEBFKMXJBCUCAI-UHFFFAOYSA-N NSC 227190 Natural products C1=C(O)C(OC)=CC(C2C(OC3=CC=C(C=C3O2)C2C(C(=O)C3=C(O)C=C(O)C=C3O2)O)CO)=C1 SEBFKMXJBCUCAI-UHFFFAOYSA-N 0.000 description 1
- 206010028729 Nasal cavity cancer Diseases 0.000 description 1
- 208000001894 Nasopharyngeal Neoplasms Diseases 0.000 description 1
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 1
- 206010029164 Nephrotic syndrome Diseases 0.000 description 1
- 102000015336 Nerve Growth Factor Human genes 0.000 description 1
- 102000007072 Nerve Growth Factors Human genes 0.000 description 1
- 206010029266 Neuroendocrine carcinoma of the skin Diseases 0.000 description 1
- 108090000742 Neurotrophin 3 Proteins 0.000 description 1
- 102100029268 Neurotrophin-3 Human genes 0.000 description 1
- ZBBHBTPTTSWHBA-UHFFFAOYSA-N Nicardipine Chemical compound COC(=O)C1=C(C)NC(C)=C(C(=O)OCCN(C)CC=2C=CC=CC=2)C1C1=CC=CC([N+]([O-])=O)=C1 ZBBHBTPTTSWHBA-UHFFFAOYSA-N 0.000 description 1
- KUEUWHJGRZKESU-UHFFFAOYSA-N Niceritrol Chemical compound C=1C=CN=CC=1C(=O)OCC(COC(=O)C=1C=NC=CC=1)(COC(=O)C=1C=NC=CC=1)COC(=O)C1=CC=CN=C1 KUEUWHJGRZKESU-UHFFFAOYSA-N 0.000 description 1
- VRAHPESAMYMDQI-UHFFFAOYSA-N Nicomol Chemical compound C1CCC(COC(=O)C=2C=NC=CC=2)(COC(=O)C=2C=NC=CC=2)C(O)C1(COC(=O)C=1C=NC=CC=1)COC(=O)C1=CC=CN=C1 VRAHPESAMYMDQI-UHFFFAOYSA-N 0.000 description 1
- 208000007944 Nodular Nonsuppurative Panniculitis Diseases 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- ILUJQPXNXACGAN-UHFFFAOYSA-N O-methylsalicylic acid Chemical compound COC1=CC=CC=C1C(O)=O ILUJQPXNXACGAN-UHFFFAOYSA-N 0.000 description 1
- BZQFBWGGLXLEPQ-UHFFFAOYSA-N O-phosphoryl-L-serine Natural products OC(=O)C(N)COP(O)(O)=O BZQFBWGGLXLEPQ-UHFFFAOYSA-N 0.000 description 1
- 208000004166 Obesity Hypoventilation Syndrome Diseases 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 239000005480 Olmesartan Substances 0.000 description 1
- UQGKUQLKSCSZGY-UHFFFAOYSA-N Olmesartan medoxomil Chemical compound C=1C=C(C=2C(=CC=CC=2)C2=NNN=N2)C=CC=1CN1C(CCC)=NC(C(C)(C)O)=C1C(=O)OCC=1OC(=O)OC=1C UQGKUQLKSCSZGY-UHFFFAOYSA-N 0.000 description 1
- 102000004140 Oncostatin M Human genes 0.000 description 1
- 108090000630 Oncostatin M Proteins 0.000 description 1
- 229940123257 Opioid receptor antagonist Drugs 0.000 description 1
- 208000003435 Optic Neuritis Diseases 0.000 description 1
- 229940123730 Orexin receptor antagonist Drugs 0.000 description 1
- 206010057444 Oropharyngeal neoplasm Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 208000007571 Ovarian Epithelial Carcinoma Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 229940123973 Oxygen scavenger Drugs 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 102000023984 PPAR alpha Human genes 0.000 description 1
- 108010016731 PPAR gamma Proteins 0.000 description 1
- CZYWHNTUXNGDGR-UHFFFAOYSA-L Pamidronate disodium Chemical compound O.O.O.O.O.[Na+].[Na+].NCCC(O)(P(O)([O-])=O)P(O)([O-])=O CZYWHNTUXNGDGR-UHFFFAOYSA-L 0.000 description 1
- 102000019280 Pancreatic lipases Human genes 0.000 description 1
- 108050006759 Pancreatic lipases Proteins 0.000 description 1
- 206010033645 Pancreatitis Diseases 0.000 description 1
- 208000000821 Parathyroid Neoplasms Diseases 0.000 description 1
- 238000003005 PathHunter Beta-Arrestin Assay Methods 0.000 description 1
- NFHFRUOZVGFOOS-UHFFFAOYSA-N Pd(PPh3)4 Substances [Pd].C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1 NFHFRUOZVGFOOS-UHFFFAOYSA-N 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 208000007683 Pediatric Obesity Diseases 0.000 description 1
- 208000002471 Penile Neoplasms Diseases 0.000 description 1
- 206010034299 Penile cancer Diseases 0.000 description 1
- 208000008469 Peptic Ulcer Diseases 0.000 description 1
- 102000003728 Peroxisome Proliferator-Activated Receptors Human genes 0.000 description 1
- 108090000029 Peroxisome Proliferator-Activated Receptors Proteins 0.000 description 1
- 102100038831 Peroxisome proliferator-activated receptor alpha Human genes 0.000 description 1
- 102100038825 Peroxisome proliferator-activated receptor gamma Human genes 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 208000009565 Pharyngeal Neoplasms Diseases 0.000 description 1
- 206010034811 Pharyngeal cancer Diseases 0.000 description 1
- 201000007100 Pharyngitis Diseases 0.000 description 1
- 229940123333 Phosphodiesterase 5 inhibitor Drugs 0.000 description 1
- 201000007286 Pilocytic astrocytoma Diseases 0.000 description 1
- UJEWTUDSLQGTOA-UHFFFAOYSA-N Piretanide Chemical compound C=1C=CC=CC=1OC=1C(S(=O)(=O)N)=CC(C(O)=O)=CC=1N1CCCC1 UJEWTUDSLQGTOA-UHFFFAOYSA-N 0.000 description 1
- 102000010752 Plasminogen Inactivators Human genes 0.000 description 1
- 108010077971 Plasminogen Inactivators Proteins 0.000 description 1
- 206010035664 Pneumonia Diseases 0.000 description 1
- 229920002507 Poloxamer 124 Polymers 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- CYLWJCABXYDINA-UHFFFAOYSA-N Polythiazide Polymers ClC1=C(S(N)(=O)=O)C=C2S(=O)(=O)N(C)C(CSCC(F)(F)F)NC2=C1 CYLWJCABXYDINA-UHFFFAOYSA-N 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 201000010769 Prader-Willi syndrome Diseases 0.000 description 1
- TUZYXOIXSAXUGO-UHFFFAOYSA-N Pravastatin Natural products C1=CC(C)C(CCC(O)CC(O)CC(O)=O)C2C(OC(=O)C(C)CC)CC(O)C=C21 TUZYXOIXSAXUGO-UHFFFAOYSA-N 0.000 description 1
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 1
- 208000001280 Prediabetic State Diseases 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 108010007568 Protamines Proteins 0.000 description 1
- 102000007327 Protamines Human genes 0.000 description 1
- 102000002727 Protein Tyrosine Phosphatase Human genes 0.000 description 1
- RWRDLPDLKQPQOW-UHFFFAOYSA-N Pyrrolidine Chemical group C1CCNC1 RWRDLPDLKQPQOW-UHFFFAOYSA-N 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 208000015634 Rectal Neoplasms Diseases 0.000 description 1
- GSINGUMRKGRYJP-VZWAGXQNSA-N Remogliflozin Chemical compound C1=CC(OC(C)C)=CC=C1CC1=C(C)N(C(C)C)N=C1O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 GSINGUMRKGRYJP-VZWAGXQNSA-N 0.000 description 1
- 206010038389 Renal cancer Diseases 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 206010057190 Respiratory tract infections Diseases 0.000 description 1
- IIDJRNMFWXDHID-UHFFFAOYSA-N Risedronic acid Chemical compound OP(=O)(O)C(P(O)(O)=O)(O)CC1=CC=CN=C1 IIDJRNMFWXDHID-UHFFFAOYSA-N 0.000 description 1
- XSVMFMHYUFZWBK-NSHDSACASA-N Rivastigmine Chemical compound CCN(C)C(=O)OC1=CC=CC([C@H](C)N(C)C)=C1 XSVMFMHYUFZWBK-NSHDSACASA-N 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- RYMZZMVNJRMUDD-UHFFFAOYSA-N SJ000286063 Natural products C12C(OC(=O)C(C)(C)CC)CC(C)C=C2C=CC(C)C1CCC1CC(O)CC(=O)O1 RYMZZMVNJRMUDD-UHFFFAOYSA-N 0.000 description 1
- 108091006277 SLC5A1 Proteins 0.000 description 1
- 208000004337 Salivary Gland Neoplasms Diseases 0.000 description 1
- 206010061934 Salivary gland cancer Diseases 0.000 description 1
- 108010077895 Sarcosine Proteins 0.000 description 1
- 240000006079 Schisandra chinensis Species 0.000 description 1
- 235000008422 Schisandra chinensis Nutrition 0.000 description 1
- 206010070834 Sensitisation Diseases 0.000 description 1
- 229940127347 Serotonin 2c Receptor Agonists Drugs 0.000 description 1
- 201000001880 Sexual dysfunction Diseases 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- 241000320380 Silybum Species 0.000 description 1
- 235000010841 Silybum marianum Nutrition 0.000 description 1
- JLRNKCZRCMIVKA-UHFFFAOYSA-N Simfibrate Chemical compound C=1C=C(Cl)C=CC=1OC(C)(C)C(=O)OCCCOC(=O)C(C)(C)OC1=CC=C(Cl)C=C1 JLRNKCZRCMIVKA-UHFFFAOYSA-N 0.000 description 1
- 229920000519 Sizofiran Polymers 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- 206010054184 Small intestine carcinoma Diseases 0.000 description 1
- 108010052164 Sodium Channels Proteins 0.000 description 1
- 102000018674 Sodium Channels Human genes 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 1
- 102000058090 Sodium-Glucose Transporter 1 Human genes 0.000 description 1
- 206010062255 Soft tissue infection Diseases 0.000 description 1
- 208000021712 Soft tissue sarcoma Diseases 0.000 description 1
- 244000061456 Solanum tuberosum Species 0.000 description 1
- 235000002595 Solanum tuberosum Nutrition 0.000 description 1
- SSZBUIDZHHWXNJ-UHFFFAOYSA-N Stearinsaeure-hexadecylester Natural products CCCCCCCCCCCCCCCCCC(=O)OCCCCCCCCCCCCCCCC SSZBUIDZHHWXNJ-UHFFFAOYSA-N 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 208000006011 Stroke Diseases 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-N Succinic acid Natural products OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- CYQFCXCEBYINGO-UHFFFAOYSA-N THC Natural products C1=C(C)CCC2C(C)(C)OC3=CC(CCCCC)=CC(O)=C3C21 CYQFCXCEBYINGO-UHFFFAOYSA-N 0.000 description 1
- QJJXYPPXXYFBGM-LFZNUXCKSA-N Tacrolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1\C=C(/C)[C@@H]1[C@H](C)[C@@H](O)CC(=O)[C@H](CC=C)/C=C(C)/C[C@H](C)C[C@H](OC)[C@H]([C@H](C[C@H]2C)OC)O[C@@]2(O)C(=O)C(=O)N2CCCC[C@H]2C(=O)O1 QJJXYPPXXYFBGM-LFZNUXCKSA-N 0.000 description 1
- QLYKJCMUNUWAGO-GAJHUEQPSA-N Taranabant Chemical compound N([C@@H](C)[C@@H](CC=1C=CC(Cl)=CC=1)C=1C=C(C=CC=1)C#N)C(=O)C(C)(C)OC1=CC=C(C(F)(F)F)C=N1 QLYKJCMUNUWAGO-GAJHUEQPSA-N 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 208000011622 Testicular disease Diseases 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- JLRGJRBPOGGCBT-UHFFFAOYSA-N Tolbutamide Chemical compound CCCCNC(=O)NS(=O)(=O)C1=CC=C(C)C=C1 JLRGJRBPOGGCBT-UHFFFAOYSA-N 0.000 description 1
- 206010062129 Tongue neoplasm Diseases 0.000 description 1
- KJADKKWYZYXHBB-XBWDGYHZSA-N Topiramic acid Chemical compound C1O[C@@]2(COS(N)(=O)=O)OC(C)(C)O[C@H]2[C@@H]2OC(C)(C)O[C@@H]21 KJADKKWYZYXHBB-XBWDGYHZSA-N 0.000 description 1
- 206010044407 Transitional cell cancer of the renal pelvis and ureter Diseases 0.000 description 1
- FNYLWPVRPXGIIP-UHFFFAOYSA-N Triamterene Chemical compound NC1=NC2=NC(N)=NC(N)=C2N=C1C1=CC=CC=C1 FNYLWPVRPXGIIP-UHFFFAOYSA-N 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- YZCKVEUIGOORGS-NJFSPNSNSA-N Tritium Chemical compound [3H] YZCKVEUIGOORGS-NJFSPNSNSA-N 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- 102100040247 Tumor necrosis factor Human genes 0.000 description 1
- 108010021436 Type 4 Melanocortin Receptor Proteins 0.000 description 1
- 201000006704 Ulcerative Colitis Diseases 0.000 description 1
- 102000008219 Uncoupling Protein 2 Human genes 0.000 description 1
- 108010021111 Uncoupling Protein 2 Proteins 0.000 description 1
- 102000008200 Uncoupling Protein 3 Human genes 0.000 description 1
- 108010021098 Uncoupling Protein 3 Proteins 0.000 description 1
- 206010046431 Urethral cancer Diseases 0.000 description 1
- 206010046458 Urethral neoplasms Diseases 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 108090000435 Urokinase-type plasminogen activator Proteins 0.000 description 1
- 102000003990 Urokinase-type plasminogen activator Human genes 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 206010046851 Uveitis Diseases 0.000 description 1
- 244000290333 Vanilla fragrans Species 0.000 description 1
- 235000009499 Vanilla fragrans Nutrition 0.000 description 1
- 235000012036 Vanilla tahitensis Nutrition 0.000 description 1
- FPIPGXGPPPQFEQ-BOOMUCAASA-N Vitamin A Natural products OC/C=C(/C)\C=C\C=C(\C)/C=C/C1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-BOOMUCAASA-N 0.000 description 1
- 229930003451 Vitamin B1 Natural products 0.000 description 1
- 229930003779 Vitamin B12 Natural products 0.000 description 1
- FZNCGRZWXLXZSZ-CIQUZCHMSA-N Voglibose Chemical compound OCC(CO)N[C@H]1C[C@](O)(CO)[C@@H](O)[C@H](O)[C@H]1O FZNCGRZWXLXZSZ-CIQUZCHMSA-N 0.000 description 1
- 206010047700 Vomiting Diseases 0.000 description 1
- 208000026736 Weber-Christian disease Diseases 0.000 description 1
- 208000008383 Wilms tumor Diseases 0.000 description 1
- 208000026589 Wolman disease Diseases 0.000 description 1
- 208000005946 Xerostomia Diseases 0.000 description 1
- 201000008629 Zollinger-Ellison syndrome Diseases 0.000 description 1
- SJZAPSHKTOTRBQ-UHFFFAOYSA-N [dimethylamino(triazolo[4,5-b]pyridin-1-yl)methylidene]-dimethylazanium Chemical compound C1=CC=C2[N+](=C(N(C)C)N(C)C)N=NC2=N1 SJZAPSHKTOTRBQ-UHFFFAOYSA-N 0.000 description 1
- 230000003187 abdominal effect Effects 0.000 description 1
- 201000010390 abdominal obesity-metabolic syndrome 1 Diseases 0.000 description 1
- 208000004622 abetalipoproteinemia Diseases 0.000 description 1
- 239000002250 absorbent Substances 0.000 description 1
- 230000002745 absorbent Effects 0.000 description 1
- 239000003655 absorption accelerator Substances 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 229960002632 acarbose Drugs 0.000 description 1
- XUFXOAAUWZOOIT-UHFFFAOYSA-N acarviostatin I01 Natural products OC1C(O)C(NC2C(C(O)C(O)C(CO)=C2)O)C(C)OC1OC(C(C1O)O)C(CO)OC1OC1C(CO)OC(O)C(O)C1O XUFXOAAUWZOOIT-UHFFFAOYSA-N 0.000 description 1
- BZKPWHYZMXOIDC-UHFFFAOYSA-N acetazolamide Chemical compound CC(=O)NC1=NN=C(S(N)(=O)=O)S1 BZKPWHYZMXOIDC-UHFFFAOYSA-N 0.000 description 1
- 229960000571 acetazolamide Drugs 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 229960001466 acetohexamide Drugs 0.000 description 1
- VGZSUPCWNCWDAN-UHFFFAOYSA-N acetohexamide Chemical compound C1=CC(C(=O)C)=CC=C1S(=O)(=O)NC(=O)NC1CCCCC1 VGZSUPCWNCWDAN-UHFFFAOYSA-N 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 102000034337 acetylcholine receptors Human genes 0.000 description 1
- 201000009840 acute diarrhea Diseases 0.000 description 1
- 208000005652 acute fatty liver of pregnancy Diseases 0.000 description 1
- 125000002015 acyclic group Chemical group 0.000 description 1
- 238000011374 additional therapy Methods 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- 229940125669 adenosine diphosphate receptor inhibitor Drugs 0.000 description 1
- 201000008395 adenosquamous carcinoma Diseases 0.000 description 1
- 210000000577 adipose tissue Anatomy 0.000 description 1
- 239000000464 adrenergic agent Substances 0.000 description 1
- 239000000048 adrenergic agonist Substances 0.000 description 1
- 239000000674 adrenergic antagonist Substances 0.000 description 1
- 229940126157 adrenergic receptor agonist Drugs 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 235000010419 agar Nutrition 0.000 description 1
- MKOMESMZHZNBIZ-UHFFFAOYSA-M alagebrium Chemical compound [Cl-].CC1=C(C)SC=[N+]1CC(=O)C1=CC=CC=C1 MKOMESMZHZNBIZ-UHFFFAOYSA-M 0.000 description 1
- OGWAVGNOAMXIIM-UHFFFAOYSA-N albiglutide Chemical compound O=C(O)C(NC(=O)CNC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)CNC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)CNC(=O)C(NC(=O)CNC(=O)C(N)CC=1(N=CNC=1))CCC(=O)O)C(O)C)CC2(=CC=CC=C2))C(O)C)CO)CC(=O)O)C(C)C)CO)CO)CC3(=CC=C(O)C=C3))CC(C)C)CCC(=O)O)CCC(=O)N)C)C)CCCCN)CCC(=O)O)CC4(=CC=CC=C4))C(CC)C)C)CC=6(C5(=C(C=CC=C5)NC=6)))CC(C)C)C(C)C)CCCCN)CCCNC(=N)N OGWAVGNOAMXIIM-UHFFFAOYSA-N 0.000 description 1
- 229960004733 albiglutide Drugs 0.000 description 1
- 206010001584 alcohol abuse Diseases 0.000 description 1
- 125000003158 alcohol group Chemical group 0.000 description 1
- 208000025746 alcohol use disease Diseases 0.000 description 1
- 230000001476 alcoholic effect Effects 0.000 description 1
- 150000001299 aldehydes Chemical group 0.000 description 1
- 239000002170 aldosterone antagonist Substances 0.000 description 1
- DAYKLWSKQJBGCS-NRFANRHFSA-N aleglitazar Chemical compound C1=2C=CSC=2C(C[C@H](OC)C(O)=O)=CC=C1OCCC(=C(O1)C)N=C1C1=CC=CC=C1 DAYKLWSKQJBGCS-NRFANRHFSA-N 0.000 description 1
- 229950010157 aleglitazar Drugs 0.000 description 1
- DCSBSVSZJRSITC-UHFFFAOYSA-M alendronate sodium trihydrate Chemical compound O.O.O.[Na+].NCCCC(O)(P(O)(O)=O)P(O)([O-])=O DCSBSVSZJRSITC-UHFFFAOYSA-M 0.000 description 1
- 229960004343 alendronic acid Drugs 0.000 description 1
- OFHCOWSQAMBJIW-AVJTYSNKSA-N alfacalcidol Chemical compound C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C\C=C1\C[C@@H](O)C[C@H](O)C1=C OFHCOWSQAMBJIW-AVJTYSNKSA-N 0.000 description 1
- 229960002535 alfacalcidol Drugs 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 229910052783 alkali metal Inorganic materials 0.000 description 1
- 229910052784 alkaline earth metal Inorganic materials 0.000 description 1
- 125000003545 alkoxy group Chemical group 0.000 description 1
- JAZBEHYOTPTENJ-JLNKQSITSA-N all-cis-5,8,11,14,17-icosapentaenoic acid Chemical compound CC\C=C/C\C=C/C\C=C/C\C=C/C\C=C/CCCC(O)=O JAZBEHYOTPTENJ-JLNKQSITSA-N 0.000 description 1
- FPIPGXGPPPQFEQ-OVSJKPMPSA-N all-trans-retinol Chemical compound OC\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-OVSJKPMPSA-N 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- BHELZAPQIKSEDF-UHFFFAOYSA-N allyl bromide Chemical compound BrCC=C BHELZAPQIKSEDF-UHFFFAOYSA-N 0.000 description 1
- 239000008168 almond oil Substances 0.000 description 1
- 229960001667 alogliptin Drugs 0.000 description 1
- ZSBOMTDTBDDKMP-OAHLLOKOSA-N alogliptin Chemical compound C=1C=CC=C(C#N)C=1CN1C(=O)N(C)C(=O)C=C1N1CCC[C@@H](N)C1 ZSBOMTDTBDDKMP-OAHLLOKOSA-N 0.000 description 1
- 239000002160 alpha blocker Substances 0.000 description 1
- HFHDHCJBZVLPGP-RWMJIURBSA-N alpha-cyclodextrin Chemical compound OC[C@H]([C@H]([C@@H]([C@H]1O)O)O[C@H]2O[C@@H]([C@@H](O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O3)[C@H](O)[C@H]2O)CO)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@@H]3O[C@@H]1CO HFHDHCJBZVLPGP-RWMJIURBSA-N 0.000 description 1
- 229940043377 alpha-cyclodextrin Drugs 0.000 description 1
- BJEPYKJPYRNKOW-UHFFFAOYSA-N alpha-hydroxysuccinic acid Natural products OC(=O)C(O)CC(O)=O BJEPYKJPYRNKOW-UHFFFAOYSA-N 0.000 description 1
- 229960003318 alteplase Drugs 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 235000010210 aluminium Nutrition 0.000 description 1
- PNEYBMLMFCGWSK-UHFFFAOYSA-N aluminium oxide Inorganic materials [O-2].[O-2].[O-2].[Al+3].[Al+3] PNEYBMLMFCGWSK-UHFFFAOYSA-N 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 235000012211 aluminium silicate Nutrition 0.000 description 1
- CEGOLXSVJUTHNZ-UHFFFAOYSA-K aluminium tristearate Chemical compound [Al+3].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CEGOLXSVJUTHNZ-UHFFFAOYSA-K 0.000 description 1
- 229940063655 aluminum stearate Drugs 0.000 description 1
- 231100000540 amenorrhea Toxicity 0.000 description 1
- HFQMYSHATTXRTC-JTQLQIEISA-N amiflamine Chemical compound C[C@H](N)CC1=CC=C(N(C)C)C=C1C HFQMYSHATTXRTC-JTQLQIEISA-N 0.000 description 1
- 229950004939 amiflamine Drugs 0.000 description 1
- 229960004050 aminobenzoic acid Drugs 0.000 description 1
- 229960000836 amitriptyline Drugs 0.000 description 1
- KRMDCWKBEZIMAB-UHFFFAOYSA-N amitriptyline Chemical compound C1CC2=CC=CC=C2C(=CCCN(C)C)C2=CC=CC=C21 KRMDCWKBEZIMAB-UHFFFAOYSA-N 0.000 description 1
- 229960000528 amlodipine Drugs 0.000 description 1
- ZPBWCRDSRKPIDG-UHFFFAOYSA-N amlodipine benzenesulfonate Chemical compound OS(=O)(=O)C1=CC=CC=C1.CCOC(=O)C1=C(COCCN)NC(C)=C(C(=O)OC)C1C1=CC=CC=C1Cl ZPBWCRDSRKPIDG-UHFFFAOYSA-N 0.000 description 1
- 239000002280 amphoteric surfactant Substances 0.000 description 1
- MZZLGJHLQGUVPN-HAWMADMCSA-N anacetrapib Chemical compound COC1=CC(F)=C(C(C)C)C=C1C1=CC=C(C(F)(F)F)C=C1CN1C(=O)O[C@H](C=2C=C(C=C(C=2)C(F)(F)F)C(F)(F)F)[C@@H]1C MZZLGJHLQGUVPN-HAWMADMCSA-N 0.000 description 1
- 229950000285 anacetrapib Drugs 0.000 description 1
- LDXYBEHACFJIEL-HNNXBMFYSA-N anagliptin Chemical compound C=1N2N=C(C)C=C2N=CC=1C(=O)NCC(C)(C)NCC(=O)N1CCC[C@H]1C#N LDXYBEHACFJIEL-HNNXBMFYSA-N 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 206010002224 anaplastic astrocytoma Diseases 0.000 description 1
- 229940044094 angiotensin-converting-enzyme inhibitor Drugs 0.000 description 1
- 229940031955 anhydrous lanolin Drugs 0.000 description 1
- 239000003957 anion exchange resin Substances 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- 239000003945 anionic surfactant Substances 0.000 description 1
- 229940124332 anorexigenic agent Drugs 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 229940005524 anti-dementia drug Drugs 0.000 description 1
- 229940121363 anti-inflammatory agent Drugs 0.000 description 1
- 239000002260 anti-inflammatory agent Substances 0.000 description 1
- 229940124599 anti-inflammatory drug Drugs 0.000 description 1
- 230000002785 anti-thrombosis Effects 0.000 description 1
- 230000000840 anti-viral effect Effects 0.000 description 1
- 229940125713 antianxiety drug Drugs 0.000 description 1
- 239000003416 antiarrhythmic agent Substances 0.000 description 1
- 239000003529 anticholesteremic agent Substances 0.000 description 1
- 229940127226 anticholesterol agent Drugs 0.000 description 1
- 229940127219 anticoagulant drug Drugs 0.000 description 1
- 239000001961 anticonvulsive agent Substances 0.000 description 1
- 239000000935 antidepressant agent Substances 0.000 description 1
- 229940005513 antidepressants Drugs 0.000 description 1
- 229940125708 antidiabetic agent Drugs 0.000 description 1
- 239000003472 antidiabetic agent Substances 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 229940006133 antiglaucoma drug and miotics carbonic anhydrase inhibitors Drugs 0.000 description 1
- 229940027983 antiseptic and disinfectant quaternary ammonium compound Drugs 0.000 description 1
- 239000004019 antithrombin Substances 0.000 description 1
- 239000003443 antiviral agent Substances 0.000 description 1
- 229940121357 antivirals Drugs 0.000 description 1
- 239000002249 anxiolytic agent Substances 0.000 description 1
- 229960003886 apixaban Drugs 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 125000000637 arginyl group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 1
- 208000011775 arteriosclerosis disease Diseases 0.000 description 1
- 206010003246 arthritis Diseases 0.000 description 1
- 125000000732 arylene group Chemical group 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 206010003549 asthenia Diseases 0.000 description 1
- 230000000923 atherogenic effect Effects 0.000 description 1
- 229960005370 atorvastatin Drugs 0.000 description 1
- MOTJMGVDPWRKOC-QPVYNBJUSA-N atrasentan Chemical compound C1([C@H]2[C@@H]([C@H](CN2CC(=O)N(CCCC)CCCC)C=2C=C3OCOC3=CC=2)C(O)=O)=CC=C(OC)C=C1 MOTJMGVDPWRKOC-QPVYNBJUSA-N 0.000 description 1
- 125000000852 azido group Chemical group *N=[N+]=[N-] 0.000 description 1
- KGSXMPPBFPAXLY-UHFFFAOYSA-N azilsartan Chemical compound CCOC1=NC2=CC=CC(C(O)=O)=C2N1CC(C=C1)=CC=C1C1=CC=CC=C1C1=NOC(=O)N1 KGSXMPPBFPAXLY-UHFFFAOYSA-N 0.000 description 1
- 229960002731 azilsartan Drugs 0.000 description 1
- 229960001211 azilsartan medoxomil Drugs 0.000 description 1
- QJFSABGVXDWMIW-UHFFFAOYSA-N azilsartan medoxomil Chemical compound C=12N(CC=3C=CC(=CC=3)C=3C(=CC=CC=3)C=3NC(=O)ON=3)C(OCC)=NC2=CC=CC=1C(=O)OCC=1OC(=O)OC=1C QJFSABGVXDWMIW-UHFFFAOYSA-N 0.000 description 1
- 229960004988 azosemide Drugs 0.000 description 1
- IIOPLILENRZKRV-UHFFFAOYSA-N azosemide Chemical compound C=1C=CSC=1CNC=1C=C(Cl)C(S(=O)(=O)N)=CC=1C1=NN=N[N]1 IIOPLILENRZKRV-UHFFFAOYSA-N 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 229950010663 balaglitazone Drugs 0.000 description 1
- 230000006399 behavior Effects 0.000 description 1
- 208000001119 benign fibrous histiocytoma Diseases 0.000 description 1
- 239000000440 bentonite Substances 0.000 description 1
- 229910000278 bentonite Inorganic materials 0.000 description 1
- SVPXDRXYRYOSEX-UHFFFAOYSA-N bentoquatam Chemical compound O.O=[Si]=O.O=[Al]O[Al]=O SVPXDRXYRYOSEX-UHFFFAOYSA-N 0.000 description 1
- 229960000686 benzalkonium chloride Drugs 0.000 description 1
- BMWITAUNXBHIPO-OZZZDHQUSA-N benzenesulfonic acid;(2s,4s)-4-fluoro-1-[2-[(1-hydroxy-2-methylpropan-2-yl)amino]acetyl]pyrrolidine-2-carbonitrile Chemical compound OS(=O)(=O)C1=CC=CC=C1.OCC(C)(C)NCC(=O)N1C[C@@H](F)C[C@H]1C#N BMWITAUNXBHIPO-OZZZDHQUSA-N 0.000 description 1
- 125000003785 benzimidazolyl group Chemical group N1=C(NC2=C1C=CC=C2)* 0.000 description 1
- 235000010233 benzoic acid Nutrition 0.000 description 1
- 150000007657 benzothiazepines Chemical class 0.000 description 1
- RROBIDXNTUAHFW-UHFFFAOYSA-N benzotriazol-1-yloxy-tris(dimethylamino)phosphanium Chemical compound C1=CC=C2N(O[P+](N(C)C)(N(C)C)N(C)C)N=NC2=C1 RROBIDXNTUAHFW-UHFFFAOYSA-N 0.000 description 1
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 1
- QQFYLZXBFWWJHR-UHFFFAOYSA-M benzyl(triethyl)phosphanium;bromide Chemical compound [Br-].CC[P+](CC)(CC)CC1=CC=CC=C1 QQFYLZXBFWWJHR-UHFFFAOYSA-M 0.000 description 1
- 229950007003 benzylhydrochlorothiazide Drugs 0.000 description 1
- 229960002890 beraprost Drugs 0.000 description 1
- YTCZZXIRLARSET-VJRSQJMHSA-M beraprost sodium Chemical compound [Na+].O([C@H]1C[C@@H](O)[C@@H]([C@@H]21)/C=C/[C@@H](O)C(C)CC#CC)C1=C2C=CC=C1CCCC([O-])=O YTCZZXIRLARSET-VJRSQJMHSA-M 0.000 description 1
- YBHILYKTIRIUTE-UHFFFAOYSA-N berberine Chemical compound C1=C2CC[N+]3=CC4=C(OC)C(OC)=CC=C4C=C3C2=CC2=C1OCO2 YBHILYKTIRIUTE-UHFFFAOYSA-N 0.000 description 1
- 229940093265 berberine Drugs 0.000 description 1
- QISXPYZVZJBNDM-UHFFFAOYSA-N berberine Natural products COc1ccc2C=C3N(Cc2c1OC)C=Cc4cc5OCOc5cc34 QISXPYZVZJBNDM-UHFFFAOYSA-N 0.000 description 1
- 150000001576 beta-amino acids Chemical class 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- WHGYBXFWUBPSRW-FOUAGVGXSA-N beta-cyclodextrin Chemical compound OC[C@H]([C@H]([C@@H]([C@H]1O)O)O[C@H]2O[C@@H]([C@@H](O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O3)[C@H](O)[C@H]2O)CO)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@@H]3O[C@@H]1CO WHGYBXFWUBPSRW-FOUAGVGXSA-N 0.000 description 1
- 229960004853 betadex Drugs 0.000 description 1
- 229960000516 bezafibrate Drugs 0.000 description 1
- IIBYAHWJQTYFKB-UHFFFAOYSA-N bezafibrate Chemical compound C1=CC(OC(C)(C)C(O)=O)=CC=C1CCNC(=O)C1=CC=C(Cl)C=C1 IIBYAHWJQTYFKB-UHFFFAOYSA-N 0.000 description 1
- 150000004283 biguanides Chemical class 0.000 description 1
- 239000003613 bile acid Substances 0.000 description 1
- 229940096699 bile acid sequestrants Drugs 0.000 description 1
- 208000026900 bile duct neoplasm Diseases 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 208000014679 binge eating disease Diseases 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 238000001574 biopsy Methods 0.000 description 1
- JCZLABDVDPYLRZ-AWEZNQCLSA-N biphenylalanine Chemical compound C1=CC(C[C@H](N)C(O)=O)=CC=C1C1=CC=CC=C1 JCZLABDVDPYLRZ-AWEZNQCLSA-N 0.000 description 1
- 208000024330 bloating Diseases 0.000 description 1
- 230000017531 blood circulation Effects 0.000 description 1
- 230000036765 blood level Effects 0.000 description 1
- 230000036772 blood pressure Effects 0.000 description 1
- 230000036760 body temperature Effects 0.000 description 1
- 208000012172 borderline epithelial tumor of ovary Diseases 0.000 description 1
- KGBXLFKZBHKPEV-UHFFFAOYSA-N boric acid Chemical compound OB(O)O KGBXLFKZBHKPEV-UHFFFAOYSA-N 0.000 description 1
- 239000004327 boric acid Substances 0.000 description 1
- 235000010338 boric acid Nutrition 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- 229960004111 buformin Drugs 0.000 description 1
- XSEUMFJMFFMCIU-UHFFFAOYSA-N buformin Chemical compound CCCC\N=C(/N)N=C(N)N XSEUMFJMFFMCIU-UHFFFAOYSA-N 0.000 description 1
- MAEIEVLCKWDQJH-UHFFFAOYSA-N bumetanide Chemical compound CCCCNC1=CC(C(O)=O)=CC(S(N)(=O)=O)=C1OC1=CC=CC=C1 MAEIEVLCKWDQJH-UHFFFAOYSA-N 0.000 description 1
- 229960004064 bumetanide Drugs 0.000 description 1
- KDYFGRWQOYBRFD-NUQCWPJISA-N butanedioic acid Chemical compound O[14C](=O)CC[14C](O)=O KDYFGRWQOYBRFD-NUQCWPJISA-N 0.000 description 1
- 230000003491 cAMP production Effects 0.000 description 1
- 230000011496 cAMP-mediated signaling Effects 0.000 description 1
- FJDQFPXHSGXQBY-UHFFFAOYSA-L caesium carbonate Chemical compound [Cs+].[Cs+].[O-]C([O-])=O FJDQFPXHSGXQBY-UHFFFAOYSA-L 0.000 description 1
- 229910000024 caesium carbonate Inorganic materials 0.000 description 1
- BBBFJLBPOGFECG-VJVYQDLKSA-N calcitonin Chemical compound N([C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(N)=O)C(C)C)C(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1 BBBFJLBPOGFECG-VJVYQDLKSA-N 0.000 description 1
- 229960003773 calcitonin (salmon synthetic) Drugs 0.000 description 1
- 229960005084 calcitriol Drugs 0.000 description 1
- GMRQFYUYWCNGIN-NKMMMXOESA-N calcitriol Chemical compound C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@@H](CCCC(C)(C)O)C)=C\C=C1\C[C@@H](O)C[C@H](O)C1=C GMRQFYUYWCNGIN-NKMMMXOESA-N 0.000 description 1
- 235000020964 calcitriol Nutrition 0.000 description 1
- 239000011612 calcitriol Substances 0.000 description 1
- 229910000019 calcium carbonate Inorganic materials 0.000 description 1
- 235000010216 calcium carbonate Nutrition 0.000 description 1
- 239000000480 calcium channel blocker Substances 0.000 description 1
- 159000000007 calcium salts Chemical class 0.000 description 1
- CJZGTCYPCWQAJB-UHFFFAOYSA-L calcium stearate Chemical compound [Ca+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CJZGTCYPCWQAJB-UHFFFAOYSA-L 0.000 description 1
- 239000008116 calcium stearate Substances 0.000 description 1
- 235000013539 calcium stearate Nutrition 0.000 description 1
- UFGVUHDWEQMLGF-UHFFFAOYSA-L calcium;2-carboxyphenolate;3,7-dimethyl-2-oxopurin-6-olate Chemical compound [Ca+2].OC1=CC=CC=C1C([O-])=O.CN1C(=O)[N-]C(=O)C2=C1N=CN2C UFGVUHDWEQMLGF-UHFFFAOYSA-L 0.000 description 1
- 229960004349 candesartan cilexetil Drugs 0.000 description 1
- 239000003536 cannabinoid receptor antagonist Substances 0.000 description 1
- 235000017663 capsaicin Nutrition 0.000 description 1
- 229960002504 capsaicin Drugs 0.000 description 1
- 229960000830 captopril Drugs 0.000 description 1
- FAKRSMQSSFJEIM-RQJHMYQMSA-N captopril Chemical compound SC[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O FAKRSMQSSFJEIM-RQJHMYQMSA-N 0.000 description 1
- FFGPTBGBLSHEPO-UHFFFAOYSA-N carbamazepine Chemical compound C1=CC2=CC=CC=C2N(C(=O)N)C2=CC=CC=C21 FFGPTBGBLSHEPO-UHFFFAOYSA-N 0.000 description 1
- 229960000623 carbamazepine Drugs 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 235000013877 carbamide Nutrition 0.000 description 1
- 239000003489 carbonate dehydratase inhibitor Substances 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- UHBYWPGGCSDKFX-UHFFFAOYSA-N carboxyglutamic acid Chemical compound OC(=O)C(N)CC(C(O)=O)C(O)=O UHBYWPGGCSDKFX-UHFFFAOYSA-N 0.000 description 1
- NPAKNKYSJIDKMW-UHFFFAOYSA-N carvedilol Chemical compound COC1=CC=CC=C1OCCNCC(O)COC1=CC=CC2=NC3=CC=C[CH]C3=C12 NPAKNKYSJIDKMW-UHFFFAOYSA-N 0.000 description 1
- 229960004195 carvedilol Drugs 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 239000003093 cationic surfactant Substances 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000012292 cell migration Effects 0.000 description 1
- MVCQKIKWYUURMU-UHFFFAOYSA-N cetilistat Chemical compound C1=C(C)C=C2C(=O)OC(OCCCCCCCCCCCCCCCC)=NC2=C1 MVCQKIKWYUURMU-UHFFFAOYSA-N 0.000 description 1
- 229950002397 cetilistat Drugs 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- WGEWUYACXPEFPO-AULYBMBSSA-N chembl2016681 Chemical compound C1C[C@@H](NS(=O)(=O)C(C)(C)C)CC[C@@H]1C(=O)NC1=CC=C(C(F)(F)F)C=N1 WGEWUYACXPEFPO-AULYBMBSSA-N 0.000 description 1
- DDPFHDCZUJFNAT-PZPWKVFESA-N chembl2104402 Chemical compound N([C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(N)=O)C(C)C)C(=O)[C@@H]1CCCCCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1 DDPFHDCZUJFNAT-PZPWKVFESA-N 0.000 description 1
- SLYFITHISHUGLZ-LWZDQURMSA-N chembl2105635 Chemical compound N([C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](CCC(N)=O)C(=O)N[C@@H]([C@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)C(C)C)C(=O)[C@@H]1CSSC[C@H](NC(=O)[C@@H](N)CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@H](C)O)C(=O)N1 SLYFITHISHUGLZ-LWZDQURMSA-N 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 208000013549 childhood kidney neoplasm Diseases 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 229960001761 chlorpropamide Drugs 0.000 description 1
- 229960001523 chlortalidone Drugs 0.000 description 1
- JIVPVXMEBJLZRO-UHFFFAOYSA-N chlorthalidone Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC(C2(O)C3=CC=CC=C3C(=O)N2)=C1 JIVPVXMEBJLZRO-UHFFFAOYSA-N 0.000 description 1
- 208000006990 cholangiocarcinoma Diseases 0.000 description 1
- 229940107137 cholecystokinin Drugs 0.000 description 1
- 201000001883 cholelithiasis Diseases 0.000 description 1
- 239000003354 cholesterol ester transfer protein inhibitor Substances 0.000 description 1
- 239000000544 cholinesterase inhibitor Substances 0.000 description 1
- 208000019902 chronic diarrheal disease Diseases 0.000 description 1
- 208000022831 chronic renal failure syndrome Diseases 0.000 description 1
- 229960001265 ciclosporin Drugs 0.000 description 1
- YZFWTZACSRHJQD-UHFFFAOYSA-N ciglitazone Chemical compound C=1C=C(CC2C(NC(=O)S2)=O)C=CC=1OCC1(C)CCCCC1 YZFWTZACSRHJQD-UHFFFAOYSA-N 0.000 description 1
- 229950009226 ciglitazone Drugs 0.000 description 1
- 229960003020 cilnidipine Drugs 0.000 description 1
- 230000007882 cirrhosis Effects 0.000 description 1
- 208000019425 cirrhosis of liver Diseases 0.000 description 1
- 235000015165 citric acid Nutrition 0.000 description 1
- 239000004927 clay Substances 0.000 description 1
- 229950003072 clinofibrate Drugs 0.000 description 1
- 229960001214 clofibrate Drugs 0.000 description 1
- KNHUKKLJHYUCFP-UHFFFAOYSA-N clofibrate Chemical compound CCOC(=O)C(C)(C)OC1=CC=C(Cl)C=C1 KNHUKKLJHYUCFP-UHFFFAOYSA-N 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- AGVAZMGAQJOSFJ-WZHZPDAFSA-M cobalt(2+);[(2r,3s,4r,5s)-5-(5,6-dimethylbenzimidazol-1-yl)-4-hydroxy-2-(hydroxymethyl)oxolan-3-yl] [(2r)-1-[3-[(1r,2r,3r,4z,7s,9z,12s,13s,14z,17s,18s,19r)-2,13,18-tris(2-amino-2-oxoethyl)-7,12,17-tris(3-amino-3-oxopropyl)-3,5,8,8,13,15,18,19-octamethyl-2 Chemical compound [Co+2].N#[C-].[N-]([C@@H]1[C@H](CC(N)=O)[C@@]2(C)CCC(=O)NC[C@@H](C)OP(O)(=O)O[C@H]3[C@H]([C@H](O[C@@H]3CO)N3C4=CC(C)=C(C)C=C4N=C3)O)\C2=C(C)/C([C@H](C\2(C)C)CCC(N)=O)=N/C/2=C\C([C@H]([C@@]/2(CC(N)=O)C)CCC(N)=O)=N\C\2=C(C)/C2=N[C@]1(C)[C@@](C)(CC(N)=O)[C@@H]2CCC(N)=O AGVAZMGAQJOSFJ-WZHZPDAFSA-M 0.000 description 1
- 206010009887 colitis Diseases 0.000 description 1
- 239000008119 colloidal silica Substances 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 229940047120 colony stimulating factors Drugs 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- 208000012696 congenital leptin deficiency Diseases 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 208000035250 cutaneous malignant susceptibility to 1 melanoma Diseases 0.000 description 1
- 208000017763 cutaneous neuroendocrine carcinoma Diseases 0.000 description 1
- 125000001995 cyclobutyl group Chemical group [H]C1([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- 125000000582 cycloheptyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 1
- 125000000596 cyclohexenyl group Chemical group C1(=CCCCC1)* 0.000 description 1
- 125000000113 cyclohexyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 1
- 125000000640 cyclooctyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- LOGSONSNCYTHPS-UHFFFAOYSA-N cyclopentane-1,3-dione Chemical class O=C1CCC(=O)C1 LOGSONSNCYTHPS-UHFFFAOYSA-N 0.000 description 1
- 125000002433 cyclopentenyl group Chemical group C1(=CCCC1)* 0.000 description 1
- 229960003206 cyclopenthiazide Drugs 0.000 description 1
- 125000001511 cyclopentyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- 125000001559 cyclopropyl group Chemical group [H]C1([H])C([H])([H])C1([H])* 0.000 description 1
- 229930182912 cyclosporin Natural products 0.000 description 1
- 229940099500 cystamine Drugs 0.000 description 1
- OOTFVKOQINZBBF-UHFFFAOYSA-N cystamine Chemical compound CCSSCCN OOTFVKOQINZBBF-UHFFFAOYSA-N 0.000 description 1
- 201000003146 cystitis Diseases 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- KWGRBVOPPLSCSI-UHFFFAOYSA-N d-ephedrine Natural products CNC(C)C(O)C1=CC=CC=C1 KWGRBVOPPLSCSI-UHFFFAOYSA-N 0.000 description 1
- 229960003850 dabigatran Drugs 0.000 description 1
- YBSJFWOBGCMAKL-UHFFFAOYSA-N dabigatran Chemical compound N=1C2=CC(C(=O)N(CCC(O)=O)C=3N=CC=CC=3)=CC=C2N(C)C=1CNC1=CC=C(C(N)=N)C=C1 YBSJFWOBGCMAKL-UHFFFAOYSA-N 0.000 description 1
- 229950004181 dalcetrapib Drugs 0.000 description 1
- 229940018872 dalteparin sodium Drugs 0.000 description 1
- 229960003834 dapagliflozin Drugs 0.000 description 1
- IJNIQYINMSGIPS-UHFFFAOYSA-N darexaban Chemical compound C1=CC(OC)=CC=C1C(=O)NC1=CC=CC(O)=C1NC(=O)C1=CC=C(N2CCN(C)CCC2)C=C1 IJNIQYINMSGIPS-UHFFFAOYSA-N 0.000 description 1
- 108010007487 davalintide Proteins 0.000 description 1
- UOQACRNTVQWTFF-UHFFFAOYSA-N decane-1,10-dithiol Chemical compound SCCCCCCCCCCS UOQACRNTVQWTFF-UHFFFAOYSA-N 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- WOUOLAUOZXOLJQ-MBSDFSHPSA-N delapril Chemical compound C([C@@H](C(=O)OCC)N[C@@H](C)C(=O)N(CC(O)=O)C1CC2=CC=CC=C2C1)CC1=CC=CC=C1 WOUOLAUOZXOLJQ-MBSDFSHPSA-N 0.000 description 1
- 229960005227 delapril Drugs 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 230000000779 depleting effect Effects 0.000 description 1
- 238000001212 derivatisation Methods 0.000 description 1
- 229960003914 desipramine Drugs 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 229910052805 deuterium Inorganic materials 0.000 description 1
- 229960003957 dexamethasone Drugs 0.000 description 1
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 1
- 229950006137 dexfosfoserine Drugs 0.000 description 1
- 208000033679 diabetic kidney disease Diseases 0.000 description 1
- HPNMFZURTQLUMO-UHFFFAOYSA-N diethylamine Chemical compound CCNCC HPNMFZURTQLUMO-UHFFFAOYSA-N 0.000 description 1
- 125000004212 difluorophenyl group Chemical group 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 230000001079 digestive effect Effects 0.000 description 1
- 208000019836 digestive system infectious disease Diseases 0.000 description 1
- 125000004925 dihydropyridyl group Chemical group N1(CC=CC=C1)* 0.000 description 1
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 1
- HSUGRBWQSSZJOP-RTWAWAEBSA-N diltiazem Chemical compound C1=CC(OC)=CC=C1[C@H]1[C@@H](OC(C)=O)C(=O)N(CCN(C)C)C2=CC=CC=C2S1 HSUGRBWQSSZJOP-RTWAWAEBSA-N 0.000 description 1
- 229960004166 diltiazem Drugs 0.000 description 1
- GXGAKHNRMVGRPK-UHFFFAOYSA-N dimagnesium;dioxido-bis[[oxido(oxo)silyl]oxy]silane Chemical compound [Mg+2].[Mg+2].[O-][Si](=O)O[Si]([O-])([O-])O[Si]([O-])=O GXGAKHNRMVGRPK-UHFFFAOYSA-N 0.000 description 1
- 125000000532 dioxanyl group Chemical group 0.000 description 1
- ZPWVASYFFYYZEW-UHFFFAOYSA-L dipotassium hydrogen phosphate Chemical compound [K+].[K+].OP([O-])([O-])=O ZPWVASYFFYYZEW-UHFFFAOYSA-L 0.000 description 1
- 235000019797 dipotassium phosphate Nutrition 0.000 description 1
- 229910000396 dipotassium phosphate Inorganic materials 0.000 description 1
- 229960002768 dipyridamole Drugs 0.000 description 1
- IZEKFCXSFNUWAM-UHFFFAOYSA-N dipyridamole Chemical compound C=12N=C(N(CCO)CCO)N=C(N3CCCCC3)C2=NC(N(CCO)CCO)=NC=1N1CCCCC1 IZEKFCXSFNUWAM-UHFFFAOYSA-N 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 235000014632 disordered eating Nutrition 0.000 description 1
- 229960001446 distigmine Drugs 0.000 description 1
- GJHSNEVFXQVOHR-UHFFFAOYSA-L distigmine bromide Chemical compound [Br-].[Br-].C=1C=C[N+](C)=CC=1OC(=O)N(C)CCCCCCN(C)C(=O)OC1=CC=C[N+](C)=C1 GJHSNEVFXQVOHR-UHFFFAOYSA-L 0.000 description 1
- 229960003530 donepezil Drugs 0.000 description 1
- 229960003638 dopamine Drugs 0.000 description 1
- 239000003136 dopamine receptor stimulating agent Substances 0.000 description 1
- 210000003717 douglas' pouch Anatomy 0.000 description 1
- 238000011143 downstream manufacturing Methods 0.000 description 1
- RUZYUOTYCVRMRZ-UHFFFAOYSA-N doxazosin Chemical compound C1OC2=CC=CC=C2OC1C(=O)N(CC1)CCN1C1=NC(N)=C(C=C(C(OC)=C2)OC)C2=N1 RUZYUOTYCVRMRZ-UHFFFAOYSA-N 0.000 description 1
- 229960001389 doxazosin Drugs 0.000 description 1
- 229960004242 dronabinol Drugs 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 206010013781 dry mouth Diseases 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 229960005175 dulaglutide Drugs 0.000 description 1
- 108010005794 dulaglutide Proteins 0.000 description 1
- 229960002866 duloxetine Drugs 0.000 description 1
- 201000000312 duodenum cancer Diseases 0.000 description 1
- 229950003693 dutogliptin Drugs 0.000 description 1
- 230000004064 dysfunction Effects 0.000 description 1
- 229960000622 edoxaban Drugs 0.000 description 1
- PSMMNJNZVZZNOI-SJILXJHISA-N edoxaban tosylate hydrate Chemical compound O.CC1=CC=C(S(O)(=O)=O)C=C1.N([C@H]1CC[C@@H](C[C@H]1NC(=O)C=1SC=2CN(C)CCC=2N=1)C(=O)N(C)C)C(=O)C(=O)NC1=CC=C(Cl)C=N1 PSMMNJNZVZZNOI-SJILXJHISA-N 0.000 description 1
- 230000002500 effect on skin Effects 0.000 description 1
- 229950003102 efonidipine Drugs 0.000 description 1
- 235000020673 eicosapentaenoic acid Nutrition 0.000 description 1
- 229960005135 eicosapentaenoic acid Drugs 0.000 description 1
- JAZBEHYOTPTENJ-UHFFFAOYSA-N eicosapentaenoic acid Natural products CCC=CCC=CCC=CCC=CCC=CCCCC(O)=O JAZBEHYOTPTENJ-UHFFFAOYSA-N 0.000 description 1
- 108700032313 elcatonin Proteins 0.000 description 1
- 229960000756 elcatonin Drugs 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 229950000269 emiglitate Drugs 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- GBXSMTUPTTWBMN-XIRDDKMYSA-N enalapril Chemical compound C([C@@H](C(=O)OCC)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(O)=O)CC1=CC=CC=C1 GBXSMTUPTTWBMN-XIRDDKMYSA-N 0.000 description 1
- 229960000873 enalapril Drugs 0.000 description 1
- 208000028208 end stage renal disease Diseases 0.000 description 1
- 201000000523 end stage renal failure Diseases 0.000 description 1
- 230000002124 endocrine Effects 0.000 description 1
- 208000030172 endocrine system disease Diseases 0.000 description 1
- 238000001839 endoscopy Methods 0.000 description 1
- 239000002308 endothelin receptor antagonist Substances 0.000 description 1
- 229950002375 englitazone Drugs 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 229960005153 enoxaparin sodium Drugs 0.000 description 1
- 210000003158 enteroendocrine cell Anatomy 0.000 description 1
- 229960002179 ephedrine Drugs 0.000 description 1
- 229960001208 eplerenone Drugs 0.000 description 1
- JUKPWJGBANNWMW-VWBFHTRKSA-N eplerenone Chemical compound C([C@@H]1[C@]2(C)C[C@H]3O[C@]33[C@@]4(C)CCC(=O)C=C4C[C@H]([C@@H]13)C(=O)OC)C[C@@]21CCC(=O)O1 JUKPWJGBANNWMW-VWBFHTRKSA-N 0.000 description 1
- 229960004563 eprosartan Drugs 0.000 description 1
- OROAFUQRIXKEMV-LDADJPATSA-N eprosartan Chemical compound C=1C=C(C(O)=O)C=CC=1CN1C(CCCC)=NC=C1\C=C(C(O)=O)/CC1=CC=CS1 OROAFUQRIXKEMV-LDADJPATSA-N 0.000 description 1
- 229940105423 erythropoietin Drugs 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- PROQIPRRNZUXQM-ZXXIGWHRSA-N estriol Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H]([C@H](O)C4)O)[C@@H]4[C@@H]3CCC2=C1 PROQIPRRNZUXQM-ZXXIGWHRSA-N 0.000 description 1
- 229960001348 estriol Drugs 0.000 description 1
- AVOLMBLBETYQHX-UHFFFAOYSA-N etacrynic acid Chemical compound CCC(=C)C(=O)C1=CC=C(OCC(O)=O)C(Cl)=C1Cl AVOLMBLBETYQHX-UHFFFAOYSA-N 0.000 description 1
- 229960003199 etacrynic acid Drugs 0.000 description 1
- 229950007164 ethiazide Drugs 0.000 description 1
- AEOCXXJPGCBFJA-UHFFFAOYSA-N ethionamide Chemical compound CCC1=CC(C(N)=S)=CC=N1 AEOCXXJPGCBFJA-UHFFFAOYSA-N 0.000 description 1
- NWWORXYTJRPSMC-QKPAOTATSA-N ethyl 4-[2-[(2r,3r,4r,5s)-3,4,5-trihydroxy-2-(hydroxymethyl)piperidin-1-yl]ethoxy]benzoate Chemical compound C1=CC(C(=O)OCC)=CC=C1OCCN1[C@H](CO)[C@@H](O)[C@H](O)[C@@H](O)C1 NWWORXYTJRPSMC-QKPAOTATSA-N 0.000 description 1
- AKFNKZFJBFQFAA-DIOPXHOYSA-N ethyl 4-[[2-[(2s,4s)-2-cyano-4-fluoropyrrolidin-1-yl]-2-oxoethyl]amino]bicyclo[2.2.2]octane-1-carboxylate Chemical compound C1CC(C(=O)OCC)(CC2)CCC12NCC(=O)N1C[C@@H](F)C[C@H]1C#N AKFNKZFJBFQFAA-DIOPXHOYSA-N 0.000 description 1
- 239000002024 ethyl acetate extract Substances 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 208000012997 experimental autoimmune encephalomyelitis Diseases 0.000 description 1
- 201000008819 extrahepatic bile duct carcinoma Diseases 0.000 description 1
- 210000003414 extremity Anatomy 0.000 description 1
- 210000001508 eye Anatomy 0.000 description 1
- 208000020603 familial colorectal cancer Diseases 0.000 description 1
- 201000005577 familial hyperlipidemia Diseases 0.000 description 1
- 229950007405 fasiglifam Drugs 0.000 description 1
- 150000002191 fatty alcohols Chemical class 0.000 description 1
- 230000004634 feeding behavior Effects 0.000 description 1
- 229960002297 fenofibrate Drugs 0.000 description 1
- YMTINGFKWWXKFG-UHFFFAOYSA-N fenofibrate Chemical compound C1=CC(OC(C)(C)C(=O)OC(C)C)=CC=C1C(=O)C1=CC=C(Cl)C=C1 YMTINGFKWWXKFG-UHFFFAOYSA-N 0.000 description 1
- 229940125753 fibrate Drugs 0.000 description 1
- 201000001169 fibrillary astrocytoma Diseases 0.000 description 1
- 229940012952 fibrinogen Drugs 0.000 description 1
- 230000020764 fibrinolysis Effects 0.000 description 1
- 239000003527 fibrinolytic agent Substances 0.000 description 1
- WAAPEIZFCHNLKK-PELKAZGASA-N fidarestat Chemical compound C([C@@H](OC1=CC=C(F)C=C11)C(=O)N)[C@@]21NC(=O)NC2=O WAAPEIZFCHNLKK-PELKAZGASA-N 0.000 description 1
- 229950007256 fidarestat Drugs 0.000 description 1
- 239000012065 filter cake Substances 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 229960003765 fluvastatin Drugs 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 235000019253 formic acid Nutrition 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 239000001530 fumaric acid Substances 0.000 description 1
- ZZUFCTLCJUWOSV-UHFFFAOYSA-N furosemide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC(C(O)=O)=C1NCC1=CC=CO1 ZZUFCTLCJUWOSV-UHFFFAOYSA-N 0.000 description 1
- 229960003883 furosemide Drugs 0.000 description 1
- 229960002870 gabapentin Drugs 0.000 description 1
- 229960003980 galantamine Drugs 0.000 description 1
- ASUTZQLVASHGKV-UHFFFAOYSA-N galanthamine hydrochloride Natural products O1C(=C23)C(OC)=CC=C2CN(C)CCC23C1CC(O)C=C2 ASUTZQLVASHGKV-UHFFFAOYSA-N 0.000 description 1
- 208000020694 gallbladder disease Diseases 0.000 description 1
- 208000001130 gallstones Diseases 0.000 description 1
- GDSRMADSINPKSL-HSEONFRVSA-N gamma-cyclodextrin Chemical compound OC[C@H]([C@H]([C@@H]([C@H]1O)O)O[C@H]2O[C@@H]([C@@H](O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O3)[C@H](O)[C@H]2O)CO)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@@H]3O[C@@H]1CO GDSRMADSINPKSL-HSEONFRVSA-N 0.000 description 1
- 229940080345 gamma-cyclodextrin Drugs 0.000 description 1
- 206010017758 gastric cancer Diseases 0.000 description 1
- 230000030136 gastric emptying Effects 0.000 description 1
- 201000000052 gastrinoma Diseases 0.000 description 1
- 208000021302 gastroesophageal reflux disease Diseases 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- 239000007897 gelcap Substances 0.000 description 1
- 229960003627 gemfibrozil Drugs 0.000 description 1
- 229960002458 gemigliptin Drugs 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 208000004104 gestational diabetes Diseases 0.000 description 1
- 229940042385 glatiramer Drugs 0.000 description 1
- WIGIZIANZCJQQY-RUCARUNLSA-N glimepiride Chemical compound O=C1C(CC)=C(C)CN1C(=O)NCCC1=CC=C(S(=O)(=O)NC(=O)N[C@@H]2CC[C@@H](C)CC2)C=C1 WIGIZIANZCJQQY-RUCARUNLSA-N 0.000 description 1
- 229960004346 glimepiride Drugs 0.000 description 1
- 206010061989 glomerulosclerosis Diseases 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 235000001727 glucose Nutrition 0.000 description 1
- 230000014101 glucose homeostasis Effects 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- 229950005232 glybuzole Drugs 0.000 description 1
- 230000036252 glycation Effects 0.000 description 1
- YQEMORVAKMFKLG-UHFFFAOYSA-N glycerine monostearate Natural products CCCCCCCCCCCCCCCCCC(=O)OC(CO)CO YQEMORVAKMFKLG-UHFFFAOYSA-N 0.000 description 1
- SVUQHVRAGMNPLW-UHFFFAOYSA-N glycerol monostearate Natural products CCCCCCCCCCCCCCCCC(=O)OCC(O)CO SVUQHVRAGMNPLW-UHFFFAOYSA-N 0.000 description 1
- 229960002449 glycine Drugs 0.000 description 1
- 208000007345 glycogen storage disease Diseases 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- LPLVUJXQOOQHMX-UHFFFAOYSA-N glycyrrhetinic acid glycoside Natural products C1CC(C2C(C3(CCC4(C)CCC(C)(CC4C3=CC2=O)C(O)=O)C)(C)CC2)(C)C2C(C)(C)C1OC1OC(C(O)=O)C(O)C(O)C1OC1OC(C(O)=O)C(O)C(O)C1O LPLVUJXQOOQHMX-UHFFFAOYSA-N 0.000 description 1
- 229960004949 glycyrrhizic acid Drugs 0.000 description 1
- UYRUBYNTXSDKQT-UHFFFAOYSA-N glycyrrhizic acid Natural products CC1(C)C(CCC2(C)C1CCC3(C)C2C(=O)C=C4C5CC(C)(CCC5(C)CCC34C)C(=O)O)OC6OC(C(O)C(O)C6OC7OC(O)C(O)C(O)C7C(=O)O)C(=O)O UYRUBYNTXSDKQT-UHFFFAOYSA-N 0.000 description 1
- 235000019410 glycyrrhizin Nutrition 0.000 description 1
- LPLVUJXQOOQHMX-QWBHMCJMSA-N glycyrrhizinic acid Chemical compound O([C@@H]1[C@@H](O)[C@H](O)[C@H](O[C@@H]1O[C@@H]1C([C@H]2[C@]([C@@H]3[C@@]([C@@]4(CC[C@@]5(C)CC[C@@](C)(C[C@H]5C4=CC3=O)C(O)=O)C)(C)CC2)(C)CC1)(C)C)C(O)=O)[C@@H]1O[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@H]1O LPLVUJXQOOQHMX-QWBHMCJMSA-N 0.000 description 1
- QWEWGXUTRTXFRF-KBPBESRZSA-N gosogliptin Chemical compound C1C(F)(F)CCN1C(=O)[C@H]1NC[C@@H](N2CCN(CC2)C=2N=CC=CN=2)C1 QWEWGXUTRTXFRF-KBPBESRZSA-N 0.000 description 1
- 208000024908 graft versus host disease Diseases 0.000 description 1
- 229940107702 grapefruit seed extract Drugs 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 239000000122 growth hormone Substances 0.000 description 1
- 125000001188 haloalkyl group Chemical group 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 210000002216 heart Anatomy 0.000 description 1
- 201000011066 hemangioma Diseases 0.000 description 1
- 208000014951 hematologic disease Diseases 0.000 description 1
- 208000018706 hematopoietic system disease Diseases 0.000 description 1
- 230000023597 hemostasis Effects 0.000 description 1
- ZFGMDIBRIDKWMY-PASTXAENSA-N heparin Chemical compound CC(O)=N[C@@H]1[C@@H](O)[C@H](O)[C@@H](COS(O)(=O)=O)O[C@@H]1O[C@@H]1[C@@H](C(O)=O)O[C@@H](O[C@H]2[C@@H]([C@@H](OS(O)(=O)=O)[C@@H](O[C@@H]3[C@@H](OC(O)[C@H](OS(O)(=O)=O)[C@H]3O)C(O)=O)O[C@@H]2O)CS(O)(=O)=O)[C@H](O)[C@H]1O ZFGMDIBRIDKWMY-PASTXAENSA-N 0.000 description 1
- 229940095529 heparin calcium Drugs 0.000 description 1
- 229960001008 heparin sodium Drugs 0.000 description 1
- 230000002440 hepatic effect Effects 0.000 description 1
- 102000056713 human FGF21 Human genes 0.000 description 1
- 102000050325 human granulocyte inhibitory Human genes 0.000 description 1
- 229960002003 hydrochlorothiazide Drugs 0.000 description 1
- DMDGGSIALPNSEE-UHFFFAOYSA-N hydroflumethiazide Chemical compound C1=C(C(F)(F)F)C(S(=O)(=O)N)=CC2=C1NCNS2(=O)=O DMDGGSIALPNSEE-UHFFFAOYSA-N 0.000 description 1
- 229960003313 hydroflumethiazide Drugs 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 1
- XMBWDFGMSWQBCA-UHFFFAOYSA-N hydrogen iodide Chemical compound I XMBWDFGMSWQBCA-UHFFFAOYSA-N 0.000 description 1
- 239000008172 hydrogenated vegetable oil Substances 0.000 description 1
- 229940071870 hydroiodic acid Drugs 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- FDUCMRMJOHDBQW-UHFFFAOYSA-N hydroxy-oxo-sulfinosulfonyloxymethane Chemical compound C(=O)(O)OS(=O)(=O)S(=O)O FDUCMRMJOHDBQW-UHFFFAOYSA-N 0.000 description 1
- 230000002727 hyperosmolar Effects 0.000 description 1
- 230000001631 hypertensive effect Effects 0.000 description 1
- 201000006866 hypopharynx cancer Diseases 0.000 description 1
- 230000002267 hypothalamic effect Effects 0.000 description 1
- 208000003532 hypothyroidism Diseases 0.000 description 1
- 230000002989 hypothyroidism Effects 0.000 description 1
- 229960004716 idoxuridine Drugs 0.000 description 1
- 125000002883 imidazolyl group Chemical group 0.000 description 1
- 229960004801 imipramine Drugs 0.000 description 1
- BCGWQEUPMDMJNV-UHFFFAOYSA-N imipramine Chemical compound C1CC2=CC=CC=C2N(CCCN(C)C)C2=CC=CC=C21 BCGWQEUPMDMJNV-UHFFFAOYSA-N 0.000 description 1
- 230000002766 immunoenhancing effect Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 229940121354 immunomodulator Drugs 0.000 description 1
- 230000001024 immunotherapeutic effect Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- LWRDQHOZTAOILO-UHFFFAOYSA-N incadronic acid Chemical compound OP(O)(=O)C(P(O)(O)=O)NC1CCCCCC1 LWRDQHOZTAOILO-UHFFFAOYSA-N 0.000 description 1
- 229950006971 incadronic acid Drugs 0.000 description 1
- NDDAHWYSQHTHNT-UHFFFAOYSA-N indapamide Chemical compound CC1CC2=CC=CC=C2N1NC(=O)C1=CC=C(Cl)C(S(N)(=O)=O)=C1 NDDAHWYSQHTHNT-UHFFFAOYSA-N 0.000 description 1
- 229960004569 indapamide Drugs 0.000 description 1
- 125000001041 indolyl group Chemical group 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 208000000509 infertility Diseases 0.000 description 1
- 230000036512 infertility Effects 0.000 description 1
- 208000021267 infertility disease Diseases 0.000 description 1
- 201000004653 inflammatory breast carcinoma Diseases 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 150000007529 inorganic bases Chemical class 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 206010022498 insulinoma Diseases 0.000 description 1
- 230000002473 insulinotropic effect Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 201000002313 intestinal cancer Diseases 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000007919 intrasynovial administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 206010073095 invasive ductal breast carcinoma Diseases 0.000 description 1
- 125000002346 iodo group Chemical group I* 0.000 description 1
- INQOMBQAUSQDDS-UHFFFAOYSA-N iodomethane Chemical compound IC INQOMBQAUSQDDS-UHFFFAOYSA-N 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- AHFWIQIYAXSLBA-RQXATKFSSA-N ipragliflozin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1C1=CC=C(F)C(CC=2SC3=CC=CC=C3C=2)=C1 AHFWIQIYAXSLBA-RQXATKFSSA-N 0.000 description 1
- 229950000991 ipragliflozin Drugs 0.000 description 1
- 229960005431 ipriflavone Drugs 0.000 description 1
- 229960002198 irbesartan Drugs 0.000 description 1
- YCPOHTHPUREGFM-UHFFFAOYSA-N irbesartan Chemical compound O=C1N(CC=2C=CC(=CC=2)C=2C(=CC=CC=2)C=2[N]N=NN=2)C(CCCC)=NC21CCCC2 YCPOHTHPUREGFM-UHFFFAOYSA-N 0.000 description 1
- 230000000302 ischemic effect Effects 0.000 description 1
- 229960004592 isopropanol Drugs 0.000 description 1
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 229960002479 isosorbide Drugs 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 230000000155 isotopic effect Effects 0.000 description 1
- CTAPFRYPJLPFDF-UHFFFAOYSA-N isoxazole Chemical compound C=1C=NOC=1 CTAPFRYPJLPFDF-UHFFFAOYSA-N 0.000 description 1
- NLYAJNPCOHFWQQ-UHFFFAOYSA-N kaolin Chemical compound O.O.O=[Al]O[Si](=O)O[Si](=O)O[Al]=O NLYAJNPCOHFWQQ-UHFFFAOYSA-N 0.000 description 1
- 229940062717 keppra Drugs 0.000 description 1
- 229960004125 ketoconazole Drugs 0.000 description 1
- 201000010982 kidney cancer Diseases 0.000 description 1
- 229940043355 kinase inhibitor Drugs 0.000 description 1
- HXEACLLIILLPRG-RXMQYKEDSA-N l-pipecolic acid Natural products OC(=O)[C@H]1CCCCN1 HXEACLLIILLPRG-RXMQYKEDSA-N 0.000 description 1
- 229960001632 labetalol Drugs 0.000 description 1
- 229960001848 lamotrigine Drugs 0.000 description 1
- PYZRQGJRPPTADH-UHFFFAOYSA-N lamotrigine Chemical compound NC1=NC(N)=NN=C1C1=CC=CC(Cl)=C1Cl PYZRQGJRPPTADH-UHFFFAOYSA-N 0.000 description 1
- 239000010410 layer Substances 0.000 description 1
- 230000013016 learning Effects 0.000 description 1
- 229940115286 lentinan Drugs 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- HPHUVLMMVZITSG-LURJTMIESA-N levetiracetam Chemical compound CC[C@@H](C(N)=O)N1CCCC1=O HPHUVLMMVZITSG-LURJTMIESA-N 0.000 description 1
- 229950011452 lidorestat Drugs 0.000 description 1
- 229960002397 linagliptin Drugs 0.000 description 1
- 230000037356 lipid metabolism Effects 0.000 description 1
- 230000029226 lipidation Effects 0.000 description 1
- 208000006132 lipodystrophy Diseases 0.000 description 1
- 239000008297 liquid dosage form Substances 0.000 description 1
- 229940057995 liquid paraffin Drugs 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- RLAWWYSOJDYHDC-BZSNNMDCSA-N lisinopril Chemical compound C([C@H](N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(O)=O)C(O)=O)CC1=CC=CC=C1 RLAWWYSOJDYHDC-BZSNNMDCSA-N 0.000 description 1
- 229960002394 lisinopril Drugs 0.000 description 1
- 208000018191 liver inflammation Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 229960001093 lixisenatide Drugs 0.000 description 1
- 108010004367 lixisenatide Proteins 0.000 description 1
- CHHXEZSCHQVSRE-UHFFFAOYSA-N lobeglitazone Chemical compound C1=CC(OC)=CC=C1OC1=CC(N(C)CCOC=2C=CC(CC3C(NC(=O)S3)=O)=CC=2)=NC=N1 CHHXEZSCHQVSRE-UHFFFAOYSA-N 0.000 description 1
- 229950007685 lobeglitazone Drugs 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 229960005060 lorcaserin Drugs 0.000 description 1
- XTTZERNUQAFMOF-QMMMGPOBSA-N lorcaserin Chemical compound C[C@H]1CNCCC2=CC=C(Cl)C=C12 XTTZERNUQAFMOF-QMMMGPOBSA-N 0.000 description 1
- 229960004773 losartan Drugs 0.000 description 1
- KJJZZJSZUJXYEA-UHFFFAOYSA-N losartan Chemical compound CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C=2[N]N=NN=2)C=C1 KJJZZJSZUJXYEA-UHFFFAOYSA-N 0.000 description 1
- 229960000519 losartan potassium Drugs 0.000 description 1
- 229960004844 lovastatin Drugs 0.000 description 1
- PCZOHLXUXFIOCF-BXMDZJJMSA-N lovastatin Chemical compound C([C@H]1[C@@H](C)C=CC2=C[C@H](C)C[C@@H]([C@H]12)OC(=O)[C@@H](C)CC)C[C@@H]1C[C@@H](O)CC(=O)O1 PCZOHLXUXFIOCF-BXMDZJJMSA-N 0.000 description 1
- QLJODMDSTUBWDW-UHFFFAOYSA-N lovastatin hydroxy acid Natural products C1=CC(C)C(CCC(O)CC(O)CC(O)=O)C2C(OC(=O)C(C)CC)CC(C)C=C21 QLJODMDSTUBWDW-UHFFFAOYSA-N 0.000 description 1
- 229940083747 low-ceiling diuretics xanthine derivative Drugs 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 229960003511 macrogol Drugs 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 159000000003 magnesium salts Chemical class 0.000 description 1
- 239000000391 magnesium silicate Substances 0.000 description 1
- 229910000386 magnesium trisilicate Inorganic materials 0.000 description 1
- 235000019793 magnesium trisilicate Nutrition 0.000 description 1
- 229940099273 magnesium trisilicate Drugs 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 1
- 239000011976 maleic acid Substances 0.000 description 1
- 239000001630 malic acid Substances 0.000 description 1
- 235000011090 malic acid Nutrition 0.000 description 1
- 208000006178 malignant mesothelioma Diseases 0.000 description 1
- 208000026045 malignant tumor of parathyroid gland Diseases 0.000 description 1
- ANEBWFXPVPTEET-UHFFFAOYSA-N manidipine Chemical compound COC(=O)C1=C(C)NC(C)=C(C(=O)OCCN2CCN(CC2)C(C=2C=CC=CC=2)C=2C=CC=CC=2)C1C1=CC=CC([N+]([O-])=O)=C1 ANEBWFXPVPTEET-UHFFFAOYSA-N 0.000 description 1
- 229960003963 manidipine Drugs 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 201000000083 maturity-onset diabetes of the young type 1 Diseases 0.000 description 1
- 229960000299 mazindol Drugs 0.000 description 1
- 208000023356 medullary thyroid gland carcinoma Diseases 0.000 description 1
- 229960004678 mefruside Drugs 0.000 description 1
- 229960004296 megestrol acetate Drugs 0.000 description 1
- RQZAXGRLVPAYTJ-GQFGMJRRSA-N megestrol acetate Chemical compound C1=C(C)C2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(C)=O)(OC(=O)C)[C@@]1(C)CC2 RQZAXGRLVPAYTJ-GQFGMJRRSA-N 0.000 description 1
- 229960004640 memantine Drugs 0.000 description 1
- BUGYDGFZZOZRHP-UHFFFAOYSA-N memantine Chemical compound C1C(C2)CC3(C)CC1(C)CC2(N)C3 BUGYDGFZZOZRHP-UHFFFAOYSA-N 0.000 description 1
- 230000002175 menstrual effect Effects 0.000 description 1
- 229940041616 menthol Drugs 0.000 description 1
- 208000030159 metabolic disease Diseases 0.000 description 1
- 208000011661 metabolic syndrome X Diseases 0.000 description 1
- 229960003739 methyclothiazide Drugs 0.000 description 1
- IVAQJHSXBVHUQT-ZVHZXABRSA-N methyl (e)-3-(3,5-dimethoxyphenyl)-2-[4-[4-[(2,4-dioxo-1,3-thiazolidin-5-yl)methyl]phenoxy]phenyl]prop-2-enoate Chemical compound C=1C=C(OC=2C=CC(CC3C(NC(=O)S3)=O)=CC=2)C=CC=1/C(C(=O)OC)=C\C1=CC(OC)=CC(OC)=C1 IVAQJHSXBVHUQT-ZVHZXABRSA-N 0.000 description 1
- ACEONLNNWKIPTM-UHFFFAOYSA-N methyl 2-bromopropanoate Chemical compound COC(=O)C(C)Br ACEONLNNWKIPTM-UHFFFAOYSA-N 0.000 description 1
- 229960004503 metoclopramide Drugs 0.000 description 1
- TTWJBBZEZQICBI-UHFFFAOYSA-N metoclopramide Chemical compound CCN(CC)CCNC(=O)C1=CC(Cl)=C(N)C=C1OC TTWJBBZEZQICBI-UHFFFAOYSA-N 0.000 description 1
- 229960002237 metoprolol Drugs 0.000 description 1
- IUBSYMUCCVWXPE-UHFFFAOYSA-N metoprolol Chemical compound COCCC1=CC=C(OCC(O)CNC(C)C)C=C1 IUBSYMUCCVWXPE-UHFFFAOYSA-N 0.000 description 1
- 108700008455 metreleptin Proteins 0.000 description 1
- 229960000668 metreleptin Drugs 0.000 description 1
- HPNSFSBZBAHARI-UHFFFAOYSA-N micophenolic acid Natural products OC1=C(CC=C(C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-UHFFFAOYSA-N 0.000 description 1
- 206010062198 microangiopathy Diseases 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- DDLIGBOFAVUZHB-UHFFFAOYSA-N midazolam Chemical compound C12=CC(Cl)=CC=C2N2C(C)=NC=C2CN=C1C1=CC=CC=C1F DDLIGBOFAVUZHB-UHFFFAOYSA-N 0.000 description 1
- 229960003793 midazolam Drugs 0.000 description 1
- 229960001110 miglitol Drugs 0.000 description 1
- 235000010755 mineral Nutrition 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- WXUAQHNMJWJLTG-UHFFFAOYSA-N monomethylpersuccinic acid Natural products OC(=O)C(C)CC(O)=O WXUAQHNMJWJLTG-UHFFFAOYSA-N 0.000 description 1
- 229950005805 monteplase Drugs 0.000 description 1
- 108010075698 monteplase Proteins 0.000 description 1
- 208000001022 morbid obesity Diseases 0.000 description 1
- 229960005181 morphine Drugs 0.000 description 1
- 125000002757 morpholinyl group Chemical group 0.000 description 1
- 230000007659 motor function Effects 0.000 description 1
- 201000010879 mucinous adenocarcinoma Diseases 0.000 description 1
- 201000006417 multiple sclerosis Diseases 0.000 description 1
- BSOQXXWZTUDTEL-ZUYCGGNHSA-N muramyl dipeptide Chemical class OC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@H]1[C@H](O)[C@@H](CO)O[C@@H](O)[C@@H]1NC(C)=O BSOQXXWZTUDTEL-ZUYCGGNHSA-N 0.000 description 1
- 201000006938 muscular dystrophy Diseases 0.000 description 1
- 229940014456 mycophenolate Drugs 0.000 description 1
- HPNSFSBZBAHARI-RUDMXATFSA-N mycophenolic acid Chemical compound OC1=C(C\C=C(/C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-RUDMXATFSA-N 0.000 description 1
- RLRHPCKWSXWKBG-UHFFFAOYSA-N n-(2-azaniumylethyl)carbamate Chemical compound NCCNC(O)=O RLRHPCKWSXWKBG-UHFFFAOYSA-N 0.000 description 1
- HWMFFWCDLWDYGX-UHFFFAOYSA-N n-(4-aminophenyl)furan-2-carboxamide Chemical compound C1=CC(N)=CC=C1NC(=O)C1=CC=CO1 HWMFFWCDLWDYGX-UHFFFAOYSA-N 0.000 description 1
- WIEDUMBCZQRGSY-UHFFFAOYSA-N n-[[2,6-difluoro-4-[3-(1h-1,2,4-triazol-5-yl)phenyl]phenyl]methyl]-2,3-dihydro-1h-inden-2-amine Chemical compound C=1C(F)=C(CNC2CC3=CC=CC=C3C2)C(F)=CC=1C(C=1)=CC=CC=1C1=NC=NN1 WIEDUMBCZQRGSY-UHFFFAOYSA-N 0.000 description 1
- GOQYKNQRPGWPLP-UHFFFAOYSA-N n-heptadecyl alcohol Natural products CCCCCCCCCCCCCCCCCO GOQYKNQRPGWPLP-UHFFFAOYSA-N 0.000 description 1
- 125000001280 n-hexyl group Chemical group C(CCCCC)* 0.000 description 1
- BDQCDIWFPIDPQU-NDEPHWFRSA-N n-methyl-5-[4-[1-[(1r)-3-oxospiro[2-benzofuran-1,3'-pyrrolidine]-1'-carbonyl]cyclopropyl]phenyl]pyridine-2-carboxamide Chemical compound C1=NC(C(=O)NC)=CC=C1C1=CC=C(C2(CC2)C(=O)N2C[C@@]3(CC2)C2=CC=CC=C2C(=O)O3)C=C1 BDQCDIWFPIDPQU-NDEPHWFRSA-N 0.000 description 1
- GNZCSGYHILBXLL-UHFFFAOYSA-N n-tert-butyl-6,7-dichloro-3-methylsulfonylquinoxalin-2-amine Chemical compound ClC1=C(Cl)C=C2N=C(S(C)(=O)=O)C(NC(C)(C)C)=NC2=C1 GNZCSGYHILBXLL-UHFFFAOYSA-N 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 125000001624 naphthyl group Chemical group 0.000 description 1
- 239000004081 narcotic agent Substances 0.000 description 1
- 230000003533 narcotic effect Effects 0.000 description 1
- 229960000698 nateglinide Drugs 0.000 description 1
- OELFLUMRDSZNSF-BRWVUGGUSA-N nateglinide Chemical compound C1C[C@@H](C(C)C)CC[C@@H]1C(=O)N[C@@H](C(O)=O)CC1=CC=CC=C1 OELFLUMRDSZNSF-BRWVUGGUSA-N 0.000 description 1
- 229950002774 nateplase Drugs 0.000 description 1
- 230000023187 negative regulation of glucagon secretion Effects 0.000 description 1
- 208000025189 neoplasm of testis Diseases 0.000 description 1
- 201000009925 nephrosclerosis Diseases 0.000 description 1
- 208000004296 neuralgia Diseases 0.000 description 1
- 208000007538 neurilemmoma Diseases 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 230000007996 neuronal plasticity Effects 0.000 description 1
- 230000000508 neurotrophic effect Effects 0.000 description 1
- 239000003900 neurotrophic factor Substances 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229940033757 niaspan Drugs 0.000 description 1
- 229960001783 nicardipine Drugs 0.000 description 1
- 229960000827 niceritrol Drugs 0.000 description 1
- 229950001071 nicomol Drugs 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 230000002474 noradrenergic effect Effects 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 239000003883 ointment base Substances 0.000 description 1
- VTRAEEWXHOVJFV-UHFFFAOYSA-N olmesartan Chemical compound CCCC1=NC(C(C)(C)O)=C(C(O)=O)N1CC1=CC=C(C=2C(=CC=CC=2)C=2NN=NN=2)C=C1 VTRAEEWXHOVJFV-UHFFFAOYSA-N 0.000 description 1
- 229960005117 olmesartan Drugs 0.000 description 1
- 229960001199 olmesartan medoxomil Drugs 0.000 description 1
- 239000006014 omega-3 oil Substances 0.000 description 1
- 208000020911 optic nerve disease Diseases 0.000 description 1
- 229940125395 oral insulin Drugs 0.000 description 1
- 201000006958 oropharynx cancer Diseases 0.000 description 1
- 201000008968 osteosarcoma Diseases 0.000 description 1
- 208000021284 ovarian germ cell tumor Diseases 0.000 description 1
- 230000027758 ovulation cycle Effects 0.000 description 1
- 235000006408 oxalic acid Nutrition 0.000 description 1
- COWNFYYYZFRNOY-UHFFFAOYSA-N oxazolidinedione Chemical compound O=C1COC(=O)N1 COWNFYYYZFRNOY-UHFFFAOYSA-N 0.000 description 1
- CTRLABGOLIVAIY-UHFFFAOYSA-N oxcarbazepine Chemical compound C1C(=O)C2=CC=CC=C2N(C(=O)N)C2=CC=CC=C21 CTRLABGOLIVAIY-UHFFFAOYSA-N 0.000 description 1
- 125000004043 oxo group Chemical group O=* 0.000 description 1
- 229960005434 oxybutynin Drugs 0.000 description 1
- 125000005430 oxychloro group Chemical group 0.000 description 1
- 125000000913 palmityl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 229960003978 pamidronic acid Drugs 0.000 description 1
- 229950003603 pamiteplase Drugs 0.000 description 1
- 108010085108 pamiteplase Proteins 0.000 description 1
- 208000021255 pancreatic insulinoma Diseases 0.000 description 1
- 229940116369 pancreatic lipase Drugs 0.000 description 1
- FJKROLUGYXJWQN-UHFFFAOYSA-N papa-hydroxy-benzoic acid Natural products OC(=O)C1=CC=C(O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-N 0.000 description 1
- 208000004019 papillary adenocarcinoma Diseases 0.000 description 1
- 229960005489 paracetamol Drugs 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 208000035824 paresthesia Diseases 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 230000006320 pegylation Effects 0.000 description 1
- 229960001639 penicillamine Drugs 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 230000002085 persistent effect Effects 0.000 description 1
- 239000003209 petroleum derivative Substances 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- 229950000688 phenothiazine Drugs 0.000 description 1
- 229960005323 phenoxyethanol Drugs 0.000 description 1
- 125000000914 phenoxymethylpenicillanyl group Chemical group CC1(S[C@H]2N([C@H]1C(=O)*)C([C@H]2NC(COC2=CC=CC=C2)=O)=O)C 0.000 description 1
- PARWUHTVGZSQPD-UHFFFAOYSA-N phenylsilane Chemical compound [SiH3]C1=CC=CC=C1 PARWUHTVGZSQPD-UHFFFAOYSA-N 0.000 description 1
- 235000021317 phosphate Nutrition 0.000 description 1
- 239000002590 phosphodiesterase V inhibitor Substances 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 150000003016 phosphoric acids Chemical class 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- BZQFBWGGLXLEPQ-REOHCLBHSA-N phosphoserine Chemical compound OC(=O)[C@@H](N)COP(O)(O)=O BZQFBWGGLXLEPQ-REOHCLBHSA-N 0.000 description 1
- USRGIUJOYOXOQJ-GBXIJSLDSA-N phosphothreonine Chemical compound OP(=O)(O)O[C@H](C)[C@H](N)C(O)=O USRGIUJOYOXOQJ-GBXIJSLDSA-N 0.000 description 1
- 239000003757 phosphotransferase inhibitor Substances 0.000 description 1
- DCWXELXMIBXGTH-UHFFFAOYSA-N phosphotyrosine Chemical compound OC(=O)C(N)CC1=CC=C(OP(O)(O)=O)C=C1 DCWXELXMIBXGTH-UHFFFAOYSA-N 0.000 description 1
- PHUTUTUABXHXLW-UHFFFAOYSA-N pindolol Chemical compound CC(C)NCC(O)COC1=CC=CC2=NC=C[C]12 PHUTUTUABXHXLW-UHFFFAOYSA-N 0.000 description 1
- 229960002508 pindolol Drugs 0.000 description 1
- 201000007315 pineal gland astrocytoma Diseases 0.000 description 1
- 125000004193 piperazinyl group Chemical group 0.000 description 1
- 229950010267 piragliatin Drugs 0.000 description 1
- 229960001085 piretanide Drugs 0.000 description 1
- 229960002797 pitavastatin Drugs 0.000 description 1
- VGYFMXBACGZSIL-MCBHFWOFSA-N pitavastatin Chemical compound OC(=O)C[C@H](O)C[C@H](O)\C=C\C1=C(C2CC2)N=C2C=CC=CC2=C1C1=CC=C(F)C=C1 VGYFMXBACGZSIL-MCBHFWOFSA-N 0.000 description 1
- 235000002378 plant sterols Nutrition 0.000 description 1
- 239000002797 plasminogen activator inhibitor Substances 0.000 description 1
- 229940093448 poloxamer 124 Drugs 0.000 description 1
- 229920000058 polyacrylate Polymers 0.000 description 1
- 201000010065 polycystic ovary syndrome Diseases 0.000 description 1
- 229940113116 polyethylene glycol 1000 Drugs 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 108010001062 polysaccharide-K Proteins 0.000 description 1
- 150000004804 polysaccharides Chemical class 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229960005483 polythiazide Drugs 0.000 description 1
- 229920000046 polythiazide Polymers 0.000 description 1
- 229920006316 polyvinylpyrrolidine Polymers 0.000 description 1
- 230000003866 positive regulation of glucagon secretion Effects 0.000 description 1
- 230000000291 postprandial effect Effects 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229960004109 potassium acetate Drugs 0.000 description 1
- XAEFZNCEHLXOMS-UHFFFAOYSA-M potassium benzoate Chemical compound [K+].[O-]C(=O)C1=CC=CC=C1 XAEFZNCEHLXOMS-UHFFFAOYSA-M 0.000 description 1
- RWPGFSMJFRPDDP-UHFFFAOYSA-L potassium metabisulfite Chemical compound [K+].[K+].[O-]S(=O)S([O-])(=O)=O RWPGFSMJFRPDDP-UHFFFAOYSA-L 0.000 description 1
- 229940043349 potassium metabisulfite Drugs 0.000 description 1
- 235000010263 potassium metabisulphite Nutrition 0.000 description 1
- 235000010241 potassium sorbate Nutrition 0.000 description 1
- 239000004302 potassium sorbate Substances 0.000 description 1
- 229940069338 potassium sorbate Drugs 0.000 description 1
- WSHYKIAQCMIPTB-UHFFFAOYSA-M potassium;2-oxo-3-(3-oxo-1-phenylbutyl)chromen-4-olate Chemical compound [K+].[O-]C=1C2=CC=CC=C2OC(=O)C=1C(CC(=O)C)C1=CC=CC=C1 WSHYKIAQCMIPTB-UHFFFAOYSA-M 0.000 description 1
- 229960003611 pramlintide Drugs 0.000 description 1
- 108010029667 pramlintide Proteins 0.000 description 1
- NRKVKVQDUCJPIZ-MKAGXXMWSA-N pramlintide acetate Chemical compound C([C@@H](C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CS)NC(=O)[C@@H](N)CCCCN)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 NRKVKVQDUCJPIZ-MKAGXXMWSA-N 0.000 description 1
- 229960004197 prasugrel Drugs 0.000 description 1
- DTGLZDAWLRGWQN-UHFFFAOYSA-N prasugrel Chemical compound C1CC=2SC(OC(=O)C)=CC=2CN1C(C=1C(=CC=CC=1)F)C(=O)C1CC1 DTGLZDAWLRGWQN-UHFFFAOYSA-N 0.000 description 1
- 229960002965 pravastatin Drugs 0.000 description 1
- TUZYXOIXSAXUGO-PZAWKZKUSA-N pravastatin Chemical compound C1=C[C@H](C)[C@H](CC[C@@H](O)C[C@@H](O)CC(O)=O)[C@H]2[C@@H](OC(=O)[C@@H](C)CC)C[C@H](O)C=C21 TUZYXOIXSAXUGO-PZAWKZKUSA-N 0.000 description 1
- 238000012746 preparative thin layer chromatography Methods 0.000 description 1
- 201000009395 primary hyperaldosteronism Diseases 0.000 description 1
- FYPMFJGVHOHGLL-UHFFFAOYSA-N probucol Chemical compound C=1C(C(C)(C)C)=C(O)C(C(C)(C)C)=CC=1SC(C)(C)SC1=CC(C(C)(C)C)=C(O)C(C(C)(C)C)=C1 FYPMFJGVHOHGLL-UHFFFAOYSA-N 0.000 description 1
- 229960003912 probucol Drugs 0.000 description 1
- 150000003145 progesterone derivatives Chemical class 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- WPDCHTSXOPUOII-UHFFFAOYSA-N propan-2-yl 4-[5-methoxy-6-[(2-methyl-6-methylsulfonylpyridin-3-yl)amino]pyrimidin-4-yl]oxypiperidine-1-carboxylate Chemical compound N1=CN=C(OC2CCN(CC2)C(=O)OC(C)C)C(OC)=C1NC1=CC=C(S(C)(=O)=O)N=C1C WPDCHTSXOPUOII-UHFFFAOYSA-N 0.000 description 1
- VVWRJUBEIPHGQF-UHFFFAOYSA-N propan-2-yl n-propan-2-yloxycarbonyliminocarbamate Chemical compound CC(C)OC(=O)N=NC(=O)OC(C)C VVWRJUBEIPHGQF-UHFFFAOYSA-N 0.000 description 1
- 235000019260 propionic acid Nutrition 0.000 description 1
- 229960001187 propiverine hydrochloride Drugs 0.000 description 1
- 229960003712 propranolol Drugs 0.000 description 1
- RUOJZAUFBMNUDX-UHFFFAOYSA-N propylene carbonate Chemical compound CC1COC(=O)O1 RUOJZAUFBMNUDX-UHFFFAOYSA-N 0.000 description 1
- 235000013772 propylene glycol Nutrition 0.000 description 1
- 108010076038 prosaptide Proteins 0.000 description 1
- 229950008679 protamine sulfate Drugs 0.000 description 1
- 108020000494 protein-tyrosine phosphatase Proteins 0.000 description 1
- 230000003331 prothrombotic effect Effects 0.000 description 1
- 208000006078 pseudohypoparathyroidism Diseases 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 235000008151 pyridoxamine Nutrition 0.000 description 1
- 239000011699 pyridoxamine Substances 0.000 description 1
- HNWCOANXZNKMLR-UHFFFAOYSA-N pyridoxamine dihydrochloride Chemical compound Cl.Cl.CC1=NC=C(CO)C(CN)=C1O HNWCOANXZNKMLR-UHFFFAOYSA-N 0.000 description 1
- 125000004076 pyridyl group Chemical group 0.000 description 1
- 125000000714 pyrimidinyl group Chemical group 0.000 description 1
- 125000000719 pyrrolidinyl group Chemical group 0.000 description 1
- 150000003856 quaternary ammonium compounds Chemical class 0.000 description 1
- IUVKMZGDUIUOCP-BTNSXGMBSA-N quinbolone Chemical compound O([C@H]1CC[C@H]2[C@H]3[C@@H]([C@]4(C=CC(=O)C=C4CC3)C)CC[C@@]21C)C1=CCCC1 IUVKMZGDUIUOCP-BTNSXGMBSA-N 0.000 description 1
- 125000002943 quinolinyl group Chemical group N1=C(C=CC2=CC=CC=C12)* 0.000 description 1
- 108700027806 rGLP-1 Proteins 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- ZAHRKKWIAAJSAO-UHFFFAOYSA-N rapamycin Natural products COCC(O)C(=C/C(C)C(=O)CC(OC(=O)C1CCCCN1C(=O)C(=O)C2(O)OC(CC(OC)C(=CC=CC=CC(C)CC(C)C(=O)C)C)CCC2C)C(C)CC3CCC(O)C(C3)OC)C ZAHRKKWIAAJSAO-UHFFFAOYSA-N 0.000 description 1
- 229940075993 receptor modulator Drugs 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 206010038038 rectal cancer Diseases 0.000 description 1
- 239000006215 rectal suppository Substances 0.000 description 1
- 229940100618 rectal suppository Drugs 0.000 description 1
- 210000000664 rectum Anatomy 0.000 description 1
- 201000001275 rectum cancer Diseases 0.000 description 1
- 229940126844 remogliflozin Drugs 0.000 description 1
- 208000015347 renal cell adenocarcinoma Diseases 0.000 description 1
- 208000030859 renal pelvis/ureter urothelial carcinoma Diseases 0.000 description 1
- 229960002354 repaglinide Drugs 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 230000003979 response to food Effects 0.000 description 1
- 239000003340 retarding agent Substances 0.000 description 1
- 210000001525 retina Anatomy 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- JZCPYUJPEARBJL-UHFFFAOYSA-N rimonabant Chemical compound CC=1C(C(=O)NN2CCCCC2)=NN(C=2C(=CC(Cl)=CC=2)Cl)C=1C1=CC=C(Cl)C=C1 JZCPYUJPEARBJL-UHFFFAOYSA-N 0.000 description 1
- 229960003015 rimonabant Drugs 0.000 description 1
- CRPGRUONUFDYBG-UHFFFAOYSA-N risarestat Chemical compound C1=C(OCC)C(OCCCCC)=CC=C1C1C(=O)NC(=O)S1 CRPGRUONUFDYBG-UHFFFAOYSA-N 0.000 description 1
- 229940089617 risedronate Drugs 0.000 description 1
- 229960004641 rituximab Drugs 0.000 description 1
- 229960001148 rivaroxaban Drugs 0.000 description 1
- KGFYHTZWPPHNLQ-AWEZNQCLSA-N rivaroxaban Chemical compound S1C(Cl)=CC=C1C(=O)NC[C@@H]1OC(=O)N(C=2C=CC(=CC=2)N2C(COCC2)=O)C1 KGFYHTZWPPHNLQ-AWEZNQCLSA-N 0.000 description 1
- 229960004136 rivastigmine Drugs 0.000 description 1
- XMSXOLDPMGMWTH-UHFFFAOYSA-N rivoglitazone Chemical compound CN1C2=CC(OC)=CC=C2N=C1COC(C=C1)=CC=C1CC1SC(=O)NC1=O XMSXOLDPMGMWTH-UHFFFAOYSA-N 0.000 description 1
- 229950010764 rivoglitazone Drugs 0.000 description 1
- 229950000261 ruboxistaurin Drugs 0.000 description 1
- 229940081974 saccharin Drugs 0.000 description 1
- 235000019204 saccharin Nutrition 0.000 description 1
- 229960004889 salicylic acid Drugs 0.000 description 1
- 108010068072 salmon calcitonin Proteins 0.000 description 1
- 208000001076 sarcopenia Diseases 0.000 description 1
- 229940043230 sarcosine Drugs 0.000 description 1
- 229950005789 sarpogrelate Drugs 0.000 description 1
- FFYNAVGJSYHHFO-UHFFFAOYSA-N sarpogrelate Chemical compound COC1=CC=CC(CCC=2C(=CC=CC=2)OCC(CN(C)C)OC(=O)CCC(O)=O)=C1 FFYNAVGJSYHHFO-UHFFFAOYSA-N 0.000 description 1
- 238000009738 saturating Methods 0.000 description 1
- 229960004937 saxagliptin Drugs 0.000 description 1
- 108010033693 saxagliptin Proteins 0.000 description 1
- QGJUIPDUBHWZPV-SGTAVMJGSA-N saxagliptin Chemical compound C1C(C2)CC(C3)CC2(O)CC13[C@H](N)C(=O)N1[C@H](C#N)C[C@@H]2C[C@@H]21 QGJUIPDUBHWZPV-SGTAVMJGSA-N 0.000 description 1
- 206010039667 schwannoma Diseases 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000000580 secretagogue effect Effects 0.000 description 1
- 230000001235 sensitizing effect Effects 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 229940076279 serotonin Drugs 0.000 description 1
- 108010064112 serotonin 6 receptor Proteins 0.000 description 1
- 239000003775 serotonin noradrenalin reuptake inhibitor Substances 0.000 description 1
- 239000003762 serotonin receptor affecting agent Substances 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 231100000872 sexual dysfunction Toxicity 0.000 description 1
- 239000010686 shark liver oil Substances 0.000 description 1
- 229940069764 shark liver oil Drugs 0.000 description 1
- 102000035025 signaling receptors Human genes 0.000 description 1
- 108091005475 signaling receptors Proteins 0.000 description 1
- 229960003310 sildenafil Drugs 0.000 description 1
- DEIYFTQMQPDXOT-UHFFFAOYSA-N sildenafil citrate Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O.CCCC1=NN(C)C(C(N2)=O)=C1N=C2C(C(=CC=1)OCC)=CC=1S(=O)(=O)N1CCN(C)CC1 DEIYFTQMQPDXOT-UHFFFAOYSA-N 0.000 description 1
- 229960002639 sildenafil citrate Drugs 0.000 description 1
- SEBFKMXJBCUCAI-HKTJVKLFSA-N silibinin Chemical compound C1=C(O)C(OC)=CC([C@@H]2[C@H](OC3=CC=C(C=C3O2)[C@@H]2[C@H](C(=O)C3=C(O)C=C(O)C=C3O2)O)CO)=C1 SEBFKMXJBCUCAI-HKTJVKLFSA-N 0.000 description 1
- 150000004760 silicates Chemical class 0.000 description 1
- RMAQACBXLXPBSY-UHFFFAOYSA-N silicic acid Chemical compound O[Si](O)(O)O RMAQACBXLXPBSY-UHFFFAOYSA-N 0.000 description 1
- 235000012239 silicon dioxide Nutrition 0.000 description 1
- 229960004245 silymarin Drugs 0.000 description 1
- 235000017700 silymarin Nutrition 0.000 description 1
- 229960004058 simfibrate Drugs 0.000 description 1
- 229960002855 simvastatin Drugs 0.000 description 1
- RYMZZMVNJRMUDD-HGQWONQESA-N simvastatin Chemical compound C([C@H]1[C@@H](C)C=CC2=C[C@H](C)C[C@@H]([C@H]12)OC(=O)C(C)(C)CC)C[C@@H]1C[C@@H](O)CC(=O)O1 RYMZZMVNJRMUDD-HGQWONQESA-N 0.000 description 1
- IZTQOLKUZKXIRV-YRVFCXMDSA-N sincalide Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](N)CC(O)=O)C1=CC=C(OS(O)(=O)=O)C=C1 IZTQOLKUZKXIRV-YRVFCXMDSA-N 0.000 description 1
- 238000009097 single-agent therapy Methods 0.000 description 1
- 208000037968 sinus cancer Diseases 0.000 description 1
- 229960002930 sirolimus Drugs 0.000 description 1
- QFJCIRLUMZQUOT-HPLJOQBZSA-N sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 1
- 229960004034 sitagliptin Drugs 0.000 description 1
- MFFMDFFZMYYVKS-SECBINFHSA-N sitagliptin Chemical compound C([C@H](CC(=O)N1CC=2N(C(=NN=2)C(F)(F)F)CC1)N)C1=CC(F)=C(F)C=C1F MFFMDFFZMYYVKS-SECBINFHSA-N 0.000 description 1
- 229950001403 sizofiran Drugs 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 230000000391 smoking effect Effects 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 229960003885 sodium benzoate Drugs 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 229940037001 sodium edetate Drugs 0.000 description 1
- 235000011121 sodium hydroxide Nutrition 0.000 description 1
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 1
- CMZUMMUJMWNLFH-UHFFFAOYSA-N sodium metavanadate Chemical compound [Na+].[O-][V](=O)=O CMZUMMUJMWNLFH-UHFFFAOYSA-N 0.000 description 1
- 159000000000 sodium salts Chemical class 0.000 description 1
- WSRBRQQGWDWSON-UHFFFAOYSA-M sodium;3,7-dimethylpurine-2,6-dione;2-hydroxybenzoate Chemical compound [Na+].OC1=CC=CC=C1C([O-])=O.CN1C(=O)NC(=O)C2=C1N=CN2C WSRBRQQGWDWSON-UHFFFAOYSA-M 0.000 description 1
- HSFQBFMEWSTNOW-UHFFFAOYSA-N sodium;carbanide Chemical group [CH3-].[Na+] HSFQBFMEWSTNOW-UHFFFAOYSA-N 0.000 description 1
- 239000008247 solid mixture Substances 0.000 description 1
- 229940033331 soy sterol Drugs 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- LXMSZDCAJNLERA-ZHYRCANASA-N spironolactone Chemical compound C([C@@H]1[C@]2(C)CC[C@@H]3[C@@]4(C)CCC(=O)C=C4C[C@H]([C@@H]13)SC(=O)C)C[C@@]21CCC(=O)O1 LXMSZDCAJNLERA-ZHYRCANASA-N 0.000 description 1
- 229960002256 spironolactone Drugs 0.000 description 1
- 239000004059 squalene synthase inhibitor Substances 0.000 description 1
- PWEBUXCTKOWPCW-UHFFFAOYSA-N squaric acid Chemical class OC1=C(O)C(=O)C1=O PWEBUXCTKOWPCW-UHFFFAOYSA-N 0.000 description 1
- DFVFTMTWCUHJBL-BQBZGAKWSA-N statine Chemical compound CC(C)C[C@H](N)[C@@H](O)CC(O)=O DFVFTMTWCUHJBL-BQBZGAKWSA-N 0.000 description 1
- SIARJEKBADXQJG-LFZQUHGESA-N stearoyl-CoA Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCSC(=O)CCCCCCCCCCCCCCCCC)O[C@H]1N1C2=NC=NC(N)=C2N=C1 SIARJEKBADXQJG-LFZQUHGESA-N 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 201000011549 stomach cancer Diseases 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 125000005346 substituted cycloalkyl group Chemical group 0.000 description 1
- 229960002317 succinimide Drugs 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 150000003455 sulfinic acids Chemical class 0.000 description 1
- 150000003460 sulfonic acids Chemical class 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 229920001059 synthetic polymer Polymers 0.000 description 1
- 229940037128 systemic glucocorticoids Drugs 0.000 description 1
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 1
- 229960001685 tacrine Drugs 0.000 description 1
- YLJREFDVOIBQDA-UHFFFAOYSA-N tacrine Chemical compound C1=CC=C2C(N)=C(CCCC3)C3=NC2=C1 YLJREFDVOIBQDA-UHFFFAOYSA-N 0.000 description 1
- 229960001967 tacrolimus Drugs 0.000 description 1
- QJJXYPPXXYFBGM-SHYZHZOCSA-N tacrolimus Natural products CO[C@H]1C[C@H](CC[C@@H]1O)C=C(C)[C@H]2OC(=O)[C@H]3CCCCN3C(=O)C(=O)[C@@]4(O)O[C@@H]([C@H](C[C@H]4C)OC)[C@@H](C[C@H](C)CC(=C[C@@H](CC=C)C(=O)C[C@H](O)[C@H]2C)C)OC QJJXYPPXXYFBGM-SHYZHZOCSA-N 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 229950005022 taranabant Drugs 0.000 description 1
- 235000002906 tartaric acid Nutrition 0.000 description 1
- 239000011975 tartaric acid Substances 0.000 description 1
- 229960000651 tasosartan Drugs 0.000 description 1
- ADXGNEYLLLSOAR-UHFFFAOYSA-N tasosartan Chemical compound C12=NC(C)=NC(C)=C2CCC(=O)N1CC(C=C1)=CC=C1C1=CC=CC=C1C=1N=NNN=1 ADXGNEYLLLSOAR-UHFFFAOYSA-N 0.000 description 1
- 229960005187 telmisartan Drugs 0.000 description 1
- WGRQANOPCQRCME-PMACEKPBSA-N teneligliptin Chemical compound O=C([C@H]1NC[C@H](C1)N1CCN(CC1)C1=CC(=NN1C=1C=CC=CC=1)C)N1CCSC1 WGRQANOPCQRCME-PMACEKPBSA-N 0.000 description 1
- CZVNLCOJFFYZPG-UHFFFAOYSA-N tert-butyl 4-aminobutanoate;hydrochloride Chemical compound Cl.CC(C)(C)OC(=O)CCCN CZVNLCOJFFYZPG-UHFFFAOYSA-N 0.000 description 1
- XUHJJLCKXZTUJN-UHFFFAOYSA-N tert-butyl n-(2-aminoethyl)carbamate;hydron;chloride Chemical compound Cl.CC(C)(C)OC(=O)NCCN XUHJJLCKXZTUJN-UHFFFAOYSA-N 0.000 description 1
- GKWGBMHXVRSFRT-UHFFFAOYSA-N tert-butyl n-[2-(methylamino)ethyl]carbamate Chemical compound CNCCNC(=O)OC(C)(C)C GKWGBMHXVRSFRT-UHFFFAOYSA-N 0.000 description 1
- NPDBDJFLKKQMCM-UHFFFAOYSA-N tert-butylglycine Chemical compound CC(C)(C)C(N)C(O)=O NPDBDJFLKKQMCM-UHFFFAOYSA-N 0.000 description 1
- VCVWXKKWDOJNIT-ZOMKSWQUSA-N tesofensine Chemical compound C1([C@H]2C[C@@H]3CC[C@@H](N3C)[C@@H]2COCC)=CC=C(Cl)C(Cl)=C1 VCVWXKKWDOJNIT-ZOMKSWQUSA-N 0.000 description 1
- 229950009970 tesofensine Drugs 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- YLQBMQCUIZJEEH-UHFFFAOYSA-N tetrahydrofuran Natural products C=1C=COC=1 YLQBMQCUIZJEEH-UHFFFAOYSA-N 0.000 description 1
- 125000003718 tetrahydrofuranyl group Chemical group 0.000 description 1
- 125000003039 tetrahydroisoquinolinyl group Chemical group C1(NCCC2=CC=CC=C12)* 0.000 description 1
- 125000001712 tetrahydronaphthyl group Chemical group C1(CCCC2=CC=CC=C12)* 0.000 description 1
- CIJQTPFWFXOSEO-NDMITSJXSA-J tetrasodium;(2r,3r,4s)-2-[(2r,3s,4r,5r,6s)-5-acetamido-6-[(1r,2r,3r,4r)-4-[(2r,3s,4r,5r,6r)-5-acetamido-6-[(4r,5r,6r)-2-carboxylato-4,5-dihydroxy-6-[[(1r,3r,4r,5r)-3-hydroxy-4-(sulfonatoamino)-6,8-dioxabicyclo[3.2.1]octan-2-yl]oxy]oxan-3-yl]oxy-2-(hydroxy Chemical compound [Na+].[Na+].[Na+].[Na+].O([C@@H]1[C@@H](COS(O)(=O)=O)O[C@@H]([C@@H]([C@H]1O)NC(C)=O)O[C@@H]1C(C[C@H]([C@@H]([C@H]1O)O)O[C@@H]1[C@@H](CO)O[C@H](OC2C(O[C@@H](OC3[C@@H]([C@@H](NS([O-])(=O)=O)[C@@H]4OC[C@H]3O4)O)[C@H](O)[C@H]2O)C([O-])=O)[C@H](NC(C)=O)[C@H]1C)C([O-])=O)[C@@H]1OC(C([O-])=O)=C[C@H](O)[C@H]1O CIJQTPFWFXOSEO-NDMITSJXSA-J 0.000 description 1
- IKRMQEUTISXXQP-UHFFFAOYSA-N tetrasulfane Chemical compound SSSS IKRMQEUTISXXQP-UHFFFAOYSA-N 0.000 description 1
- 229940126585 therapeutic drug Drugs 0.000 description 1
- 238000011285 therapeutic regimen Methods 0.000 description 1
- 229960003495 thiamine Drugs 0.000 description 1
- DPJRMOMPQZCRJU-UHFFFAOYSA-M thiamine hydrochloride Chemical compound Cl.[Cl-].CC1=C(CCO)SC=[N+]1CC1=CN=C(C)N=C1N DPJRMOMPQZCRJU-UHFFFAOYSA-M 0.000 description 1
- 239000003451 thiazide diuretic agent Substances 0.000 description 1
- 150000001467 thiazolidinediones Chemical class 0.000 description 1
- 125000000335 thiazolyl group Chemical group 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 150000007970 thio esters Chemical group 0.000 description 1
- AUKDKWLCVXCCBN-UHFFFAOYSA-N thiodiacetic acid sulfoxide Chemical compound OC(=O)CS(=O)CC(O)=O AUKDKWLCVXCCBN-UHFFFAOYSA-N 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 239000003868 thrombin inhibitor Substances 0.000 description 1
- 229960000103 thrombolytic agent Drugs 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 229960002961 ticlopidine hydrochloride Drugs 0.000 description 1
- MTKNGOHFNXIVOS-UHFFFAOYSA-N ticlopidine hydrochloride Chemical compound [H+].[Cl-].ClC1=CC=CC=C1CN1CC(C=CS2)=C2CC1 MTKNGOHFNXIVOS-UHFFFAOYSA-N 0.000 description 1
- COKMIXFXJJXBQG-NRFANRHFSA-N tirofiban Chemical compound C1=CC(C[C@H](NS(=O)(=O)CCCC)C(O)=O)=CC=C1OCCCCC1CCNCC1 COKMIXFXJJXBQG-NRFANRHFSA-N 0.000 description 1
- 229960003425 tirofiban Drugs 0.000 description 1
- 229960002277 tolazamide Drugs 0.000 description 1
- OUDSBRTVNLOZBN-UHFFFAOYSA-N tolazamide Chemical compound C1=CC(C)=CC=C1S(=O)(=O)NC(=O)NN1CCCCCC1 OUDSBRTVNLOZBN-UHFFFAOYSA-N 0.000 description 1
- 229960005371 tolbutamide Drugs 0.000 description 1
- 229960002309 toloxatone Drugs 0.000 description 1
- LUBHDINQXIHVLS-UHFFFAOYSA-N tolrestat Chemical compound OC(=O)CN(C)C(=S)C1=CC=CC2=C(C(F)(F)F)C(OC)=CC=C21 LUBHDINQXIHVLS-UHFFFAOYSA-N 0.000 description 1
- 229960003069 tolrestat Drugs 0.000 description 1
- 201000006134 tongue cancer Diseases 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 229960004394 topiramate Drugs 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 229960004380 tramadol Drugs 0.000 description 1
- TVYLLZQTGLZFBW-GOEBONIOSA-N tramadol Natural products COC1=CC=CC([C@@]2(O)[C@@H](CCCC2)CN(C)C)=C1 TVYLLZQTGLZFBW-GOEBONIOSA-N 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 208000009174 transverse myelitis Diseases 0.000 description 1
- IWYJYHUNXVAVAA-OAHLLOKOSA-N trelagliptin Chemical compound C=1C(F)=CC=C(C#N)C=1CN1C(=O)N(C)C(=O)C=C1N1CCC[C@@H](N)C1 IWYJYHUNXVAVAA-OAHLLOKOSA-N 0.000 description 1
- 229950010728 trelagliptin Drugs 0.000 description 1
- ZGYICYBLPGRURT-UHFFFAOYSA-N tri(propan-2-yl)silicon Chemical compound CC(C)[Si](C(C)C)C(C)C ZGYICYBLPGRURT-UHFFFAOYSA-N 0.000 description 1
- 229960001288 triamterene Drugs 0.000 description 1
- 229920000428 triblock copolymer Polymers 0.000 description 1
- LMJSLTNSBFUCMU-UHFFFAOYSA-N trichlormethiazide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC2=C1NC(C(Cl)Cl)NS2(=O)=O LMJSLTNSBFUCMU-UHFFFAOYSA-N 0.000 description 1
- 229960004813 trichlormethiazide Drugs 0.000 description 1
- 229940061414 trileptal Drugs 0.000 description 1
- FIQMHBFVRAXMOP-UHFFFAOYSA-N triphenylphosphane oxide Chemical compound C=1C=CC=CC=1P(C=1C=CC=CC=1)(=O)C1=CC=CC=C1 FIQMHBFVRAXMOP-UHFFFAOYSA-N 0.000 description 1
- UCPYLLCMEDAXFR-UHFFFAOYSA-N triphosgene Chemical compound ClC(Cl)(Cl)OC(=O)OC(Cl)(Cl)Cl UCPYLLCMEDAXFR-UHFFFAOYSA-N 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 229910052722 tritium Inorganic materials 0.000 description 1
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 1
- 208000035408 type 1 diabetes mellitus 1 Diseases 0.000 description 1
- 229940079023 tysabri Drugs 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 208000019206 urinary tract infection Diseases 0.000 description 1
- 229960005356 urokinase Drugs 0.000 description 1
- 208000037965 uterine sarcoma Diseases 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 229960004699 valsartan Drugs 0.000 description 1
- ACWBQPMHZXGDFX-QFIPXVFZSA-N valsartan Chemical compound C1=CC(CN(C(=O)CCCC)[C@@H](C(C)C)C(O)=O)=CC=C1C1=CC=CC=C1C1=NN=NN1 ACWBQPMHZXGDFX-QFIPXVFZSA-N 0.000 description 1
- 230000006492 vascular dysfunction Effects 0.000 description 1
- 229940099259 vaseline Drugs 0.000 description 1
- 229940124549 vasodilator Drugs 0.000 description 1
- 239000003071 vasodilator agent Substances 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 229950006508 velneperit Drugs 0.000 description 1
- 229960001722 verapamil Drugs 0.000 description 1
- 229960001254 vildagliptin Drugs 0.000 description 1
- SYOKIDBDQMKNDQ-XWTIBIIYSA-N vildagliptin Chemical compound C1C(O)(C2)CC(C3)CC1CC32NCC(=O)N1CCC[C@H]1C#N SYOKIDBDQMKNDQ-XWTIBIIYSA-N 0.000 description 1
- 235000019155 vitamin A Nutrition 0.000 description 1
- 239000011719 vitamin A Substances 0.000 description 1
- 235000019156 vitamin B Nutrition 0.000 description 1
- 239000011720 vitamin B Substances 0.000 description 1
- 235000010374 vitamin B1 Nutrition 0.000 description 1
- 239000011691 vitamin B1 Substances 0.000 description 1
- 235000019163 vitamin B12 Nutrition 0.000 description 1
- 239000011715 vitamin B12 Substances 0.000 description 1
- 229940045997 vitamin a Drugs 0.000 description 1
- 229940046001 vitamin b complex Drugs 0.000 description 1
- 229940019333 vitamin k antagonists Drugs 0.000 description 1
- 229960001729 voglibose Drugs 0.000 description 1
- 239000000341 volatile oil Substances 0.000 description 1
- 230000008673 vomiting Effects 0.000 description 1
- 229960000883 warfarin potassium Drugs 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 208000016261 weight loss Diseases 0.000 description 1
- 230000004580 weight loss Effects 0.000 description 1
- 210000002268 wool Anatomy 0.000 description 1
- 229920001285 xanthan gum Polymers 0.000 description 1
- 239000000230 xanthan gum Substances 0.000 description 1
- 235000010493 xanthan gum Nutrition 0.000 description 1
- 229940082509 xanthan gum Drugs 0.000 description 1
- 150000003751 zinc Chemical class 0.000 description 1
- 239000011701 zinc Substances 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
- 239000011592 zinc chloride Substances 0.000 description 1
- 235000005074 zinc chloride Nutrition 0.000 description 1
- 229910000166 zirconium phosphate Inorganic materials 0.000 description 1
- 229940061639 zonegran Drugs 0.000 description 1
- UBQNRHZMVUUOMG-UHFFFAOYSA-N zonisamide Chemical compound C1=CC=C2C(CS(=O)(=O)N)=NOC2=C1 UBQNRHZMVUUOMG-UHFFFAOYSA-N 0.000 description 1
- 229950005346 zopolrestat Drugs 0.000 description 1
- KYHVTMFADJNSGS-UHFFFAOYSA-N {3-[(4,5,7-trifluoro-1,3-benzothiazol-2-yl)methyl]-1h-indol-1-yl}acetic acid Chemical compound C12=CC=CC=C2N(CC(=O)O)C=C1CC1=NC2=C(F)C(F)=CC(F)=C2S1 KYHVTMFADJNSGS-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/605—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
- A61K47/545—Heterocyclic compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/08—Drugs for disorders of the alimentary tract or the digestive system for nausea, cinetosis or vertigo; Antiemetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- This disclosure features chemical entities (e.g., a compound or a pharmaceutically acceptable salt and/or hydrate and/or prodrug of the compound) that modulate (e.g., agonize or partially agonize or antagonize) glucagon-like peptide-1 receptor (“GLP-1R”) and/or the gastric inhibitory polypeptide receptor (“GIPR”).
- GLP-1R glucagon-like peptide-1 receptor
- GIPR gastric inhibitory polypeptide receptor
- the chemical entities are useful, e.g., for treating a subject (e.g., a human) having a disease, disorder, or condition in which modulation (e.g., agonism, partial agonism or antagonism) of GLP-1R and/or GIPR activities is beneficial for the treatment or prevention of the underlying pathology and/or symptoms and/or progression of the disease, disorder, or condition.
- the modulation results in an enhancement of (e.g., an increase in) existing levels (e.g., normal or below normal levels) of GLP-1R and/or GIPR activity (e.g., signaling).
- the chemical entities described herein further modulate (e.g., attenuate, uncouple) ⁇ -arrestin signaling relative to what is observed with the native ligand.
- This disclosure also features compositions as well as other methods of using and making the said chemical entities.
- Type-2 diabetes Diabetes mellitus type 2 (type-2 diabetes) is characterized by high blood glucose and insulin resistance. Type 2 diabetes as well as conditions that are co-morbid or sequela with type-2 diabetes affect tens of millions of people in the United States alone. Type-2 diabetes is frequently associated with obesity.
- Nonalcoholic steatohepatitis is liver inflammation and damage caused by a buildup of fat in the liver. It is part of a group of conditions called nonalcoholic fatty liver disease (NAFLD). NASH and NAFLD tend to develop in patients having one of the following risk factors: obesity, dyslipidemia, and glucose intolerance and appears to be linked to insulin resistance (e.g., as in obesity or metabolic syndrome).
- Incretin hormones are hormones that provide glycemic control in response to food intake.
- Gastric inhibitory polypeptide (“GIP”) and glucagon-like peptide-1 (“GLP-1”) are primary incretin hormones secreted from small intestinal L cells and K cells, respectively, on ingestion of glucose or nutrients to stimulate insulin secretion from pancreatic ⁇ cells.
- GIP and GLP-1 undergo degradation by dipeptidyl peptidase-4 (DPP-4), and rapidly lose their biological activities (see, e.g., Y Sieno, et. al, Journal of Diabetes Investigation 2013, 4, 108-130).
- GIP and GLP-1 are believed to be mediated by their specific receptors, the GIP receptor (GIPR) and the GLP-1 receptor (GLP-1R), respectively, which both belong to the G-protein coupled receptor family and are expressed in pancreatic ⁇ -cells, as well as in various tissues and organs.
- GLP-1 activities include, without limitation, stimulation of insulin synthesis and secretion, inhibition of glucagon secretion, and inhibition of food intake.
- GIP activities include, without limitation, stimulation of glucose-dependent insulin secretion, an increase in ⁇ -cell mass, stimulation of glucagon secretion, and a decrease in gastric acid secretion. See, e.g., WO 2016/131893.
- GLP-1 and GLP-1 analogues acting as agonists at the GLP-1 receptor, have been shown to be effective in glycemic control, e.g., type-2 diabetes. See, e.g., WO 2016/131893.
- GIP and GLP-1 are believed to be involved in various biological processes in different tissues and organs that express GIPR and GLP-1R, including, e.g., the pancreas, fat, bone, brain, heart, kidney, eye, nerves, and liver.
- investigations using mice lacking GIPR and/or GLP-1R, as well as mice lacking DPP-4 showed involvement of GIP and GLP-1 in divergent biological activities.
- diabetes-related microvascular complications e.g., retinopathy, nephropathy and neuropathy
- macrovascular complications e.g., coronary artery disease, peripheral artery disease and cerebrovascular disease
- diabetes-related comorbidity e.g., obesity, non-alcoholic fatty liver disease, bone fracture and cognitive dysfunction. See, e.g., Sieno at page 108.
- This disclosure features chemical entities (e.g., a compound or a pharmaceutically acceptable salt and/or hydrate and/or prodrug of the compound) that modulate (e.g., agonize or partially agonize or antagonize) glucagon-like peptide-1 receptor (“GLP-1R”) and/or the gastric inhibitory polypeptide receptor (“GIPR”).
- GLP-1R glucagon-like peptide-1 receptor
- GIPR gastric inhibitory polypeptide receptor
- the chemical entities are useful, e.g., for treating a subject (e.g., a human) having a disease, disorder, or condition in which modulation (e.g., agonism, partial agonism or antagonism) of GLP-1R and/or GIPR activities is beneficial for the treatment or prevention of the underlying pathology and/or symptoms and/or progression of the disease, disorder, or condition.
- the modulation results in an enhancement of (e.g., an increase in) existing levels (e.g., normal or below normal levels) of GLP-1R and/or GIPR activity (e.g., signaling).
- the chemical entities described herein further modulate (e.g., attenuate, uncouple) ⁇ -arrestin signaling relative to what is observed with the native ligand.
- This disclosure also features compositions as well as other methods of using and making the said chemical entities.
- An “agonist” of GLP-1R includes compounds that, at the protein level, directly bind or modify GLP-1R such that an activity of GLP-1R is increased, e.g., by activation, stabilization, altered distribution, or otherwise relative to GLP-1R activity in absence of ligand.
- GLP-1R full agonist e.g native GLP-1
- GLP-1R full agonist e.g native GLP-1
- these compounds antagonize activation of GLP-1R by a GLP-1R full agonist because they prevent the full effect of GLP-1R interaction.
- the compounds also, on their own, activate some GLP-1R activity, typically less than a corresponding amount of the GLP-1R full agonist.
- Such compounds are sometimes referred to herein as “partial agonists of GLP-1R”.
- an “antagonist” of GLP-1R includes compounds that, at the protein level, directly bind or modify GLP-1R such that an activity of GLP-1R is decreased, e.g., by inhibition, blocking or dampening agonist-mediated responses, altered distribution, or otherwise relative to GLP-1R activity in absence of ligand.
- the compounds described herein are agonists (e.g. full agonists) of GLP-1R. In other embodiments, the compounds described herein are partial agonists or antagonists of GLP-1R.
- An “agonist” of GIPR includes compounds that, at the protein level, directly bind or modify GIPR such that an activity of GIPR is increased, e.g., by activation, stabilization, altered distribution, or otherwise relative to GIPR activity in absence of ligand.
- Certain compounds described herein that agonize GIPR to a lesser extent than native GIP can function as antagonists as well as agonists. These compounds are partial antagonists as they reduce activation of GIPR by native GIP because they reduce the full effect of native GIP. However, the compounds also, on their own, activate some GIPR activity, typically less than a corresponding amount of native GIP. Such compounds are sometimes referred to herein as “partial agonists of GIPR”.
- an “antagonist” of GIPR includes compounds that, at the protein level, directly bind or modify GIPR such that an activity of GIPR is decreased, e.g., by inhibition, blocking or dampening agonist-mediated responses, altered distribution, or otherwise relative to GIPR activity in absence of ligand.
- the compounds described herein are agonists (e.g. full agonists) of GIPR. In other embodiments, the compounds described herein are partial agonists of GIPR. In still other embodiments, the compounds described herein are or antagonists of GIPR.
- the compounds described herein are full agonists of both GLP-1R and GIPR. In some embodiments, the compounds described herein are partial agonists of both GLP-1R and GIPR.
- This disclosure also contemplates chemical entities that (i) agonize one of GLP-1R and GIPR (e.g., GLP-1R); and antagonize the other of GLP-1R and GIPR (e.g., GIPR).
- this disclosure contemplates chemical entities that (i) fully agonize one of GLP-1R and GIPR (e.g., GLP-1R); and partially agonize or antagonize the other of GLP-1R and GIPR (e.g., GIPR).
- a receptor exists in an active (R a ) and an inactive (Ri) conformation.
- Certain compounds that affect the receptor can alter the ratio of Ra to Ri (Ra/Ri).
- a full agonist increases the ratio of Ra/Ri and can cause a “maximal”, saturating effect.
- a partial agonist when bound to the receptor, gives a response that is lower than that elicited by a full agonist (e.g., an endogenous agonist).
- a full agonist e.g., an endogenous agonist
- the Ra/Ri for a partial agonist is less than for a full agonist.
- the potency of a partial agonist may be greater or less than that of the full agonist.
- the chemical entities described herein further modulate (e.g., reduce, e.g., attenuate, disrupt, inhibit) ⁇ -arrestin coupling and/or b-arrestin signaling, and GLP-1R and/or GIPR internalization.
- the chemical entities described herein modulate (e.g., reduce, e.g., attenuate, disrupt, inhibit) recruitment of ⁇ -arrestin to a G-protein coupled receptor (e.g., GLP-1R).
- the chemical entities described herein modulate (e.g., reduce, e.g., attenuate, disrupt, inhibit) formation of a complex (“coupling”) (e.g., a signaling complex) between ⁇ -arrestin and a G-protein coupled receptor (e.g., GLP-1R or GIPR).
- a complex e.g., a signaling complex
- GLP-1R or GIPR G-protein coupled receptor
- a value of ⁇ -arrestin (GLP-1R) EC50 ⁇ 1 ⁇ M in the aforementioned assay indicates a compound that induces ⁇ -arrestin recruitment to GLP-1R.
- GLP-1, the native ligand for GLP-1R, and therapeutic analogs thereof, such a liraglutide, are potent recruiters of ⁇ -arrestin.
- a value of ⁇ -arrestin (GLP1R) EC 50 >1 ⁇ M indicates a compound that does not substantially induce ⁇ -arrestin recruitment to GLP-1R.
- G-protein coupled receptors e.g., GLP-1R and/or GIPR
- GLP-1R and/or GIPR G-protein coupled receptors
- b-arrestin coupling is a key strep in receptor internalization and subsequent de-sensitization and attenuation of signaling.
- GLP-1 and the liraglutide analog
- GIP have been shown to produce rapid receptor internalization.
- compounds that activate GLP-1R and/or GIPR cAMP signaling but do not substantially couple to ⁇ -arrestin have the potential to prolong receptor signaling and extend pharmacological benefits.
- the chemical entities described herein exhibit relatively strong GLP-1R and/or GIPR mediated cAMP activation with minimal or no detectable ⁇ -arrestin coupling. In some embodiments, the chemical entities described herein exhibit relatively strong GLP-1R mediated cAMP activation and no or little GIPR mediated cAMP activation with minimal or no detectable ⁇ -arrestin coupling.
- the compounds described herein show reduced activity in a rodent aversion model, while maintaining a relatively high potency in glucose clearance assay.
- Aversion models such as conditioned taste aversion, are commonly used to identify compounds with adverse effects such as nausea.
- Nausea causing agents, such a Exendin-4 and liraglutide are know to have a strong signal in conditioned taste aversion models.
- some of the chemical entities described herein are therefore expected to have a reduced likelihood of producing unwanted side effects, such as nausea, when administered to a patient, while maintaining full pharmacological benefit.
- this disclosure features peptide-based chemical entities (e.g., N-protected peptide-based chemical entities; e.g., peptide-based chemical entities having from 30-50 amino acids, 30-45 amino acids, 30-40 amino acids, 35-40 amino acids; e.g., an N-protected peptide-based chemical entities having from 30-50 amino acids, 30-45 amino acids, 30-40 amino acids, 35-40 amino acids).
- N-protected peptide-based chemical entities e.g., N-protected peptide-based chemical entities; e.g., peptide-based chemical entities having from 30-50 amino acids, 30-45 amino acids, 30-40 amino acids, 35-40 amino acids
- an N-protected peptide-based chemical entities having from 30-50 amino acids, 30-45 amino acids, 30-40 amino acids, 35-40 amino acids.
- the peptide-based chemical entities modulate (e.g., agonize or partially agonize or antagonize) glucagon-like peptide-1 receptor (“GLP-1R”) and/or the gastric inhibitory polypeptide receptor (“GIPR”) and optionally further modulate (e.g., uncouple, attenuate) ⁇ -arrestin signaling and/or aversion as described herein.
- GLP-1R glucagon-like peptide-1 receptor
- GIPR gastric inhibitory polypeptide receptor
- the peptide-based chemical entities agonize or partially agonize GLP-1R.
- the peptide-based chemical entities agonize or partially agonize or antagonize GIPR.
- said peptide-based chemical entities reduce (e.g., uncouple, attenuate, inhibit) ⁇ -arrestin signaling; e.g., reduce (e.g., uncouple, attenuate, inhibit) the recruitment of ⁇ -arrestin to a G-protein coupled receptor (e.g., GLP-1R); e.g., reduce (e.g., attenuate, disrupt, inhibit) the formation of a complex (e.g., a signaling complex) between ⁇ -arrestin and a G-protein coupled receptor (e.g., GLP-1R).
- a complex e.g., a signaling complex
- the peptide-based chemical entities are:
- the peptide-based chemical entities exhibit a value of cAMP (GLP1R) EC50 of less than about 10 nM, 5 nM, or 1 nM (e.g., less than about 1 nM).
- GLP1R cAMP
- the peptide-based chemical entities exhibit a value of cAMP (GIPR) EC50 of less than about 100 nm, 50 nM, or 10 nM (e.g., less than about 10 nM).
- GIPR cAMP
- the peptide-based chemical entities inhibit GIP induced cAMP production (GIPR antagonism).
- the compounds described herein exhibit a value of ⁇ -arrestin (GLP1R) EC50>1 ⁇ M.
- the peptide-based chemical entities :
- the featured peptide-based chemical entities include compounds of Formula (IAA), or a pharmaceutically acceptable salt thereof:
- ring A, G, L, W, R 1 , R 2 , R 2′ , and R 4 can be as defined anywhere herein.
- compositions are featured that include a chemical entity described herein (e.g., a compound described generically or specifically herein or a pharmaceutically acceptable salt thereof or compositions containing the same) and one or more pharmaceutically acceptable excipients.
- a chemical entity described herein e.g., a compound described generically or specifically herein or a pharmaceutically acceptable salt thereof or compositions containing the same
- one or more pharmaceutically acceptable excipients e.g., a compound described generically or specifically herein or a pharmaceutically acceptable salt thereof or compositions containing the same.
- methods for modulating e.g., agonizing, partially agonizing, or antagonizing
- GLP-1R and/or GIPR activities include contacting GLP-1R and/or GIPR with a chemical entity described herein (e.g., a compound described generically or specifically herein or a pharmaceutically acceptable salt thereof or compositions containing the same).
- Methods include in vitro methods, e.g., contacting a sample that includes one or more cells, each independently comprising one or more of GLP-1R and/or GIPR with the chemical entity.
- Methods can also include in vivo methods; e.g., administering the chemical entity to a subject (e.g., a human) having a disease, disorder, or condition in which modulation of GLP-1R and/or GIPR signaling is beneficial for the treatment of the underlying pathology and/or symptoms and/or progression of the disease, disorder, or condition (e.g., diabetes; e.g., NASH; e.g., obesity).
- In vivo methods include, but are not limited to modulating (e.g., increasing) insulin levels and modulating (e.g., decreasing) glucose levels in a subject (e.g., a human).
- said methods of modulating are achieved without substantially stimulating Q-arrestin signaling; e.g., without stimulating the recruitment of ⁇ -arrestin to a G-protein coupled receptor (e.g., GLP-1R); e.g., without stimulating the formation of a complex (e.g., a signaling complex) between ⁇ -arrestin and a G-protein coupled receptor (e.g., GLP-1R).
- said methods of modulating are achieved without causing aversion or nausea.
- methods of treatment of a disease, disorder, or condition are featured, in which modulation of GLP-1R and/or GIPR signaling is beneficial for the treatment of the underlying pathology and/or symptoms and/or progression of the disease, disorder, or condition.
- the methods include administering to a subject in need of such treatment an effective amount of a chemical entity described herein (e.g., a compound described generically or specifically herein, a pharmaceutically acceptable salt thereof, or compositions containing the same).
- this disclosure features methods of treating a subject having a disease, disorder, or condition in which modulation of GLP-1R and/or GIPR signaling is beneficial for the treatment of the underlying pathology and/or symptoms and/or progression of the disease, disorder, or condition.
- the methods include administering a chemical entity described herein (e.g., a compound described generically or specifically herein, a pharmaceutically acceptable salt thereof or compositions containing the same) in an amount effective to treat the disease, disorder, or condition.
- methods of treatment include administering to a subject chemical entity described herein (e.g., a compound described generically or specifically herein, a pharmaceutically acceptable salt thereof, or compositions containing the same).
- the methods include administering the chemical entity in an amount effective to treat a disease, disorder, or condition, wherein modulation of GLP-1R and/or GIPR is beneficial for the treatment of the underlying pathology and/or symptoms and/or progression of the disease, disorder, or condition, thereby treating the disease, disorder, or condition.
- methods of treatment can further include:
- Non-limiting examples of such diseases, disorders, and conditions include metabolic syndrome; diabetes (e.g., type 2 diabetes); obesity; obesity-related disorders; impaired glucose tolerance; insulin resistance; non-alcoholic steatohepatitis (NASH); fatty liver disease; steatohepatitis; and other forms of inflammation in metabolically important tissues including, liver, fat, pancreas, kidney, and gut.
- diabetes e.g., type 2 diabetes
- obesity obesity-related disorders
- impaired glucose tolerance e.g., impaired glucose tolerance
- insulin resistance e.g., non-alcoholic steatohepatitis (NASH); fatty liver disease; steatohepatitis; and other forms of inflammation in metabolically important tissues including, liver, fat, pancreas, kidney, and gut.
- NASH non-alcoholic steatohepatitis
- fatty liver disease steatohepatitis
- steatohepatitis steatohepatitis
- other forms of inflammation in metabolically important tissues including,
- neurological disorders include brain insulin resistance, mild cognitive impairment (MCI), Alzheimer's disease (AD), Parkinson's disease (PD), anxiety, dementia (e.g., senile dementia), traumatic brain injury, Huntington's chores, tardive dyskinesia, hyperkinesia, mania, Morbus Parkinson, steel-Richard syndrome, Down's syndrome, myasthenia gravis, nerve trauma, brain trauma, vascular amyloidosis, cerebral hemorrhage I with amyloidosis, brain inflammation, Friedrich's ataxia, acute confusion disorder, amyotrophic lateral sclerosis (ALS), glaucoma, and apoptosis-mediated degenerative diseases of the central nervous system (e.g., Creutzfeldt-Jakob Disease, bovine spongiform encephalopathy (mad cow disease), and chronic wasting syndrome).
- MCI mild cognitive impairment
- AD Alzheimer's disease
- PD Parkinson's disease
- anxiety dementia
- dementia e.g., senile
- Such diseases, disorders, and conditions include bone disorder characterized by altered bone metabolism, such as osteoporosis, including post-menopausal osteoporosis, poor bone strength, osteopenia, Paget's disease, osteolytic metastasis in cancer patients, osteodystrophy in liver disease and the altered bone metabolism caused by renal failure or haemodialysis, bone fracture, bone surgery, aging, pregnancy, protection against bone fractures, and malnutrition.
- bone disorder characterized by altered bone metabolism such as osteoporosis, including post-menopausal osteoporosis, poor bone strength, osteopenia, Paget's disease, osteolytic metastasis in cancer patients, osteodystrophy in liver disease and the altered bone metabolism caused by renal failure or haemodialysis, bone fracture, bone surgery, aging, pregnancy, protection against bone fractures, and malnutrition.
- the disease, disorder, or condition is diabetes.
- the disease, disorder, or condition is NASH.
- the disease, disorder, or condition is obesity.
- the disease, disorder, or condition is Alzheimer's disease (AD) or Parkinson's disease (PD).
- AD Alzheimer's disease
- PD Parkinson's disease
- the disease, disorder, or condition is a bone disorder characterized by altered bone metabolism, such as osteoporosis, including post-menopausal osteoporosis, poor bone strength, osteopenia, Paget's disease, osteolytic metastasis in cancer patients, osteodystrophy in liver disease and the altered bone metabolism caused by renal failure or haemodialysis, bone fracture, bone surgery, aging, or pregnancy.
- bone disorder characterized by altered bone metabolism, such as osteoporosis, including post-menopausal osteoporosis, poor bone strength, osteopenia, Paget's disease, osteolytic metastasis in cancer patients, osteodystrophy in liver disease and the altered bone metabolism caused by renal failure or haemodialysis, bone fracture, bone surgery, aging, or pregnancy.
- the chemical entities described herein are useful for protection against bone fractures.
- the methods described herein can further include treating one or more conditions associated, co-morbid or sequela with any one or more of the conditions described herein.
- the methods can further include treating one or more conditions that are co-morbid or sequela with diabetes (e.g., type 2 diabetes), such as obesity, obesity-related disorders, metabolic syndrome, impaired glucose tolerance; insulin resistance; cardiovascular risk factors.
- diabetes e.g., type 2 diabetes
- cardiovascular risk factors e.g., coronary artery disease, peripheral artery disease, cerebrovascular disease, hypertension, and risk factors related to unmanaged cholesterol and/or lipid levels, and/or inflammation
- retinopathy retinopathy
- nephropathy neuropathy
- NASH bone fracture and cognitive dysfunction.
- this disclosure features methods for screening a candidate compound for treatment of a disease, disorder, or condition, in which modulation of GLP-1R and/or GIPR is beneficial for the treatment of the underlying pathology and/or symptoms and/or progression of the disease, disorder, or condition; the method comprising:
- the methods further include selecting a candidate compound that exhibits a value of ⁇ -arrestin (GLP-1R) EC50>1 ⁇ M.
- GLP-1R ⁇ -arrestin
- the methods can further include identifying the subject.
- the methods can further include administering one or more other therapeutic agents (e.g., in combination with a chemical entity described herein).
- Embodiments can include one of more of the following advantageous properties.
- the compounds described herein exhibit a value of AUC Score of 0-25% of vehicle, which corresponds to a finding of maximal decrease in glucose excursion compared to control.
- the compounds described herein exhibit a value of cAMP (GLP-1R) EC50 of less than about 1 nM, which is indicative that the compound is a relatively potent GLP-1R agonist.
- the compounds described herein exhibit a value of cAMP (GLP-1R) Emax of greater than about 80%, which is indicative that the compound is an agonist that can fully activate GLP-1R.
- the compounds described herein exhibit a value of cAMP (GIPR) EC 50 of less than about 10 nM, which is indicative that the compound is a relatively potent GIPR agonist.
- GIPR cAMP
- the compounds described herein exhibit a value of cAMP (GIPR) EC 50 of less than about 10 nM, which is indicative that the compound is a relatively potent GIPR antagonist.
- GIPR cAMP
- GLP-1 and GIP are susceptible to rapid degradation by dipeptidyl peptidase-IV (DPP-IV) (see, e.g., Deacon, et al. Journal of Clinical Endocrinology & Metabolism, 1995, 80, 952-957).
- DPP-IV dipeptidyl peptidase-IV
- GLP-1 and GIP have been shown to exhibit relatively short half-life times in human due to DPP-IV degradation.
- the compounds described herein exhibit relatively long half-life times in the presence of DPP-IV when compared to those of GLP-1 and GIP.
- the compounds described herein exhibit a value of ⁇ -arrestin coupling (GLP-1R) EC50>1 ⁇ M in a ⁇ -arrestin (GLP1R) assay that measures the formation of a complex between GLP-1R and ⁇ -arrestin in cells.
- GLP-1R ⁇ -arrestin coupling
- GLP1R ⁇ -arrestin coupling
- a value of ⁇ -arrestin (GLP1R) EC50>1 ⁇ M indicates a compound that does not substantially induce ⁇ -arrestin recruitment to GLP-1R.
- CTA conditioned taste aversion
- the conditioned taste aversion assay measures the preference for a dilute saccharin solution that is associated with compound administration.
- the compounds described herein have a reduced likelihood of producing unwanted side effects when administered to a patient.
- a non-limiting example of such a side effect is nausea.
- FIG. 1 depicts representative compounds of Formula (IAA).
- GLP-1R is meant to include, without limitation, nucleic acids, polynucleotides, oligonucleotides, sense and antisense polynucleotide strands, complementary sequences, peptides, polypeptides, proteins, homologous and/or orthologous GLP-1R molecules, isoforms, precursors, mutants, variants, derivatives, splice variants, alleles, different species, and active fragments thereof.
- GIPR is meant to include, without limitation, nucleic acids, polynucleotides, oligonucleotides, sense and antisense polynucleotide strands, complementary sequences, peptides, polypeptides, proteins, homologous and/or orthologous GIPR molecules, isoforms, precursors, mutants, variants, derivatives, splice variants, alleles, different species, and active fragments thereof.
- API refers to an active pharmaceutical ingredient.
- IC50 refers an amount, concentration, or dosage of a compound that is required for 50% inhibition or activation of a maximal response observed for such compound (or that of a reference compound as the case may be) in an assay that measures such response.
- an “effective amount” or “therapeutically effective amount,” as used herein, refer to a sufficient amount of a chemical entity (e.g., a compound described generically or specifically herein, a pharmaceutically acceptable salt thereof, or compositions containing the same) being administered which will relieve to some extent one or more of the symptoms of the disease or condition being treated. The result includes reduction and/or alleviation of the signs, symptoms, or causes of a disease, or any other desired alteration of a biological system.
- an “effective amount” for therapeutic uses is the amount of the composition comprising a compound as disclosed herein required to provide a clinically significant decrease in disease symptoms.
- An appropriate “effective” amount in any individual case is determined using any suitable technique, such as a dose escalation study.
- excipient or “pharmaceutically acceptable excipient” means a pharmaceutically-acceptable material, composition, or vehicle, such as a liquid or solid filler, diluent, carrier, solvent, or encapsulating material.
- each component is “pharmaceutically acceptable” in the sense of being compatible with the other ingredients of a pharmaceutical formulation, and suitable for use in contact with the tissue or organ of humans and animals without excessive toxicity, irritation, allergic response, immunogenicity, or other problems or complications, commensurate with a reasonable benefit/risk ratio.
- pharmaceutically acceptable salt refers to a formulation of a compound that does not cause significant irritation to an organism to which it is administered and does not abrogate the biological activity and properties of the compound.
- pharmaceutically acceptable salts are obtained by reacting a compound described herein, with acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, methanesulfonic acid, ethanesulfonic acid, p-toluenesulfonic acid, salicylic acid and the like.
- pharmaceutically acceptable salts are obtained by reacting a compound having acidic group described herein with a base to form a salt such as an ammonium salt, an alkali metal salt, such as a sodium or a potassium salt, an alkaline earth metal salt, such as a calcium or a magnesium salt, a salt of organic bases such as dicyclohexylamine, N-methyl-D-glucamine, tris(hydroxymethyl)methylamine, and salts with amino acids such as arginine, lysine, and the like, or by other methods previously determined.
- a salt such as an ammonium salt, an alkali metal salt, such as a sodium or a potassium salt, an alkaline earth metal salt, such as a calcium or a magnesium salt, a salt of organic bases such as dicyclohexylamine, N-methyl-D-glucamine, tris(hydroxymethyl)methylamine, and salts with amino acids such as arginine, lysine, and the like, or by other methods previously determined.
- Examples of a salt that the compounds described hereinform with a base include the following: salts thereof with inorganic bases such as sodium, potassium, magnesium, calcium, and aluminum; salts thereof with organic bases such as methylamine, ethylamine and ethanolamine; salts thereof with basic amino acids such as lysine and ornithine; and ammonium salt.
- the salts may be acid addition salts, which are specifically exemplified by acid addition salts with the following: mineral acids such as hydrochloric acid, hydrobromic acid, hydroiodic acid, sulfuric acid, nitric acid, and phosphoric acid:organic acids such as formic acid, acetic acid, propionic acid, oxalic acid, malonic acid, succinic acid, fumaric acid, maleic acid, lactic acid, malic acid, tartaric acid, citric acid, methanesulfonic acid, and ethanesulfonic acid; acidic amino acids such as aspartic acid and glutamic acid.
- mineral acids such as hydrochloric acid, hydrobromic acid, hydroiodic acid, sulfuric acid, nitric acid, and phosphoric acid
- organic acids such as formic acid, acetic acid, propionic acid, oxalic acid, malonic acid, succinic acid, fumaric acid, maleic acid, lactic acid, malic acid, tart
- composition refers to a mixture of a compound described herein with other chemical components (referred to collectively herein as “excipients”), such as carriers, stabilizers, diluents, dispersing agents, suspending agents, and/or thickening agents.
- excipients such as carriers, stabilizers, diluents, dispersing agents, suspending agents, and/or thickening agents.
- the pharmaceutical composition facilitates administration of the compound to an organism. Multiple techniques of administering a compound exist in the art including, but not limited to rectal, oral, intravenous, aerosol, parenteral, ophthalmic, pulmonary, and topical administration.
- subject refers to an animal, including, but not limited to, a primate (e.g., human), monkey, cow, pig, sheep, goat, horse, dog, cat, rabbit, rat, or mouse.
- primate e.g., human
- monkey cow, pig, sheep, goat
- horse dog, cat, rabbit, rat
- patient are used interchangeably herein in reference, for example, to a mammalian subject, such as a human.
- treat in the context of treating a disease, disorder, or condition, are meant to include alleviating or abrogating a disorder, disease, or condition, or one or more of the symptoms associated with the disorder, disease, or condition; or to slowing the progression, spread or worsening of a disease, disorder or condition or of one or more symptoms thereof.
- halo refers to fluoro (F), chloro (Cl), bromo (Br), or iodo (I).
- alkyl refers to a hydrocarbon chain that may be a straight chain or branched chain, containing the indicated number of carbon atoms.
- C 1-10 indicates that the group may have from 1 to 10 (inclusive) carbon atoms in it.
- Non-limiting examples include methyl, ethyl, iso-propyl, tert-butyl, n-hexyl.
- haloalkyl refers to an alkyl, in which one or more hydrogen atoms is/are replaced with an independently selected halo.
- alkoxy refers to an —O-alkyl radical (e.g., —OCH 3 ).
- haloalkoxy refers to an —O-haloalkyl radical (e.g., —OCH 3 ).
- alkylene refers to a branched or unbranched divalent alkyl (e.g., —CH 2 —).
- arylene and the like refer to divalent forms of the ring system, here divalent aryl.
- alkenyl refers to a hydrocarbon chain that may be a straight chain or branched chain having one or more carbon-carbon double bonds.
- the alkenyl moiety contains the indicated number of carbon atoms. For example, C 2-6 indicates that the group may have from 2 to 6 (inclusive) carbon atoms in it.
- alkynyl refers to a hydrocarbon chain that may be a straight chain or branched chain having one or more carbon-carbon triple bonds.
- the alkynyl moiety contains the indicated number of carbon atoms. For example, C 2-6 indicates that the group may have from 2 to 6 (inclusive) carbon atoms in it.
- aryl refers to a 6-carbon monocyclic, 10-carbon bicyclic, or 14-carbon tricyclic aromatic ring system wherein 0, 1, 2, 3, or 4 atoms of each ring may be substituted by a substituent, and wherein the ring comprising a monocyclic radical is aromatic and wherein at least one of the fused rings comprising a bicyclic or tricyclic radical is aromatic e.g. tetrahydronaphthyl. Examples of aryl groups also include phenyl, naphthyl and the like.
- cycloalkyl as used herein includes saturated cyclic hydrocarbon groups having 3 to 10 carbons, preferably 3 to 8 carbons, and more preferably 3 to 6 carbons, wherein the cycloalkyl group may be optionally substituted.
- Preferred cycloalkyl groups include, without limitation, cyclopropyl, cyclobutyl, cyclopentyl, cyclopentenyl, cyclohexyl, cyclohexenyl, cycloheptyl, and cyclooctyl.
- heteroaryl refers to an aromatic 5-8 membered monocyclic, 8-12 membered bicyclic, or 11-14 membered tricyclic ring system having 1-3 heteroatoms if monocyclic, 1-6 heteroatoms if bicyclic, or 1-9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S (e.g., carbon atoms and 1-3, 1-6, or 1-9 heteroatoms of N, O, or S if monocyclic, bicyclic, or tricyclic, respectively), wherein 0, 1, 2, 3, or 4 atoms of each ring may be substituted by a substituent, and wherein the ring comprising a monocyclic radical is aromatic and wherein at least one of the fused rings comprising a bicyclic or tricyclic radical is aromatic (but does not have to be a ring which contains a heteroatom, e.g.
- heteroaryl groups also include pyridyl, furyl or furanyl, imidazolyl, benzimidazolyl, pyrimidinyl, thiophenyl or thienyl, quinolinyl, indolyl, thiazolyl, and the like.
- heterocyclyl refers to a nonaromatic 5-8 membered monocyclic, 8-12 membered bicyclic, or 11-14 membered tricyclic ring system having 1-3 heteroatoms if monocyclic, 1-6 heteroatoms if bicyclic, or 1-9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S (e.g., carbon atoms and 1-3, 1-6, or 1-9 heteroatoms of N, O, or S if monocyclic, bicyclic, or tricyclic, respectively), wherein 0, 1, 2 or 3 atoms of each ring may be substituted by a substituent.
- heterocyclyl groups include piperazinyl, pyrrolidinyl, dioxanyl, morpholinyl, tetrahydrofuranyl, and the like.
- atoms making up the compounds of the present embodiments are intended to include all isotopic forms of such atoms.
- Isotopes include those atoms having the same atomic number but different mass numbers.
- isotopes of hydrogen include tritium and deuterium
- isotopes of carbon include 13 C and 14 C.
- This disclosure features chemical entities (e.g., a compound or a pharmaceutically acceptable salt and/or hydrate and/or prodrug of the compound) that modulate (e.g., agonize or partially agonize or antagonize) glucagon-like peptide-1 receptor (“GLP-1R”) and/or the gastric inhibitory polypeptide receptor (“GIPR”).
- GLP-1R glucagon-like peptide-1 receptor
- GIPR gastric inhibitory polypeptide receptor
- the chemical entities are useful, e.g., for treating a subject (e.g., a human) having a disease, disorder, or condition in which modulation (e.g., agonism, partial agonism or antagonism) of GLP-1R and/or GIPR activities is beneficial for the treatment or prevention of the underlying pathology and/or symptoms and/or progression of the disease, disorder, or condition.
- the modulation results in an enhancement of (e.g., an increase in) existing levels (e.g., normal or below normal levels) of GLP-1R and/or GIPR activity (e.g., signaling).
- the chemical entities described herein further modulate (e.g., attenuate, uncouple) ⁇ -arrestin signaling relative to what is observed with the native ligand.
- This disclosure also features compositions as well as other methods of using and making the said chemical entities.
- the disclosure provides a compound having formula (IAA), or a pharmaceutically acceptable salt thereof:
- R 2′ and R 4 taken together with the atoms connecting them form a ring including from 5-8 ring atoms, wherein from 3-7 are ring carbon atoms each substituted with from 1-2 substituents independently selected from H, halo, hydroxy, oxo, and C 1-3 alkyl; and from 0-1 is a heteroatom (in addition to the N attached to R 1 ) selected from O, —NH, —N(C 1-3 alkyl), and S (e.g., R 4 and R 3 , taken together with the atoms to which each is attached form a ring including 5-8 ring atoms);
- the compound has Formula (IIAA):
- the compound has Formula (IIAA-B):
- the compound has Formula (IA):
- the compound has Formula (IIA):
- the compound has Formula (I):
- one or more of the compound provisions delineated herein apply.
- the compound is other than CAS RN 1401463-49-7; and/or CAS RN 1116465-43-0; and/or CAS RN 1614237-35-2, and/or CAS RN 1614237-36-3; and/or CAS RN 1353718-57-6; and/or CAS Registry Number: 1083307-90-7, in which each of the registered chemical structures is incorporated herein by reference.
- the compound is not any of the compounds disclosed in Nacheva et al., Organic & Biomolecular Chemistry, 2012, 10 (38), 7840-7846, Chopra et al., Bioconjugate Chemistry, 2009, 20 (2), 231-240, and PCT application publication No. WO 2013/148579, each of which is incorporated by reference.
- ring A is other than unsubstituted maleimide-1-yl, i.e.:
- ring A is other than unsubstituted maleimid-1-yl.
- ring A is other than unsubstituted maleimid-1-yl.
- ring A is other than substituted maleimid-1-yl (e.g., other than 3,4-bis(2,4-difluorophenyl)-maleimid-1-yl, i.e.:
- ring A is other than substituted maleimid-1-yl (e.g., other than 3,4-bis(2,4-difluorophenyl)-maleimid-1-yl).
- ring A is other than substituted maleimid-1-yl (e.g., other than 3,4-bis(2,4-difluorophenyl)-maleimid-1-yl).
- ring A is other than optionally substituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl, (e.g., other than unsubstituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl, i.e.:
- ring A is other than optionally substituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl, (e.g., other than unsubstituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl).
- ring A is other than than optionally substituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl, (e.g., unsubstituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl).
- ring A is other than:
- ring A is other than:
- the first three amino acids in W′ must be glycine-threonine-phenylalanine (GTF).
- W′ must include 11 or more amino acids (e.g., 12 or more, 13 or more, 14 or more, 15 or more, 16 or more, 17 or more, 18 or more, 19 or more, 20 or more, 25 or more, 30 or more amino acids).
- 11 or more amino acids e.g., 12 or more, 13 or more, 14 or more, 15 or more, 16 or more, 17 or more, 18 or more, 19 or more, 20 or more, 25 or more, 30 or more amino acids.
- the first three amino acids in W′ must be glycine-threonine-phenylalanine (GTF); and W′ must include 11 or more amino acids (e.g., 12 or more, 13 or more, 14 or more, 15 or more, 16 or more, 17 or more, 18 or more, 19 or more, 20 or more, 25 or more, 30 or more amino acids).
- GTF glycine-threonine-phenylalanine
- Ring A is unsubstituted maleimid-1-yl, and L is —(CH 2 ) 2 —, —(CH 2 ) 5 —C(O)NH—CH 2 —, or —(CH 2 ) 2 —C(O)NH—(CH 2 ) 6 — (optionally, a is 1).
- Ring A is substituted maleimid-1-yl (e.g., 3,4-bis(2,4-difluorophenyl)-maleimid-1-yl), and L is —(CH 2 ) 3 — (optionally, a is 1).
- Ring A is optionally substituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl, (e.g., unsubstituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl) (optionally, a is 0).
- the R b groups are not both o,p-(di-fluoro)phenyl, or ring A is substituted with 2 o,p-(di-fluoro)phenyl groups, the first amino acid in the sequence W′ is not valine, or when ring A is substituted with 2 o,p-(di-fluoro)phenyl groups, L is not (CH 2 ) 3 ; or when L is (CH 2 ) 3 , the first amino acid is the sequence W′ is not valine.
- the first amino acid in the sequence W′ is not alanine.
- G is C(O).
- such compounds can include those having formula (I-A), (I-AA), or (I-AB):
- G is S(O) or SO 2 .
- such compounds can include those having formula (I-B), (I-BA), or (I-BB):
- ring A is a saturated or unsaturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms.
- ring A is saturated. In other embodiments, ring A is unsaturated. In certain of these embodiments, ring A includes 4-7 ring atoms or 5-6 ring atoms.
- ring A is a saturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms.
- ring A is a saturated monocyclic ring that includes from 5-7 ring atoms.
- ring A is a saturated monocyclic ring that includes from 5-6 ring atoms.
- ring A has the following formula (III):
- ring A has formula (III):
- a 1 is other than a bond (i.e., A 1 is C(O), CH 2 , CHR b , or C(R b ) 2 ), and ring A includes 6 ring atoms (i.e., ring A is a 6-membered ring).
- a 1 is CH 2 , CHR b , or C(R b ) 2 .
- a 1 can be CH 2 .
- a 1 is C(O).
- a 2 is CH 2 , CHR b , or C(R b ) 2 .
- a 2 can be CH 2 .
- a 3 is CH 2 , CHR b , or C(R b ) 2 .
- a 3 can be CH 2 .
- a 3 is O; S; SO 2 ; or N(R a ).
- a 4 is CH 2 , CHR b , or C(R b ) 2 .
- a 4 can be CH 2 .
- a 4 is O; S; or N(R a ).
- a 2 , A 3 and A 4 are each independently selected from the group consisting of CH 2 , CHR b , or C(R b ) 2 .
- one or two (e.g., one) of A 2 , A 3 and A 4 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the other(s) is/are CH 2 .
- a 2 , A 3 and A 4 are each CH 2 .
- a 2 and A 4 are each independently selected from the group consisting of CH 2 , CHR b , and C(R b ) 2 ; and A 3 is O; S; SO 2 ; or N(R a ).
- one or two (e.g., one) of A 2 and A 4 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the other (where applicable) is CH 2 .
- a 2 and A 4 are both CH 2 .
- a 3 is N(R a ) (e.g., A 3 can be NH).
- a 3 is O.
- a 3 is SO 2 .
- a 2 and A 3 are each independently selected from the group consisting of CH 2 , CHR b , and C(R b ) 2 ; and A 4 is O; S; or N(R a ).
- one or two (e.g., one) of A 2 and A 3 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the other (where applicable) is CH 2 .
- a 2 and A 3 are both CH 2 .
- a 4 is N(R a ) (e.g., A 4 can be NH).
- a 4 is O.
- a 1 , A 2 , A 3 and A 4 are each independently selected from the group consisting of CH 2 , CHR b , or C(R b ) 2 .
- one or two (e.g., one) of A 1 , A 2 , A 3 and A 4 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the others are CH 2 .
- a 1 , A 2 , A 3 and A 4 are each CH 2 .
- a 1 , A 2 and A 4 are each independently selected from the group consisting of CH 2 , CHR b , and C(R b ) 2 ; and A 3 is O; S; SO 2 ; or N(R a ).
- one or two (e.g., one) of A 2 and A 4 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the other (where applicable) is CH 2 .
- a 2 and A 3 are both CH 2 .
- a 1 is CH 2 .
- a 3 is N(R a ) (e.g., A 3 can be NH).
- a 3 is O.
- a 3 is SO 2 .
- a 1 , A 2 and A 3 are each independently selected from the group consisting of CH 2 , CHR b , and C(R b ) 2 ; and A 4 is O; S; or N(R a ).
- one or two (e.g., one) of A 2 and A 4 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the other (where applicable) is CH 2 .
- a 2 and A 3 are both CH 2 .
- a 1 is CH 2 .
- a 4 is N(R a ) (e.g., A 4 can be NH).
- a 4 is O.
- a 1 is C(O); and A 2 , A 3 and A 4 are each independently selected from the group consisting of CH 2 , CHR b , or C(R b ) 2 .
- one or two (e.g., one) of A 2 , A 3 and A 4 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the other(s) is/are CH 2 .
- a 1 is C(O); and A 2 , A 3 and A 4 are each CH 2 .
- a 1 is C(O);
- a 2 and A 4 are each independently selected from the group consisting of CH 2 , CHR b , and C(R b ) 2 ; and A 3 is O; S; SO 2 ; or N(R a ).
- one or two (e.g., one) of A 2 and A 4 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the other (where applicable) is CH 2 .
- a 2 and A 4 are both CH 2 .
- a 3 is N(R a ) (e.g., A 3 can be NH).
- a 3 is O.
- a 3 is SO 2 .
- a 1 is C(O);
- a 2 and A 3 are each independently selected from the group consisting of CH 2 , CHR b , and C(R b ) 2 ; and
- a 4 is O; S; or N(R a ).
- one or two (e.g., one) of A 2 and A 3 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the other (where applicable) is CH 2 .
- a 2 and A 3 are both CH 2 .
- a 4 is N(R a ) (e.g., A 4 can be NH).
- a 4 is O.
- a 1 is a bond
- ring A includes 5 ring atoms (i.e., ring A is a 5-membered ring)
- ring A has formula (III-A):
- a 2 is C( ⁇ O). In other embodiments, A 2 is CH 2 , CHR b , or C(R b ) 2 ; for example, A 2 can be CH 2 .
- a 3 is O; S; or N(R e ).
- a 3 can be S.
- a 3 can be N(R a ) (e.g., A 3 can be NH).
- a 4 is CH 2 , CHR b , or C(R b ) 2 .
- a 4 can be CHR b or C(R b ) 2 .
- a 4 can be CH 2 .
- a 2 is C( ⁇ O); A 3 is O; S; or N(R e ); and A 4 is CH 2 , CHR b , or C(R b ) 2 .
- a 3 is S.
- a 3 is N(R a ) (e.g., A 3 is NH).
- a 4 is CH 2 .
- a 4 is CHR b or C(R b ) 2 .
- a 2 is C( ⁇ O); and each of A 3 and A 4 is independently selected from CH 2 , CHR b , or C(R b ) 2 .
- each of A 3 and A 4 is CH 2 .
- one of A 3 and A 4 is CH 2
- the other of A 3 and A 4 is CHR b or C(R b ) 2 .
- each of A 3 and A 4 is independently selected from CHR b or C(R b ) 2 .
- a 2 is CH 2 , CHR b , or C(R b ) 2 , e.g., A 2 can be CH 2 ; and each of A 3 and A 4 is independently selected from CH 2 , CHR b , or C(R b ) 2 (e.g., each of A 3 and A 4 is CH 2 ).
- a 1 is A 1A -A 1B .
- each of A 1A and A 1B is independently CH 2 , CHR b , or C(R b ) 2 .
- each of A 1A and A 1B can be independently CH 2 .
- a 2 is CH 2 , CHR b , or C(R b ) 2 .
- a 2 can be CH 2 .
- a 3 is CH 2 , CHR b , or C(R b ) 2 .
- a 3 can be CH 2 .
- a 4 is CH 2 , CHR b , or C(R b ) 2 .
- a 4 is CH 2 .
- each occurrence of R b is independently selected from the group consisting of:
- each occurrence of R b is independently selected from the group consisting of:
- each occurrence of R b is independently selected from the group consisting of: C 1-6 alkyl optionally substituted with from 1-2 independently selected R e ; phenyl optionally substituted with from 1-5 independently selected R c ; —OH; —F; —N(R a )(R′′); and C 1-4 alkoxy.
- Non-limiting examples of ring A moities having formula (III) or (III-A) are delineated in tabular format in Table 1 below.
- ring A is an unsaturated monocyclic ring that includes from 4-8 (e.g., 4-7, 5-6) ring atoms.
- ring A is an unsaturated monocyclic ring that includes from 4-7 ring atoms.
- ring A is an unsaturated monocyclic ring that includes from 5-6 ring atoms.
- ring A is an unsaturated monocyclic ring that includes 6 ring atoms.
- ring A is other than an unsaturated monocyclic ring that includes 5 ring atoms (e.g., other than maleimide, e.g, unsubstituted or di-substituted maleimide).
- ring A has formula (IV):
- ring A has formula (IV):
- a 5 , A 6 , A 7 , and A 8 are each independently selected from CH and CR b .
- one or two of A 5 , A 6 , A 7 , and A 8 are an independently selected CR b , and the others are CH.
- a 5 , A 6 , A 7 , and A 8 are each CH.
- a 5 , A 6 , and A 7 are each independently selected from CH and CR b , and A 8 is N.
- one or two of A 5 , A 6 , and A 7 are an independently selected CR b , and the others are CH.
- a 5 , A 6 , and A 7 are each CH.
- a 5 is N; and each of A 6 , A 7 , and A 8 is independently selected from CH and CR b (e.g., one of A 6 , A 7 , and A 8 is CR b (e.g., C—OH)).
- each occurrence of R b is independently selected from the group consisting of: R 3 ; C 1-4 haloalkyl; —OH; —N(R a )(R′′); C 1-4 alkoxy; and C 1-4 haloalkoxy.
- each occurrence of R b is independently selected from the group consisting of: R 31 ; —OH; —N(R a )(R′′); C 1-4 alkoxy; and C 1-4 haloalkoxy.
- each occurrence of R b is independently selected from the group consisting of:
- ring A has formula (V):
- a 6 and A 7 are each CH. In other formula (IV) embodiments, A 6 and A 7 cannot both be CH.
- one of A 6 and A 7 is CR b , the other of A 6 and A 7 is CH.
- a 6 and A 7 are each an independently selected CR b . In other formula (IV) embodiments, A 6 and A 7 cannot both be an independently selected CR b . In certain of these embodiments, when A 6 and A 7 are each an independently selected CR b , then both R b substituents cannot be C 6-10 aryl (e.g., phenyl) substituted with from 1-5 independently selected R c . As another example, both R b substituents cannot be C 6-10 aryl (e.g., phenyl) substituted with from 1-3 or 1-2 independently selected R c .
- both R b substituents cannot be C 6-10 aryl (e.g., phenyl), substituted with from 1-5 independently halo (e.g., fluoro).
- both R b substituents cannot be C 6-10 aryl (e.g., phenyl), substituted with from 1-3 or 1-2 independently selected halo (e.g., fluoro).
- both R b substituents cannot be difluorophenyl, e.g., o,p-(di-fluoro)phenyl.
- ring A is a saturated or unsaturated bicyclic or tricyclic ring that includes from 7-9 (e.g., 7-8, e.g, 7) ring atoms.
- (A) applies (e.g., three adjacent ring carbon atoms of the divalent group are each independently selected from the group consisting of C, CH, CR b , CH 2 , C(R b )H, C(R b ) 2 and are fused to a second ring).
- ring A has the following formula:
- D is:
- ring A can be:
- ring A is a saturated or unsaturated bicyclic or tricyclic ring that includes from 8-10 ring atoms.
- ring A is saturated. In other embodiments, ring A is unsaturated.
- (A) applies (e.g., two adjacent ring carbon atoms of the divalent group are each independently selected from the group consisting of C, CH, and, CR b and are fused to a second ring).
- (B) applies.
- ring A is an unsaturated bicyclic or tricyclic ring that includes from 8-10 ring atoms. In certain of these embodiments, (A) applies. In certain of these embodiments, ring A is optionally further substituted with 1 oxo.
- (A) applies, ring A is optionally further substituted with 1 oxo, and ring A has formula (VI):
- fused ring B is fused C 6-10 aryl optionally substituted with from 1-5 independently selected R c .
- fused ring B can be fused phenyl optionally substituted with from 1-5 independently selected R c .
- ring A can have formula (VI-A):
- R c′ is H or R c (e.g., C 1-6 alkyl, e.g., CH 3 ).
- ring B is fused C 10 aryl optionally substituted with from 1-5 independently selected R c (e.g., unsubstituted).
- ring B is fused heteroaryl including from 5-10 (e.g., 6) ring atoms, wherein from 1-4 (e.g., 1) ring atoms are each independently selected from the group consisting of N, N(R a ), O, and S, wherein the heteroaryl is optionally substituted with from 1-3 independently selected R c .
- ring A is selected from one of the follows:
- each fused ring B is independently selected from:
- each fused ring B can be independently a fused C 6-10 (e.g., C 6 ) aryl optionally substituted with from 1-5 (e.g., from 1-2) independently selected R c .
- ring A is a saturated bicyclic or tricyclic ring that includes from 8-10 ring atoms. In certain of these embodiments, (A) applies. In other embodiments, (B) applies. In certain of these embodiments, ring A is optionally further substituted with 1 oxo.
- (A) applies, ring A is optionally further substituted with 1 oxo, and ring A has formula (VI):
- fused ring B is fused C 3-10 cycloalkyl optionally substituted with from 1-4 independently selected R d .
- fused ring B can be fused C 3-6 cycloalkyl (e.g., C 3-4 cycloalkyl) optionally substituted with from 1-4 independently selected R d (e.g., R d can be C 1-3 alkyl).
- ring A is optionally further substituted with 1 oxo, and ring A has formula (VII):
- the spiro-fused ring B is spiro-fused C 3-10 cycloalkyl optionally substituted with from 1-4 independently selected R d .
- the spiro-fused ring B is spiro-fused C 3-6 cycloalkyl (e.g., C 3-4 cycloalkyl) optionally substituted with from 1-4 independently selected R d (e.g., R d can be C 1-3 alkyl).
- L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —.
- m is from 2-6 (e.g., m can be 2).
- m is 1.
- X 1 is —N(R′)C(O)— (e.g., X 1 can be —N(H)C(O)—).
- n+p ⁇ 2 In certain embodiments of formula (VIII), n+p ⁇ 2.
- n+p 2
- n+p 0.
- X 2 is: —O—; —S—; or —S(O) t —, wherein t is 1 or 2.
- X 2 can be —S—.
- X 2 is —C(Q 1 )(Q 2 )-.
- each of Q 1 and Q 2 is independently selected from the group consisting of H and C 1-4 alkyl.
- one of Q 1 and Q 2 can be H, and the other of Q 1 and Q 2 can be C 1-4 alkyl (e.g., CH 3 ).
- Q 1 can be H; and Q 2 can be C 1-4 alkyl.
- each of Q 1 and Q 2 can be H.
- each of Q 1 and Q 2 can be an independently selected C 1-4 alkyl.
- Q 1 and Q 2 together with the carbon atom to which each is attached forms C 3-10 cycloalkyl that is optionally substituted with from 1-4 independently selected R d and optionally fused to phenyl.
- Q 1 and Q 2 together with the carbon atom to which each is attached forms C 3-6 cycloalkyl that is optionally substituted with from 1-4 independently selected R d and optionally fused to phenyl.
- Q 1 and Q 2 together with the carbon atom to which each is attached forms C 4-6 (e.g., C 4 ) cycloalkyl that is optionally substituted with from 1-2 independently selected R d .
- X 2 is:
- X 2 can be:
- X 2 can be:
- X 2 is (viii) heterocycloalkylene including from 3-10 ring atoms, wherein from 1-3 ring atoms are each independently selected from the group consisting of N(R a ), O, and S; and which is optionally substituted with from 1-5 independently selected R d .
- X 2 is (viii) heterocycloalkylene including from 4-6 (e.g., 4) ring atoms, wherein from 1-3 (e.g., 1) ring atoms are each independently selected from the group consisting of N(R a ), O, and S; and which is optionally substituted with from 1-5 independently selected R d (e.g., X 2 can be
- L has formula (IX): L has formula (IX): —C(O)—(CH 2 ) n —X 3 —(CH 2 ) p —.
- n+p ⁇ 2.
- n+p 2 (e.g., each of n and p is 1).
- X 3 is —S—.
- n is 2.
- X 1 is —N(R′)C(O)— (e.g., —N(H)C(O)—).
- n+p 2 ⁇ n+p>2.
- n+p 2 (e.g., each of n and p is 1).
- X 2 is —S—.
- m is 2-6 (e.g., 2)
- X 1 is —N(R′)C(O)— (e.g., —N(H)C(O)—)
- n+p >2.
- m is 2-6 (e.g., 2)
- X 1 is —N(R′)C(O)— (e.g., —N(H)C(O)—)
- n+p>2 X 2 is —S—.
- n is 2-6 (e.g., 2)
- X 1 is —N(R′)C(O)— (e.g., —N(H)C(O)—)
- m is 2-6 (e.g., 2)
- X 1 is —N(R′)C(O)— (e.g., —N(H)C(O)—)
- X 2 is —S—.
- L can be —CH 2 CH 2 NHC(O)CH 2 SCH 2 —.
- n is 2.
- X 1 is —N(R′)C(O)— (e.g., —N(H)C(O)—).
- n+p 0.
- X 2 is —C(Q 1 )(Q 2 )-.
- each of Q 1 and Q 2 is H.
- Q 1 is C 1-4 alkyl.
- Q 2 is C 1-4 alkyl.
- each of Q 1 and Q 2 is an independently selected C 1-4 alkyl (e.g., CH 3 ).
- Q 1 and Q 2 together with the carbon atom to which each is attached forms C 3-6 cycloalkyl that is optionally substituted with from 1-4 independently selected R d and optionally fused to phenyl.
- X 2 is:
- X 2 is (viii) heterocycloalkylene including from 4-6 (e.g., 4) ring atoms, wherein from 1-3 (e.g., 1) ring atoms are each independently selected from the group consisting of N(R a ), O, and S; and which is optionally substituted with from 1-5 independently selected R d (e.g., X 2 can be
- m is 2-6 (e.g., 2)
- X 1 is —N(R′)C(O)— (e.g., —N(H)C(O)—)
- n+p 0.
- m is 2-6 (e.g., 2)
- X 1 is —N(R′)C(O)— (e.g., —N(H)C(O)—)
- n+p 0
- X 2 is —C(Q 1 )(Q 2 )-
- Q 1 and Q 2 together with the carbon atom to which each is attached forms C 3-6 cycloalkyl that is optionally substituted with from 1-4 independently selected R d and optionally fused to phenyl.
- m is 2-6 (e.g., 2)
- X 1 is —N(R′)C(O)— (e.g., —N(H)C(O)—)
- n+p 0
- X 2 is —C(Q 1 )(Q 2 )-
- Q 1 and Q 2 is an independently selected C 1-4 alkyl (e.g., CH 3 ).
- m is 2-6 (e.g., 2)
- X 1 is —N(R′)C(O)— (e.g., —N(H)C(O)—)
- n+p 0
- X 2 is: (v) C 6-10 arylene (e.g., phenylene) optionally substituted with from 1-5 independently selected R e ; or (vii) C 3-10 cycloalkylene optionally substituted with from 1-4 independently selected R d .
- n+p 2 (e.g., each of n and p is 1), and X 3 is —S—.
- n+p 2.
- X 2 is —S—.
- X 2 is C(Q 1 )(Q 2 ).
- each of Q 1 and Q 2 is H.
- each of Q 1 and Q 2 is C 1-4 alkyl.
- Q 1 is H; and Q 2 is C 1-4 alkyl.
- R 1 is H. In some embodiments, R 2 is H. In some embodiments, R 4 is H.
- two of R 1 , R 2 , and R 4 are H.
- each of R 1 , R 2 , and R 4 is H.
- R 2 is unsubstituted C 1-3 alkyl (e.g., methyl).
- R 1 and R 4 is H.
- R 2′ is as defined according to (AA).
- a′ is 1.
- each of R 3a and R 3A is H.
- each of R 3a and R 3b is C 1-3 alkyl (e.g., methyl).
- a′ is 0.
- R 3 is —C(O)OH.
- R 3 is a carboxylic acid isostere.
- carboxylic acid isosteres include noncarbon acyclic acids such as phosphonic/phosphinic and sulfonic/sulfinic acids and sulfonamides; modified carbon-based acids such as hydroxamic acids, hydroxamic esters, acylureas, acyl sulfonamides, and sulfonyl ureas; optionally substituted heteroaryl and heterocyclyl-based isosteres, such as those based on optionally substituted tetrazole, oxadiazol-5(4H)-thione, thiadiazol-5(4H)-one, oxathiadiazole and oxidized forms thereof, isoxazole, thiazolidinedione, oxazolidinedione, tetramic acid, and derivatives thereof, and
- R 3 is an amide. In certain embodiments, R 3 is an optionally substituted tetrazolyl (e.g., unsubstituted tetrazolyl). In certain embodiments, R 3 is an optionally substituted isoxazolyl (e.g., isoxazolyl substituted with hydroxy (e.g.,
- W is a peptide having the formula W′—R 5 , wherein W′ is a sequence of from 5-60 amino acids, and R 5 is a C-terminal amino acid, amino acid ester, or amino acid amide that is optionally substituted with from 1-2 modifying groups (e.g., 1-2 groups selected from an acyl group and a PEG group).
- 1-2 modifying groups e.g., 1-2 groups selected from an acyl group and a PEG group.
- peptide refers to a chain of amino acid monomers (sometimes termed “residues”) linked by peptide (amide) bonds (or an isosteric replacement thereof), which have an N-terminal (N—R 4 in formulae (IAA), (IA), or (I)) and a C-terminal amino acid residue (R 5 ) at each of the ends of the peptide.
- the term peptide also includes modified peptides, including, e.g., any one or more of the modifications described herein.
- W includes one or more naturally occurring amino acids found, e.g., in polypeptides and/or proteins produced by living organisms, such as Ala (A), Val (V), Leu (L), Ile (I), Pro (P), Phe (F), Trp (W), Met (M), Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gln (Q), Asp (D), Glu (E), Lys (K), Arg (R), and His (H).
- Naturally occurring amino acids found e.g., in polypeptides and/or proteins produced by living organisms, such as Ala (A), Val (V), Leu (L), Ile (I), Pro (P), Phe (F), Trp (W), Met (M), Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gln (Q), Asp (D), Glu (E), Lys (K), Arg (R), and His (
- W includes one or more independently selected modifications that occur present in so-called modified peptides.
- modifications include, but not limited to: (i) the incorporation of lactam-bridge; (ii) head-to-tail cyclization; (iii) one or more alternative or non-naturally occurring (D or L) amino acids, such as synthetic non-native amino acids, substituted amino acids, and D-amino acids; (iv) peptide bond replacements; (v) targeting groups; and the like.
- W includes one modification in either the W′ or R 5 component.
- W includes more than one independently selected modification (e.g., 2 independently selected modifications, 3 independently selected modifications, 4 independently selected modifications, 5 independently selected modifications, 6 independently selected modifications, 7 independently selected modifications, 8 independently selected modifications, 9 independently selected modifications, or 10 independently selected modifications that occur in the W′ and/or R 5 component (e.g., in the W′ component only; or in the R 5 component only; or in both the W′ and R 5 components).
- independently selected modification e.g., 2 independently selected modifications, 3 independently selected modifications, 4 independently selected modifications, 5 independently selected modifications, 6 independently selected modifications, 7 independently selected modifications, 8 independently selected modifications, 9 independently selected modifications, or 10 independently selected modifications that occur in the W′ and/or R 5 component (e.g., in the W′ component only; or in the R 5 component only; or in both the W′ and R 5 components).
- Non-limiting examples of alternative or non-naturally amino acids include, D-amino acids; beta-amino acids; homocysteine, phosphoserine, phosphothreonine, phosphotyrosine, hydroxyproline, gamma-carboxyglutamate; hippuric acid, octahydroindole-2-carboxylic acid, statine, 1,2,3,4,-tetrahydroisoquinoline-3-carboxylic acid, penicillamine (3-mercapto-D-valine), ornithine, citruline, alpha-methyl-alanine, para-benzoylphenylalanine, para-amino phenylalanine, p-fluorophenylalanine, phenylglycine, propargylglycine, sarcosine, and tert-butylglycine), diaminobutyric acid, 7-hydroxy-tetrahydroisoquinoline carboxylic acid, nap
- Non-limiting examples of peptide bond replacements include urea, thiourea, carbamate, sulfonyl urea, trifluoroethylamine, ortho-(aminoalkyl)-phenylacetic acid, para-(aminoalkyl)-phenylacetic acid, meta-(aminoalkyl)-phenylacetic acid, thioamide, tetrazole, boronic ester, olefinic group, and derivatives thereof.
- modifications and/or moieties include PEGylation; glycosylation; HESylation; ELPylation; lipidation; acetylation; amidation; end-capping modifications (e.g., amidation at the C-terminus, introduction of C-terminal alcohol, aldehyde, ester, and thioester moieties); cyano groups; phosphorylation; cyclization, conjugation with targeting moieties and/or agents that increase retention in the body (e.g., agents such as cellulose, fatty acids, polyethylene glycol (PEG) or combinations thereof); incorporation of retro-inverso peptide motif (ie., a peptide with a reversal of the direction of the peptide bond on at least one position);
- retro-inverso peptide motif ie., a peptide with a reversal of the direction of the peptide bond on at least one position
- W includes only naturally occurring amino acids. In other embodiments, W includes only alternative or non-naturally occurring amino acids. In still other embodiments, W includes one or more naturally occurring amino acids and one or more alternative or non-naturally occurring amino acids. In certain of the foregoing embodiments, W includes only L amino acids; or W includes both D and L amino acids; or W includes only D amino acids. While not wishing to be bound by theory, it is believed that the incorporation of D amino acids can confer enhanced in vivo or intracellular stability to the compounds described herein.
- W includes amino acid residues each of Formula XAA:
- R aa1 and R aa2 are independently selected from:
- W includes 25-45 amino acid residues of Formula XAA, wherein R aa2 is H; or a C-terminal amino acid or an amino acid ester or an amino acid amide thereof.
- R aa1 is selected from the group consisting of:
- W can include from 25-45 naturally occurring amino acids found, e.g., in polypeptides and/or proteins produced by living organisms, such as Ala (A), Val (V), Leu (L), Ile (I), Pro (P), Phe (F), Trp (W), Met (M), Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gln (Q), Asp (D), Glu (E), Lys (K), Arg (R), and His (H); or amino acid ester or amino acid amide thereof.
- W includes from 1-2 (e.g., 1) amino acid residue of Formula XAA, wherein R aa2 is H; R aa1 is: C 1-6 alkyl, which is substituted with from 1-2 (e.g., 1) R ba ; and each occurrence of R ba is independently selected from: —N(R ga )(R ha ) or a C-terminal amino acid or an amino acid ester or an amino acid amide thereof.
- W can include an amino acid residue selected from:
- W includes from 1-2 (e.g., 1) amino acid residue of Formula XAA, wherein R aa2 is C 1-3 alkyl (e.g., methyl); and R aa1 is other than H; or a C-terminal amino acid or an amino acid ester or an amino acid amide thereof.
- Non-limiting examples include:
- W′ is a sequence of from 20-60 (e.g., 20-55, 20-50, 20-45, 20-40, 20-30, 20-35) amino acids.
- W′ is a sequence of from 30-60 (e.g., 30-55, 30-50, 30-45, 30-40) amino acids. In certain embodiments, W′ is a sequence of from 25-45 (e.g., 30-45) amino acids. In certain embodiments, W′ is a sequence of from 30-50 amino acids. For example, W′ can be a sequence of from 30-45 amino acids or from 30-40 amino acids. In certain embodiments, W′ can be a sequence of 34, 35, 36, 37, 38, or 39 amino acids; e.g., 36 or 37 amino acids; e.g., 36 amino acids. In certain embodiments, W′ can be a sequence of 25-28 amino acids; e.g., 26 or 27 amino acids.
- R 5 is a C-terminal amino acid amide that is optionally substituted with from 1-2 modifying groups. In other embodiments, R 5 is a C-terminal amino acid that is optionally substituted with from 1-2 modifying groups.
- R 5 is a C-terminal lysyl residue, e.g., a lysyl amide residue that is optionally substituted with from 1-2 modifying groups.
- R 5 can be a C-terminal L-lysyl amide residue that is optionally substituted with from 1-2 modifying groups.
- R 5 has formula (XI):
- R* is H.
- the modifying group is an acyl group.
- the acyl group can be a C 2-30 (e.g., C 2-20 , C 2-10 , C 2-6 ) acyl group that is optionally substituted with from 1-2 independently selected R.
- R f is selected from the group consisting of —C( ⁇ O)(OH); —C( ⁇ O)(C 2-20 alkyl); —C( ⁇ O)O(C 2-20 alkyl); and —S(O) 1-2 (C 1-6 alkyl); oxo; F; C 1-10 alkoxy; C 1-10 haloalkoxy; and —N(R g )(R h ).
- R g and R h are independently selected from the group consisting of H; C 1-4 alkyl; —C( ⁇ O)(C 2-20 alkyl); —C( ⁇ O)O(C 2-20 alkyl); and —S(O) 1-2 (C 1-6 alkyl).
- the modifying group (e.g., R*) is a C 2-30 (e.g., C 2-20 , C 2-10 , C 2-6 ) acyl group that is substituted with 1-2 (e.g., 2) independently selected R.
- each occurrence of R f can independently selected from the group consisting of —C( ⁇ O)(OH) and —N(R g )(R h ); e.g., in which one of R g and R h is independently selected from the group consisting of —C( ⁇ O)(C 2-20 alkyl); —C( ⁇ O)O(C 2-20 alkyl); and —S(O) 1-2 (C 1-6 alkyl), e.g., —C( ⁇ O)(C 2-20 alkyl).
- the modifying group e.g., R*
- R* can be:
- R* can be:
- R 5 is a C-terminal amino acid that is optionally substituted with from 1-2 modifying groups (e.g., 1-2 groups selected from an acyl group and a PEG group).
- 1-2 modifying groups e.g., 1-2 groups selected from an acyl group and a PEG group.
- R 5 is a C-terminal lysine that is optionally substituted with from 1-2 modifying groups (e.g., 1-2 groups selected from an acyl group and a PEG group).
- R 5 can be a C-terminal L-lysine that is optionally substituted with from 1-2 modifying groups (e.g., 1-2 groups selected from an acyl group and a PEG group).
- R 5 has formula (XI-OH):
- R* is H.
- the modifying group is an acyl group.
- the acyl group can be a C 2-30 (e.g., C 2-20 , C 2-10 , C 2-6 ) acyl group that is optionally substituted with from 1-2 independently selected R.
- Each occurrence of R is selected from the group consisting of —C( ⁇ O)(OH); —C( ⁇ O)(C 2-20 alkyl); —C( ⁇ O)O(C 2-20 alkyl); and —S(O) 1-2 (C 1-6 alkyl); oxo; F; C 1-10 alkoxy; C 1-10 haloalkoxy; and —N(R g )(R h ).
- R g and R h are independently selected from the group consisting of H; C 1-4 alkyl; —C( ⁇ O)(C 2-20 alkyl); —C( ⁇ O)O(C 2-20 alkyl); and —S(O) 1-2 (C 1-6 alkyl).
- the modifying group (e.g., R*) is a C 2-30 (e.g., C 2-20 , C 2-10 , C 2-6 ) acyl group that is substituted with 1-2 (e.g., 2) independently selected R.
- each occurrence of R can independently selected from the group consisting of —C( ⁇ O)(OH) and —N(R g )(R h ); e.g., in which one of R g and R h is independently selected from the group consisting of —C( ⁇ O)(C 2-20 alkyl); —C( ⁇ O)O(C 2-20 alkyl); and —S(O) 1-2 (C 1-6 alkyl), e.g., —C( ⁇ O)(C 2-20 alkyl).
- the modifying group e.g., R*
- R* can be:
- R* can be:
- acyl modifying groups are delineated, e.g., in Table 2.
- the modifying group is PEG.
- polyethylene glycol or “PEG”, refers to mixtures of condensation polymers of ethylene oxide and water, in a branched or straight chain, represented by the general formula H(OCH 2 CH 2 ) n OH, wherein n is at least 9. Absent any further characterization, the term is intended to include polymers of ethylene glycol with an average total molecular weight selected from the range of 5,000 to 40,000 Daltons. “Polyethylene glycol” or “PEG” is used in combination with a numeric suffix to indicate the approximate average molecular weight thereof. For example, PEG-5,000 refers to polyethylene glycol having a total molecular weight average of about 5,000.
- PEGylated refers to a compound that has been modified from its native state by linking a PEG chain to the peptide.
- a “PEGylated peptide” is a peptide that has a PEG chain covalently attached to the peptide itself.
- R 5 is a C-terminal amino acid selected from serine, glycine, and arginine.
- R 5 is a C-terminal amino acid amide selected from serinyl amide, glycyl amide, and argininyl amide.
- R 5 is a C-terminal glycyl residue (e.g., C-terminal glycine or C-terminal glycyl amide).
- R 5 is a C-terminal argininyl residue (e.g., C-terminal arginine or C-terminal argininyl amide).
- R 5 is a C-terminal serinyl residue (e.g., C-terminal serine or C-terminal serinyl amide).
- the amino acid sequence present in W is, or includes, the sequence that is present in native GLP-1-OH or GLP-1-NH 2 . In other embodiments, the amino acid sequence present in W is, or includes, the sequence that is present in native GIP. In still other embodiments, the amino acid sequence present in W is, or includes, a hybrid sequence having one or more fragments (e.g., functional fragments) present in native GLP-1-OH or GLP-1-NH 2 and one or more fragments (e.g., functional fragments) present in native GIP.
- one or more fragments e.g., functional fragments
- W is, or includes, a conservatively substituted variation of the foregoing, meaning that one or more amino acid residues of an original peptide are replaced by different residues, and that the conservatively substituted peptide retains a desired biological activity.
- conservative substitutions include substitution of amino acids that tend not alter the secondary and/or tertiary structure of the compounds described herein, substitutions that do not change the overall or local hydrophobic character, substitutions that do not change the overall or local charge, substitutions by residues of equivalent side chain size, or substitutions by side chains with similar reactive groups.
- a given amino acid can be replaced by a residue having similar physiochemical characteristics, e.g., substituting one aliphatic residue for another (such as Ile, Val, Leu, or Ala for one another), or substitution of one polar residue for another (such as between Lys and Arg; Glu and Asp; or Gln and Asn).
- substituting one aliphatic residue for another such as Ile, Val, Leu, or Ala for one another
- substitution of one polar residue for another such as between Lys and Arg; Glu and Asp; or Gln and Asn.
- Other such conservative substitutions e.g., substitutions of entire regions having similar hydrophobicity characteristics or substitutions of residues with similar side chain volume are also within the scope of this disclosure.
- Amino acids can be grouped according to similarities in the properties of their side chains (in A. L. Lehninger, in Biochemistry, second ed., pp. 73-75, Worth Publishers, New York (1975)): (1) non-polar: Ala (A), Val (V), Leu (L), Ile (I), Pro (P), Phe (F), Trp (W), Met (M); (2) uncharged polar: Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gln (Q); (3) acidic: Asp (D), Glu (E); (4) basic: Lys (K), Arg (R), His (H).
- Naturally occurring residues can be divided into groups based on common side-chain properties: (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile, Phe, Trp; (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln, Ala, Tyr, His, Pro, Gly; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; (6) aromatic: Trp, Tyr, Phe, Pro, His, or hydroxyproline.
- Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
- conservative substitutions for use in the variants described herein are as follows: Ala into Gly or into Ser; Arg into Lys; Asn into Gln or into His; Asp into Glu or into Asn; Cys into Ser; Gln into Asn; Glu into Asp; Gly into Ala or into Pro; His into Asn or into Gln; Ile into Leu or into Val; Leu into Ile or into Val; Lys into Arg, into Gln or into Glu; Met into Leu, into Tyr or into Ile; Phe into Met, into Leu or into Tyr; Ser into Thr; Thr into Ser; Trp into Tyr or into Phe; Tyr into Phe or into Trp; and/or Phe into Val, into Tyr, into Ile or into Leu.
- conservative substitutions encompass residue exchanges with those of similar physicochemical properties (i.e. substitution of a hydrophobic residue for another hydrophobic amino acid).
- the amino acid sequence present in W is, or includes, or is based upon a sequence that is present in a peptide having at least 0.01% of the GLP-1 receptor activation activity of the native GLP-1, such as at least 0.1%, 0.2%, 0.5%, 0.8%, 1%, 3%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99% of the GLP-1 receptor activation activity of the native GLP-1-OH or GLP-1-NH 2 and/or at least 0.01% of the GIP receptor activation activity of GIP, such as at least 0.1%, 0.2%, 0.5%, 0.8%, 1%, 3%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99% of the GIP receptor activation activity of the native GIP.
- GLP-1 refers to a peptide comprising the sequence of human GLP-1 (7-36, or 7-37), and term “native GIP” refers to a peptide comprising the sequence of human GIP (1-42).
- GLP-1 or “GIP” in the absence of any further designation is intended to mean native GLP-1 or native GIP, respectively.
- W has formula (X): -GTF-W′′—R 5 , wherein W′′ is a sequence of 30-40 (e.g., 31-36, 33) amino acids.
- W has formula (XII):
- W has formula (XII—OH):
- W has formula (XIII):
- W has formula (XIV-AA): GT(Xaa3)(Xaa4)SD(Xaa7)S(Xaa9)(Xaa10)(Xaa11)(Xaa12)(Xaa13)(Xaa14)(X aa15)(Xaa16)(Xaa17)(Xaa18)(Xaa19)(Xaa20)(Xaa21)WL(Xaa24)(Xaa25)(Xaa26)GP SSGAPPP(Xaa36)-R 5 (SEQ ID NO: 2A which is listed as SEQ ID NO: 35 in sequence listing);
- W has formula (XIV-AA):
- W has formula (XIV-A):
- W has formula (XIV-B):
- (Aib) refers to 2-aminoisobutyric acid (also known as ⁇ -aminoisobutyric acid or ⁇ -methylalanine or 2-methylalanine).
- Y* refers to 2-amino-3-(4-hydroxyphenyl)-2-methylpropanoic acid (e.g., (S)-2-amino-3-(4-hydroxyphenyl)-2-methylpropanoic acid).
- L* refers to 2-amino-2-methylpentanoic acid (e.g., (S)-2-amino-2-methylpentanoic acid).
- K* is a lysine residue substituted with a modifying group, or a C-terminal amino acid or an amino acid ester or amino acid amide thereof.
- Non-limiting examples of K* can include an amino acid residue selected from:
- W is represented by formula (X), (XII), (XIII), (XIV-AA), (XIV), (XIV-A), (XIV-B), (XV), or any of SEQ ID 1-34.
- W can have any of the sequences delineated in Table 2.
- W is represented by any one of SEQ ID 1-34 (e.g., SEQ. ID 5-27; e.g., SEQ ID 5-29; (e.g., SEQ ID 6); e.g., SEQ ID 28-29; e.g., SEQ ID 30-34).
- SEQ ID 1-34 e.g., SEQ. ID 5-27; e.g., SEQ ID 5-29; (e.g., SEQ ID 6); e.g., SEQ ID 28-29; e.g., SEQ ID 30-34.
- W is represented by any one of SEQ ID 1-27 (e.g., SEQ. ID 5-27; e.g., SEQ ID 6).
- W is represented by any one of SEQ ID 28-29 (e.g., 28, 29).
- W has the sequence of SEQ ID 6.
- the compound has formula (I-A), (I-AA, or (I-AB), ring A is a saturated or unsaturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms, and L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —.
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), and R 3 is —C(O)OH.
- the compound has formula (IA-A), (IA-AA), or (IA-AB), ring A is a saturated or unsaturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms, and L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —.
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), and R 3 is —C(O)OH. In certain embodiments, a′ is 1; each of R 3a and R 3A is H.
- the compound has formula (I-A), (I-AA), or (I-AB), (I-A), (I-AA), or (I-AB), ring A is a saturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms, and L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —.
- one, two, or three of R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), and R 3 is —C(O)OH.
- the compound has formula (IA-A), (IA-AA), or (IA-AB), (IA-B), (IA-BA, or (IA-BB), ring A is a saturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms, and L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —.
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), and R 3 is —C(O)OH.
- a′ is 1; each of R 3a and R 3b is H.
- the compound has formula (I-A), (I-AA), or (I-AB), ring A is a saturated, monocyclic, 6-membered ring having formula (III) (i.e., A 1 is not a bond), and L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —.
- one, two, or three of R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), and R 3 is —C(O)OH.
- the compound has formula (IA-A), (IA-AA), or (IA-AB), ring A is a saturated, monocyclic, 6-membered ring having formula (III) (i.e., A 1 is not a bond), and L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —.
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), and R 3 is —C(O)OH. In certain embodiments, a′ is 1; each of R 3a and R 3A is H.
- the compound has formula (I-A), (I-AA), or (I-AB), ring A is a saturated, monocyclic, 5-membered ring having formula (III-A) (i.e., A 1 in formula (III) is a bond), and L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —.
- one, two, or three of R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), and R 3 is —C(O)OH.
- the compound has formula (IA-A), (IA-AA), or (IA-AB), ring A is a saturated, monocyclic, 5-membered ring having formula (III-A) (i.e., A 1 in formula (III) is a bond), and L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —.
- one, two, or three of R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), and R 3 is —C(O)OH. In certain embodiments, a′ is 1; each of R 3a and R 3b is H.
- the compound has formula (I-A), (I-AA), or (I-AB), ring A is a saturated or unsaturated bicyclic or tricyclic ring that includes from 6-14 (e.g., 8-10) ring atoms, and L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —.
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), and R 3 is —C(O)OH.
- the compound has formula (IA-A), (IA-AA), or (IA-AB), ring A is a saturated or unsaturated bicyclic or tricyclic ring that includes from 6-14 (e.g., 8-10) ring atoms, and L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —.
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), and R 3 is —C(O)OH. In certain embodiments, a′ is 1; each of R 3a and R 3b is H.
- the compound has formula (I-A), (I-AA), or (I-AB), ring A is a saturated or unsaturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms, L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —, and W is represented by formula (X), (XII), (XIII), (XIV), (XIV-A), (XIV-B), or any of SEQ ID 1-27 (e.g., SEQ ID 5-27, e.g., SEQ ID 6).
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- R 5 has formula (XI).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), R 3 is —C(O)OH, and R 5 has formula (XI).
- the compound has formula (IA-A), (IA-AA), or (IA-AB), ring A is a saturated or unsaturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms, L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —, and W is represented by formula (X), (XII), (XIII), (XIV-AA), (XIV), (XIV-A), (XIV-B), (XV), or any of SEQ ID 1-34 (e.g., SEQ ID 5-27; e.g., SEQ ID 5-29; (e.g., SEQ ID 6); e.g., SEQ ID 28-29; e.g., SEQ ID 30-34).
- SEQ ID 1-34 e.g., SEQ ID 5-27; e.g., SEQ ID 5-29; (
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- R 5 has formula (XI).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), R 3 is —C(O)OH, and R 5 has formula (XI).
- a′ is 1; each of R 3a and R 3b is H.
- the compound has formula (I-A), (I-AA), or (I-AB), ring A is a saturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms, L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —, and W is represented by (X), (XII), (XIII), (XIV), (XIV-A), (XIV-B), or any of SEQ ID 1-27 (e.g., SEQ ID 5-27, e.g., SEQ ID 6).
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- R 5 has formula (XI).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), R 3 is —C(O)OH, and R 5 has formula (XI).
- the compound has formula (I-A), (I-AA), or (I-AB), ring A is a saturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms, L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —, and W is represented by formula (X), (XII), (XIII), (XIV-AA), (XIV), (XIV-A), (XIV-B), (XV), or any of SEQ ID 1-34 (e.g., SEQ.
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- R 5 has formula (XI).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), R 3 is —C(O)OH, and R 5 has formula (XI).
- a′ is 1; each of R 3a and R 3b is H.
- the compound has formula (I-A), (I-AA), or (I-AB), ring A is a saturated, monocyclic, 6-membered ring having formula (III) (i.e., A 1 is not a bond), L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —, and W is represented by formula (X), (XII), (XIII), (XIV), (XIV-A), (XIV-B), or any of SEQ ID 1-27 (e.g., SEQ ID 5-27, e.g., SEQ ID 6).
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- R 5 has formula (XI).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), R 3 is —C(O)OH, and R 5 has formula (XI).
- the compound has formula (IA-A), (IA-AA), or (IA-AB), ring A is a saturated, monocyclic, 6-membered ring having formula (III) (i.e., A 1 is not a bond), L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —, and W is represented by formula (X), (XII), (XIII), (XIV-AA), (XIV), (XIV-A), (XIV-B), (XV), or any of SEQ ID 1-34 (e.g., SEQ.
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- R 5 has formula (XI).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), R 3 is —C(O)OH, and R 5 has formula (XI).
- a′ is 1; each of R 3a and R 3A is H.
- the compound has formula (I-A), (I-AA), or (I-AB), ring A is a saturated, monocyclic, 5-membered ring having formula (III-A) (i.e., A 1 in formula (III) is a bond), L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —, and W is represented by formula (X), (XII), (XIII), (XIV), (XIV-A), (XIV-B), or any of SEQ ID 1-27 (e.g., SEQ ID 5-27, e.g., SEQ ID 6).
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- R 5 has formula (XI).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), R 3 is —C(O)OH, and R 5 has formula (XI).
- the compound has formula (IA-A), (IA-AA), or (IA-AB), ring A is a saturated, monocyclic, 5-membered ring having formula (III-A) (i.e., A 1 in formula (III) is a bond), L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —, and W is represented by formula (X), (XII), (XIII), (XIV-AA), (XIV), (XIV-A), (XIV-B), (XV), or any of SEQ ID 1-34 (e.g., SEQ.
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- R 5 has formula (XI).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), R 3 is —C(O)OH, and R 5 has formula (XI).
- a′ is 1; each of R 3a and R 3b is H.
- the compound has formula (I-A), (I-AA), or (I-AB), ring A is a saturated or unsaturated bicyclic or tricyclic ring that includes from 6-14 (e.g., 8-10) ring atoms, L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —, and W is represented by formula (X), (XII), (XIII), (XIV), (XIV-A), (XIV-B), or any of SEQ ID 1-27 (e.g., SEQ ID 5-27, e.g., SEQ ID 6).
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- R 5 has formula (XI).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), R 3 is —C(O)OH, and R 5 has formula (XI).
- the compound has formula (IA-A), (IA-AA), or (IA-AB), ring A is a saturated or unsaturated bicyclic or tricyclic ring that includes from 6-14 (e.g., 8-10) ring atoms, L has formula (VIII): —(CH 2 ) m —X 1 —(CH 2 ) n —X 2 —(CH 2 ) p —, and W is represented by formula (X), (XII), (XIII), (XIV-AA), (XIV), (XIV-A), (XIV-B), (XV), or any of SEQ ID 1-34 (e.g., SEQ.
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- R 5 has formula (XI).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), R 3 is —C(O)OH, and R 5 has formula (XI).
- a′ is 1; each of R 3a and R 3b is H.
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- R 5 has formula (XI).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), R 3 is —C(O)OH, and R 5 has formula (XI).
- m is 2-6 (e.g., 2)
- X 1 is —N(R′)C(O)— (e.g., —N(H)C(O)—)
- X 2 is —S—.
- L can be —CH 2 CH 2 NHC(O)CH 2 SCH 2 —.
- any one of SEQ ID 5-27 (e.g., SEQ ID 6) represents W.
- m is 2-6 (e.g., 2)
- X 1 is —N(R′)C(O)— (e.g., —N(H)C(O)—)
- X 2 is —S—; or
- m is 2-6 (e.g., 2)
- X 2 is: heterocycloalkylene including from 4-6 (e.g., 4) ring atoms, wherein from 1-3 (e.g., 1) ring atoms are each independently selected from the group consisting of N(R a ), O, and S; and which is optionally substituted with from 1-5 independently selected R d (e.g., X 2 can be
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- R 5 has formula (XI).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), R 3 is —C(O)OH, and R 5 has formula (XI).
- a′ is 1; each of R 3a and R 3b is H.
- m is 2-6 (e.g., 2)
- X 1 is —N(R′)C(O)— (e.g., —N(H)C(O)—)
- X 2 is —S—.
- L can be —CH 2 CH 2 NHC(O)CH 2 SCH 2 —.
- any one of SEQ ID 5-34 (e.g., SEQ ID 6) represents W.
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- R 5 has formula (XI).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), R 3 is —C(O)OH, and R 5 has formula (XI).
- m is 2-6 (e.g., 2)
- X 1 is —N(R′)C(O)— (e.g., —N(H)C(O)—)
- X 2 is —S—.
- L can be —CH 2 CH 2 NHC(O)CH 2 SCH 2 —.
- any one of SEQ ID 5-27 (e.g., SEQ ID 6) represents W.
- a 1 , A 2 , A 3 and A 4 are each independently selected from the group consisting of CH 2 , CHR b , or C(R b ) 2 .
- one or two (e.g., one) of A 1 , A 2 , A 3 and A 4 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the others are CH 2 .
- a 1 , A 2 , A 3 and A 4 are each CH 2 .
- a 1 , A 2 and A 4 are each independently selected from the group consisting of CH 2 , CHR b , and C(R b ) 2 ; and A 3 is O; S; SO 2 ; or N(R a ).
- one or two (e.g., one) of A 2 and A 4 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the other (where applicable) is CH 2 .
- a 2 and A 3 are both CH 2 .
- a 1 is CH 2 .
- a 3 is N(R a ) (e.g., A 3 can be NH).
- a 3 is O.
- a 3 is SO 2 .
- a 1 , A 2 and A 3 are each independently selected from the group consisting of CH 2 , CHR b , and C(R b ) 2 ; and A 4 is O; S; or N(R a ).
- one or two (e.g., one) of A 2 and A 4 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the other (where applicable) is CH 2 .
- a 2 and A 3 are both CH 2 .
- a 1 is CH 2 .
- a 4 is N(R a ) (e.g., A 4 can be NH).
- a 4 is O.
- a 1 is C(O); and A 2 , A 3 and A 4 are each independently selected from the group consisting of CH 2 , CHR b , or C(R b ) 2 .
- one or two (e.g., one) of A 2 , A 3 and A 4 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the other(s) is/are CH 2 .
- a 1 is C(O); and A 2 , A 3 and A 4 are each CH 2 .
- a 1 is C(O);
- a 2 and A 4 are each independently selected from the group consisting of CH 2 , CHR b , and C(R b ) 2 ; and A 3 is O; S; SO 2 ; or N(R a ).
- one or two (e.g., one) of A 2 and A 4 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the other (where applicable) is CH 2 .
- a 2 and A 4 are both CH 2 .
- a 3 is N(R a ) (e.g., A 3 can be NH).
- a 3 is O.
- a 3 is SO 2 .
- a 1 is C(O);
- a 2 and A 3 are each independently selected from the group consisting of CH 2 , CHR b , and C(R b ) 2 ; and
- a 4 is O; S; or N(R a ).
- one or two (e.g., one) of A 2 and A 3 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the other (where applicable) is CH 2 .
- a 2 and A 3 are both CH 2 .
- a 4 is N(R a ) (e.g., A 4 can be NH).
- a 4 is O.
- a 1 , A 2 , A 3 and A 4 are each independently selected from the group consisting of CH 2 , CHR b , or C(R b ) 2 .
- m is 2-6 (e.g., 2)
- X 1 is —N(R′)C(O)— (e.g., —N(H)C(O)—)
- X 2 is —S—; or
- m is 2-6 (e.g., 2)
- X 2 is: heterocycloalkylene including from 4-6 (e.g., 4) ring atoms, wherein from 1-3 (e.g., 1) ring atoms are each independently selected from the group consisting of N(R a ), O, and S; and which is optionally substituted with from 1-5 independently selected R d (e.g., X 2 can be
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- R 5 has formula (XI).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), R 3 is —C(O)OH, and R 5 has formula (XI).
- a′ is 1; each of R 3a and R 3b is H.
- m is 2-6 (e.g., 2)
- X 1 is —N(R′)C(O)— (e.g., —N(H)C(O)—)
- X 2 is —S—.
- L can be —CH 2 CH 2 NHC(O)CH 2 SCH 2 —.
- any one of SEQ ID 5-34 (e.g., SEQ ID 6) represents W.
- a 1 , A 2 , A 3 and A 4 are each independently selected from the group consisting of CH 2 , CHR b , or C(R b ) 2 .
- one or two (e.g., one) of A 1 , A 2 , A 3 and A 4 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the others are CH 2 .
- a 1 , A 2 , A 3 and A 4 are each CH 2 .
- a 1 , A 2 and A 4 are each independently selected from the group consisting of CH 2 , CHR b , and C(R b ) 2 ; and A 3 is O; S; SO 2 ; or N(R a ).
- one or two (e.g., one) of A 2 and A 4 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the other (where applicable) is CH 2 .
- a 2 and A 3 are both CH 2 .
- a 1 is CH 2 .
- a 3 is N(R a ) (e.g., A 3 can be NH).
- a 3 is O.
- a 3 is SO 2 .
- a 1 , A 2 and A 3 are each independently selected from the group consisting of CH 2 , CHR b , and C(R b ) 2 ; and A 4 is O; S; or N(R a ).
- one or two (e.g., one) of A 2 and A 4 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the other (where applicable) is CH 2 .
- a 2 and A 3 are both CH 2 .
- a 1 is CH 2 .
- a 4 is N(R a ) (e.g., A 4 can be NH).
- a 4 is O.
- a 1 is C(O); and A 2 , A 3 and A 4 are each independently selected from the group consisting of CH 2 , CHR b , or C(R b ) 2 .
- one or two (e.g., one) of A 2 , A 3 and A 4 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the other(s) is/are CH 2 .
- a 1 is C(O); and A 2 , A 3 and A 4 are each CH 2 .
- a 1 is C(O);
- a 2 and A 4 are each independently selected from the group consisting of CH 2 , CHR b , and C(R b ) 2 ; and A 3 is O; S; SO 2 ; or N(R a ).
- one or two (e.g., one) of A 2 and A 4 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the other (where applicable) is CH 2 .
- a 2 and A 4 are both CH 2 .
- a 3 is N(R a ) (e.g., A 3 can be NH).
- a 3 is O.
- a 3 is SO 2 .
- a 1 is C(O);
- a 2 and A 3 are each independently selected from the group consisting of CH 2 , CHR b , and C(R b ) 2 ; and
- a 4 is O; S; or N(R a ).
- one or two (e.g., one) of A 2 and A 3 are independently selected from the group consisting of CHR b and C(R b ) 2 , and the other (where applicable) is CH 2 .
- a 2 and A 3 are both CH 2 .
- a 4 is N(R a ) (e.g., A 4 can be NH).
- a 4 is O.
- a 1 , A 2 , A 3 and A 4 are each independently selected from the group consisting of CH 2 , CHR b , or C(R b ) 2 .
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- R 5 has formula (XI).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), R 3 is —C(O)OH, and R 5 has formula (XI).
- m is 2-6 (e.g., 2)
- X 1 is —N(R′)C(O)— (e.g., —N(H)C(O)—)
- X 2 is —S—.
- L can be —CH 2 CH 2 NHC(O)CH 2 SCH 2 —.
- any one of SEQ ID 5-27 (e.g., SEQ ID 6) represents W.
- m is 2-6 (e.g., 2)
- X 1 is —N(R′)C(O)— (e.g., —N(H)C(O)—)
- X 2 is —S—; or
- m is 2-6 (e.g., 2)
- X 2 is: heterocycloalkylene including from 4-6 (e.g., 4) ring atoms, wherein from 1-3 (e.g., 1) ring atoms are each independently selected from the group consisting of N(R a ), O, and S; and which is optionally substituted with from 1-5 independently selected R d (e.g., X 2 can be
- R 1 , R 2 , and R 4 are H.
- R 3 is —C(O)OH.
- a is 0, 1, or 2 (e.g., 1).
- R 5 has formula (XI).
- each of R 1 , R 2 , and R 4 is H, a is 0, 1, or 2 (e.g., 1), R 3 is —C(O)OH, and R 5 has formula (XI).
- a′ is 1; each of R 3a and R 3b is H.
- m is 2-6 (e.g., 2)
- X 1 is —N(R′)C(O)— (e.g., —N(H)C(O)—)
- X 2 is —S—.
- L can be —CH 2 CH 2 NHC(O)CH 2 SCH 2 —.
- any one of SEQ ID 5-34 (e.g., SEQ ID 6) represents W.
- Embodiments of combinations [1]-[13] can also include any one or more of the features delineated in the Detailed Descriptions and/or claims.
- Embodiments of combinations [1A]-[13A] can also include any one or more of the features delineated in the Detailed Descriptions and/or claims.
- a chemical entity e.g., a compound or a pharmaceutically acceptable salt and/or hydrate and/or prodrug of the compound
- GLP-1R glucagon-like peptide-1 receptor
- GIPR gastric inhibitory polypeptide receptor
- the chemical entities can be administered in combination with one or more conventional pharmaceutical excipients.
- Pharmaceutically acceptable excipients include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, self-emulsifying drug delivery systems (SEDDS) such as d- ⁇ -tocopherol polyethylene glycol 1000 succinate, surfactants used in pharmaceutical dosage forms such as Tweens, poloxamers or other similar polymeric delivery matrices, serum proteins, such as human serum albumin, buffer substances such as phosphates, tris, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium-chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium, sodium
- Cyclodextrins such as ⁇ -, ⁇ , and ⁇ -cyclodextrin, or chemically modified derivatives such as hydroxyalkylcyclodextrins, including 2- and 3-hydroxypropyl- ⁇ -cyclodextrins, or other solubilized derivatives can also be used to enhance delivery of compounds described herein.
- Dosage forms or compositions containing a chemical entity as described herein in the range of 0.005% to 100% with the balance made up from non-toxic excipient may be prepared.
- the contemplated compositions may contain 0.001%-100% of a chemical entity provided herein, in one embodiment 0.1-95%, in another embodiment 75-85%, in a further embodiment 20-80%.
- Actual methods of preparing such dosage forms are known, or will be apparent, to those skilled in this art; for example, see Remington: The Science and Practice of Pharmacy, 22 nd Edition (Pharmaceutical Press, London, U K. 2012).
- the chemical entities described herein or a pharmaceutical composition thereof can be administered to subject in need thereof by any accepted route of administration.
- Acceptable routes of administration include, but are not limited to, buccal, cutaneous, endocervical, endosinusial, endotracheal, enteral, epidural, interstitial, intra-abdominal, intra-arterial, intrabronchial, intrabursal, intracerebral, intracisternal, intracoronary, intradermal, intraductal, intraduodenal, intradural, intraepidermal, intraesophageal, intragastric, intragingival, intraileal, intralymphatic, intramedullary, intrameningeal, intramuscular, intraovarian, intraperitoneal, intraprostatic, intrapulmonary, intrasinal, intraspinal, intrasynovial, intratesticular, intrathecal, intratubular, intratumoral, intrauterine, intravascular, intravenous, nasal, nasogastric
- compositions can be formulated for parenteral administration, e.g., formulated for injection via the intravenous, intramuscular, sub-cutaneous, or even intraperitoneal routes.
- parenteral administration e.g., formulated for injection via the intravenous, intramuscular, sub-cutaneous, or even intraperitoneal routes.
- such compositions can be prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for use to prepare solutions or suspensions upon the addition of a liquid prior to injection can also be prepared; and the preparations can also be emulsified.
- injectables either as liquid solutions or suspensions
- solid forms suitable for use to prepare solutions or suspensions upon the addition of a liquid prior to injection can also be prepared; and the preparations can also be emulsified.
- the preparation of such formulations will be known to those of skill in the art in light of the present disclosure.
- the pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions; formulations including sesame oil, peanut oil, or aqueous propylene glycol; and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
- the form must be sterile and must be fluid to the extent that it may be easily injected. It also should be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
- the carrier also can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetable oils.
- the proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion, and by the use of surfactants.
- the prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like.
- isotonic agents for example, sugars or sodium chloride.
- Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.
- Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with various of the other ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
- the preferred methods of preparation are vacuum-drying and freeze-drying techniques, which yield a powder of the active ingredient, plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- Pharmacologically acceptable excipients usable in the rectal composition as a gel, cream, enema, or rectal suppository include, without limitation, any one or more of cocoa butter glycerides, synthetic polymers such as polyvinylpyrrolidone, PEG (like PEG ointments), glycerine, glycerinated gelatin, hydrogenated vegetable oils, poloxamers, mixtures of polyethylene glycols of various molecular weights and fatty acid esters of polyethylene glycol Vaseline, anhydrous lanolin, shark liver oil, sodium saccharinate, menthol, sweet almond oil, sorbitol, sodium benzoate, anoxid SBN, vanilla essential oil, aerosol, parabens in phenoxyethanol, sodium methyl p-oxybenzoate, sodium propyl p-oxybenzoate, diethylamine, carbomers, carbopol, methyloxybenzoate, macrogol cetostearyl ether, cocoyl caprylocap
- suppositories can be prepared by mixing the chemical entities described herein with suitable non-irritating excipients or carriers such as cocoa butter, polyethylene glycol or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum and release the active compound.
- suitable non-irritating excipients or carriers such as cocoa butter, polyethylene glycol or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum and release the active compound.
- compositions for rectal administration are in the form of an enema.
- the compounds described herein or a pharmaceutical composition thereof are suitable for local delivery to the digestive or GI tract by way of oral administration (e.g., solid or liquid dosage forms).
- Solid dosage forms for oral administration include capsules, tablets, pills, powders, and granules.
- the chemical entity is mixed with one or more pharmaceutically acceptable excipients, such as sodium citrate or dicalcium phosphate and/or: a) fillers or extenders such as starches, lactose, sucrose, glucose, mannitol, and silicic acid, b) binders such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinylpyrrolidinone, sucrose, and acacia, c) humectants such as glycerol, d) disintegrating agents such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate, e) solution retarding agents such as paraffin, f) absorption accelerators such as quaternary ammonium compounds, g) wetting agents such as, for example, cetyl alcohol and glycerol mono
- the dosage form may also comprise buffering agents.
- Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.
- the compositions will take the form of a unit dosage form such as a pill or tablet and thus the composition may contain, along with a chemical entity provided herein, a diluent such as lactose, sucrose, dicalcium phosphate, or the like; a lubricant such as magnesium stearate or the like; and a binder such as starch, gum acacia, polyvinylpyrrolidine, gelatin, cellulose, cellulose derivatives or the like.
- a diluent such as lactose, sucrose, dicalcium phosphate, or the like
- a lubricant such as magnesium stearate or the like
- a binder such as starch, gum acacia, polyvinylpyrrolidine, gelatin, cellulose, cellulose derivatives or the like.
- a powder, marume, solution or suspension (e.g., in propylene carbonate, vegetable oils, PEG's, poloxamer 124 or triglycerides) is encapsulated in a capsule (gelatin or cellulose base capsule).
- Unit dosage forms in which one or more chemical entities provided herein or additional active agents are physically separated are also contemplated; e.g., capsules with granules (or tablets in a capsule) of each drug; two-layer tablets; two-compartment gel caps, etc. Enteric coated or delayed release oral dosage forms are also contemplated.
- physiologically acceptable compounds include wetting agents, emulsifying agents, dispersing agents or preservatives that are particularly useful for preventing the growth or action of microorganisms.
- Various preservatives are well known and include, for example, phenol and ascorbic acid.
- the excipients are sterile and generally free of undesirable matter. These compositions can be sterilized by conventional, well-known sterilization techniques. For various oral dosage form excipients such as tablets and capsules, sterility is not required. The USP/NF standard is usually sufficient.
- Ocular compositions can include, without limitation, one or more of any of the following: viscogens (e.g., Carboxymethylcellulose, Glycerin, Polyvinylpyrrolidone, Polyethylene glycol); Stabilizers (e.g., Pluronic (triblock copolymers), Cyclodextrins); Preservatives (e.g., Benzalkonium chloride, ETDA, SofZia (boric acid, propylene glycol, sorbitol, and zinc chloride; Alcon Laboratories, Inc.), Purite (stabilized oxychloro complex; Allergan, Inc.)).
- viscogens e.g., Carboxymethylcellulose, Glycerin, Polyvinylpyrrolidone, Polyethylene glycol
- Stabilizers e.g., Pluronic (triblock copolymers), Cyclodextrins
- Preservatives e.g., Benzalkonium chloride, ETDA, SofZ
- Topical compositions can include ointments and creams.
- Ointments are semisolid preparations that are typically based on petrolatum or other petroleum derivatives.
- Creams containing the selected active agent are typically viscous liquid or semisolid emulsions, often either oil-in-water or water-in-oil.
- Cream bases are typically water-washable, and contain an oil phase, an emulsifier and an aqueous phase.
- the oil phase also sometimes called the “internal” phase, is generally comprised of petrolatum and a fatty alcohol such as cetyl or stearyl alcohol; the aqueous phase usually, although not necessarily, exceeds the oil phase in volume, and generally contains a humectant.
- the emulsifier in a cream formulation is generally a nonionic, anionic, cationic or amphoteric surfactant.
- an ointment base should be inert, stable, nonirritating and non-sensitizing.
- compositions described herein can include one or more one or more of the following: lipids, interbilayer crosslinked multilamellar vesicles, biodegradable poly(D,L-lactic-co-glycolic acid) [PLGA]-based or poly anhydride-based nanoparticles or microparticles, and nanoporous particle-supported lipid bilayers.
- lipids interbilayer crosslinked multilamellar vesicles
- biodegradable poly(D,L-lactic-co-glycolic acid) [PLGA]-based or poly anhydride-based nanoparticles or microparticles and nanoporous particle-supported lipid bilayers.
- the dosages may be varied depending on the requirement of the patient, the severity of the condition being treating and the particular compound being employed. Proper dosage for a particular situation can be determined by one skilled in the medical arts. In some cases, the total daily dosage may be divided and administered in portions throughout the day or by means providing continuous delivery.
- the compounds described herein are administered at a dosage of from about 0.0002 mg/Kg to about 100 mg/Kg (e.g., from about 0.0002 mg/Kg to about 50 mg/Kg; from about 0.0002 mg/Kg to about 25 mg/Kg; from about 0.0002 mg/Kg to about 10 mg/Kg; from about 0.0002 mg/Kg to about 5 mg/Kg; from about 0.0002 mg/Kg to about 1 mg/Kg; from about 0.0002 mg/Kg to about 0.5 mg/Kg; from about 0.0002 mg/Kg to about 0.1 mg/Kg; from about 0.001 mg/Kg to about 50 mg/Kg; from about 0.001 mg/Kg to about 25 mg/Kg; from about 0.001 mg/Kg to about 10 mg/Kg; from about 0.001 mg/Kg to about 5 mg/Kg; from about 0.001 mg/Kg to about 1 mg/Kg; from about 0.001 mg/Kg to about to about
- the foregoing dosages can be administered on a daily basis (e.g., as a single dose or as two or more divided doses) or non-daily basis (e.g., every other day, every two days, every three days, once weekly, twice weeks, once every two weeks, once a month).
- a daily basis e.g., as a single dose or as two or more divided doses
- non-daily basis e.g., every other day, every two days, every three days, once weekly, twice weeks, once every two weeks, once a month.
- the period of administration of a compound described herein is for 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, or more.
- a period of during which administration is stopped is for 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, or more.
- a therapeutic compound is administered to an individual for a period of time followed by a separate period of time.
- a therapeutic compound is administered for a first period and a second period following the first period, with administration stopped during the second period, followed by a third period where administration of the therapeutic compound is started and then a fourth period following the third period where administration is stopped.
- the period of administration of a therapeutic compound followed by a period where administration is stopped is repeated for a determined or undetermined period of time.
- a period of administration is for 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, or more.
- a period of during which administration is stopped is for 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, or more.
- This disclosure features methods for treating a subject (e.g., a human) having a disease, disorder, or condition in which modulation of GLP-1R and/or GIPR activities (e.g., repressed or impaired and/or elevated or unwanted GLP-1R and/or GIPR signaling) is beneficial for the treatment of the underlying pathology and/or symptoms and/or progression of the disease, disorder, or condition.
- the methods described herein can include or further include treating one or more conditions associated, co-morbid or sequela with any one or more of the conditions described herein.
- the chemical entities described herein induce blood glucose reduction (e.g., reduce blood glucose levels), promote insulin synthesis, stimulate insulin secretion, increase the mass of ⁇ -cells, modulate gastric acid secretion, modulate gastric emptying, and/or decrease glucagon production. In certain embodiments, the chemical entities described herein stabilize serum glucose and serum insulin levels.
- the condition, disease or disorder is obesity and conditions, diseases or disorders that are associated with obesity.
- obesity and obesity related conditions include symptomatic obesity, simple obesity, childhood obesity, morbid obesity and abdominal obesity (central obesity characterized by abdominal adiposity).
- Non-limiting examples of symptomatic obesity include endocrine obesity (e.g., Cushing syndrome, hypothyroidism, insulinoma, obese type II diabetes, pseudohypoparathyroidism, hypogonadism), hypothalamic obesity, hereditary obesity (e.g., Prader-Willi syndrome, Laurence-Moon-Biedl syndrome), and drug-induced obesity (e.g., steroid, phenothiazine, insulin, sulfonylurea agent, or ⁇ -blocker-induced obesity).
- endocrine obesity e.g., Cushing syndrome, hypothyroidism, insulinoma, obese type II diabetes, pseudohypoparathyroidism, hypogonadism
- hypothalamic obesity e.g., hereditary obesity (e.g., Prader-Willi syndrome, Laurence-Moon-Biedl syndrome)
- drug-induced obesity e.g., steroid, phenothiazine, insulin,
- the condition, disease or disorder is associated with obesity.
- conditions, disease or disorders include, without limitation, glucose tolerance disorders, diabetes (e.g., type 2 diabetes, obese diabetes), lipid metabolism abnormality, hyperlipidemia, hypertension, cardiac failure, hyperuricemia, gout, fatty liver (including non-alcoholic steatohepatitis (NASH)), coronary heart disease (e.g., myocardial infarction, angina pectoris), cerebral infarction (e.g., brain thrombosis, transient cerebral ischemic attack), bone or articular disease (e.g., knee osteoarthritis, hip osteoarthritis, spondylitis deformans, lumbago), sleep apnea syndrome, obesity hypoventilation syndrome (Pickwickian syndrome), menstrual disorder (e.g., abnormal menstrual cycle, abnormality of menstrual flow and cycle, amenorrhea, abnormal catamenial symptom), visceral obesity syndrome, and metabolic syndrome.
- diabetes e.
- the condition, disease or disorder is diabetes.
- diabetes include type 1 diabetes, type 2 diabetes (e.g., diet-treated type 2-diabetes, sulfonylurea-treated type 2-diabetes, a far-advanced stage type 2-diabetes, long-term insulin-treated type 2-diabetes), diabetes mellitus (e.g., non-insulin-dependent diabetes mellitus, insulin-dependent diabetes mellitus), gestational diabetes, obese diabetes, autoimmune diabetes, and borderline type diabetes.
- the condition, disease or disorder is associated with diabetes (e.g., a complication of diabetes).
- disorders associated with diabetes include obesity, obesity-related disorders, metabolic syndrome, neuropathy, nephropathy (e.g., diabetic nephropathy), retinopathy, diabetic cardiomyopathy, cataract, macroangiopathy, osteopenia, hyperosmolar diabetic coma, infectious disease (e.g., respiratory infection, urinary tract infection, gastrointestinal infection, dermal soft tissue infections, inferior limb infection), diabetic gangrene, xerostomia, hypacusis, cerebrovascular disorder, diabetic cachexia, delayed wound healing, diabetic dyslipidemia peripheral blood circulation disorder, cardiovascular risk factors. (e.g., coronary artery disease, peripheral artery disease, cerebrovascular disease, hypertension, and risk factors related to unmanaged cholesterol and/or lipid levels, and/or inflammation), NASH, bone fracture and cognitive dysfunction
- disorders related to diabetes include pre-diabetes, hyperlipidemia (e.g., hypertriglyceridemia, hypercholesterolemia, high LDL-cholesterolemia, low HDL-cholesterolemia, postprandial hyperlipemia), metabolic syndrome (e.g., metabolic disorder where activation of GLP-1R is beneficial, metabolic syndrome X), hypertension, impaired glucose tolerance (IGT), insulin resistance, and sarcopenia.
- hyperlipidemia e.g., hypertriglyceridemia, hypercholesterolemia, high LDL-cholesterolemia, low HDL-cholesterolemia, postprandial hyperlipemia
- metabolic syndrome e.g., metabolic disorder where activation of GLP-1R is beneficial, metabolic syndrome X
- hypertension e.g., impaired glucose tolerance (IGT), insulin resistance, and sarcopenia.
- ITT impaired glucose tolerance
- the condition, disease or disorder is diabetes and obesity (diabesity).
- the compounds described herein are also useful in improving the therapeutic effectiveness of metformin.
- condition, disease or disorder is a disorder of a metabolically important tissue.
- the condition, disease or disorder is a fatty liver disease.
- Fatty liver diseases include, but are not limited to, non-alcoholic fatty acid liver disease (NAFLD), steatohepatitis, non-alcoholic steatohepatitis (NASH), fatty liver disease resulting from hepatitis, fatty liver disease resulting from obesity, fatty liver disease resulting from diabetes, fatty liver disease resulting from insulin resistance, fatty liver disease resulting from hypertriglyceridemia, Abetalipoproteinemia, glycogen storage diseases, Weber-Christian disease, Wolmans disease, acute fatty liver of pregnancy, and lipodystrophy.
- NAFLD non-alcoholic fatty acid liver disease
- NASH non-alcoholic steatohepatitis
- fatty liver disease resulting from obesity fatty liver disease resulting from diabetes
- fatty liver disease resulting from insulin resistance fatty liver disease resulting from hypertriglyceridemia
- Abetalipoproteinemia glycogen storage diseases
- Weber-Christian disease Wo
- Non-alcoholic fatty liver disease represents a spectrum of disease occurring in the absence of alcohol abuse and is typically characterized by the presence of steatosis (fat in the liver).
- NAFLD is believed to be linked to a variety of conditions, e.g., metabolic syndrome (including obesity, diabetes and hypertriglyceridemia) and insulin resistance. It can cause liver disease in adults and children and may ultimately lead to cirrhosis (Skelly et al., J Hepatol 2001; 35: 195-9; Chitturi et al., Hepatology 2002; 35(2):373-9).
- NAFLD nonalcoholic fatty liver or NAFL
- NAFL nonalcoholic fatty liver or NAFL
- NASH non-alcoholic steatohepatitis
- the subject is a pediatric subject (e.g., 6-16 years old; or 6-12 years old; or 6-10 years old). In certain embodiments, the subject is a adult subject.
- disorders in metabolically important tissues include joint disorders (e.g., osteoarthritis, secondary osteoarthritis), steatosis (e.g. in the liver); gall stones; gallbladder disorders; gastroesophageal reflux; sleep apnea; hepatitis; fatty liver; bone disorder characterized by altered bone metabolism, such as osteoporosis, including post-menopausal osteoporosis, poor bone strength, osteopenia, Paget's disease, osteolytic metastasis in cancer patients, osteodystrophy in liver disease and the altered bone metabolism caused by renal failure or haemodialysis, bone fracture, bone surgery, aging, pregnancy, protection against bone fractures, and malnutrition polycystic ovary syndrome; renal disease (e.g., chronic renal failure, glomerulonephritis, glomerulosclerosis, nephrotic syndrome, hypertensive nephrosclerosis, end-stage renal disease); muscular dystrophy, angina pectoris
- the condition, disease or disorder is a cardiovascular disease.
- cardiovascular disease include congestive heart failure, atherosclerosis, arteriosclerosis, coronary heart disease, or peripheral artery disease, stroke, coronary artery disease, congestive heart failure, coronary heart disease, hypertension, cardiac failure, cerebrovascular disorder (e.g., cerebral infarction), vascular dysfunction, myocardial infarction, elevated blood pressure (e.g., 130/85 mm Hg or higher), and prothrombotic state (exemplified by high fibrinogen or plasminogen activator inhibitor in the blood).
- cerebrovascular disorder e.g., cerebral infarction
- vascular dysfunction vascular dysfunction
- myocardial infarction myocardial infarction
- elevated blood pressure e.g., 130/85 mm Hg or higher
- prothrombotic state exemplified by high fibrinogen or plasminogen activator inhibitor in the blood.
- the condition, disease or disorder is a neurological disorder (e.g., neurodegenerative disorder) or a psychiatric disorder.
- neurological disorders include brain insulin resistance, mild cognitive impairment (MCI), Alzheimer's disease (AD), Parkinson's disease (PD), anxiety, dementia (e.g., senile dementia), traumatic brain injury, Huntington's chores, tardive dyskinesia, hyperkinesia, mania, Morbus Parkinson, steel-Richard syndrome, Down's syndrome, myasthenia gravis, nerve trauma, brain trauma, vascular amyloidosis, cerebral hemorrhage I with amyloidosis, brain inflammation, Friedrich's ataxia, acute confusion disorder, amyotrophic lateral sclerosis (ALS), glaucoma, and apoptosis-mediated degenerative diseases of the central nervous system (e.g., Creutzfeldt-Jakob Disease, bovine spongiform encephalopathy (mad cow disease), chronic wasting syndrome
- MCI mild cognitive impairment
- Non-limiting examples of psychiatric disorders include drug dependence/addiction (narcotics and amphetamines and attention deficit/hyperactivity disorder (ADHD).
- the chemical entities described herein can be useful in improving behavioral response to addictive drugs, decreasing drug dependence, prevention drug abuse relapse, and relieving anxiety caused by the absence of a given addictive substance. See, e.g., US20120021979A1.
- the chemical entities described herein are useful in improving learning and memory by enhancing neuronal plasticity and facilitation of cellular differentiation, and also in preserving dopamine neurons and motor function in Morbus Parkinson.
- the condition, disease or disorder is impaired fasting glucose (IFG), impaired fasting glycemia (IFG), hyperglycemia, insulin resistance (impaired glucose homeostasis), hyperinsulinemia, elevated blood levels of fatty acids or glycerol, a hypoglycemic condition, insulin resistant syndrome, paresthesia caused by hyperinsulinemia, hyperlipidaemia, hypercholesteremia, impaired wound healing, leptin resistance, glucose intolerance, increased fasting glucose, dyslipidemia (e.g., hyperlipidemia, atherogenic dyslipidemia characterized by high triglycerides and low HDL cholesterol), glucagonoma, hyperuricacidemia, hypoglycemia (e.g., nighttime hypoglycemia), and concomitant comatose endpoint associated with insulin.
- IGF impaired fasting glucose
- IGF impaired fasting glycemia
- hyperglycemia insulin resistance
- hyperinsulinemia elevated blood levels of fatty acids or glycerol
- the chemical entities described herein can reduce or slow down the progression of borderline type, impaired fasting glucose or impaired fasting glycemia into diabetes.
- the condition, disease or disorder is an autoimmune disorder.
- autoimmune disorders include multiple sclerosis, experimental autoimmune encephalomyelitis, autoimmune disorder is associated with immune rejection, graft versus host disease, uveitis, optic neuropathies, optic neuritis, transverse myelitis, inflammatory bowel disease, rheumatoid arthritis, ankylosing spondylitis, systemic lupus erythematosus, myasthenia gravis, and Graves disease. See, e.g., US20120148586A1.
- the condition, disease or disorder is a stomach or intestine related disorder.
- these disorders include ulcers of any etiology (e.g. peptic ulcers, Zollinger-Ellison syndrome, drug-induced ulcers, ulcers related to infections or other pathogens), digestion disorders, malabsorption, short bowel syndrome, cul-de-sac syndrome, inflammatory bowel diseases (Crohn's disease and ulcerative colitis), celiac sprue, hypogammaglobulinemic sprue, chemotherapy and/or radiation therapy-induced mucositis and diarrhea, gastrointestinal inflammation, short bowel syndrome, colitis ulcerosa, gastric mucosal injury (e.g., gastric mucosal injury caused by aspirin), small intestinal mucosal injury, and cachexia (e.g., cancerous cachexia, tuberculous cachexia, cachexia associated with blood disease, cachexia associated with endocrine disease, cachexia associated with infectious disease, cachexia caused by acquired
- cachexia e.
- the chemical entities described herein can be used to reduce body weight (e.g., excess body weight), prevent body weight gain, induce weight loss, decrease body fat, or reduce food intake in a subject (e.g., a subject in need thereof).
- the weight increase in a subject may be attributed to excessive ingestion of food or unbalanced diets, or may be weight increase derived from a concomitant drug (e.g., insulin sensitizers having a PPAR ⁇ agonist-like action, such as troglitazone, rosiglitazone, englitazone, ciglitazone, pioglitazone and the like).
- the weight increase may be weight increase before reaching obesity, or may be weight increase in an obese subject.
- the weight increase may also be medication-induced weight gain or weight gain subsequent to cessation of smoking.
- condition, disease or disorder is an eating disorder, such as hyperphagia, binge eating, bulimia, or compulsive eating.
- the condition, disease or disorder is an inflammatory disorder.
- inflammatory disorders include chronic rheumatoid arthritis, spondylitis deformans, arthritis deformans, lumbago, gout, post-operational or post-traumatic inflammation, bloating, neuralgia, laryngopharyngitis, cystitis, pneumonia, pancreatitis, enteritis, inflammatory bowel disease (including inflammatory large bowel disease), inflammation in metabolically important tissues including liver, fat, pancreas, kidney and gut, and a proinflammatory state (e.g., elevated levels of proinflammatory cytokines or markers of inflammation-like C-reactive protein in the blood).
- a proinflammatory state e.g., elevated levels of proinflammatory cytokines or markers of inflammation-like C-reactive protein in the blood.
- the condition, disease or disorder is cancer.
- suitable examples of cancer include breast cancer (e.g., invasive ductal breast cancer, noninvasive ductal breast cancer, inflammatory breast cancer), prostate cancer (e.g., hormone-dependent prostate cancer, hormone-independent prostate cancer), pancreatic cancer (e.g., ductal pancreatic cancer), gastric cancer (e.g., papillary adenocarcinoma, mucous adenocarcinoma, adenosquamous carcinoma), lung cancer (e.g., non-small cell lung cancer, small-cell lung cancer, malignant mesothelioma), colon cancer (e.g., gastrointestinal stromal tumor), rectal cancer (e.g., gastrointestinal stromal tumor), colorectal cancer (e.g., familial colorectal cancer, hereditary non-polyposis colorectal cancer, gastrointestinal stromal tumor), small intestinal cancer (e.g., non-Hodgkin's lymphom
- This disclosure contemplates both monotherapy regimens as well as combination therapy regimens.
- the methods described herein can further include administering one or more additional therapies (e.g., one or more additional therapeutic agents and/or one or more therapeutic regimens) in combination with administration of the compounds described herein.
- additional therapies e.g., one or more additional therapeutic agents and/or one or more therapeutic regimens
- the methods described herein include administering a compound described herein in combination with one or more of a diet therapy (e.g., diet therapy for diabetes), an exercise therapy, blood sugar monitoring, and diet modifications.
- a diet therapy e.g., diet therapy for diabetes
- an exercise therapy e.g., exercise therapy for diabetes
- blood sugar monitoring e.g., blood sugar monitoring
- diet modifications e.g., diet modifications
- the compound described herein can be administered in combination with one or more of additional therapeutic agents.
- Representative additional therapeutic agents include, but are not limited to, anti-obesity agents, therapeutic agents for diabetes, therapeutic agents for diabetic complications, therapeutic agents for hyperlipidemia, antihypertensive agents, diuretics, chemotherapeutics, immunotherapeutics, anti-inflammatory drugs, antithrombotic agents, anti-oxidants, therapeutic agents for osteoporosis, vitamins, antidementia drugs, erectile dysfunction drugs, therapeutic drugs for urinary frequency or urinary incontinence, therapeutic agents for NAFLD, and therapeutic agents for dysuria.
- anti-obesity agents therapeutic agents for diabetes, therapeutic agents for diabetic complications, therapeutic agents for hyperlipidemia, antihypertensive agents, diuretics, chemotherapeutics, immunotherapeutics, anti-inflammatory drugs, antithrombotic agents, anti-oxidants, therapeutic agents for osteoporosis, vitamins, antidementia drugs, erectile dysfunction drugs, therapeutic drugs for urinary frequency or urinary incontinence, therapeutic agents for NAFLD, and therapeutic agents for dysuri
- the one or more additional therapeutic agents include those useful, e.g., as anti-obesity agents.
- Non-limiting examples include:
- the one or more additional therapeutic agents include those useful, e.g., as anti-diabetic agents.
- Non-limiting examples include:
- the one or more additional therapeutic agents include those useful, e.g., for treating NAFL and NASH.
- Non-limiting examples include glycyrrhizin, schisandra extract, ascorbic acid, glutathione, silymarin, lipoic acid, and d-alpha-tocopherol, ascorbic acid, glutathione, vitamin B-complex, glitazones/thiazolidinediones (e.g., troglitazone, rosiglitazone, pioglitazone), metformin, cystamine, sulfonylureas, alpha-glucosidase inhibitors, meglitinides, vitamin E, tetrahydrolipstatin, milk thistle protein, anti-virals, and anti-oxidants.
- glycyrrhizin schisandra extract
- ascorbic acid glutathione
- silymarin silymarin
- lipoic acid and d-alpha-
- the one or more additional therapeutic agents include those useful, e.g., for treating diabetic complications.
- Non-limiting examples include:
- the one or more additional therapeutic agents include those useful, e.g., for treating hyperlipidemia.
- Non-limiting examples include:
- the one or more additional therapeutic agents include those useful, e.g., as anti-hypertensive agents.
- Non-limiting examples include:
- the one or more additional therapeutic agents include those useful, e.g., as diuretics.
- Non-limiting examples include:
- the one or more additional therapeutic agents include those useful, e.g., as immunotherapeutic agents.
- immunotherapeutic agents include: microbial or bacterial compounds (e.g., muramyl dipeptide derivative, picibanil); polysaccharides having immunoenhancing activity (e.g., lentinan, sizofiran, krestin); cytokines obtained by genetic engineering approaches (e.g., interferon, interleukin (IL) such as IL-1, IL-2, IL-12); and colony-stimulating factors (e.g., granulocyte colony-stimulating factor, erythropoietin).
- microbial or bacterial compounds e.g., muramyl dipeptide derivative, picibanil
- polysaccharides having immunoenhancing activity e.g., lentinan, sizofiran, krestin
- cytokines obtained by genetic engineering approaches (e.g., interferon, interleukin (IL) such
- the one or more additional therapeutic agents include those useful, e.g., as anti-thrombotic agents.
- Non-limiting examples include: heparins (e.g., heparin sodium, heparin calcium, enoxaparin sodium, dalteparin sodium); warfarin (e.g., warfarin potassium); anti-thrombin drugs (e.g., argatroban, dabigatran); FXa inhibitors (e.g., rivaroxaban, apixaban, edoxaban, YM150, compounds described in WO02/06234, WO2004/048363, WO2005/030740, WO2005/058823, and WO2005/113504); thrombolytic agents (e.g., urokinase, tisokinase, alteplase, nateplase, monteplase, pamiteplase); and platelet aggregation inhibitors (e.g., he
- the one or more additional therapeutic agents include those useful, e.g., for treating osteoporosis.
- Non-limiting examples include: alfacalcidol, calcitriol, elcatonin, calcitonin salmon, estriol, ipriflavone, pamidronate disodium, alendronate sodium hydrate, incadronate disodium, and risedronate disodium.
- vitamins include vitamin B1 and vitamin B12.
- Suitable examples of erectile dysfunction drugs include apomorphine and sildenafil citrate.
- Suitable examples of therapeutic agents for urinary frequency or urinary incontinence include flavorxate hydrochloride, oxybutynin hydrochloride and propiverine hydrochloride.
- Suitable examples of therapeutic agents for dysuria include acetylcholine esterase inhibitors (e.g., distigmine).
- Suitable examples of anti-inflammatory agents include nonsteroidal anti-inflammatory drugs such as aspirin, acetaminophen, indomethacin.
- the second therapeutic agent or regimen is administered to the subject prior to contacting with or administering the chemical entity (e.g., about one hour prior, or about 6 hours prior, or about 12 hours prior, or about 24 hours prior, or about 48 hours prior, or about 1 week prior, or about 1 month prior).
- the chemical entity e.g., about one hour prior, or about 6 hours prior, or about 12 hours prior, or about 24 hours prior, or about 48 hours prior, or about 1 week prior, or about 1 month prior.
- the second therapeutic agent or regimen is administered to the subject at about the same time as contacting with or administering the chemical entity.
- the second therapeutic agent or regimen and the chemical entity are provided to the subject simultaneously in the same dosage form.
- the second therapeutic agent or regimen and the chemical entity are provided to the subject concurrently in separate dosage forms.
- the second therapeutic agent or regimen is administered to the subject after contacting with or administering the chemical entity (e.g., about one hour after, or about 6 hours after, or about 12 hours after, or about 24 hours after, or about 48 hours after, or about 1 week after, or about 1 month after).
- the chemical entity e.g., about one hour after, or about 6 hours after, or about 12 hours after, or about 24 hours after, or about 48 hours after, or about 1 week after, or about 1 month after.
- the methods described herein further include the step of identifying a subject (e.g., a patient) in need of such treatment (e.g., by way of biopsy, endoscopy, or other conventional method known in the art).
- intermediates useful for preparing the compounds described herein can be prepared using the chemistries delineated in any one or more of the following schemes and non-limiting examples.
- Diester I-16 Prepared according to GP2. Yield: 1.16 g (65%).
- Diester I-19 Prepared according to GP2. Yield: 569.8 mg (64%).
- Diester I-20 Prepared according to GP2. Yield: 399.3 mg (48%).
- Amine salt I-14 (81 mg, 0.41 mmol) and glutaric anhydride (49 mg, 1.04 equiv.) were suspended in DCM (4 mL), and DIPEA (0.14 mL, 2.0 equiv.) was added. The reaction mixture was stirred at ambient temperature for 15 hours, whereupon pentafluorophenol (80 mg, 1.06 equiv.) and EDC (81 mg, 1.02 equiv.) were added to the homogeneous solution. After an additional 4 hours, the reaction mixture was diluted with DCM (20 mL) and washed with 1 M HCl (5 mL) and brine (8 mL).
- Amine salt I-14 (69 mg, 0.35 mmol) and succinic anhydride (35 mg, 1.0 equiv.) were suspended in DCM (5 mL), and DIPEA (0.12 mL, 2.0 equiv.) was added. The reaction mixture was stirred at ambient temperature for 16 hours, whereupon pentafluorophenol (80 mg, 1.24 equiv.) and EDC (74 mg, 1.1 equiv.) were added to the homogeneous solution. After an additional 4 hours, the reaction mixture was diluted with DCM (20 mL) and washed with 1 M HCl (5 mL) and brine (8 mL).
- I-48 Adipic acid bis-N-hydroxysuccinimide ester I-47 was prepared as described for diester I-45. Coupling with amine hydrochloride I-46 as described in the preparation of I-44 afforded 69.8 mg (69% yield) of I-48 after purification by preparative HPLC (H 2 O/MeCN with 0.1% TFA).
- Glutarimide I-54 (59 mg, 0.21 mmol) was dissolved in 4 M HCl in dioxane (3 mL). After 2 hours, the reaction mixture was concentrated to afford a white solid. This solid and thiodiglycolic anhydride (28.3 mg, 1.03 equiv.) were dissolved in DCM (3 mL), and TEA (90 ⁇ L, 3.1 equiv.) was added. After 25 minutes, the reaction mixture was concentrated and purified by preparative HPLC (H 2 O/MeCN with 0.1% TFA) to afford 40.5 mg (62% yield) of I-55. ESI-MS found 317.2, C 13 H 21 N 2 O 5 S (MH + ) requires 317.1.
- the silyl ether was then dissolved in DMF (7 mL). This solution was added to a suspension of NaH (574 mg of 60% dispersion in mineral oil, 3.0 equiv.) in DMF (15 mL) that had been pre-cooled to 0-5° C. After 4 minutes, (2-bromoethoxy)(tert-butyl)dimethylsilane (1.37 g, 1.2 equiv.) was added. The reaction mixture was allowed to warm to ambient temperature. After 1.5 hours, the reaction mixture was quenched with saturated aqueous NH 4 Cl (20 mL), and diluted with brine (100 mL). The aqueous phase was extracted with EtOAc (3 ⁇ 70 mL).
- reaction mixture was cooled to 0-5° C., and the reaction was quenched with saturated aqueous NH 4 Cl (10 mL).
- the reaction mixture was diluted with 50% brine (100 mL) and extracted with EtOAc (3 ⁇ 50 mL).
- the organic extracts were combined, dried (Na 2 SO 4 ), and concentrated to afford a colorless oil which was then dissolved in THE (12 mL).
- Aqueous HCl (1 M, 4 mL) was added, and the reaction mixture was stirred at ambient temperature for 5 hours.
- the reaction was quenched with saturated aqueous NaHCO 3 (10 mL) and diluted with brine (50 mL), then extracted with EtOAc (3 ⁇ 50 mL).
- I-101 an analogous procedure was used to synthesize enantiomeric building block I-101. Yield 16.2 mg (6% yield, 3 steps). ESI-MS found 289.2, C 11 H 17 N 2 O 5 S (MH + ) requires 289.1.
- the resulting suspension was filtered through a plug of cotton, treated with proton sponge (201 mg, 3.0 equiv.), and added to a solution of triphosgene (56 mg, 0.6 equiv.) in 5 mL of DCM at 0° C. under N 2 . After stirring for 4 hours at 0-5° C., the reaction mixture was allowed to warm to ambient temperature, and stirring was continued another 24 hours. The reaction mixture was then diluted with 45 mL of DCM. The organic phase was washed twice with 1 M aqueous NaHSO 4 , brine, dried over Na 2 SO 4 and concentrated in vacuo.
- the salt was dissolved in 4 mL of DMF and treated with a solution of thiodiglycolic anhydride (32 mg, 0.24 mmol) and DIPEA (48 ⁇ L, 0.27 mmol) in 1 mL of DMF.
- the reaction mixture was stirred for 2 hours and then a solution of EDC (68 mg, 0.32 mmol) and pentafluorophenol (58 mg, 0.32 mmol) in 1 mL of DMF was added; stirring was continued for one hour.
- HATU 400 mg, 1.1 equiv.
- DIPEA 607 ⁇ L, 3.5 equiv.
- ⁇ -alanine-tert-butyl ester hydrochloride 200 mg, 1.1 equiv.
- the reaction mixture was stirred at ambient temperature until the reaction was deemed complete by LC-MS.
- the reaction mixture was concentrated to a residue, which was taken up in EtOAc and the organic extract was washed with 1 M HCl, dried and concentrated. The resulting residue was purified by silica gel chromatography to afford 167 mg (48% yield, 2 steps) of phthalimide I-117.
- the resulting crude carbamate I-125 was stirred in 1:1 DCM/TFA for 2 hours, after which removal of the solvent afforded a primary amine salt.
- the amine salt was suspended in DCM and treated with thiodiglycolic anhydride (73 mg, 1.1 equiv.) and DIPEA (219 ⁇ L, 2.5 equiv.).
- the reaction mixture was stirred 4 hours.
- Pentafluorophenol (139 mg, 1.5 equiv.) and EDC (207 mg, 2.0 equiv.) were added; stirring was continued for 2 hours.
- the reaction mixture was diluted with EtOAc and the solution was washed with 1 M HCl then brine, dried over sodium sulfate and concentrated in vacuo. Purification by flash chromatography using EtOAc in hexanes afforded I-126.
- Alcohol I-143 was dissolved in THF (6 mL) in the presence of triphenylphosphine (85.7 mg, 1.5 equiv.) and phthalimide (48.1 mg, 1.5 equiv.). The solution was cooled to 0-5° C., and DIAD (64 ⁇ L, 1.5 equiv.) was added; the reaction mixture was allowed to warm to ambient temperature. After 1.5 hours, the reaction mixture was concentrated to a yellow oil, which was purified by silica gel chromatography (12 g pre-packed column, eluting with 0 to 35% Acetonitrile in DCM) to afford 42.5 mg of phthalimide I-144 (65% yield) as a colorless oil.
Abstract
This disclosure features chemical entities (e.g., a compound or a pharmaceutically acceptable salt and/or hydrate and/or prodrug of the compound) that modulate (e.g., agonize or partially agonize or antagonize) glucagon-like peptide-1 receptor (“GLP-1R”) and/or the gastric inhibitory polypeptide receptor (“GIPR”). The chemical entities are useful, e.g., for treating a subject (e.g., a human) having a disease, disorder, or condition in which modulation (e.g., agonism, partial agonism or antagonism) of GLP-1R and/or GIPR activities is beneficial for the treatment or prevention of the underlying pathology and/or symptoms and/or progression of the disease, disorder, or condition. In some embodiments, the modulation results in an enhancement of (e.g., an increase in) existing levels (e.g., normal or below normal levels) of GLP-1R and/or GIPR activity (e.g., signaling). In some embodiments, the chemical entities described herein further modulate (e.g., attenuate, uncouple) β-arrestin signaling relative to what is observed with the native ligand. This disclosure also features compositions as well as other methods of using and making the said chemical entities.
Description
- This application is a continuation of U.S. application Ser. No. 17/040,653, filed on Sep. 23, 2020, which is a National Stage application under 35 U.S.C. § 371 of International Application No. PCT/US2019/023726, having an
International Filing Date 5 of Mar. 22, 2019, which the benefit of U.S. Provisional Application Ser. No. 62/647,604, filed on Mar. 23, 2018, which is incorporated herein by reference in its entirety. - This application contains a Sequence Listing that has been submitted electronically as an XML file named “41517-0002002 ST26.XML.” The XML file, created on Dec. 20, 2022, is 132,954 bytes in size. The material in the XML file is hereby incorporated by reference in its entirety
- This disclosure features chemical entities (e.g., a compound or a pharmaceutically acceptable salt and/or hydrate and/or prodrug of the compound) that modulate (e.g., agonize or partially agonize or antagonize) glucagon-like peptide-1 receptor (“GLP-1R”) and/or the gastric inhibitory polypeptide receptor (“GIPR”). The chemical entities are useful, e.g., for treating a subject (e.g., a human) having a disease, disorder, or condition in which modulation (e.g., agonism, partial agonism or antagonism) of GLP-1R and/or GIPR activities is beneficial for the treatment or prevention of the underlying pathology and/or symptoms and/or progression of the disease, disorder, or condition. In some embodiments, the modulation results in an enhancement of (e.g., an increase in) existing levels (e.g., normal or below normal levels) of GLP-1R and/or GIPR activity (e.g., signaling). In some embodiments, the chemical entities described herein further modulate (e.g., attenuate, uncouple) β-arrestin signaling relative to what is observed with the native ligand. This disclosure also features compositions as well as other methods of using and making the said chemical entities.
- Diabetes mellitus type 2 (type-2 diabetes) is characterized by high blood glucose and insulin resistance.
Type 2 diabetes as well as conditions that are co-morbid or sequela with type-2 diabetes affect tens of millions of people in the United States alone. Type-2 diabetes is frequently associated with obesity. - Nonalcoholic steatohepatitis (NASH) is liver inflammation and damage caused by a buildup of fat in the liver. It is part of a group of conditions called nonalcoholic fatty liver disease (NAFLD). NASH and NAFLD tend to develop in patients having one of the following risk factors: obesity, dyslipidemia, and glucose intolerance and appears to be linked to insulin resistance (e.g., as in obesity or metabolic syndrome).
- Incretin hormones are hormones that provide glycemic control in response to food intake. Gastric inhibitory polypeptide (“GIP”) and glucagon-like peptide-1 (“GLP-1”) are primary incretin hormones secreted from small intestinal L cells and K cells, respectively, on ingestion of glucose or nutrients to stimulate insulin secretion from pancreatic β cells. GIP and GLP-1 undergo degradation by dipeptidyl peptidase-4 (DPP-4), and rapidly lose their biological activities (see, e.g., Y Sieno, et. al, Journal of Diabetes Investigation 2013, 4, 108-130).
- The actions of GIP and GLP-1 are believed to be mediated by their specific receptors, the GIP receptor (GIPR) and the GLP-1 receptor (GLP-1R), respectively, which both belong to the G-protein coupled receptor family and are expressed in pancreatic β-cells, as well as in various tissues and organs. GLP-1 activities include, without limitation, stimulation of insulin synthesis and secretion, inhibition of glucagon secretion, and inhibition of food intake. GIP activities include, without limitation, stimulation of glucose-dependent insulin secretion, an increase in β-cell mass, stimulation of glucagon secretion, and a decrease in gastric acid secretion. See, e.g., WO 2016/131893.
- GLP-1 and GLP-1 analogues, acting as agonists at the GLP-1 receptor, have been shown to be effective in glycemic control, e.g., type-2 diabetes. See, e.g., WO 2016/131893. In addition to their insulinotropic effects, GIP and GLP-1 are believed to be involved in various biological processes in different tissues and organs that express GIPR and GLP-1R, including, e.g., the pancreas, fat, bone, brain, heart, kidney, eye, nerves, and liver. By way of example, investigations using mice lacking GIPR and/or GLP-1R, as well as mice lacking DPP-4, showed involvement of GIP and GLP-1 in divergent biological activities. The results of these investigations point to involvement of GIP and GLP-1 in treating and/or preventing diabetes-related microvascular complications (e.g., retinopathy, nephropathy and neuropathy) and macrovascular complications (e.g., coronary artery disease, peripheral artery disease and cerebrovascular disease), as well as diabetes-related comorbidity (e.g., obesity, non-alcoholic fatty liver disease, bone fracture and cognitive dysfunction). See, e.g., Sieno at page 108.
- This disclosure features chemical entities (e.g., a compound or a pharmaceutically acceptable salt and/or hydrate and/or prodrug of the compound) that modulate (e.g., agonize or partially agonize or antagonize) glucagon-like peptide-1 receptor (“GLP-1R”) and/or the gastric inhibitory polypeptide receptor (“GIPR”). The chemical entities are useful, e.g., for treating a subject (e.g., a human) having a disease, disorder, or condition in which modulation (e.g., agonism, partial agonism or antagonism) of GLP-1R and/or GIPR activities is beneficial for the treatment or prevention of the underlying pathology and/or symptoms and/or progression of the disease, disorder, or condition. In some embodiments, the modulation results in an enhancement of (e.g., an increase in) existing levels (e.g., normal or below normal levels) of GLP-1R and/or GIPR activity (e.g., signaling). In some embodiments, the chemical entities described herein further modulate (e.g., attenuate, uncouple) β-arrestin signaling relative to what is observed with the native ligand. This disclosure also features compositions as well as other methods of using and making the said chemical entities.
- An “agonist” of GLP-1R includes compounds that, at the protein level, directly bind or modify GLP-1R such that an activity of GLP-1R is increased, e.g., by activation, stabilization, altered distribution, or otherwise relative to GLP-1R activity in absence of ligand.
- Certain compounds described herein that agonize GLP-1R to a lesser extent (partial agonists) than a GLP-1R full agonist (e.g native GLP-1) can function in assays as antagonists as well as agonists. These compounds antagonize activation of GLP-1R by a GLP-1R full agonist because they prevent the full effect of GLP-1R interaction. However, the compounds also, on their own, activate some GLP-1R activity, typically less than a corresponding amount of the GLP-1R full agonist. Such compounds are sometimes referred to herein as “partial agonists of GLP-1R”.
- An “antagonist” of GLP-1R includes compounds that, at the protein level, directly bind or modify GLP-1R such that an activity of GLP-1R is decreased, e.g., by inhibition, blocking or dampening agonist-mediated responses, altered distribution, or otherwise relative to GLP-1R activity in absence of ligand.
- In some embodiments, the compounds described herein are agonists (e.g. full agonists) of GLP-1R. In other embodiments, the compounds described herein are partial agonists or antagonists of GLP-1R.
- An “agonist” of GIPR includes compounds that, at the protein level, directly bind or modify GIPR such that an activity of GIPR is increased, e.g., by activation, stabilization, altered distribution, or otherwise relative to GIPR activity in absence of ligand.
- Certain compounds described herein that agonize GIPR to a lesser extent than native GIP (s full agonist) can function as antagonists as well as agonists. These compounds are partial antagonists as they reduce activation of GIPR by native GIP because they reduce the full effect of native GIP. However, the compounds also, on their own, activate some GIPR activity, typically less than a corresponding amount of native GIP. Such compounds are sometimes referred to herein as “partial agonists of GIPR”.
- An “antagonist” of GIPR includes compounds that, at the protein level, directly bind or modify GIPR such that an activity of GIPR is decreased, e.g., by inhibition, blocking or dampening agonist-mediated responses, altered distribution, or otherwise relative to GIPR activity in absence of ligand.
- In some embodiments, the compounds described herein are agonists (e.g. full agonists) of GIPR. In other embodiments, the compounds described herein are partial agonists of GIPR. In still other embodiments, the compounds described herein are or antagonists of GIPR.
- In some embodiments, the compounds described herein are full agonists of both GLP-1R and GIPR. In some embodiments, the compounds described herein are partial agonists of both GLP-1R and GIPR. This disclosure also contemplates chemical entities that (i) agonize one of GLP-1R and GIPR (e.g., GLP-1R); and antagonize the other of GLP-1R and GIPR (e.g., GIPR). For example, this disclosure contemplates chemical entities that (i) fully agonize one of GLP-1R and GIPR (e.g., GLP-1R); and partially agonize or antagonize the other of GLP-1R and GIPR (e.g., GIPR). In certain embodiments, the chemical entities that are full agonists of GLP-1R and partial agonists or antagonists of GIPR; or that are partial agonists or antagonists of GLP-1R and full agonists of GIPR.
- Generally, a receptor exists in an active (Ra) and an inactive (Ri) conformation. Certain compounds that affect the receptor can alter the ratio of Ra to Ri (Ra/Ri). For example, a full agonist increases the ratio of Ra/Ri and can cause a “maximal”, saturating effect. A partial agonist, when bound to the receptor, gives a response that is lower than that elicited by a full agonist (e.g., an endogenous agonist). Thus, the Ra/Ri for a partial agonist is less than for a full agonist. However, the potency of a partial agonist may be greater or less than that of the full agonist.
- In some embodiments, the chemical entities described herein further modulate (e.g., reduce, e.g., attenuate, disrupt, inhibit) β-arrestin coupling and/or b-arrestin signaling, and GLP-1R and/or GIPR internalization. In certain embodiments, the chemical entities described herein modulate (e.g., reduce, e.g., attenuate, disrupt, inhibit) recruitment of β-arrestin to a G-protein coupled receptor (e.g., GLP-1R). In certain embodiments, the chemical entities described herein modulate (e.g., reduce, e.g., attenuate, disrupt, inhibit) formation of a complex (“coupling”) (e.g., a signaling complex) between β-arrestin and a G-protein coupled receptor (e.g., GLP-1R or GIPR). The effects of the chemical entities described herein on β-arrestin signaling and associated downstream processes (e.g., those delineated above) can be assessed using conventional methods, e.g., PathHunter β-arrestin Assay for determining β-arresting coupling (see Examples section). By way of example, a value of β-arrestin (GLP-1R) EC50<1 μM in the aforementioned assay indicates a compound that induces β-arrestin recruitment to GLP-1R. GLP-1, the native ligand for GLP-1R, and therapeutic analogs thereof, such a liraglutide, are potent recruiters of β-arrestin. As another example, a value of β-arrestin (GLP1R) EC50>1 μM (e.g., >10 μM) indicates a compound that does not substantially induce β-arrestin recruitment to GLP-1R. Therapeutic agents that modulate G-protein coupled receptors (e.g., GLP-1R and/or GIPR) can produce a variety of effects depending on the degree of cAMP activation versus β-arrestin-based signaling. It has been shown that b-arrestin coupling is a key strep in receptor internalization and subsequent de-sensitization and attenuation of signaling. Both GLP-1 (and the liraglutide analog) and GIP have been shown to produce rapid receptor internalization. Thus, compounds that activate GLP-1R and/or GIPR cAMP signaling but do not substantially couple to β-arrestin have the potential to prolong receptor signaling and extend pharmacological benefits. In some embodiments, the chemical entities described herein exhibit relatively strong GLP-1R and/or GIPR mediated cAMP activation with minimal or no detectable β-arrestin coupling. In some embodiments, the chemical entities described herein exhibit relatively strong GLP-1R mediated cAMP activation and no or little GIPR mediated cAMP activation with minimal or no detectable β-arrestin coupling.
- In some embodiments, the compounds described herein show reduced activity in a rodent aversion model, while maintaining a relatively high potency in glucose clearance assay. Aversion models, such as conditioned taste aversion, are commonly used to identify compounds with adverse effects such as nausea. Nausea causing agents, such a Exendin-4 and liraglutide, are know to have a strong signal in conditioned taste aversion models. Advantageously, some of the chemical entities described herein are therefore expected to have a reduced likelihood of producing unwanted side effects, such as nausea, when administered to a patient, while maintaining full pharmacological benefit.
- Accordingly, in one aspect, this disclosure features peptide-based chemical entities (e.g., N-protected peptide-based chemical entities; e.g., peptide-based chemical entities having from 30-50 amino acids, 30-45 amino acids, 30-40 amino acids, 35-40 amino acids; e.g., an N-protected peptide-based chemical entities having from 30-50 amino acids, 30-45 amino acids, 30-40 amino acids, 35-40 amino acids). The peptide-based chemical entities modulate (e.g., agonize or partially agonize or antagonize) glucagon-like peptide-1 receptor (“GLP-1R”) and/or the gastric inhibitory polypeptide receptor (“GIPR”) and optionally further modulate (e.g., uncouple, attenuate) β-arrestin signaling and/or aversion as described herein.
- In some embodiments, the peptide-based chemical entities agonize or partially agonize GLP-1R.
- In some embodiments, the peptide-based chemical entities agonize or partially agonize or antagonize GIPR.
- In some embodiments, said peptide-based chemical entities reduce (e.g., uncouple, attenuate, inhibit) β-arrestin signaling; e.g., reduce (e.g., uncouple, attenuate, inhibit) the recruitment of β-arrestin to a G-protein coupled receptor (e.g., GLP-1R); e.g., reduce (e.g., attenuate, disrupt, inhibit) the formation of a complex (e.g., a signaling complex) between β-arrestin and a G-protein coupled receptor (e.g., GLP-1R).
- In certain embodiments, the peptide-based chemical entities:
-
- agonize or partially agonize GLP-1R;
- agonize or partially agonize or antagonize GIPR;
- reduce (e.g., uncouple, attenuate, inhibit) β-arrestin signaling; e.g., reduce (e.g., attenuate, disrupt, inhibit) the recruitment of β-arrestin to a G-protein coupled receptor (e.g., GLP-1R and/or GIPR); e.g., reduce (e.g., attenuate, disrupt, inhibit) the formation of a complex (e.g., a signaling complex) between β-arrestin and a G-protein coupled receptor (e.g., GLP-1R and/or GIPR); and
- stimulate glucose clearance in vivo (GTT test) without causing aversion.
- In some embodiments, the peptide-based chemical entities exhibit a value of cAMP (GLP1R) EC50 of less than about 10 nM, 5 nM, or 1 nM (e.g., less than about 1 nM).
- In some embodiments, the peptide-based chemical entities exhibit a value of cAMP (GIPR) EC50 of less than about 100 nm, 50 nM, or 10 nM (e.g., less than about 10 nM).
- In some embodiments, the peptide-based chemical entities inhibit GIP induced cAMP production (GIPR antagonism).
- In some embodiments, the compounds described herein exhibit a value of β-arrestin (GLP1R) EC50>1 μM.
- In some embodiments, the peptide-based chemical entities:
-
- exhibit a value of cAMP (GLP1R) EC50 of less than about 10 nM, 5 nM, or 1 nM (e.g., less than about 1 nM);
- exhibit a value of cAMP (GIPR) EC50 of less than about 100 nm, 50 nM, or 10 nM (e.g., less than about 10 nM) or are GIPR antagonists;
- exhibit a value of β-arrestin (GLP1R) EC50>1 μM; and
- stimulate glucose clearance in vivo (GTT test) without causing aversion (nausea)
- In one aspect, the featured peptide-based chemical entities include compounds of Formula (IAA), or a pharmaceutically acceptable salt thereof:
- in which ring A, G, L, W, R1, R2, R2′, and R4 can be as defined anywhere herein.
- In one aspect, pharmaceutical compositions are featured that include a chemical entity described herein (e.g., a compound described generically or specifically herein or a pharmaceutically acceptable salt thereof or compositions containing the same) and one or more pharmaceutically acceptable excipients.
- In one aspect, methods for modulating (e.g., agonizing, partially agonizing, or antagonizing) GLP-1R and/or GIPR activities are featured that include contacting GLP-1R and/or GIPR with a chemical entity described herein (e.g., a compound described generically or specifically herein or a pharmaceutically acceptable salt thereof or compositions containing the same). Methods include in vitro methods, e.g., contacting a sample that includes one or more cells, each independently comprising one or more of GLP-1R and/or GIPR with the chemical entity. Methods can also include in vivo methods; e.g., administering the chemical entity to a subject (e.g., a human) having a disease, disorder, or condition in which modulation of GLP-1R and/or GIPR signaling is beneficial for the treatment of the underlying pathology and/or symptoms and/or progression of the disease, disorder, or condition (e.g., diabetes; e.g., NASH; e.g., obesity). In vivo methods include, but are not limited to modulating (e.g., increasing) insulin levels and modulating (e.g., decreasing) glucose levels in a subject (e.g., a human). In some of the foregoing embodiments, said methods of modulating are achieved without substantially stimulating Q-arrestin signaling; e.g., without stimulating the recruitment of β-arrestin to a G-protein coupled receptor (e.g., GLP-1R); e.g., without stimulating the formation of a complex (e.g., a signaling complex) between β-arrestin and a G-protein coupled receptor (e.g., GLP-1R). In some of the foregoing embodiments, said methods of modulating are achieved without causing aversion or nausea.
- In a further aspect, methods of treatment of a disease, disorder, or condition are featured, in which modulation of GLP-1R and/or GIPR signaling is beneficial for the treatment of the underlying pathology and/or symptoms and/or progression of the disease, disorder, or condition. The methods include administering to a subject in need of such treatment an effective amount of a chemical entity described herein (e.g., a compound described generically or specifically herein, a pharmaceutically acceptable salt thereof, or compositions containing the same).
- In another aspect, this disclosure features methods of treating a subject having a disease, disorder, or condition in which modulation of GLP-1R and/or GIPR signaling is beneficial for the treatment of the underlying pathology and/or symptoms and/or progression of the disease, disorder, or condition. The methods include administering a chemical entity described herein (e.g., a compound described generically or specifically herein, a pharmaceutically acceptable salt thereof or compositions containing the same) in an amount effective to treat the disease, disorder, or condition.
- In a further aspect, methods of treatment are featured that include administering to a subject chemical entity described herein (e.g., a compound described generically or specifically herein, a pharmaceutically acceptable salt thereof, or compositions containing the same). The methods include administering the chemical entity in an amount effective to treat a disease, disorder, or condition, wherein modulation of GLP-1R and/or GIPR is beneficial for the treatment of the underlying pathology and/or symptoms and/or progression of the disease, disorder, or condition, thereby treating the disease, disorder, or condition.
- In another aspect, methods of treatment can further include:
-
- (i) administering a first therapeutic agent that modulates (e.g., agonizes, partially agonizes, or antagonizes) GLP-1R and/or GIPR to a subject as defined anywhere herein;
- (ii) determining that the subject is suffering from one or more side effects (e.g., aversion, nausea or vomiting); and
- (iii) ceasing administration of the first therapeutic agent and administering a chemical entity as described herein (e.g., a compound having formula (IAA), (IA), or (I)).
- Non-limiting examples of such diseases, disorders, and conditions include metabolic syndrome; diabetes (e.g.,
type 2 diabetes); obesity; obesity-related disorders; impaired glucose tolerance; insulin resistance; non-alcoholic steatohepatitis (NASH); fatty liver disease; steatohepatitis; and other forms of inflammation in metabolically important tissues including, liver, fat, pancreas, kidney, and gut. - Other non-limiting examples of such diseases, disorders, and conditions include neurological disorders include brain insulin resistance, mild cognitive impairment (MCI), Alzheimer's disease (AD), Parkinson's disease (PD), anxiety, dementia (e.g., senile dementia), traumatic brain injury, Huntington's chores, tardive dyskinesia, hyperkinesia, mania, Morbus Parkinson, steel-Richard syndrome, Down's syndrome, myasthenia gravis, nerve trauma, brain trauma, vascular amyloidosis, cerebral hemorrhage I with amyloidosis, brain inflammation, Friedrich's ataxia, acute confusion disorder, amyotrophic lateral sclerosis (ALS), glaucoma, and apoptosis-mediated degenerative diseases of the central nervous system (e.g., Creutzfeldt-Jakob Disease, bovine spongiform encephalopathy (mad cow disease), and chronic wasting syndrome).
- Still other non-limiting examples of such diseases, disorders, and conditions include bone disorder characterized by altered bone metabolism, such as osteoporosis, including post-menopausal osteoporosis, poor bone strength, osteopenia, Paget's disease, osteolytic metastasis in cancer patients, osteodystrophy in liver disease and the altered bone metabolism caused by renal failure or haemodialysis, bone fracture, bone surgery, aging, pregnancy, protection against bone fractures, and malnutrition.
- In certain embodiments, the disease, disorder, or condition is diabetes.
- In other embodiments, the disease, disorder, or condition is NASH.
- In still other embodiments, the disease, disorder, or condition is obesity.
- In other embodiments, the disease, disorder, or condition is Alzheimer's disease (AD) or Parkinson's disease (PD).
- In still other embodiments, the disease, disorder, or condition is a bone disorder characterized by altered bone metabolism, such as osteoporosis, including post-menopausal osteoporosis, poor bone strength, osteopenia, Paget's disease, osteolytic metastasis in cancer patients, osteodystrophy in liver disease and the altered bone metabolism caused by renal failure or haemodialysis, bone fracture, bone surgery, aging, or pregnancy.
- In certain embodiments, the chemical entities described herein are useful for protection against bone fractures.
- The methods described herein can further include treating one or more conditions associated, co-morbid or sequela with any one or more of the conditions described herein. By way of non-limiting example, the methods can further include treating one or more conditions that are co-morbid or sequela with diabetes (e.g.,
type 2 diabetes), such as obesity, obesity-related disorders, metabolic syndrome, impaired glucose tolerance; insulin resistance; cardiovascular risk factors. (e.g., coronary artery disease, peripheral artery disease, cerebrovascular disease, hypertension, and risk factors related to unmanaged cholesterol and/or lipid levels, and/or inflammation), retinopathy, nephropathy, neuropathy, NASH, bone fracture and cognitive dysfunction. - In another aspect, this disclosure features methods for screening a candidate compound for treatment of a disease, disorder, or condition, in which modulation of GLP-1R and/or GIPR is beneficial for the treatment of the underlying pathology and/or symptoms and/or progression of the disease, disorder, or condition; the method comprising:
-
- (a) contacting the candidate compound with (i) a β-Arrestin-coupled GPCR receptor signaling complex or (ii) one or more GPCR receptor signaling complexes that are not complexed with β-arrestin (e.g., uncoupled GLP-1R and/or uncoupled GIPR); and
- (b) detecting (i) the disruption of the b-arrestin coupled complex; or (ii) detecting the formation of the signaling complex in the absence of b-arrestin coupling; wherein the candidate compound modulates (e.g., agonizes, partially agonizes) GLP-1R and/or GIPR.
- In certain embodiments, the methods further include selecting a candidate compound that exhibits a value of β-arrestin (GLP-1R) EC50>1 μM.
- The methods can further include identifying the subject.
- The methods can further include administering one or more other therapeutic agents (e.g., in combination with a chemical entity described herein).
- Embodiments can include one of more of the following advantageous properties.
- In some embodiments, the compounds described herein exhibit a value of AUC Score of 0-25% of vehicle, which corresponds to a finding of maximal decrease in glucose excursion compared to control.
- In some embodiments, the compounds described herein exhibit a value of cAMP (GLP-1R) EC50 of less than about 1 nM, which is indicative that the compound is a relatively potent GLP-1R agonist.
- In some embodiments, the compounds described herein exhibit a value of cAMP (GLP-1R) Emax of greater than about 80%, which is indicative that the compound is an agonist that can fully activate GLP-1R.
- In some embodiments, the compounds described herein exhibit a value of cAMP (GIPR) EC50 of less than about 10 nM, which is indicative that the compound is a relatively potent GIPR agonist.
- In some embodiments, the compounds described herein exhibit a value of cAMP (GIPR) EC50 of less than about 10 nM, which is indicative that the compound is a relatively potent GIPR antagonist.
- GLP-1 and GIP are susceptible to rapid degradation by dipeptidyl peptidase-IV (DPP-IV) (see, e.g., Deacon, et al. Journal of Clinical Endocrinology & Metabolism, 1995, 80, 952-957). As such, GLP-1 and GIP have been shown to exhibit relatively short half-life times in human due to DPP-IV degradation. Advantageously, the compounds described herein exhibit relatively long half-life times in the presence of DPP-IV when compared to those of GLP-1 and GIP.
- In some embodiments, the compounds described herein exhibit a value of β-arrestin coupling (GLP-1R) EC50>1 μM in a β-arrestin (GLP1R) assay that measures the formation of a complex between GLP-1R and β-arrestin in cells. A value of β-arrestin (GLP1R) EC50>1 μM indicates a compound that does not substantially induce β-arrestin recruitment to GLP-1R.
- In some embodiments, the compounds described herein exhibit a value of conditioned taste aversion (“CTA”)=0.6-1.0, which indicates no measurable aversion to a compound, which is desired. A value of CTA=0.0-0.6 indicates significant aversion to a compound. The conditioned taste aversion assay measures the preference for a dilute saccharin solution that is associated with compound administration.
- In some embodiments, the compounds described herein have a reduced likelihood of producing unwanted side effects when administered to a patient. A non-limiting example of such a side effect is nausea.
- Other embodiments include those described in the Detailed Description, drawings, and/or in the claims.
-
FIG. 1 depicts representative compounds of Formula (IAA). - To facilitate understanding of the disclosure set forth herein, a number of additional terms are defined below. Generally, the nomenclature used herein and the laboratory procedures in organic chemistry, medicinal chemistry, and pharmacology described herein are those well-known and commonly employed in the art. Unless defined otherwise, all technical and scientific terms used herein generally have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. Each of the patents, applications, published applications, and other publications that are mentioned throughout the specification and the attached appendices are incorporated herein by reference in their entireties.
- As used herein, the term “GLP-1R” is meant to include, without limitation, nucleic acids, polynucleotides, oligonucleotides, sense and antisense polynucleotide strands, complementary sequences, peptides, polypeptides, proteins, homologous and/or orthologous GLP-1R molecules, isoforms, precursors, mutants, variants, derivatives, splice variants, alleles, different species, and active fragments thereof.
- As used herein, the term “GIPR” is meant to include, without limitation, nucleic acids, polynucleotides, oligonucleotides, sense and antisense polynucleotide strands, complementary sequences, peptides, polypeptides, proteins, homologous and/or orthologous GIPR molecules, isoforms, precursors, mutants, variants, derivatives, splice variants, alleles, different species, and active fragments thereof.
- The term “acceptable” with respect to a formulation, composition or ingredient, as used herein, means having no persistent detrimental effect on the general health of the subject being treated.
- “API” refers to an active pharmaceutical ingredient.
- The term “IC50” or “EC50” refers an amount, concentration, or dosage of a compound that is required for 50% inhibition or activation of a maximal response observed for such compound (or that of a reference compound as the case may be) in an assay that measures such response.
- The terms “effective amount” or “therapeutically effective amount,” as used herein, refer to a sufficient amount of a chemical entity (e.g., a compound described generically or specifically herein, a pharmaceutically acceptable salt thereof, or compositions containing the same) being administered which will relieve to some extent one or more of the symptoms of the disease or condition being treated. The result includes reduction and/or alleviation of the signs, symptoms, or causes of a disease, or any other desired alteration of a biological system. For example, an “effective amount” for therapeutic uses is the amount of the composition comprising a compound as disclosed herein required to provide a clinically significant decrease in disease symptoms. An appropriate “effective” amount in any individual case is determined using any suitable technique, such as a dose escalation study.
- The term “excipient” or “pharmaceutically acceptable excipient” means a pharmaceutically-acceptable material, composition, or vehicle, such as a liquid or solid filler, diluent, carrier, solvent, or encapsulating material. In one embodiment, each component is “pharmaceutically acceptable” in the sense of being compatible with the other ingredients of a pharmaceutical formulation, and suitable for use in contact with the tissue or organ of humans and animals without excessive toxicity, irritation, allergic response, immunogenicity, or other problems or complications, commensurate with a reasonable benefit/risk ratio. See, e.g., Remington: The Science and Practice of Pharmacy, 21st ed.; Lippincott Williams & Wilkins: Philadelphia, P A, 2005; Handbook of Pharmaceutical Excipients, 6th ed.; Rowe et al., Eds.; The Pharmaceutical Press and the American Pharmaceutical Association: 2009; Handbook of Pharmaceutical Additives, 3rd ed.; Ash and Ash Eds.; Gower Publishing Company: 2007; Pharmaceutical Preformulation and Formulation, 2nd ed.; Gibson Ed.; CRC Press LLC: Boca Raton, F L, 2009.
- The term “pharmaceutically acceptable salt” refers to a formulation of a compound that does not cause significant irritation to an organism to which it is administered and does not abrogate the biological activity and properties of the compound. In certain instances, pharmaceutically acceptable salts are obtained by reacting a compound described herein, with acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, methanesulfonic acid, ethanesulfonic acid, p-toluenesulfonic acid, salicylic acid and the like. In some instances, pharmaceutically acceptable salts are obtained by reacting a compound having acidic group described herein with a base to form a salt such as an ammonium salt, an alkali metal salt, such as a sodium or a potassium salt, an alkaline earth metal salt, such as a calcium or a magnesium salt, a salt of organic bases such as dicyclohexylamine, N-methyl-D-glucamine, tris(hydroxymethyl)methylamine, and salts with amino acids such as arginine, lysine, and the like, or by other methods previously determined. The pharmacologically acceptable salt s not specifically limited as far as it can be used in medicaments. Examples of a salt that the compounds described hereinform with a base include the following: salts thereof with inorganic bases such as sodium, potassium, magnesium, calcium, and aluminum; salts thereof with organic bases such as methylamine, ethylamine and ethanolamine; salts thereof with basic amino acids such as lysine and ornithine; and ammonium salt. The salts may be acid addition salts, which are specifically exemplified by acid addition salts with the following: mineral acids such as hydrochloric acid, hydrobromic acid, hydroiodic acid, sulfuric acid, nitric acid, and phosphoric acid:organic acids such as formic acid, acetic acid, propionic acid, oxalic acid, malonic acid, succinic acid, fumaric acid, maleic acid, lactic acid, malic acid, tartaric acid, citric acid, methanesulfonic acid, and ethanesulfonic acid; acidic amino acids such as aspartic acid and glutamic acid.
- The term “pharmaceutical composition” refers to a mixture of a compound described herein with other chemical components (referred to collectively herein as “excipients”), such as carriers, stabilizers, diluents, dispersing agents, suspending agents, and/or thickening agents. The pharmaceutical composition facilitates administration of the compound to an organism. Multiple techniques of administering a compound exist in the art including, but not limited to rectal, oral, intravenous, aerosol, parenteral, ophthalmic, pulmonary, and topical administration.
- The term “subject” refers to an animal, including, but not limited to, a primate (e.g., human), monkey, cow, pig, sheep, goat, horse, dog, cat, rabbit, rat, or mouse. The terms “subject” and “patient” are used interchangeably herein in reference, for example, to a mammalian subject, such as a human.
- The terms “treat,” “treating,” and “treatment,” in the context of treating a disease, disorder, or condition, are meant to include alleviating or abrogating a disorder, disease, or condition, or one or more of the symptoms associated with the disorder, disease, or condition; or to slowing the progression, spread or worsening of a disease, disorder or condition or of one or more symptoms thereof.
- The term “halo” refers to fluoro (F), chloro (Cl), bromo (Br), or iodo (I).
- The term “alkyl” refers to a hydrocarbon chain that may be a straight chain or branched chain, containing the indicated number of carbon atoms. For example, C1-10 indicates that the group may have from 1 to 10 (inclusive) carbon atoms in it. Non-limiting examples include methyl, ethyl, iso-propyl, tert-butyl, n-hexyl.
- The term “haloalkyl” refers to an alkyl, in which one or more hydrogen atoms is/are replaced with an independently selected halo.
- The term “alkoxy” refers to an —O-alkyl radical (e.g., —OCH3).
- The term “haloalkoxy” refers to an —O-haloalkyl radical (e.g., —OCH3).
- The term “alkylene” refers to a branched or unbranched divalent alkyl (e.g., —CH2—).
- The term “arylene” and the like refer to divalent forms of the ring system, here divalent aryl.
- The term “alkenyl” refers to a hydrocarbon chain that may be a straight chain or branched chain having one or more carbon-carbon double bonds. The alkenyl moiety contains the indicated number of carbon atoms. For example, C2-6 indicates that the group may have from 2 to 6 (inclusive) carbon atoms in it.
- The term “alkynyl” refers to a hydrocarbon chain that may be a straight chain or branched chain having one or more carbon-carbon triple bonds. The alkynyl moiety contains the indicated number of carbon atoms. For example, C2-6 indicates that the group may have from 2 to 6 (inclusive) carbon atoms in it.
- The term “aryl” refers to a 6-carbon monocyclic, 10-carbon bicyclic, or 14-carbon tricyclic aromatic ring system wherein 0, 1, 2, 3, or 4 atoms of each ring may be substituted by a substituent, and wherein the ring comprising a monocyclic radical is aromatic and wherein at least one of the fused rings comprising a bicyclic or tricyclic radical is aromatic e.g. tetrahydronaphthyl. Examples of aryl groups also include phenyl, naphthyl and the like.
- The term “cycloalkyl” as used herein includes saturated cyclic hydrocarbon groups having 3 to 10 carbons, preferably 3 to 8 carbons, and more preferably 3 to 6 carbons, wherein the cycloalkyl group may be optionally substituted. Preferred cycloalkyl groups include, without limitation, cyclopropyl, cyclobutyl, cyclopentyl, cyclopentenyl, cyclohexyl, cyclohexenyl, cycloheptyl, and cyclooctyl.
- The term “heteroaryl” refers to an aromatic 5-8 membered monocyclic, 8-12 membered bicyclic, or 11-14 membered tricyclic ring system having 1-3 heteroatoms if monocyclic, 1-6 heteroatoms if bicyclic, or 1-9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S (e.g., carbon atoms and 1-3, 1-6, or 1-9 heteroatoms of N, O, or S if monocyclic, bicyclic, or tricyclic, respectively), wherein 0, 1, 2, 3, or 4 atoms of each ring may be substituted by a substituent, and wherein the ring comprising a monocyclic radical is aromatic and wherein at least one of the fused rings comprising a bicyclic or tricyclic radical is aromatic (but does not have to be a ring which contains a heteroatom, e.g. tetrahydroisoquinolinyl. Examples of heteroaryl groups also include pyridyl, furyl or furanyl, imidazolyl, benzimidazolyl, pyrimidinyl, thiophenyl or thienyl, quinolinyl, indolyl, thiazolyl, and the like.
- The term “heterocyclyl” refers to a nonaromatic 5-8 membered monocyclic, 8-12 membered bicyclic, or 11-14 membered tricyclic ring system having 1-3 heteroatoms if monocyclic, 1-6 heteroatoms if bicyclic, or 1-9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S (e.g., carbon atoms and 1-3, 1-6, or 1-9 heteroatoms of N, O, or S if monocyclic, bicyclic, or tricyclic, respectively), wherein 0, 1, 2 or 3 atoms of each ring may be substituted by a substituent. Examples of heterocyclyl groups include piperazinyl, pyrrolidinyl, dioxanyl, morpholinyl, tetrahydrofuranyl, and the like.
- In addition, atoms making up the compounds of the present embodiments are intended to include all isotopic forms of such atoms. Isotopes, as used herein, include those atoms having the same atomic number but different mass numbers. By way of general example and without limitation, isotopes of hydrogen include tritium and deuterium, and isotopes of carbon include 13C and 14C.
- The details of one or more embodiments of the invention are set forth in the description below and in the drawings. Other features and advantages will also be apparent from the claims.
- This disclosure features chemical entities (e.g., a compound or a pharmaceutically acceptable salt and/or hydrate and/or prodrug of the compound) that modulate (e.g., agonize or partially agonize or antagonize) glucagon-like peptide-1 receptor (“GLP-1R”) and/or the gastric inhibitory polypeptide receptor (“GIPR”). The chemical entities are useful, e.g., for treating a subject (e.g., a human) having a disease, disorder, or condition in which modulation (e.g., agonism, partial agonism or antagonism) of GLP-1R and/or GIPR activities is beneficial for the treatment or prevention of the underlying pathology and/or symptoms and/or progression of the disease, disorder, or condition. In some embodiments, the modulation results in an enhancement of (e.g., an increase in) existing levels (e.g., normal or below normal levels) of GLP-1R and/or GIPR activity (e.g., signaling). In some embodiments, the chemical entities described herein further modulate (e.g., attenuate, uncouple) β-arrestin signaling relative to what is observed with the native ligand. This disclosure also features compositions as well as other methods of using and making the said chemical entities.
- In one aspect, the disclosure provides a compound having formula (IAA), or a pharmaceutically acceptable salt thereof:
-
- wherein:
- ring A is:
- (i) a saturated or unsaturated monocyclic ring that includes from 3-8 ring atoms (inclusive of G and the nitrogen atom labelled N*); or
- (ii) a saturated or unsaturated bicyclic or tricyclic ring that includes from 6-14 ring atoms (inclusive of G and the nitrogen atom labelled N*), wherein:
- G is C(O), S(O), or SO2; and
- the dotted, circular line connecting G and N* is a divalent group that includes from 1-6 ring atoms; wherein:
- (a) from 0-2 of the divalent group's ring atoms are ring heteroatoms, which are each independently selected from the group consisting of N, N(Ra), O, S, and SO2; and
- (b) from 1-6 of the divalent group's ring atoms are ring carbon atoms, which are each independently selected from the group consisting of C, CH, CH2, CRb, C(Rb)2, and CHRb;
- wherein:
- (1) when ring A is a monocyclic ring, then each of the divalent group's 1-6 ring carbon atoms is independently selected from the group consisting of CH, CH2, CRb, C(Rb)2, and CHRb; and
- (2) when ring A is a bicyclic or tricyclic ring, then (A) or (B) applies:
- (A) two or three adjacent ring carbon atoms of the divalent group are each independently selected from the group consisting of the group consisting of C, CH, CH2, CRb, C(Rb)2, and CHRb and are fused to a second ring that is selected from the group consisting of:
- (a) C6-10 aryl optionally substituted with from 1-5 independently selected Rc;
- (b) heteroaryl including from 5-10 ring atoms, wherein from 1-4 ring atoms are each independently selected from the group consisting of N, N(Ra), O, and S, wherein the heteroaryl is optionally substituted with from 1-3 independently selected Rc;
- (c) C3-10 cycloalkyl optionally substituted with from 1-4 independently selected Rd,
- (d) heterocyclyl including from 3-10 ring atoms, wherein from 1-3 ring atoms are each independently selected from the group consisting of N(Ra), O, and S, wherein the heterocyclyl is optionally substituted with from 1-4 independently selected Rd; or
- (B) one of the divalent group's ring carbon atoms is C and is spiro-fused to a second ring that is selected from the group consisting of:
- (a) C3-10 cycloalkyl optionally substituted with from 1-4 independently selected Rd,
- (b) heterocyclyl including from 3-10 ring atoms, wherein from 1-3 ring atoms are each independently selected from the group consisting of N(Ra), O, and S, wherein the heterocyclyl is optionally substituted with from 1-4 independently selected Rd;
- L is:
- (i)—(CH2)m—X1—(CH2)n—X2—(CH2)p— (formula VIII), wherein m is from 1-6; n is from 0-2; and p is from 0-8;
- (ii) —C(O)—(CH2)n—X3—(CH2)p— (formula IX), wherein n is from 0-2; and p is from 0-8;
- (iii) —(CH2)q—, wherein q is from 1-10;
- (iv) —C(O)—; or
- (v) —(CH2)m—X1—(CH2)p— (formula VIII), wherein m is from 1-6; and p is from 0-8;
- X1 is —C(O)—; —N(R′)C(O)—; —C(O)N(R′)—; or —N(R′)C(O)NR′)—; wherein each occurrence of R′ is independently selected from the group consisting of: H and C1-4 alkyl;
- X2 is:
- (i) —O—;
- (ii) —S—;
- (iii) —S(O)t—, wherein t is 1 or 2;
- (iv) —C(Q1)(Q2)-, wherein each of Q1 and Q2 is independently selected from the group consisting of H and C1-4 alkyl; or Q1 and Q2, together with the carbon atom to which each is attached forms C3-10 cycloalkyl that is optionally substituted with from 1-4 independently selected Rd and optionally fused to phenyl;
- (v) C6-10 arylene optionally substituted with from 1-5 independently selected Rc;
- (vi) heteroarylene including from 5-10 ring atoms, wherein from 1-4 ring atoms are each independently selected from the group consisting of N, N(Ra), O, and S; and which is optionally substituted with from 1-5 independently selected Rc;
- (vii) C3-10 cycloalkylene optionally substituted with from 1-4 independently selected Rd.
- (viii) heterocycloalkylene including from 3-10 ring atoms, wherein from 1-3 ring atoms are each independently selected from the group consisting of N(Ra), O, and S; and which is optionally substituted with from 1-5 independently selected Rd
- (ix) C2-C4 alkenylene optionally substituted with from 1-2 Re; or
- (x) C2-C4 alkynylene optionally substituted with from 1-2 Re;
- X3 is: —O—; —S—; or —S(O)t—, wherein t is 1 or 2;
- each of R1, R2, and R4 is independently selected from the group consisting of H and unsubstituted C1-3 alkyl;
- R2′ is as defined according to (AA) or (BB) below:
- R2′ is
- wherein:
-
- R3 is —C(O)OH, —C(O)OR31, —CH(C(O)OH)2 or a carboxylic acid isostere (e.g., amide or tetrazolyl);
- a is 0-5;
- a′ is 0 or 1; and each of R3a and R3b is independently H or C1-3 alkyl;
- R2′ and R4 taken together with the atoms connecting them form a ring including from 5-8 ring atoms, wherein from 3-7 are ring carbon atoms each substituted with from 1-2 substituents independently selected from H, halo, hydroxy, oxo, and C1-3 alkyl; and from 0-1 is a heteroatom (in addition to the N attached to R1) selected from O, —NH, —N(C1-3 alkyl), and S (e.g., R4 and R3, taken together with the atoms to which each is attached form a ring including 5-8 ring atoms);
-
- R31 is:
- (i) C1-6 alkyl optionally substituted with from 1-2 independently selected Re;
- (ii) —(C0-3 alkylene)-C3-10 cycloalkyl, wherein the cycloalkyl is optionally substituted with from 1-4 independently selected Rd.
- (iii) —(C0-3 alkylene)-heterocyclyl including from 3-10 ring atoms, wherein from 1-3 ring atoms are each independently selected from the group consisting of N(Ra), O, and S, wherein the heterocyclyl is optionally substituted with from 1-4 independently selected Rd;
- (iv) —(C0-3 alkylene)-C6-10 aryl, wherein the aryl is optionally substituted with from 1-5 independently selected Rc; or
- (v) —(C0-3 alkylene)-heteroaryl including from 5-10 ring atoms, wherein from 1-4 ring atoms are each independently selected from the group consisting of N, N(Ra), O, and S, wherein the heteroaryl is optionally substituted with from 1-3 independently selected Rc;
- each occurrence of Ra is independently selected from the group consisting of: H; C1-4 alkyl; C3-6 cycloalkyl; —C(═O)(C1-6 alkyl); —C(═O)O(C1-6 alkyl); and —S(O)1-2(C1-6 alkyl);
- each occurrence of Rb is independently selected from the group consisting of: R31; C1-4 haloalkyl; —OH; oxo; —F; —N(Ra)(R″); C1-4 alkoxy; C1-4 haloalkoxy; —C(═O)(C1-4 alkyl); —C(═O)O(C1-6 alkyl); —C(═O)OH, —C(═O)N(R′″)(R″″), —S(O)1-2(C1-6 alkyl); and cyano;
- each occurrence of Rc is independently selected from the group consisting of: C1-6 alkyl optionally substituted with from 1-2 independently selected Re; C3-6 cycloalkyl; C1-4 haloalkyl; —OH; -halo; —NO2; N3; —N(Ra)(R″); C1-4 alkoxy; C1-4 thioalkoxy; C1-4 haloalkoxy; —OC(═O)(C1-6 alkyl); —C(═O)(C1-6 alkyl); —C(═O)O(C1-6 alkyl); —C(═O)OH, —C(═O)N(R′″)(R″″), —S(O)1-2(C1-6 alkyl); and cyano;
- each occurrence of Rd is independently selected from the group consisting of: C1-6 alkyl optionally substituted with from 1-2 independently selected Re; C1-4 haloalkyl; —OH; —F; Cl; —N(Ra)(R″); oxo; C1-4 alkoxy; C1-4 haloalkoxy; —OC(═O)(C1-6 alkyl); —C(═O)(C1-6 alkyl); —C(═O)O(C1-6 alkyl); —C(═O)OH, —C(═O)N(R′″)(R″″), —S(O)1-2(C1-6 alkyl); and cyano;
- each occurrence of Re is independently selected from the group consisting of: —OH; —N(Ra)(R″); C1-4 alkoxy; C1-4 haloalkoxy; —OC(═O)(C1-6 alkyl); —C(═O)O(C1-6 alkyl); —C(═O)OH, —C(═O)N(R′″)(R″″), —S(O)1-2(C1-6 alkyl); and cyano;
- each occurrence of R″, R′″, and R″″ is independently selected from the group consisting of: H and C1-6 alkyl; and
- W is a peptide having the formula W′—R5, wherein W′ is a sequence of from 5-60 amino acids, and R5 is a C-terminal amino acid, amino acid ester, or amino acid amide that is optionally substituted with from 1-2 modifying groups (e.g., 1-2 groups selected from an acyl group and a PEG group).
- In some embodiments, the compound has Formula (IIAA):
- In some embodiments, the compound has Formula (IIAA-B):
- In some embodiments, the compound has Formula (IA):
-
- wherein:
- ring A is:
- (i) a saturated or unsaturated monocyclic ring that includes from 3-8 ring atoms (inclusive of G and the nitrogen atom labelled N*); or
- (ii) a saturated or unsaturated bicyclic or tricyclic ring that includes from 6-14 ring atoms (inclusive of G and the nitrogen atom labelled N*), wherein:
- G is C(O), S(O), or SO2; and
- the dotted, circular line connecting G and N* is a divalent group that includes from 1-6 ring atoms; wherein:
- (a) from 0-2 of the divalent group's ring atoms are ring heteroatoms, which are each independently selected from the group consisting of N, N(Ra), O, S, and SO2; and
- (b) from 1-6 of the divalent group's ring atoms are ring carbon atoms, which are each independently selected from the group consisting of C, CH, CH2, CRb, C(Rb)2, and CHRb;
- wherein:
- (1) when ring A is a monocyclic ring, then each of the divalent group's 1-6 ring carbon atoms is independently selected from the group consisting of CH, CH2, CRb, C(Rb)2, and CHRb; and
- (2) when ring A is a bicyclic or tricyclic ring, then (A) or (B) applies:
- (A) two or three adjacent ring carbon atoms of the divalent group are each independently selected from the group consisting of C, CH, and, CRb and are fused to a second ring that is selected from the group consisting of:
- (a) C6-10 aryl optionally substituted with from 1-5 independently selected Rc;
- (b) heteroaryl including from 5-10 ring atoms, wherein from 1-4 ring atoms are each independently selected from the group consisting of N, N(Ra), O, and S, wherein the heteroaryl is optionally substituted with from 1-3 independently selected Rc;
- (c) C3-10 cycloalkyl optionally substituted with from 1-4 independently selected Rd;
- (d) heterocyclyl including from 3-10 ring atoms, wherein from 1-3 ring atoms are each independently selected from the group consisting of N(Ra), O, and S, wherein the heterocyclyl is optionally substituted with from 1-4 independently selected Rd; or
- (B) one of the divalent group's ring carbon atoms is C and is spiro-fused to a second ring that is selected from the group consisting of:
- (a) C3-10 cycloalkyl optionally substituted with from 1-4 independently selected Rd;
- (b) heterocyclyl including from 3-10 ring atoms, wherein from 1-3 ring atoms are each independently selected from the group consisting of N(Ra), O, and S, wherein the heterocyclyl is optionally substituted with from 1-4 independently selected Rd;
- L is:
- (i) —(CH2)m—X1—(CH2)n—X2—(CH2)p— (formula VIII), wherein m is from 1-6; n is from 0-2; and p is from 0-8;
- (ii) —C(O)—(CH2)n—X3—(CH2)p— (formula IX), wherein n is from 0-2; and p is from 0-8;
- (iii) —(CH2)q—, wherein q is from 1-10;
- (iv) —C(O)—; or
- (v) —(CH2)m—X1—(CH2)p— (formula VIII), wherein m is from 1-6; and p is from 0-8;
- X is —C(O)—; —N(R′)C(O)—; —C(O)N(R′)—; or —N(R′)C(O)NR′)—; wherein each occurrence of R′ is independently selected from the group consisting of: H and C1-4 alkyl;
- X2 is:
- (i) —O—;
- (ii) —S—;
- (iii) —S(O)t—, wherein t is 1 or 2;
- (iv) —C(Q1)(Q2)-, wherein each of Q1 and Q2 is independently selected from the group consisting of H and C1-4 alkyl; or Q1 and Q2, together with the carbon atom to which each is attached forms C3-10 cycloalkyl that is optionally substituted with from 1-4 independently selected Rd and optionally fused to phenyl;
- (v) C6-10 arylene optionally substituted with from 1-5 independently selected Rc;
- (vi) heteroarylene including from 5-10 ring atoms, wherein from 1-4 ring atoms are each independently selected from the group consisting of N, N(Ra), O, and S; and which is optionally substituted with from 1-5 independently selected Re;
- (vii) C3-10 cycloalkylene optionally substituted with from 1-4 independently selected Rd.
- (viii) heterocycloalkylene including from 3-10 ring atoms, wherein from 1-3 ring atoms are each independently selected from the group consisting of N(Ra), O, and S; and which is optionally substituted with from 1-5 independently selected Rd;
- (ix) C2-C4 alkenylene optionally substituted with from 1-2 Re; or
- (x) C2-C4 alkynylene optionally substituted with from 1-2 Re;
- X3 is: —O—; —S—; or —S(O)t—, wherein t is 1 or 2;
- each of R1, R2, and R4 is independently selected from the group consisting of H and unsubstituted C1-3 alkyl;
- R3 is —C(O)OH, —C(O)OR31, —CH(C(O)OH)2 or a carboxylic acid isostere (e.g., amide or tetrazolyl);
- a is 0-5;
- a′ is 0 or 1;
- each of R3a and R3b is independently H or C1-3 alkyl;
- R31 is:
- (i) C1-6 alkyl optionally substituted with from 1-2 independently selected Re;
- (ii) —(C0-3 alkylene)-C3-10 cycloalkyl, wherein the cycloalkyl is optionally substituted with from 1-4 independently selected Rd;
- (iii) —(C0-3 alkylene)-heterocyclyl including from 3-10 ring atoms, wherein from 1-3 ring atoms are each independently selected from the group consisting of N(Ra), O, and S, wherein the heterocyclyl is optionally substituted with from 1-4 independently selected Rd;
- (iv) —(C0-3 alkylene)-C6-10 aryl, wherein the aryl is optionally substituted with from 1-5 independently selected Rc; or
- (v) —(C0-3 alkylene)-heteroaryl including from 5-10 ring atoms, wherein from 1-4 ring atoms are each independently selected from the group consisting of N, N(Ra), O, and S, wherein the heteroaryl is optionally substituted with from 1-3 independently selected Rc;
- each occurrence of Ra is independently selected from the group consisting of: H; C1-4 alkyl; C3-6 cycloalkyl; —C(═O)(C1-6 alkyl); —C(═O)O(C1-6 alkyl); and —S(O)1-2(C1-6 alkyl);
- each occurrence of Rb is independently selected from the group consisting of: R31; C1-4 haloalkyl; —OH; oxo; —F; —N(Ra)(R″); C1-4 alkoxy; C1-4 haloalkoxy; —C(═O)(C1-4 alkyl); —C(═O)O(C1-6 alkyl); —C(═O)OH, —C(═O)N(R′″)(R″″), —S(O)1-2(C1-6 alkyl); and cyano;
- each occurrence of Rc is independently selected from the group consisting of: C1-6 alkyl optionally substituted with from 1-2 independently selected Re; C3-6 cycloalkyl; C1-4 haloalkyl; —OH; -halo; —NO2; N3; —N(Ra)(R″); C1-4 alkoxy; C1-4 thioalkoxy; C1-4 haloalkoxy; —OC(═O)(C1-6 alkyl); —C(═O)(C1-6 alkyl); —C(═O)O(C1-6 alkyl); —C(═O)OH, —C(═O)N(R′″)(R″″), —S(O)1-2(C1-6 alkyl); and cyano;
- each occurrence of Rd is independently selected from the group consisting of: C1-6 alkyl optionally substituted with from 1-2 independently selected Re; C1-4 haloalkyl; —OH; —F; Cl; —N(Ra)(R″); oxo; C1-4 alkoxy; C1-4 haloalkoxy; —OC(═O)(C1-6 alkyl); —C(═O)(C1-6 alkyl); —C(═O)O(C1-6 alkyl); —C(═O)OH, —C(═O)N(R′″)(R″″), —S(O)1-2(C1-6 alkyl); and cyano;
- each occurrence of Re is independently selected from the group consisting of: —OH; —N(Ra)(R″); C1-4 alkoxy; C1-4 haloalkoxy; —OC(═O)(C1-6 alkyl); —C(═O)O(C1-6 alkyl); —C(═O)OH, —C(═O)N(R′″)(R″″), —S(O)1-2(C1-6 alkyl); and cyano;
- each occurrence of R″, R′″, and R″″ is independently selected from the group consisting of: H and C1-6 alkyl; and
- W is a peptide having the formula W′—R5, wherein W′ is a sequence of from 5-60 amino acids, and R5 is a C-terminal amino acid, amino acid ester, or amino acid amide that is optionally substituted with from 1-2 modifying groups (e.g., 1-2 groups selected from an acyl group and a PEG group).
- In some embodiments, the compound has Formula (IIA):
- In some embodiments, the compound has Formula (I):
-
- wherein:
- ring A is:
- (i) a saturated or unsaturated monocyclic ring that includes from 3-8 ring atoms (inclusive of G and the nitrogen atom labelled N*); or
- (ii) a saturated or unsaturated bicyclic or tricyclic ring that includes from 6-14 ring atoms (inclusive of G and the nitrogen atom labelled N*), wherein:
- G is C(O), S(O), or SO2; and
- the dotted, circular line connecting G and N* is a divalent group that includes from 1-6 ring atoms; wherein:
- (a) from 0-2 of the divalent group's ring atoms are ring heteroatoms, which are each independently selected from the group consisting of N, N(Ra), O, S, and SO2; and
- (b) from 1-6 of the divalent group's ring atoms are ring carbon atoms, which are each independently selected from the group consisting of C, CH, CH2, CRb, C(Rb)2, and CHRb;
- wherein:
- (1) when ring A is a monocyclic ring, then each of the divalent group's 1-6 ring carbon atoms is independently selected from the group consisting of CH, CH2, CRb, C(Rb)2, and CHRb; and
- (2) when ring A is a bicyclic or tricyclic ring, then (A) or (B) applies:
- (A) two or three adjacent ring carbon atoms of the divalent group are each independently selected from the group consisting of C, CH, and, CRb and are fused to a second ring that is selected from the group consisting of:
- (a) C6-10 aryl optionally substituted with from 1-5 independently selected Rc;
- (b) heteroaryl including from 5-10 ring atoms, wherein from 1-4 ring atoms are each independently selected from the group consisting of N, N(Ra), O, and S, wherein the heteroaryl is optionally substituted with from 1-3 independently selected Rc;
- (c) C3-10 cycloalkyl optionally substituted with from 1-4 independently selected Rd.
- (d) heterocyclyl including from 3-10 ring atoms, wherein from 1-3 ring atoms are each independently selected from the group consisting of N(Ra), O, and S, wherein the heterocyclyl is optionally substituted with from 1-4 independently selected Rd; or
- (A) two or three adjacent ring carbon atoms of the divalent group are each independently selected from the group consisting of C, CH, and, CRb and are fused to a second ring that is selected from the group consisting of:
- (B) one of the divalent group's ring carbon atoms is C and is spiro-fused to a second ring that is selected from the group consisting of:
- (a) C3-10 cycloalkyl optionally substituted with from 1-4 independently selected Rd;
- (b) heterocyclyl including from 3-10 ring atoms, wherein from 1-3 ring atoms are each independently selected from the group consisting of N(Ra), O, and S, wherein the heterocyclyl is optionally substituted with from 1-4 independently selected Rd;
- L is:
- (i) —(CH2)m—X1—(CH2)n—X2—(CH2)p— (formula VIII), wherein m is from 1-6; n is from 0-2; and p is from 0-8;
- (ii) —C(O)—(CH2)n—X3—(CH2)p— (formula IX), wherein n is from 0-2; and p is from 0-8;
- (iii) —(CH2)q—, wherein q is from 1-10;
- (iv) —C(O)—; or
- (v) —(CH2)m—X1—(CH2)p— (formula VIII), wherein m is from 1-6; and p is from 0-8;
- X1 is —C(O)—; —N(R′)C(O)—; —C(O)N(R′)—; or —N(R′)C(O)NR′)—; wherein each occurrence of R′ is independently selected from the group consisting of: H and C1-4 alkyl;
- X2 is:
- (i) —O—;
- (ii) —S—;
- (iii) —S(O)t—, wherein t is 1 or 2;
- (iv) —C(Q1)(Q2)-, wherein each of Q1 and Q2 is independently selected from the group consisting of H and C1-4 alkyl; or Q1 and Q2, together with the carbon atom to which each is attached forms C3-10 cycloalkyl that is optionally substituted with from 1-4 independently selected Rd and optionally fused to phenyl;
- (v) C6-10 arylene optionally substituted with from 1-5 independently selected Re;
- (vi) heteroarylene including from 5-10 ring atoms, wherein from 1-4 ring atoms are each independently selected from the group consisting of N, N(Ra), O, and S; and which is optionally substituted with from 1-5 independently selected Re;
- (vii) C3-10 cycloalkylene optionally substituted with from 1-4 independently selected Rd.
- (viii) heterocycloalkylene including from 3-10 ring atoms, wherein from 1-3 ring atoms are each independently selected from the group consisting of N(Ra), O, and S; and which is optionally substituted with from 1-5 independently selected Rd;
- (ix) C2-C4 alkenylene optionally substituted with from 1-2 Re; or
- (x) C2-C4 alkynylene optionally substituted with from 1-2 Re;
- X3 is: —O—; —S—; or —S(O)t—, wherein t is 1 or 2;
- each of R1, R2, and R4 is independently selected from the group consisting of H and unsubstituted C1-3 alkyl;
- R3 is —C(O)OH, —C(O)OR31, or a carboxylic acid isostere; wherein R31 is:
- (i) C1-6 alkyl optionally substituted with from 1-2 independently selected Re;
- (ii) —(C0-3 alkylene)-C3-10 cycloalkyl, wherein the cycloalkyl is optionally substituted with from 1-4 independently selected Rd;
- (iii) —(C0-3 alkylene)-heterocyclyl including from 3-10 ring atoms, wherein from 1-3 ring atoms are each independently selected from the group consisting of N(Ra), O, and S, wherein the heterocyclyl is optionally substituted with from 1-4 independently selected Rd;
- (iv) —(C0-3 alkylene)-C6-10 aryl, wherein the aryl is optionally substituted with from 1-5 independently selected Rc; or
- (v) —(C0-3 alkylene)-heteroaryl including from 5-10 ring atoms, wherein from 1-4 ring atoms are each independently selected from the group consisting of N, N(Ra), O, and S, wherein the heteroaryl is optionally substituted with from 1-3 independently selected Rc;
- a is 0-5;
- each occurrence of Ra is independently selected from the group consisting of: H; C1-4 alkyl; C3-6 cycloalkyl; —C(═O)(C1-6 alkyl); —C(═O)O(C1-6 alkyl); and —S(O)1-2(C1-6 alkyl);
- each occurrence of Rb is independently selected from the group consisting of: R31; C1-4 haloalkyl; —OH; oxo; —F; —N(Ra)(R″); C1-4 alkoxy; C1-4 haloalkoxy; —C(═O)(C1-4 alkyl); —C(═O)O(C1-6 alkyl); —C(═O)OH, —C(═O)N(R′″)(R″″), —S(O)1-2(C1-6 alkyl); and cyano;
- each occurrence of Rc is independently selected from the group consisting of: C1-6 alkyl optionally substituted with from 1-2 independently selected Re; C3-6 cycloalkyl; C1-4 haloalkyl; —OH; -halo; —NO2; N3; —N(Ra)(R″); C1-4 alkoxy; C1-4 thioalkoxy; C1-4 haloalkoxy; —OC(═O)(C1-6 alkyl); —C(═O)(C1-6 alkyl); —C(═O)O(C1-6 alkyl); —C(═O)OH, —C(═O)N(R′″)(R″″), —S(O)1-2(C1-6 alkyl); and cyano;
- each occurrence of Rd is independently selected from the group consisting of: C1-6 alkyl optionally substituted with from 1-2 independently selected Re; C1-4 haloalkyl; —OH; —F; Cl; —N(Ra)(R″); oxo; C1-4 alkoxy; C1-4 haloalkoxy; —OC(═O)(C1-6 alkyl); —C(═O)(C1-6 alkyl); —C(═O)O(C1-6 alkyl); —C(═O)OH, —C(═O)N(R′″)(R″″), —S(O)1-2(C1-6 alkyl); and cyano;
- each occurrence of Re is independently selected from the group consisting of: —OH; —N(Ra)(R″); C1-4 alkoxy; C1-4 haloalkoxy; —OC(═O)(C1-6 alkyl); —C(═O)O(C1-6 alkyl); —C(═O)OH, —C(═O)N(R′″)(R″″), —S(O)1-2(C1-6 alkyl); and cyano;
- each occurrence of R″, R′″, and R″″ is independently selected from the group consisting of: H and C1-6 alkyl; and
- W is a peptide having the formula W′—R5, wherein W′ is a sequence of from 5-60 amino acids, and R5 is a C-terminal amino acid, amino acid ester, or amino acid amide that is optionally substituted with from 1-2 modifying groups (e.g., 1-2 groups selected from an acyl group and a PEG group).
- In some embodiments, one or more of the compound provisions delineated herein (e.g., as delineated in the section below) apply.
- Compound Provisions
- In some embodiments, the compound is other than CAS RN 1401463-49-7; and/or CAS RN 1116465-43-0; and/or CAS RN 1614237-35-2, and/or CAS RN 1614237-36-3; and/or CAS RN 1353718-57-6; and/or CAS Registry Number: 1083307-90-7, in which each of the registered chemical structures is incorporated herein by reference.
- In some embodiments, the compound is not any of the compounds disclosed in Nacheva et al., Organic & Biomolecular Chemistry, 2012, 10 (38), 7840-7846, Chopra et al., Bioconjugate Chemistry, 2009, 20 (2), 231-240, and PCT application publication No. WO 2013/148579, each of which is incorporated by reference.
- In some embodiments, ring A is other than unsubstituted maleimide-1-yl, i.e.:
- In certain embodiments, when L is —(CH2)2—, —(CH2)5—C(O)NH—CH2—, or —(CH2)2—C(O)NH—(CH2)6—, then ring A is other than unsubstituted maleimid-1-yl.
- In certain embodiments, when L is —(CH2)2—, —(CH2)5—C(O)NH—CH2—, or —(CH2)2—C(O)NH—(CH2)6—, and a is 1, then ring A is other than unsubstituted maleimid-1-yl.
- In some embodiments, ring A is other than substituted maleimid-1-yl (e.g., other than 3,4-bis(2,4-difluorophenyl)-maleimid-1-yl, i.e.:
- In certain embodiments, when L is —(CH2)3—, then ring A is other than substituted maleimid-1-yl (e.g., other than 3,4-bis(2,4-difluorophenyl)-maleimid-1-yl).
- In certain embodiments, when L is —(CH2)3—, and a is 1, then ring A is other than substituted maleimid-1-yl (e.g., other than 3,4-bis(2,4-difluorophenyl)-maleimid-1-yl).
- In some embodiments, ring A is other than optionally substituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl, (e.g., other than unsubstituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl, i.e.:
- In certain embodiments, when L is —(CH2)3—, then ring A is other than optionally substituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl, (e.g., other than unsubstituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl).
- In certain embodiments, when L is —(CH2)3—, and a is 0, then ring A is other than than optionally substituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl, (e.g., unsubstituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl).
- In some embodiments, ring A is other than:
-
- (i) unsubstituted maleimid-1-yl; and
- (ii) substituted maleimid-1-yl (e.g., other than 3,4-bis(2,4-difluorophenyl)-maleimid-1-yl).
- In some embodiments, ring A is other than:
-
- (i) unsubstituted maleimid-1-yl;
- (ii) substituted maleimid-1-yl (e.g., other than 3,4-bis(2,4-difluorophenyl)-maleimid-1-yl), and
- (iii) optionally substituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl, (e.g., other than unsubstituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl).
- In Some Embodiments:
-
- (i) when L is —(CH2)2—, —(CH2)5—C(O)NH—CH2—, or —(CH2)2—C(O)NH—(CH2)6—, then ring A is other than unsubstituted maleimid-1-yl; and
- (ii) when L is —(CH2)3—, then ring A is other than substituted maleimid-1-yl (e.g., other than 3,4-bis(2,4-difluorophenyl)-maleimid-1-yl).
- In Some Embodiments:
-
- (i) when L is —(CH2)2—, —(CH2)5—C(O)NH—CH2—, or —(CH2)2—C(O)NH—(CH2)6—, and a is 1, then ring A is other than unsubstituted maleimid-1-yl; and
- (ii) when L is —(CH2)3—, and a is 1, then ring A is other than substituted maleimid-1-yl (e.g., other than 3,4-bis(2,4-difluorophenyl)-maleimid-1-yl).
- In Some Embodiments:
-
- (i) when L is —(CH2)2—, —(CH2)5—C(O)NH—CH2—, or —(CH2)2—C(O)NH—(CH2)6—, then ring A is other than unsubstituted maleimid-1-yl;
- (ii) when L is —(CH2)3—, then ring A is other than substituted maleimid-1-yl (e.g., other than 3,4-bis(2,4-difluorophenyl)-maleimid-1-yl); and
- (iii) when L is —(CH2)3—, then ring A is other than optionally substituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl, (e.g., other than unsubstituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl).
- In Some Embodiments:
-
- (i) when L is —(CH2)2—, —(CH2)5—C(O)NH—CH2—, or —(CH2)2—C(O)NH—(CH2)6—, and a is 1, then ring A is other than unsubstituted maleimid-1-yl;
- (ii) when L is —(CH2)3—, and a is 1, then ring A is other than substituted maleimid-1-yl (e.g., other than 3,4-bis(2,4-difluorophenyl)-maleimid-1-yl); and
- (iii) when L is —(CH2)3—, and a is 0, then ring A is other than optionally substituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl, (e.g., unsubstituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl.
- In some embodiments, the first three amino acids in W′ must be glycine-threonine-phenylalanine (GTF).
- In some embodiments, W′ must include 11 or more amino acids (e.g., 12 or more, 13 or more, 14 or more, 15 or more, 16 or more, 17 or more, 18 or more, 19 or more, 20 or more, 25 or more, 30 or more amino acids).
- In some embodiments, the first three amino acids in W′ must be glycine-threonine-phenylalanine (GTF); and W′ must include 11 or more amino acids (e.g., 12 or more, 13 or more, 14 or more, 15 or more, 16 or more, 17 or more, 18 or more, 19 or more, 20 or more, 25 or more, 30 or more amino acids).
- In certain of these embodiments, one or more of the following applies. Ring A is unsubstituted maleimid-1-yl, and L is —(CH2)2—, —(CH2)5—C(O)NH—CH2—, or —(CH2)2—C(O)NH—(CH2)6— (optionally, a is 1). Ring A is substituted maleimid-1-yl (e.g., 3,4-bis(2,4-difluorophenyl)-maleimid-1-yl), and L is —(CH2)3— (optionally, a is 1). Ring A is optionally substituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl, (e.g., unsubstituted N-[2-(1,3-dioxo-1H-benz[de]isoquinolin-2(3H)-yl) (optionally, a is 0).
- In certain embodiments, when L is (CH2)q, q is not 3. In certain embodiments, when ring A is substituted with 2 Rb groups, the Rb groups are not both o,p-(di-fluoro)phenyl, or ring A is substituted with 2 o,p-(di-fluoro)phenyl groups, the first amino acid in the sequence W′ is not valine, or when ring A is substituted with 2 o,p-(di-fluoro)phenyl groups, L is not (CH2)3; or when L is (CH2)3, the first amino acid is the sequence W′ is not valine.
- In certain embodiments, when L is —(CH2)m—X1—(CH2)n—X2—(CH2)p—, m is 5, X1 is —C(O)NH—, n and p are each zero, and X2 is CQ1Q2, at least one of Q1 and Q2 is not H. In certain embodiments, when L is —(CH2)m—X1—(CH2)n—X2—(CH2)p—, m is 5, X1 is —C(O)NH—, n and p are each zero, and X2 is CH2, ring A is not —N-maleimide. or In certain embodiments, when L is —(CH2)m—X1—(CH2)n—X2—(CH2)p—, m is 5, X1 is —C(O)NH—, n and p are each zero, X2 is CH2, and ring A is —N-maleimide, the first amino acid is the sequence W′ is not glycine.
- In certain embodiments, when L is —(CH2)m—X1—(CH2)n—X2—(CH2)p—, m is 2, X1 is —C(O)NH—, the sum of n and p is 5, and X2 is CQ1Q2, at least one of Q1 and Q2 is not H. In certain embodiments, when L is —(CH2)m—X1—(CH2)n—X2—(CH2)p—, m is 2, X1 is —C(O)NH—, the sum of n and p is 5, and X2 is CH2, ring A is not-N-maleimide. In certain embodiments, when L is —(CH2)m—X1—(CH2)n—X2—(CH2)p—, m is 2, X1 is —C(O)NH—, the sum of n and p is 5, X2 is CH2, and ring A is —N-maleimide, the first amino acid in the sequence W′ is not alanine.
- In certain embodiments, when L is (CH2)q, q is not 2; or when L is (CH2)2, ring A is not —N-maleimide; or when L is (CH2)2 and ring A is —N-maleimide, the first amino acid in the sequence W′ is not alanine.
- Ring A
- In some embodiments, G is C(O). By way of non-limiting example, such compounds can include those having formula (I-A), (I-AA), or (I-AB):
- Further non-limiting examples include compounds having formula (IA-A), (IA-AA), or (IA-AB):
- In some embodiments, G is S(O) or SO2. By way of non-limiting example, such compounds can include those having formula (I-B), (I-BA), or (I-BB):
- Further non-limiting examples include compounds having formula (IA-B), (IA-BA), or (IA-BB):
- In some embodiments, ring A is a saturated or unsaturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms.
- In certain of these embodiments, ring A is saturated. In other embodiments, ring A is unsaturated. In certain of these embodiments, ring A includes 4-7 ring atoms or 5-6 ring atoms.
- In certain embodiments, ring A is a saturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms.
- In certain embodiments, ring A is a saturated monocyclic ring that includes from 5-7 ring atoms.
- In certain embodiments, ring A is a saturated monocyclic ring that includes from 5-6 ring atoms.
- In certain embodiments, ring A has the following formula (III):
-
- wherein:
- A1 is a bond, A1A-A1B, C(O), CH2, CHRb, or C(Rb)2;
- each of A1A and A1B is independently C(O), CH2, CHRb, or C(Rb)2;
- A2 is C(O), CH2, CHRb, or C(Rb)2;
- A3 is C(O), CH2, CHRb, or C(Rb)2, O; S; SO2, or N(Ra);
- A4 is C(O), CH2, CHRb, or C(Rb)2; O; S; or N(Ra); provided that A3 and A4 cannot both be O; S; or N(Ra); or a combination thereof.
- In certain embodiments, ring A has formula (III):
-
- wherein:
- A1 is a bond, C(O), CH2, CHRb, or C(Rb)2;
- A2 is C(O), CH2, CHRb, or C(Rb)2;
- A3 is C(O), CH2, CHRb, or C(Rb)2, O; S; SO2, or N(Ra); and
- A4 is CH2, CHRb, or C(Rb)2; O; S; or N(Ra); provided that A3 and A4 cannot both be O; S; or N(Ra); or a combination thereof.
- In certain embodiments of formula (III), A1 is other than a bond (i.e., A1 is C(O), CH2, CHRb, or C(Rb)2), and ring A includes 6 ring atoms (i.e., ring A is a 6-membered ring).
- In certain formula (III), 6-membered ring embodiments, A1 is CH2, CHRb, or C(Rb)2. For example, A1 can be CH2. In other embodiments, A1 is C(O).
- In certain formula (III), 6-membered ring embodiments, A2 is CH2, CHRb, or C(Rb)2. For example, A2 can be CH2.
- In certain formula (III), 6-membered ring embodiments, A3 is CH2, CHRb, or C(Rb)2. For example, A3 can be CH2. In other embodiments, A3 is O; S; SO2; or N(Ra).
- In certain formula (III), 6-membered ring embodiments, A4 is CH2, CHRb, or C(Rb)2. For example, A4 can be CH2. In other embodiments, A4 is O; S; or N(Ra).
- In certain formula (III), 6-membered ring embodiments, A2, A3 and A4 are each independently selected from the group consisting of CH2, CHRb, or C(Rb)2.
- In certain embodiments, one or two (e.g., one) of A2, A3 and A4 are independently selected from the group consisting of CHRb and C(Rb)2, and the other(s) is/are CH2.
- In certain formula (III), 6-membered ring embodiments, A2, A3 and A4 are each CH2.
- In certain formula (III), 6-membered ring embodiments, A2 and A4 are each independently selected from the group consisting of CH2, CHRb, and C(Rb)2; and A3 is O; S; SO2; or N(Ra). In certain of these embodiments, one or two (e.g., one) of A2 and A4 are independently selected from the group consisting of CHRb and C(Rb)2, and the other (where applicable) is CH2. In other embodiments, A2 and A4 are both CH2. In certain of these embodiments, A3 is N(Ra) (e.g., A3 can be NH). In other embodiments, A3 is O. In still other embodiments, A3 is SO2.
- In certain formula (III), 6-membered ring embodiments, A2 and A3 are each independently selected from the group consisting of CH2, CHRb, and C(Rb)2; and A4 is O; S; or N(Ra). In certain of these embodiments, one or two (e.g., one) of A2 and A3 are independently selected from the group consisting of CHRb and C(Rb)2, and the other (where applicable) is CH2. In other embodiments, A2 and A3 are both CH2. In certain of these embodiments, A4 is N(Ra) (e.g., A4 can be NH). In other embodiments, A4 is O.
- In certain formula (III), 6-membered ring embodiments, A1, A2, A3 and A4 are each independently selected from the group consisting of CH2, CHRb, or C(Rb)2.
- In certain formula (III), 6-membered ring embodiments, one or two (e.g., one) of A1, A2, A3 and A4 are independently selected from the group consisting of CHRb and C(Rb)2, and the others are CH2.
- In certain formula (III), 6-membered ring embodiments, A1, A2, A3 and A4 are each CH2.
- In certain formula (III), 6-membered ring embodiments, A1, A2 and A4 are each independently selected from the group consisting of CH2, CHRb, and C(Rb)2; and A3 is O; S; SO2; or N(Ra). In certain of these embodiments, one or two (e.g., one) of A2 and A4 are independently selected from the group consisting of CHRb and C(Rb)2, and the other (where applicable) is CH2. In other embodiments, A2 and A3 are both CH2. In certain of these embodiments, A1 is CH2. In certain of these embodiments, A3 is N(Ra) (e.g., A3 can be NH). In other embodiments, A3 is O. In still other embodiments, A3 is SO2.
- In certain formula (III), 6-membered ring embodiments, A1, A2 and A3 are each independently selected from the group consisting of CH2, CHRb, and C(Rb)2; and A4 is O; S; or N(Ra). In certain of these embodiments, one or two (e.g., one) of A2 and A4 are independently selected from the group consisting of CHRb and C(Rb)2, and the other (where applicable) is CH2. In other embodiments, A2 and A3 are both CH2. In certain of these embodiments, A1 is CH2. In certain of these embodiments, A4 is N(Ra) (e.g., A4 can be NH). In other embodiments, A4 is O.
- In certain formula (III), 6-membered ring embodiments, A1 is C(O); and A2, A3 and A4 are each independently selected from the group consisting of CH2, CHRb, or C(Rb)2. In certain of these embodiments, one or two (e.g., one) of A2, A3 and A4 are independently selected from the group consisting of CHRb and C(Rb)2, and the other(s) is/are CH2.
- In certain formula (III), 6-membered ring embodiments, A1 is C(O); and A2, A3 and A4 are each CH2.
- In certain formula (III), 6-membered ring embodiments, A1 is C(O); A2 and A4 are each independently selected from the group consisting of CH2, CHRb, and C(Rb)2; and A3 is O; S; SO2; or N(Ra). In certain of these embodiments, one or two (e.g., one) of A2 and A4 are independently selected from the group consisting of CHRb and C(Rb)2, and the other (where applicable) is CH2. In other embodiments, A2 and A4 are both CH2. In certain of these embodiments, A3 is N(Ra) (e.g., A3 can be NH). In other embodiments, A3 is O. In still other embodiments, A3 is SO2.
- In certain formula (III), 6-membered ring embodiments, A1 is C(O); A2 and A3 are each independently selected from the group consisting of CH2, CHRb, and C(Rb)2; and A4 is O; S; or N(Ra). In certain of these embodiments, one or two (e.g., one) of A2 and A3 are independently selected from the group consisting of CHRb and C(Rb)2, and the other (where applicable) is CH2. In other embodiments, A2 and A3 are both CH2. In certain of these embodiments, A4 is N(Ra) (e.g., A4 can be NH). In other embodiments, A4 is O.
- In certain embodiments of formula (III), A1 is a bond, and ring A includes 5 ring atoms (i.e., ring A is a 5-membered ring), and ring A has formula (III-A):
- In certain formula (III-A) embodiments, A2 is C(═O). In other embodiments, A2 is CH2, CHRb, or C(Rb)2; for example, A2 can be CH2.
- In certain formula (III-A) embodiments, A3 is O; S; or N(Re). For example, A3 can be S. As another example, A3 can be N(Ra) (e.g., A3 can be NH).
- In certain formula (III-A) embodiments, A4 is CH2, CHRb, or C(Rb)2. For example, A4 can be CHRb or C(Rb)2. As another example, A4 can be CH2.
- In certain formula (III-A) embodiments, A2 is C(═O); A3 is O; S; or N(Re); and A4 is CH2, CHRb, or C(Rb)2. In certain of these embodiments, A3 is S. In other embodiments, A3 is N(Ra) (e.g., A3 is NH). In certain of these embodiments, A4 is CH2. In other embodiments, A4 is CHRb or C(Rb)2.
- In certain formula (III-A) embodiments, A2 is C(═O); and each of A3 and A4 is independently selected from CH2, CHRb, or C(Rb)2. In certain of these embodiments, each of A3 and A4 is CH2. In other embodiments, one of A3 and A4 is CH2, and the other of A3 and A4 is CHRb or C(Rb)2. In still other embodiments, each of A3 and A4 is independently selected from CHRb or C(Rb)2.
- In certain formula (III-A) embodiments, A2 is CH2, CHRb, or C(Rb)2, e.g., A2 can be CH2; and each of A3 and A4 is independently selected from CH2, CHRb, or C(Rb)2 (e.g., each of A3 and A4 is CH2).
- In certain of formula (III) embodiments, A1 is A1A-A1B.
- In certain of the foregoing formula (III) embodiments, each of A1A and A1B is independently CH2, CHRb, or C(Rb)2. As a non-limiting example, each of A1A and A1B can be independently CH2.
- In certain of formula (III) embodiments (when A1 is A1A-A1B), A2 is CH2, CHRb, or C(Rb)2. As a non-limiting example, A2 can be CH2.
- In certain of formula (III) embodiments (when A1 is A1A-A1B), A3 is CH2, CHRb, or C(Rb)2. As a non-limiting example, A3 can be CH2.
- In certain of formula (III) embodiments (when A1 is A1A-A1B), A4 is CH2, CHRb, or C(Rb)2. As a non-limiting example, A4 is CH2.
- In certain of the foregoing formula (III) and (III-A) embodiments, each occurrence of Rb is independently selected from the group consisting of:
-
- (i) C1-6 alkyl optionally substituted with from 1-2 independently selected Re.
- (ii) —(C0-3 alkylene)-C6-10 aryl, wherein the aryl is optionally substituted with from 1-5 independently selected Rc;
- (iii) —(C0-3 alkylene)-heteroaryl including from 5-10 ring atoms, wherein from 1-4 ring atoms are each independently selected from the group consisting of N, N(Ra), O, and S, wherein the heteroaryl is optionally substituted with from 1-3 independently selected Rc;
- (iv) —OH;
- (v) —N(Ra)(R″);
- (vi) C1-4 alkoxy; and
- (vii) C1-4 haloalkoxy; and
- (viii) —F.
- In certain of the formula (III) and (III-A) embodiments, each occurrence of Rb is independently selected from the group consisting of:
-
- (i) C1-6 alkyl;
- (iv) —OH;
- (v) —N(Ra)(R″);
- (vi) C1-4 alkoxy;
- (vii) C1-4 haloalkoxy; and
- (viii) —F.
- In certain of the foregoing formula (III) embodiments, each occurrence of Rb is independently selected from the group consisting of: C1-6 alkyl optionally substituted with from 1-2 independently selected Re; phenyl optionally substituted with from 1-5 independently selected Rc; —OH; —F; —N(Ra)(R″); and C1-4 alkoxy.
- Non-limiting examples of ring A moities having formula (III) or (III-A) are delineated in tabular format in Table 1 below.
-
TABLE 1 Example A1 A2 A3 A4 III-1 Bond C(O) S CH2 III-2 CH2 CH2 CH2 CH2 III-3 Bond C(O) NH CH2 III-4 CH2 CH2 S CH2 III-5 CH2 CH2 SO2 CH2 III-6 CH2—CH2 CH2 CH2 CH2 III-7 CH2 CH2 CH2 C(O) III-8 CH2 CH2 O CH2 - In some embodiments, ring A is an unsaturated monocyclic ring that includes from 4-8 (e.g., 4-7, 5-6) ring atoms.
- In certain embodiments, ring A is an unsaturated monocyclic ring that includes from 4-7 ring atoms.
- In certain embodiments, ring A is an unsaturated monocyclic ring that includes from 5-6 ring atoms.
- In certain embodiments, ring A is an unsaturated monocyclic ring that includes 6 ring atoms.
- In certain embodiments, ring A is other than an unsaturated monocyclic ring that includes 5 ring atoms (e.g., other than maleimide, e.g, unsubstituted or di-substituted maleimide).
- In certain of these embodiments, ring A has formula (IV):
-
- wherein:
- each of A6, and A7 is independently selected from CH and CRb; and
- each of A5 and A8 is independently N, CH, or CRb.
- In certain of these embodiments, ring A has formula (IV):
-
- wherein:
- each of A5, A6, and A7 is independently selected from CH and CRb; and
- A8 is N, CH, or CRb.
- In certain formula (IV) embodiments, A5, A6, A7, and A8 are each independently selected from CH and CRb. For example, one or two of A5, A6, A7, and A8 are an independently selected CRb, and the others are CH. As another example, A5, A6, A7, and A8 are each CH.
- In other formula (IV) embodiments, A5, A6, and A7 are each independently selected from CH and CRb, and A8 is N. For example, one or two of A5, A6, and A7 are an independently selected CRb, and the others are CH. As another example, A5, A6, and A7 are each CH.
- In still other formula (IV) embodiments, A5 is N; and each of A6, A7, and A8 is independently selected from CH and CRb (e.g., one of A6, A7, and A8 is CRb (e.g., C—OH)).
- In certain of the foregoing formula (IV) embodiments, each occurrence of Rb is independently selected from the group consisting of: R3; C1-4 haloalkyl; —OH; —N(Ra)(R″); C1-4 alkoxy; and C1-4 haloalkoxy.
- In certain of the foregoing formula (IV) embodiments, each occurrence of Rb is independently selected from the group consisting of: R31; —OH; —N(Ra)(R″); C1-4 alkoxy; and C1-4 haloalkoxy.
- In certain of the foregoing formula (IV) embodiments, each occurrence of Rb is independently selected from the group consisting of:
-
- (i) C1-6 alkyl optionally substituted with from 1-2 independently selected Re.
- (ii) —(C0-3 alkylene)-C6-10 aryl, wherein the aryl is optionally substituted with from 1-5 independently selected Rc;
- (iii) —(C0-3 alkylene)-heteroaryl including from 5-10 ring atoms, wherein from 1-4 ring atoms are each independently selected from the group consisting of N, N(Ra), O, and S, wherein the heteroaryl is optionally substituted with from 1-3 independently selected Rc;
- (iv) —OH;
- (v) —N(Ra)(R″);
- (vi) C1-4 alkoxy;
- (vii) C1-4 haloalkoxy; and
- (viii) —F.
- In certain of these embodiments, ring A has formula (V):
-
- wherein:
- each of A6 and A7 is independently selected from CH and CRb; and
- A8 is N, CH, or CRb.
- In other formula (V) embodiments, A6 and A7 are each CH. In other formula (IV) embodiments, A6 and A7 cannot both be CH.
- In certain formula (V) embodiments, one of A6 and A7 is CRb, the other of A6 and A7 is CH.
- In other formula (IV) embodiments, A6 and A7 are each an independently selected CRb. In other formula (IV) embodiments, A6 and A7 cannot both be an independently selected CRb. In certain of these embodiments, when A6 and A7 are each an independently selected CRb, then both Rb substituents cannot be C6-10 aryl (e.g., phenyl) substituted with from 1-5 independently selected Rc. As another example, both Rb substituents cannot be C6-10 aryl (e.g., phenyl) substituted with from 1-3 or 1-2 independently selected Rc. For example, both Rb substituents cannot be C6-10 aryl (e.g., phenyl), substituted with from 1-5 independently halo (e.g., fluoro). As another example, both Rb substituents cannot be C6-10 aryl (e.g., phenyl), substituted with from 1-3 or 1-2 independently selected halo (e.g., fluoro). For example, both Rb substituents cannot be difluorophenyl, e.g., o,p-(di-fluoro)phenyl.
- In some embodiments, ring A is a saturated or unsaturated bicyclic or tricyclic ring that includes from 7-9 (e.g., 7-8, e.g, 7) ring atoms.
- In certain of these embodiments, (A) applies (e.g., three adjacent ring carbon atoms of the divalent group are each independently selected from the group consisting of C, CH, CRb, CH2, C(Rb)H, C(Rb)2 and are fused to a second ring).
- In certain of these embodiments, ring A has the following formula:
- wherein D is:
-
- (c) C3-10 cycloalkyl optionally substituted with from 1-4 independently selected Rd; or
- (d) heterocyclyl including from 4-10 ring atoms, wherein from 1-3 ring atoms are each independently selected from the group consisting of N(Ra), O, and S, wherein the heterocyclyl is optionally substituted with from 1-4 independently selected Rd.
- As non-limiting examples of the foregoing embodiments, ring A can be:
- In some embodiments, ring A is a saturated or unsaturated bicyclic or tricyclic ring that includes from 8-10 ring atoms.
- In certain of these embodiments, ring A is saturated. In other embodiments, ring A is unsaturated.
- In certain of these embodiments, (A) applies (e.g., two adjacent ring carbon atoms of the divalent group are each independently selected from the group consisting of C, CH, and, CRb and are fused to a second ring). In other embodiments, (B) applies.
- In certain embodiments, ring A is an unsaturated bicyclic or tricyclic ring that includes from 8-10 ring atoms. In certain of these embodiments, (A) applies. In certain of these embodiments, ring A is optionally further substituted with 1 oxo.
- In certain embodiments, (A) applies, ring A is optionally further substituted with 1 oxo, and ring A has formula (VI):
- In certain of these embodiments, fused ring B is fused C6-10 aryl optionally substituted with from 1-5 independently selected Rc. For example, fused ring B can be fused phenyl optionally substituted with from 1-5 independently selected Rc. As a further example, ring A can have formula (VI-A):
- wherein Rc′ is H or Rc (e.g., C1-6 alkyl, e.g., CH3).
- In certain of the formula (VI) embodiments, ring B is fused C10 aryl optionally substituted with from 1-5 independently selected Rc (e.g., unsubstituted).
- In certain of the formula (VI) embodiments, ring B is fused heteroaryl including from 5-10 (e.g., 6) ring atoms, wherein from 1-4 (e.g., 1) ring atoms are each independently selected from the group consisting of N, N(Ra), O, and S, wherein the heteroaryl is optionally substituted with from 1-3 independently selected Rc.
- In certain embodiments, ring A is selected from one of the follows:
- In certain of the foregoing embodiments, each fused ring B is independently selected from:
-
- fused heteroaryl including from 5-10 (e.g., 6) ring atoms, wherein from 1-4 (e.g., 1) ring atoms are each independently selected from the group consisting of N, N(Ra), O, and S, wherein the heteroaryl is optionally substituted with from 1-3 independently selected Rc; and
- fused C6-10 (e.g., C6) aryl optionally substituted with from 1-5 (e.g., from 1-2) independently selected Rc.
- As a non-limiting example, each fused ring B can be independently a fused C6-10 (e.g., C6) aryl optionally substituted with from 1-5 (e.g., from 1-2) independently selected Rc.
- In certain embodiments, ring A is a saturated bicyclic or tricyclic ring that includes from 8-10 ring atoms. In certain of these embodiments, (A) applies. In other embodiments, (B) applies. In certain of these embodiments, ring A is optionally further substituted with 1 oxo.
- In certain embodiments, (A) applies, ring A is optionally further substituted with 1 oxo, and ring A has formula (VI):
- In certain of these embodiments, fused ring B is fused C3-10 cycloalkyl optionally substituted with from 1-4 independently selected Rd. For example, fused ring B can be fused C3-6 cycloalkyl (e.g., C3-4 cycloalkyl) optionally substituted with from 1-4 independently selected Rd (e.g., Rd can be C1-3 alkyl).
- In other embodiments, (B) applies, ring A is optionally further substituted with 1 oxo, and ring A has formula (VII):
- In certain of these embodiments, the spiro-fused ring B is spiro-fused C3-10 cycloalkyl optionally substituted with from 1-4 independently selected Rd. For example, the spiro-fused ring B is spiro-fused C3-6 cycloalkyl (e.g., C3-4 cycloalkyl) optionally substituted with from 1-4 independently selected Rd (e.g., Rd can be C1-3 alkyl).
- Variable L
- In some embodiments, L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—.
- In certain embodiments of formula (VIII), m is from 2-6 (e.g., m can be 2).
- In certain embodiments of formula (VIII), m is 1.
- In certain embodiments of formula (VIII), X1 is —N(R′)C(O)— (e.g., X1 can be —N(H)C(O)—).
- In certain embodiments of formula (VIII), n+p≥2. For example, n+p=2 (e.g., each of n and p is 1). As another example, n+p≥2 (e.g., n+p=3, 4, 5, 6, 7, 8, 9, or 10).
- In another embodiment, n+p<2.
- In still other embodiments, n+p=0.
- In certain embodiments of formula (VIII), X2 is: —O—; —S—; or —S(O)t—, wherein t is 1 or 2. For example, X2 can be —S—.
- In certain embodiments of formula (VIII), X2 is —C(Q1)(Q2)-.
- In certain of these embodiments, each of Q1 and Q2 is independently selected from the group consisting of H and C1-4 alkyl. For example, one of Q1 and Q2 can be H, and the other of Q1 and Q2 can be C1-4 alkyl (e.g., CH3). For example, Q1 can be H; and Q2 can be C1-4 alkyl. As another example, each of Q1 and Q2 can be H. As a further example, each of Q1 and Q2 can be an independently selected C1-4 alkyl.
- In other embodiments, Q1 and Q2, together with the carbon atom to which each is attached forms C3-10 cycloalkyl that is optionally substituted with from 1-4 independently selected Rd and optionally fused to phenyl. For example, Q1 and Q2, together with the carbon atom to which each is attached forms C3-6 cycloalkyl that is optionally substituted with from 1-4 independently selected Rd and optionally fused to phenyl.
- In certain of the foregoing embodiments, Q1 and Q2, together with the carbon atom to which each is attached forms C4-6 (e.g., C4) cycloalkyl that is optionally substituted with from 1-2 independently selected Rd.
- In certain embodiments of formula (VIII), X2 is:
-
- (v) C6-10 arylene optionally substituted with from 1-5 independently selected Rc;
- (vi) heteroarylene including from 5-10 ring atoms, wherein from 1-4 ring atoms are each independently selected from the group consisting of N, N(Ra), O, and S; and which is optionally substituted with from 1-5 independently selected Rc;
- (vii) C3-10 cycloalkylene optionally substituted with from 1-4 independently selected Rd; or
- (viii) heterocycloalkylene including from 3-10 ring atoms, wherein from 1-3 ring atoms are each independently selected from the group consisting of N(Ra), O, and S; and which is optionally substituted with from 1-5 independently selected Rd.
- For example, X2 can be:
-
- (v) C6-10 arylene optionally substituted with from 1-5 independently selected Rc; or
- (vii) C3-10 cycloalkylene optionally substituted with from 1-4 independently selected Rd.
- As another example, X2 can be:
-
- (v) phenylene optionally substituted with from 1-5 (e.g., 1-3, 1-2, 1) independently selected Rc; or
- (vii) C3-6 cycloalkylene (e.g., C3-4 cycloalkylene) optionally substituted with from 1-4 independently selected Rd (e.g., Rd can be C1-3 alkyl).
- In certain embodiments of formula (VIII), X2 is (viii) heterocycloalkylene including from 3-10 ring atoms, wherein from 1-3 ring atoms are each independently selected from the group consisting of N(Ra), O, and S; and which is optionally substituted with from 1-5 independently selected Rd.
- In certain embodiments of formula (VIII), X2 is (viii) heterocycloalkylene including from 4-6 (e.g., 4) ring atoms, wherein from 1-3 (e.g., 1) ring atoms are each independently selected from the group consisting of N(Ra), O, and S; and which is optionally substituted with from 1-5 independently selected Rd (e.g., X2 can be
- In some embodiments, L has formula (IX): L has formula (IX): —C(O)—(CH2)n—X3—(CH2)p—. In certain of these embodiments, n+p≥2. For example, n+p=2 (e.g., each of n and p is 1). As another example, n+p>2. In certain of these embodiments, X3 is —S—.
- Non-Limiting L Combinations
- [1] In certain embodiments of formula (VIII):
-
- m is from 2-6;
- n+p≥2; and
- X2 is: —O—; —S—; or —S(O)t—.
- In certain of these embodiments, m is 2.
- In certain of these embodiments, X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—).
- In certain of these embodiments, n+p>2.
- In certain of these embodiments, n+p=2 (e.g., each of n and p is 1).
- In certain of these embodiments X2 is —S—.
- In certain of these embodiments, m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), and n+p>2.
- In certain of these embodiments, m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), and n+p>2, and X2 is —S—.
- In certain of these embodiments, m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), and n+p=2 (e.g., each of n and p is 1).
- In certain of these embodiments, m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), and n+p=2 (e.g., each of n and p is 1), and X2 is —S—.
- For example, L can be —CH2CH2NHC(O)CH2SCH2—.
- [2] In certain embodiments of formula (VIII):
-
- m is from 2-6;
- n+p<2; and
- X2 is:
- (i) —C(Q1)(Q2)-, wherein each of Q1 and Q2 is an independently selected C1-4 alkyl; or Q1 and Q2, together with the carbon atom to which each is attached forms C3-10 cycloalkyl that is optionally substituted with from 1-4 independently selected Rd and optionally fused to phenyl;
- (v) C6-10 arylene optionally substituted with from 1-5 independently selected Rc;
- (vi) heteroarylene including from 5-10 ring atoms, wherein from 1-4 ring atoms are each independently selected from the group consisting of N, N(Ra), O, and S; and which is optionally substituted with from 1-5 independently selected Rc;
- (vii) C3-10 cycloalkylene optionally substituted with from 1-4 independently selected Rd; or
- (viii) heterocycloalkylene including from 3-10 ring atoms, wherein from 1-3 ring atoms are each independently selected from the group consisting of N(Ra), O, and S; and which is optionally substituted with from 1-5 independently selected Rd.
- In certain of these embodiments, m is 2.
- In certain of these embodiments, X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—).
- In certain of these embodiments, n+p=0.
- In certain of these embodiments, X2 is —C(Q1)(Q2)-.
- In certain of these embodiments, each of Q1 and Q2 is H.
- In certain of these embodiments, Q1 is C1-4 alkyl.
- In certain of these embodiments, Q2 is C1-4 alkyl.
- In certain of these embodiments, each of Q1 and Q2 is an independently selected C1-4 alkyl (e.g., CH3).
- In certain of these embodiments, Q1 and Q2, together with the carbon atom to which each is attached forms C3-6 cycloalkyl that is optionally substituted with from 1-4 independently selected Rd and optionally fused to phenyl.
- In certain of these embodiments, X2 is:
-
- (v) C6-10 arylene optionally substituted with from 1-5 independently selected Rc; or
- (vii) C3-10 cycloalkylene optionally substituted with from 1-4 independently selected Rd.
- In certain of these embodiments, X2 is (viii) heterocycloalkylene including from 4-6 (e.g., 4) ring atoms, wherein from 1-3 (e.g., 1) ring atoms are each independently selected from the group consisting of N(Ra), O, and S; and which is optionally substituted with from 1-5 independently selected Rd (e.g., X2 can be
- In certain of these embodiments, m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), and n+p=0.
- In certain of these embodiments, m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, X2 is —C(Q1)(Q2)-, and Q1 and Q2, together with the carbon atom to which each is attached forms C3-6 cycloalkyl that is optionally substituted with from 1-4 independently selected Rd and optionally fused to phenyl.
- In certain of these embodiments, m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, X2 is —C(Q1)(Q2)-, and Q1 and Q2 is an independently selected C1-4 alkyl (e.g., CH3).
- In certain of these embodiments, m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, and X2 is: (v) C6-10 arylene (e.g., phenylene) optionally substituted with from 1-5 independently selected Re; or (vii) C3-10 cycloalkylene optionally substituted with from 1-4 independently selected Rd.
- [3] In certain embodiments of formula (IX): n+p=2 (e.g., each of n and p is 1), and X3 is —S—.
- [4] In certain embodiments of formula (VIII):
-
- m is 1;
- n+p<2; and
- X2 is: —O—; —S—; —S(O)t—, or C(Q1)(Q2).
- In certain of these embodiments, n+p=2.
- In certain of these embodiments, X2 is —S—.
- In certain of these embodiments, n+p<2 (e.g., n+p=0; or n+p=1).
- In certain of these foregoing embodiments, X2 is C(Q1)(Q2).
- In certain of these embodiments, each of Q1 and Q2 is H.
- In certain of these embodiments, each of Q1 and Q2 is C1-4 alkyl.
- In certain of these embodiments, Q1 is H; and Q2 is C1-4 alkyl.
- Variables R1, R2, R2′, and R4
- In some embodiments, R1 is H. In some embodiments, R2 is H. In some embodiments, R4 is H.
- In some embodiments, two of R1, R2, and R4 are H.
- In some embodiments, each of R1, R2, and R4 is H.
- In some embodiments, R2 is unsubstituted C1-3 alkyl (e.g., methyl).
- In some embodiments, R1 and R4 is H.
- In some embodiments, R2′ is as defined according to (AA).
- In certain embodiments, a′ is 1.
- In certain of these embodiments, each of R3a and R3A is H.
- In certain of these embodiments, each of R3a and R3b is C1-3 alkyl (e.g., methyl).
- In other embodiments, a′ is 0.
- In some embodiments, R3 is —C(O)OH. In other embodiments, R3 is a carboxylic acid isostere. Non-limiting examples of carboxylic acid isosteres include noncarbon acyclic acids such as phosphonic/phosphinic and sulfonic/sulfinic acids and sulfonamides; modified carbon-based acids such as hydroxamic acids, hydroxamic esters, acylureas, acyl sulfonamides, and sulfonyl ureas; optionally substituted heteroaryl and heterocyclyl-based isosteres, such as those based on optionally substituted tetrazole, oxadiazol-5(4H)-thione, thiadiazol-5(4H)-one, oxathiadiazole and oxidized forms thereof, isoxazole, thiazolidinedione, oxazolidinedione, tetramic acid, and derivatives thereof, and optionally substituted cycloalkyl and aryl-based isosteres, such as those based on optionally substituted cyclopentane-1,3-dione, phenol and squaric acid and derivatives thereof (e.g., tetrazolyl or amide). In certain embodiments, R3 is an amide. In certain embodiments, R3 is an optionally substituted tetrazolyl (e.g., unsubstituted tetrazolyl). In certain embodiments, R3 is an optionally substituted isoxazolyl (e.g., isoxazolyl substituted with hydroxy (e.g.,
- In some embodiments, a is 1-5 (e.g., 1-4, 1-3, 1-2). In some embodiments, a is 0. In some embodiments, a is 0, 1, or 2. In certain embodiments, a is 1. In other embodiments, a is 2. In still other embodiments, a is 0. In some embodiments, a is 0, 1, 2, or 3 (e.g., a=0; or a=1; or a=2).
- Variables W, W′, and R5
- W is a peptide having the formula W′—R5, wherein W′ is a sequence of from 5-60 amino acids, and R5 is a C-terminal amino acid, amino acid ester, or amino acid amide that is optionally substituted with from 1-2 modifying groups (e.g., 1-2 groups selected from an acyl group and a PEG group). As used herein, “peptide” refers to a chain of amino acid monomers (sometimes termed “residues”) linked by peptide (amide) bonds (or an isosteric replacement thereof), which have an N-terminal (N—R4 in formulae (IAA), (IA), or (I)) and a C-terminal amino acid residue (R5) at each of the ends of the peptide. The term peptide also includes modified peptides, including, e.g., any one or more of the modifications described herein.
- Constituent Amino Acids and Modifications Thereof
- In some embodiments, W includes one or more naturally occurring amino acids found, e.g., in polypeptides and/or proteins produced by living organisms, such as Ala (A), Val (V), Leu (L), Ile (I), Pro (P), Phe (F), Trp (W), Met (M), Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gln (Q), Asp (D), Glu (E), Lys (K), Arg (R), and His (H).
- In some embodiments, W includes one or more independently selected modifications that occur present in so-called modified peptides. Such modifications include, but not limited to: (i) the incorporation of lactam-bridge; (ii) head-to-tail cyclization; (iii) one or more alternative or non-naturally occurring (D or L) amino acids, such as synthetic non-native amino acids, substituted amino acids, and D-amino acids; (iv) peptide bond replacements; (v) targeting groups; and the like. In certain embodiments, W includes one modification in either the W′ or R5 component. In other embodiments, W includes more than one independently selected modification (e.g., 2 independently selected modifications, 3 independently selected modifications, 4 independently selected modifications, 5 independently selected modifications, 6 independently selected modifications, 7 independently selected modifications, 8 independently selected modifications, 9 independently selected modifications, or 10 independently selected modifications that occur in the W′ and/or R5 component (e.g., in the W′ component only; or in the R5 component only; or in both the W′ and R5 components).
- Non-limiting examples of alternative or non-naturally amino acids include, D-amino acids; beta-amino acids; homocysteine, phosphoserine, phosphothreonine, phosphotyrosine, hydroxyproline, gamma-carboxyglutamate; hippuric acid, octahydroindole-2-carboxylic acid, statine, 1,2,3,4,-tetrahydroisoquinoline-3-carboxylic acid, penicillamine (3-mercapto-D-valine), ornithine, citruline, alpha-methyl-alanine, para-benzoylphenylalanine, para-amino phenylalanine, p-fluorophenylalanine, phenylglycine, propargylglycine, sarcosine, and tert-butylglycine), diaminobutyric acid, 7-hydroxy-tetrahydroisoquinoline carboxylic acid, naphthylalanine, biphenylalanine, cyclohexylalanine, amino-isobutyric acid, norvaline, norleucine, tert-leucine, tetrahydroisoquinoline carboxylic acid, pipecolic acid, phenylglycine, homophenylalanine, cyclohexylglycine, dehydroleucine, 2,2-diethylglycine, 1-amino-1-cyclopentanecarboxylic acid, 1-amino-1-cyclohexanecarboxylic acid, amino-benzoic acid, amino-naphthoic acid, gamma-aminobutyric acid, difluorophenylalanine, nipecotic acid, alpha-amino butyric acid, thienyl-alanine, t-butylglycine, trifluorovaline; hexafluoroleucine; fluorinated analogs; azide-modified amino acids; alkyne-modified amino acids; cyano-modified amino acids; and derivatives thereof (each which can be, where appropriate can each independently be D or L amino acids).
- Non-limiting examples of peptide bond replacements include urea, thiourea, carbamate, sulfonyl urea, trifluoroethylamine, ortho-(aminoalkyl)-phenylacetic acid, para-(aminoalkyl)-phenylacetic acid, meta-(aminoalkyl)-phenylacetic acid, thioamide, tetrazole, boronic ester, olefinic group, and derivatives thereof.
- Other non-limiting examples of modifications and/or moieties include PEGylation; glycosylation; HESylation; ELPylation; lipidation; acetylation; amidation; end-capping modifications (e.g., amidation at the C-terminus, introduction of C-terminal alcohol, aldehyde, ester, and thioester moieties); cyano groups; phosphorylation; cyclization, conjugation with targeting moieties and/or agents that increase retention in the body (e.g., agents such as cellulose, fatty acids, polyethylene glycol (PEG) or combinations thereof); incorporation of retro-inverso peptide motif (ie., a peptide with a reversal of the direction of the peptide bond on at least one position);
- In certain embodiments, W includes only naturally occurring amino acids. In other embodiments, W includes only alternative or non-naturally occurring amino acids. In still other embodiments, W includes one or more naturally occurring amino acids and one or more alternative or non-naturally occurring amino acids. In certain of the foregoing embodiments, W includes only L amino acids; or W includes both D and L amino acids; or W includes only D amino acids. While not wishing to be bound by theory, it is believed that the incorporation of D amino acids can confer enhanced in vivo or intracellular stability to the compounds described herein.
- In some embodiments, W includes amino acid residues each of Formula XAA:
- wherein each of Raa1 and Raa2 is independently selected from:
-
- (a) H;
- (b) C1-6 alkyl, which is optionally substituted with from 1-3 Rba;
- (c) (C0-3 alkylene)-C3-10 cycloalkyl, which is optionally substituted with from 1-4 Rba;
- (d) (C0-3 alkylene)-heterocyclyl, wherein the heterocyclyl includes from 3-10 ring atoms, wherein from 1-3 ring atoms are heteroatoms, each independently selected from the group consisting of N(Rda), O, and S, and wherein one or more of the heterocyclyl ring carbon atoms are optionally substituted with from 1-4 independently selected Rba,
- (e) (C0-3 alkylene)-C6-C10 aryl, which is optionally substituted with from 1-4 Rca;
- (f) (C0-3 alkylene)-heteroaryl, wherein the heteroaryl includes from 5-10 ring atoms, wherein from 1-4 ring atoms are heteroatoms, each independently selected from the group consisting of N, N(Rda), O, and S, and wherein one or more of the heteroaryl ring carbon atoms are optionally substituted with from 1-4 independently selected Rca; OR
- (g) Raa1 and Rda, in the —C(═O)CRaa1(Raa2)N(Rda)— group, combine to form a ring including from 5-8 ring atoms, wherein the ring includes: (a) from 1-6 ring carbon atoms (in addition to CRaa1(Raa2)), each of which is substituted with from 1-2 substituents independently selected from H and C1-3 alkyl; and (b) from 0-3 ring heteroatoms (in addition to the nitrogen atom attached to Rda), which are each independently selected from the group consisting of N(Rda), O, and S;
- each occurrence of Rba is selected from the group consisting of —C(═O)(OH); —C(═O)(C2-20 alkyl); —C(═O)NR′R″; —NHC(═NR′)NR′R″; —C(═O)O(C2-20 alkyl); —S(O)0-2(C1-6 alkyl); oxo; F; C1-10 alkoxy; C1-10 haloalkoxy; azido; —N(Rga)(Rha);
- each occurrence of Rca is independently selected from the group consisting of: —OH; —SH; —F; —Cl; —Br; —NR′R″; C1-4 alkyl; C1-4 haloalkyl; C1-4 alkoxy; C1-4 haloalkoxy; —C(═O)O(C1-4 alkyl); —C(═O)(C1-4 alkyl); —C(═O)OH; —CON(R′)(R″); —S(O)1-2(NR′R″); —S(O)0-2(C1-4 alkyl); cyano; —NR′C(═NR′)NR′R″; C6-10 aryl optionally substituted with 1-4 substituents independently selected from halo, C1-4 alkyl, and C1-4 haloalkyl; and C3-6 cycloalkyl optionally substituted with from 1-4 independently selected C1-4 alkyl;
- each occurrence of Rda is independently selected from the group consisting of: H, C1-6 alkyl; C3-6 cycloalkyl; —C(O)(C1-4 alkyl); —C(O)O(C1-4 alkyl); —CON(R′)(R″); —S(O)1-2 (NR′R″); —S(O)1-2(C1-4 alkyl); —OH; and C1-4 alkoxy; or Raa1 and Rda, in the —C(═O)CRaa1(Raa2) N(Rda)— group, combine to form a ring including from 5-8 ring atoms as defined above;
- each occurrence of Rga and Rha is independently selected from the group consisting of H; C1-4 alkyl; —C(═O)O(C2-20 alkyl); and —S(O)1-2(C1-6 alkyl); and
- each occurrence of R′ and R″ is independently selected from the group consisting of: H and C1-4 alkyl; or R′ and R″ together with the nitrogen atom to which each is attached forms a ring including from 3-8 ring atoms, wherein the ring includes: (a) from 1-7 ring carbon atoms, each of which is substituted with from 1-2 substituents independently selected from H and C1-3 alkyl; and (b) from 0-3 ring heteroatoms (in addition to the nitrogen atom attached to R′ and R″), which are each independently selected from the group consisting of N(H), O, and S;
- or a C-terminal amino acid or an amino acid ester or an amino acid amide thereof.
- In some embodiments, W includes 25-45 amino acid residues of Formula XAA, wherein Raa2 is H; or a C-terminal amino acid or an amino acid ester or an amino acid amide thereof.
- In certain of these embodiments, Raa1 is selected from the group consisting of:
-
- H;
- C1-C6 alkyl optionally substituted with 1-2 substituents selected from —NH2, —OH, —SH, —SMe, —NH(C═NH)NH2, CO2H, and CO2NH2;
- (C1-C6 alkylene)-phenyl, optionally substituted with 1-2—OH;
- (C1-C6 alkylene)-indolyl; and
- (C1-C6 alkylene)-imidazolyl; or
- Raa1 and Rda, in the —CH(Raa1)N(Rda)— group, combine to form a pyrrolidine ring.
- As non-limiting examples of the foregoing, W can include from 25-45 naturally occurring amino acids found, e.g., in polypeptides and/or proteins produced by living organisms, such as Ala (A), Val (V), Leu (L), Ile (I), Pro (P), Phe (F), Trp (W), Met (M), Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gln (Q), Asp (D), Glu (E), Lys (K), Arg (R), and His (H); or amino acid ester or amino acid amide thereof.
- In certain embodiments, W includes from 1-2 (e.g., 1) amino acid residue of Formula XAA, wherein Raa2 is H; Raa1 is: C1-6 alkyl, which is substituted with from 1-2 (e.g., 1) Rba; and each occurrence of Rba is independently selected from: —N(Rga)(Rha) or a C-terminal amino acid or an amino acid ester or an amino acid amide thereof.
- As non-limiting examples of the foregoing, W can include an amino acid residue selected from:
-
- or a C-terminal amino acid or an amino acid ester or an amino acid amide thereof.
- In certain embodiments, W includes from 1-2 (e.g., 1) amino acid residue of Formula XAA, wherein Raa2 is C1-3 alkyl (e.g., methyl); and Raa1 is other than H; or a C-terminal amino acid or an amino acid ester or an amino acid amide thereof.
- Non-limiting examples include:
- or a C-terminal amino acid or an amino acid ester or an amino acid amide thereof.
- Variable W′
- In some embodiments, W′ is a sequence of from 20-60 (e.g., 20-55, 20-50, 20-45, 20-40, 20-30, 20-35) amino acids.
- In some embodiments, W′ is a sequence of from 30-60 (e.g., 30-55, 30-50, 30-45, 30-40) amino acids. In certain embodiments, W′ is a sequence of from 25-45 (e.g., 30-45) amino acids. In certain embodiments, W′ is a sequence of from 30-50 amino acids. For example, W′ can be a sequence of from 30-45 amino acids or from 30-40 amino acids. In certain embodiments, W′ can be a sequence of 34, 35, 36, 37, 38, or 39 amino acids; e.g., 36 or 37 amino acids; e.g., 36 amino acids. In certain embodiments, W′ can be a sequence of 25-28 amino acids; e.g., 26 or 27 amino acids.
- Variable R5
- In some embodiments, R5 is a C-terminal amino acid amide that is optionally substituted with from 1-2 modifying groups. In other embodiments, R5 is a C-terminal amino acid that is optionally substituted with from 1-2 modifying groups.
- In certain embodiments, R5 is a C-terminal lysyl residue, e.g., a lysyl amide residue that is optionally substituted with from 1-2 modifying groups. For example, R5 can be a C-terminal L-lysyl amide residue that is optionally substituted with from 1-2 modifying groups. In certain embodiments, R5 has formula (XI):
-
- wherein R* is H or a modifying group. In certain of these embodiments, formula (XI) is L. In other embodiments, formula (XI) is D.
- In certain embodiments, R* is H.
- In certain embodiments, the modifying group (e.g., R*) is an acyl group. For example, the acyl group can be a C2-30 (e.g., C2-20, C2-10, C2-6) acyl group that is optionally substituted with from 1-2 independently selected R. Each occurrence of Rf is selected from the group consisting of —C(═O)(OH); —C(═O)(C2-20 alkyl); —C(═O)O(C2-20 alkyl); and —S(O)1-2(C1-6 alkyl); oxo; F; C1-10 alkoxy; C1-10 haloalkoxy; and —N(Rg)(Rh). Each occurrence of Rg and Rh is independently selected from the group consisting of H; C1-4 alkyl; —C(═O)(C2-20 alkyl); —C(═O)O(C2-20 alkyl); and —S(O)1-2(C1-6 alkyl).
- In certain embodiments, the modifying group (e.g., R*) is a C2-30 (e.g., C2-20, C2-10, C2-6) acyl group that is substituted with 1-2 (e.g., 2) independently selected R. In certain embodiments, each occurrence of Rf can independently selected from the group consisting of —C(═O)(OH) and —N(Rg)(Rh); e.g., in which one of Rg and Rh is independently selected from the group consisting of —C(═O)(C2-20 alkyl); —C(═O)O(C2-20 alkyl); and —S(O)1-2(C1-6 alkyl), e.g., —C(═O)(C2-20 alkyl). By way of example, the modifying group (e.g., R*) can be:
- As an additional example, R* can be:
- In some embodiments, R5 is a C-terminal amino acid that is optionally substituted with from 1-2 modifying groups (e.g., 1-2 groups selected from an acyl group and a PEG group).
- In certain embodiments, R5 is a C-terminal lysine that is optionally substituted with from 1-2 modifying groups (e.g., 1-2 groups selected from an acyl group and a PEG group). For example, R5 can be a C-terminal L-lysine that is optionally substituted with from 1-2 modifying groups (e.g., 1-2 groups selected from an acyl group and a PEG group).
- In certain embodiments, R5 has formula (XI-OH):
-
- wherein R* is H or a modifying group (e.g., an acyl group and a PEG group). In certain of these embodiments, formula (XI-OH) is L. In other embodiments, formula (XI-OH) is D.
- In certain embodiments of formula (XI) and (XI-OH), R* is H.
- In certain embodiments, the modifying group (e.g., R*) is an acyl group. For example, the acyl group can be a C2-30 (e.g., C2-20, C2-10, C2-6) acyl group that is optionally substituted with from 1-2 independently selected R. Each occurrence of R is selected from the group consisting of —C(═O)(OH); —C(═O)(C2-20 alkyl); —C(═O)O(C2-20 alkyl); and —S(O)1-2(C1-6 alkyl); oxo; F; C1-10 alkoxy; C1-10 haloalkoxy; and —N(Rg)(Rh). Each occurrence of Rg and Rh is independently selected from the group consisting of H; C1-4 alkyl; —C(═O)(C2-20 alkyl); —C(═O)O(C2-20 alkyl); and —S(O)1-2(C1-6 alkyl).
- In certain embodiments, the modifying group (e.g., R*) is a C2-30 (e.g., C2-20, C2-10, C2-6) acyl group that is substituted with 1-2 (e.g., 2) independently selected R. In certain embodiments, each occurrence of R can independently selected from the group consisting of —C(═O)(OH) and —N(Rg)(Rh); e.g., in which one of Rg and Rh is independently selected from the group consisting of —C(═O)(C2-20 alkyl); —C(═O)O(C2-20 alkyl); and —S(O)1-2(C1-6 alkyl), e.g., —C(═O)(C2-20 alkyl). By way of example, the modifying group (e.g., R*) can be:
- As an additional example, R* can be:
- Other non-limiting, representative examples of acyl modifying groups are delineated, e.g., in Table 2.
- In other embodiments, the modifying group is PEG. As used herein the general term “polyethylene glycol” or “PEG”, refers to mixtures of condensation polymers of ethylene oxide and water, in a branched or straight chain, represented by the general formula H(OCH2CH2)nOH, wherein n is at least 9. Absent any further characterization, the term is intended to include polymers of ethylene glycol with an average total molecular weight selected from the range of 5,000 to 40,000 Daltons. “Polyethylene glycol” or “PEG” is used in combination with a numeric suffix to indicate the approximate average molecular weight thereof. For example, PEG-5,000 refers to polyethylene glycol having a total molecular weight average of about 5,000. As used herein the term “PEGylated” or like terms refers to a compound that has been modified from its native state by linking a PEG chain to the peptide. A “PEGylated peptide” is a peptide that has a PEG chain covalently attached to the peptide itself.
- In certain embodiments, R5 is a C-terminal amino acid selected from serine, glycine, and arginine.
- In certain embodiments, R5 is a C-terminal amino acid amide selected from serinyl amide, glycyl amide, and argininyl amide.
- In certain embodiments, R5 is a C-terminal glycyl residue (e.g., C-terminal glycine or C-terminal glycyl amide).
- In certain embodiments, R5 is a C-terminal argininyl residue (e.g., C-terminal arginine or C-terminal argininyl amide).
- In certain embodiments, R5 is a C-terminal serinyl residue (e.g., C-terminal serine or C-terminal serinyl amide).
- In some embodiments, the amino acid sequence present in W is, or includes, the sequence that is present in native GLP-1-OH or GLP-1-NH2. In other embodiments, the amino acid sequence present in W is, or includes, the sequence that is present in native GIP. In still other embodiments, the amino acid sequence present in W is, or includes, a hybrid sequence having one or more fragments (e.g., functional fragments) present in native GLP-1-OH or GLP-1-NH2 and one or more fragments (e.g., functional fragments) present in native GIP. This disclosure further contemplates variations of the foregoing embodiments, e.g., W is, or includes, a conservatively substituted variation of the foregoing, meaning that one or more amino acid residues of an original peptide are replaced by different residues, and that the conservatively substituted peptide retains a desired biological activity. Examples of conservative substitutions include substitution of amino acids that tend not alter the secondary and/or tertiary structure of the compounds described herein, substitutions that do not change the overall or local hydrophobic character, substitutions that do not change the overall or local charge, substitutions by residues of equivalent side chain size, or substitutions by side chains with similar reactive groups.
- A given amino acid can be replaced by a residue having similar physiochemical characteristics, e.g., substituting one aliphatic residue for another (such as Ile, Val, Leu, or Ala for one another), or substitution of one polar residue for another (such as between Lys and Arg; Glu and Asp; or Gln and Asn). Other such conservative substitutions, e.g., substitutions of entire regions having similar hydrophobicity characteristics or substitutions of residues with similar side chain volume are also within the scope of this disclosure.
- Amino acids can be grouped according to similarities in the properties of their side chains (in A. L. Lehninger, in Biochemistry, second ed., pp. 73-75, Worth Publishers, New York (1975)): (1) non-polar: Ala (A), Val (V), Leu (L), Ile (I), Pro (P), Phe (F), Trp (W), Met (M); (2) uncharged polar: Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gln (Q); (3) acidic: Asp (D), Glu (E); (4) basic: Lys (K), Arg (R), His (H). Alternatively, naturally occurring residues can be divided into groups based on common side-chain properties: (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile, Phe, Trp; (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln, Ala, Tyr, His, Pro, Gly; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; (6) aromatic: Trp, Tyr, Phe, Pro, His, or hydroxyproline. Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
- In certain embodiments, conservative substitutions for use in the variants described herein are as follows: Ala into Gly or into Ser; Arg into Lys; Asn into Gln or into His; Asp into Glu or into Asn; Cys into Ser; Gln into Asn; Glu into Asp; Gly into Ala or into Pro; His into Asn or into Gln; Ile into Leu or into Val; Leu into Ile or into Val; Lys into Arg, into Gln or into Glu; Met into Leu, into Tyr or into Ile; Phe into Met, into Leu or into Tyr; Ser into Thr; Thr into Ser; Trp into Tyr or into Phe; Tyr into Phe or into Trp; and/or Phe into Val, into Tyr, into Ile or into Leu. In general, conservative substitutions encompass residue exchanges with those of similar physicochemical properties (i.e. substitution of a hydrophobic residue for another hydrophobic amino acid).
- In still other embodiments, the amino acid sequence present in W is, or includes, or is based upon a sequence that is present in a peptide having at least 0.01% of the GLP-1 receptor activation activity of the native GLP-1, such as at least 0.1%, 0.2%, 0.5%, 0.8%, 1%, 3%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99% of the GLP-1 receptor activation activity of the native GLP-1-OH or GLP-1-NH2 and/or at least 0.01% of the GIP receptor activation activity of GIP, such as at least 0.1%, 0.2%, 0.5%, 0.8%, 1%, 3%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99% of the GIP receptor activation activity of the native GIP.
- As used herein the term “native GLP-1” refers to a peptide comprising the sequence of human GLP-1 (7-36, or 7-37), and term “native GIP” refers to a peptide comprising the sequence of human GIP (1-42). As used herein, a general reference to “GLP-1” or “GIP” in the absence of any further designation is intended to mean native GLP-1 or native GIP, respectively.
- In some embodiments, W has formula (X): -GTF-W″—R5, wherein W″ is a sequence of 30-40 (e.g., 31-36, 33) amino acids.
- In certain embodiments, W has formula (XII):
-
- wherein W″ is a sequence of 30-40 (e.g., 31-35, e.g., 33) amino acids, and R* is H or a modifying group (e.g., an acyl group and a PEG group as described herein).
- In certain embodiments, W has formula (XII—OH):
-
- wherein W″ is a sequence of 30-40 (e.g., 31-35, e.g., 33) amino acids, and R* is H or a modifying group (e.g., an acyl group and a PEG group as described herein).
- In some embodiments, W has formula (XIII):
-
- -GTF-W′″-GPSSGAPPPS-R5 (SEQ ID NO: 1); wherein W′″ is a sequence of 20-30 (e.g., 21-25, e.g., 23) amino acids.
- In some embodiments, W has formula (XIV-AA): GT(Xaa3)(Xaa4)SD(Xaa7)S(Xaa9)(Xaa10)(Xaa11)(Xaa12)(Xaa13)(Xaa14)(X aa15)(Xaa16)(Xaa17)(Xaa18)(Xaa19)(Xaa20)(Xaa21)WL(Xaa24)(Xaa25)(Xaa26)GP SSGAPPP(Xaa36)-R5 (SEQ ID NO: 2A which is listed as SEQ ID NO: 35 in sequence listing);
-
- wherein:
- Xaa3 is F;
- Xaa4 is T or I (e.g., T);
- Xaa7 is Y, V, L, or K* (e.g., Y);
- Xaa9 is I or S (e.g., I);
- Xaa10 is Y, Y*, Q, A, or (Aib) (e.g., Y);
- Xaa11 is L, M, or L* (e.g., L);
- Xaa12 is D or E (e.g., D);
- Xaa13 is K, G, R, or E (e.g., K);
- Xaa14 is Q or I (e.g., Q);
- Xaa15 is A, H, or R (e.g., A);
- Xaa16 is A, Q, or V (e.g., A);
- Xaa17 is A, (Aib), K*, K, or Q (e.g., (Aib));
- Xaa18 is A, D, E, (Aib), or L (e.g., A, D, E, or L (e.g., E));
- Xaa19 is F, or A (e.g., F);
- Xaa20 is V or I (e.g., V);
- Xaa21 is N, A, Q, K*, or E (e.g., N);
- Xaa24 is I, L or V (e.g., L);
- Xaa25 is A, K, or I (e.g., A);
- Xaa26 is Q-R, G-R-G-K*, Q, or G (e.g., G); and
- Xaa36 is S or absent (e.g., S).
- In some embodiments (e.g., when W has formula (XIV-AA)), W has formula (XIV):
-
- GTF(Xaa4)SD(Xaa7)S(Xaa9)(Xaa10)(Xaa11)(Xaa12)(Xaa13)QA(Xaa16)(Xaa 17)(Xaa18)F—(Xaa20)(Xaa21)WL(Xaa24)(Xaa25)GGPSSGAPPPS-R5 (SEQ ID NO: 2);
- wherein:
- Xaa4 is T or I (e.g., T);
- Xaa7 is Y, V, or L (e.g., Y);
- Xaa9 is I or S (e.g., I);
- Xaa10 is Y, Q, or A (e.g., Y);
- Xaa11 is L, M, or L* (e.g., L);
- Xaa12 is D or E (e.g., D);
- Xaa13 is K, G, or E (e.g., K);
- Xaa16 is A or V (e.g., A);
- Xaa17 is (Aib) or K (e.g., (Aib));
- Xaa18 is E or L (e.g., E);
- Xaa20 is V or I (e.g., V);
- Xaa21 is N, A, or E (e.g., N);
- Xaa24 is L or V (e.g., L); and
- Xaa25 is A or K (e.g., A).
- In certain embodiments, W has formula (XIV-A):
-
- GTF(Xaa4)SD(Xaa7)S(Xaa9)(Xaa10)(Xaa11)(Xaa12)(Xaa13)QA(Xaa16)(Aib)-(Xaa18)F(Xaa20)(Xaa21)WL(Xaa24)(Xaa25)GGPSSGAPPPS-R5 (SEQ ID NO: 3), wherein each of the “Xaa” variables is as defined in conjunction with Formula (XIV). In certain of these embodiments, R5 can be as defined anywhere herein (e.g., can have formula (XI); e.g., D or L formula (XI), and R* can be as defined anywhere herein).
- In certain embodiments, W has formula (XIV-B):
-
- GTFTSDYSIYLDKQAA(Aib)EFVNWLLAGGPSSGAPPPS-R5 (SEQ ID NO: 4). In certain of these embodiments, R5 can be as defined anywhere herein (e.g., can have formula (XI); e.g., D or L formula (XI), and R* can be as defined anywhere herein).
- As used herein “(Aib)” refers to 2-aminoisobutyric acid (also known as α-aminoisobutyric acid or α-methylalanine or 2-methylalanine).
- As used herein, Y* refers to 2-amino-3-(4-hydroxyphenyl)-2-methylpropanoic acid (e.g., (S)-2-amino-3-(4-hydroxyphenyl)-2-methylpropanoic acid). As used herein, L* refers to 2-amino-2-methylpentanoic acid (e.g., (S)-2-amino-2-methylpentanoic acid).
-
- or a C-terminal amino acid or an amino acid ester or an amino acid amide thereof.
- As used herein K* is a lysine residue substituted with a modifying group, or a C-terminal amino acid or an amino acid ester or amino acid amide thereof.
- Non-limiting examples of K* can include an amino acid residue selected from:
- or a C-terminal amino acid or an amino acid ester or an amino acid amide thereof.
- In some embodiments, W is represented by formula (X), (XII), (XIII), (XIV-AA), (XIV), (XIV-A), (XIV-B), (XV), or any of SEQ ID 1-34.
- For example, W can have any of the sequences delineated in Table 2.
-
TABLE 2 SEQ ID NO: Sequence 5 GTFTSDYSIYLDKQAA(Aib)EFVNWLLAGGPSSGAPPPSK— NH 26 GTFTSDYSIYLDKQAA(Aib)EFVNWLLAGGPSSGAPPPSK* 7 GTFTSDYSIYLDKQAA(Aib)EFVNWLLAGGPSSGAPPPSK* 8 GTFTSDYSIYLDKQAA(Aib)EFVNWLLAGGPSSGAPPPSK* 9 GTFTSDYSIYLDKQAA(Aib)EFVNWLLAGGPSSGAPPPSK*, 10 GTFTSDVSSYLEGQAAKEFIAWLVKGGPSSGAPPPSK*—NH 2, 11 GTFISDYSIAMDKIRQQDFVNWLLAQRGPSSGAPPPSK*—NH 2, 12 GTFTSDLSIYLDKQAA(Aib)EFVNWLLAGGPSSGAPPPSK— NH 213 GTFTSDYSIYLDEQAA(Aib)EFVNWLLAGGPSSGAPPPSK— NH 214 GTFTSDYSIYLDKQAV(Aib)EFVNWLLAGGPSSGAPPPSK— NH 215 GTFTSDYSIYLDKQAA(Aib)LFVNWLLAGGPSSGAPPPSK— NH 216 GTFTSDYSIYLDKQAA(Aib)EFINWLLAGGPSSGAPPPSK— NH 217 GTFTSDYSIYLDKQAA(Aib)EFVEWLLAGGPSSGAPPPSK— NH 218 GTFTSDYSIYLDKQAV(Aib)EFINWLLAGGPSSGAPPPSK— NH 219 GTFTSDYSIQMDKQAA(Aib)EFVNWLLAGGPSSGAPPPSK*—NH 2 20 GTFTSDYSIAMDKQAA(Aib)EFVNWLLAGGPSSGAPPPSK*—NH 2 21 GTFTSDYSIYL*DKQAA(Aib)EFVNWLLAGGPSSGAPPPSK*—NH 2 22 GTFTSDYSIYLDRQAA(Aib)EFVNWLLAGGPSSGAPPPS— NH 223 24 25 26 27 28 GTFTSDYSIYLDKQAA(Aib)EFVNWLLAGGPSSGAPPPSK*—NH 2 29 GTFTSDYSIY*LDKQAA(Aib)EFVNWLLAGGPSSGAPPPSK*—NH 2 30 GTFTSDYSIYLDKQAV(Aib)EFVNWLLAGGPSSGAPPPSK*—NH 2 31 GTFTSDYSIYLDKQAA(Aib)EFVK*WLLAGGPSSGAPPPSK—NH 2 32 GTFTSDYSIYLDKQAA(Aib)EFVNWLLAGRGK*GPSSGAPPPS—NH 2 33 GTFTSDYSIYLDKQAAK*EFVNWLLAGGPSSGAPPPSK—NH 2 34 GTFTSDK*SIYLDKQAA(Aib)EFVNWLLAGGPSSGAPPPSK—NH 2 - In some embodiments, W is represented by any one of SEQ ID 1-34 (e.g., SEQ. ID 5-27; e.g., SEQ ID 5-29; (e.g., SEQ ID 6); e.g., SEQ ID 28-29; e.g., SEQ ID 30-34).
- In some embodiments, W is represented by any one of SEQ ID 1-27 (e.g., SEQ. ID 5-27; e.g., SEQ ID 6).
- In some embodiments, W is represented by any one of SEQ ID 28-29 (e.g., 28, 29).
- In certain embodiments, W has the sequence of
SEQ ID 6. - Non-Limiting Combinations of Formulae (IAA), (IA), and (I)
- [1] In some embodiments, the compound has formula (I-A), (I-AA, or (I-AB), ring A is a saturated or unsaturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms, and L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—. In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), and R3 is —C(O)OH.
- [1A] In some embodiments, the compound has formula (IA-A), (IA-AA), or (IA-AB), ring A is a saturated or unsaturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms, and L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—. In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), and R3 is —C(O)OH. In certain embodiments, a′ is 1; each of R3a and R3A is H.
- [2] In some embodiments, the compound has formula (I-A), (I-AA), or (I-AB), (I-A), (I-AA), or (I-AB), ring A is a saturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms, and L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—. In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), and R3 is —C(O)OH.
- [2A] In some embodiments, the compound has formula (IA-A), (IA-AA), or (IA-AB), (IA-B), (IA-BA, or (IA-BB), ring A is a saturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms, and L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—. In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), and R3 is —C(O)OH. In certain embodiments, a′ is 1; each of R3a and R3b is H.
- [3] In some embodiments, the compound has formula (I-A), (I-AA), or (I-AB), ring A is a saturated, monocyclic, 6-membered ring having formula (III) (i.e., A1 is not a bond), and L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—. In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), and R3 is —C(O)OH.
- [3A] In some embodiments, the compound has formula (IA-A), (IA-AA), or (IA-AB), ring A is a saturated, monocyclic, 6-membered ring having formula (III) (i.e., A1 is not a bond), and L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—. In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), and R3 is —C(O)OH. In certain embodiments, a′ is 1; each of R3a and R3A is H.
- [4] In some embodiments, the compound has formula (I-A), (I-AA), or (I-AB), ring A is a saturated, monocyclic, 5-membered ring having formula (III-A) (i.e., A1 in formula (III) is a bond), and L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—. In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), and R3 is —C(O)OH.
- [4A] In some embodiments, the compound has formula (IA-A), (IA-AA), or (IA-AB), ring A is a saturated, monocyclic, 5-membered ring having formula (III-A) (i.e., A1 in formula (III) is a bond), and L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—. In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), and R3 is —C(O)OH. In certain embodiments, a′ is 1; each of R3a and R3b is H.
- [5] In some embodiments, the compound has formula (I-A), (I-AA), or (I-AB), ring A is a saturated or unsaturated bicyclic or tricyclic ring that includes from 6-14 (e.g., 8-10) ring atoms, and L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—. In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), and R3 is —C(O)OH.
- [5A] In some embodiments, the compound has formula (IA-A), (IA-AA), or (IA-AB), ring A is a saturated or unsaturated bicyclic or tricyclic ring that includes from 6-14 (e.g., 8-10) ring atoms, and L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—. In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), and R3 is —C(O)OH. In certain embodiments, a′ is 1; each of R3a and R3b is H.
- [6] In some embodiments, the compound has formula (I-A), (I-AA), or (I-AB), ring A is a saturated or unsaturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms, L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—, and W is represented by formula (X), (XII), (XIII), (XIV), (XIV-A), (XIV-B), or any of SEQ ID 1-27 (e.g., SEQ ID 5-27, e.g., SEQ ID 6). In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, R5 has formula (XI). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), R3 is —C(O)OH, and R5 has formula (XI).
- [6A] In some embodiments, the compound has formula (IA-A), (IA-AA), or (IA-AB), ring A is a saturated or unsaturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms, L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—, and W is represented by formula (X), (XII), (XIII), (XIV-AA), (XIV), (XIV-A), (XIV-B), (XV), or any of SEQ ID 1-34 (e.g., SEQ ID 5-27; e.g., SEQ ID 5-29; (e.g., SEQ ID 6); e.g., SEQ ID 28-29; e.g., SEQ ID 30-34). In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, R5 has formula (XI). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), R3 is —C(O)OH, and R5 has formula (XI). In certain embodiments, a′ is 1; each of R3a and R3b is H.
- [7] In some embodiments, the compound has formula (I-A), (I-AA), or (I-AB), ring A is a saturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms, L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—, and W is represented by (X), (XII), (XIII), (XIV), (XIV-A), (XIV-B), or any of SEQ ID 1-27 (e.g., SEQ ID 5-27, e.g., SEQ ID 6). In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, R5 has formula (XI). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), R3 is —C(O)OH, and R5 has formula (XI).
- [7A] In some embodiments, the compound has formula (I-A), (I-AA), or (I-AB), ring A is a saturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms, L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—, and W is represented by formula (X), (XII), (XIII), (XIV-AA), (XIV), (XIV-A), (XIV-B), (XV), or any of SEQ ID 1-34 (e.g., SEQ. ID 5-27; e.g., SEQ ID 5-29; (e.g., SEQ ID 6); e.g., SEQ ID 28-29; e.g., SEQ ID 30-34). In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, R5 has formula (XI). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), R3 is —C(O)OH, and R5 has formula (XI). In certain embodiments, a′ is 1; each of R3a and R3b is H.
- [8] In some embodiments, the compound has formula (I-A), (I-AA), or (I-AB), ring A is a saturated, monocyclic, 6-membered ring having formula (III) (i.e., A1 is not a bond), L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—, and W is represented by formula (X), (XII), (XIII), (XIV), (XIV-A), (XIV-B), or any of SEQ ID 1-27 (e.g., SEQ ID 5-27, e.g., SEQ ID 6). In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, R5 has formula (XI). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), R3 is —C(O)OH, and R5 has formula (XI).
- [8A] In some embodiments, the compound has formula (IA-A), (IA-AA), or (IA-AB), ring A is a saturated, monocyclic, 6-membered ring having formula (III) (i.e., A1 is not a bond), L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—, and W is represented by formula (X), (XII), (XIII), (XIV-AA), (XIV), (XIV-A), (XIV-B), (XV), or any of SEQ ID 1-34 (e.g., SEQ. ID 5-27; e.g., SEQ ID 5-29; (e.g., SEQ ID 6); e.g., SEQ ID 28-29; e.g., SEQ ID 30-34). In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, R5 has formula (XI). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), R3 is —C(O)OH, and R5 has formula (XI). In certain embodiments, a′ is 1; each of R3a and R3A is H.
- [9] In some embodiments, the compound has formula (I-A), (I-AA), or (I-AB), ring A is a saturated, monocyclic, 5-membered ring having formula (III-A) (i.e., A1 in formula (III) is a bond), L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—, and W is represented by formula (X), (XII), (XIII), (XIV), (XIV-A), (XIV-B), or any of SEQ ID 1-27 (e.g., SEQ ID 5-27, e.g., SEQ ID 6). In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, R5 has formula (XI). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), R3 is —C(O)OH, and R5 has formula (XI).
- [9A] In some embodiments, the compound has formula (IA-A), (IA-AA), or (IA-AB), ring A is a saturated, monocyclic, 5-membered ring having formula (III-A) (i.e., A1 in formula (III) is a bond), L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—, and W is represented by formula (X), (XII), (XIII), (XIV-AA), (XIV), (XIV-A), (XIV-B), (XV), or any of SEQ ID 1-34 (e.g., SEQ. ID 5-27; e.g., SEQ ID 5-29; (e.g., SEQ ID 6); e.g., SEQ ID 28-29; e.g., SEQ ID 30-34). In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, R5 has formula (XI). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), R3 is —C(O)OH, and R5 has formula (XI). In certain embodiments, a′ is 1; each of R3a and R3b is H.
- [10] In some embodiments, the compound has formula (I-A), (I-AA), or (I-AB), ring A is a saturated or unsaturated bicyclic or tricyclic ring that includes from 6-14 (e.g., 8-10) ring atoms, L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—, and W is represented by formula (X), (XII), (XIII), (XIV), (XIV-A), (XIV-B), or any of SEQ ID 1-27 (e.g., SEQ ID 5-27, e.g., SEQ ID 6). In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, R5 has formula (XI). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), R3 is —C(O)OH, and R5 has formula (XI).
- [10A] In some embodiments, the compound has formula (IA-A), (IA-AA), or (IA-AB), ring A is a saturated or unsaturated bicyclic or tricyclic ring that includes from 6-14 (e.g., 8-10) ring atoms, L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—, and W is represented by formula (X), (XII), (XIII), (XIV-AA), (XIV), (XIV-A), (XIV-B), (XV), or any of SEQ ID 1-34 (e.g., SEQ. ID 5-27; e.g., SEQ ID 5-29; (e.g., SEQ ID 6); e.g., SEQ ID 28-29; e.g., SEQ ID 30-34). In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, R5 has formula (XI). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), R3 is —C(O)OH, and R5 has formula (XI). In certain embodiments, a′ is 1; each of R3a and R3b is H.
- In Some Embodiments:
-
- the compound has formula (I-A), (I-AA), or (I-AB);
- ring A is a saturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms;
- L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—,
- W is represented by formula (X), (XII), (XIII), (XIV), (XIV-A), (XIV-B), or any of SEQ ID 1-27 (e.g., SEQ ID 5-27, e.g., SEQ ID 6); and
- m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), and n+p=2 (e.g., each of n and p is 1), and X2 is —S—; or
- m is 2-6 (e.g., 2), X is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, X2 is —C(Q1)(Q2)- and Q1 and Q2, together with the carbon atom to which each is attached forms C3-6 cycloalkyl that is optionally substituted with from 1-4 independently selected Rd and optionally fused to phenyl; or
- m is 2-6 (e.g., 2), X is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, X2 is —C(Q1)(Q2)- and Q1 and Q2 is an independently selected C1-4 alkyl (e.g., CH3); or
- m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, and X2 is: (v) C6-10 arylene (e.g., phenylene) optionally substituted with from 1-5 independently selected Re; or (vii) C3-10 cycloalkylene optionally substituted with from 1-4 independently selected Rd.
- In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, R5 has formula (XI). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), R3 is —C(O)OH, and R5 has formula (XI).
- In certain of these embodiments, m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), and n+p=2 (e.g., each of n and p is 1), and X2 is —S—. For example, L can be —CH2CH2NHC(O)CH2SCH2—.
- In certain of these embodiments, any one of SEQ ID 5-27 (e.g., SEQ ID 6) represents W.
- [11A] In some embodiments:
-
- the compound has formula (IA-A), (IA-AA), or (IA-AB);
- ring A is a saturated monocyclic ring that includes from 3-8 (e.g., 4-8, 4-7, 5-6) ring atoms;
- L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—, and
- W is represented by formula (X), (XII), (XIII), (XIV-AA), (XIV), (XIV-A), (XIV-B), (XV), or any of SEQ ID 1-34 (e.g., SEQ. ID 5-27; e.g., SEQ ID 5-29; (e.g., SEQ ID 6); e.g., SEQ ID 28-29; e.g., SEQ ID 30-34).
- In certain embodiments, m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), and n+p=2 (e.g., each of n and p is 1), and X2 is —S—; or
-
- m is 2-6 (e.g., 2), X is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, X2 is —C(Q1)(Q2)-, and Q1 and Q2, together with the carbon atom to which each is attached forms C3-6 cycloalkyl that is optionally substituted with from 1-4 independently selected Rd and optionally fused to phenyl; or
- m is 2-6 (e.g., 2), X is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, X2 is —C(Q1)(Q2)- and Q1 and Q2 is an independently selected C1-4 alkyl (e.g., CH3); or
- m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, and X2 is: (v) C6-10 arylene (e.g., phenylene) optionally substituted with from 1-5 independently selected Rc; or (vii) C3-10 cycloalkylene optionally substituted with from 1-4 independently selected Rd.
- In certain embodiments, m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, and X2 is: heterocycloalkylene including from 4-6 (e.g., 4) ring atoms, wherein from 1-3 (e.g., 1) ring atoms are each independently selected from the group consisting of N(Ra), O, and S; and which is optionally substituted with from 1-5 independently selected Rd (e.g., X2 can be
- In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, R5 has formula (XI). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), R3 is —C(O)OH, and R5 has formula (XI). In certain embodiments, a′ is 1; each of R3a and R3b is H.
- In certain of these embodiments, m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), and n+p=2 (e.g., each of n and p is 1), and X2 is —S—. For example, L can be —CH2CH2NHC(O)CH2SCH2—.
- In certain of these embodiments, any one of SEQ ID 5-34 (e.g., SEQ ID 6) represents W.
- In Some Embodiments:
-
- the compound has formula (I-A), (I-AA), or (I-AB);
- ring A is a saturated, monocyclic, 6-membered ring having formula (III) (i.e., A1 is not a bond);
- L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—;
- W is represented by formula (X), (XII), (XIII), (XIV), (XIV-A), (XIV-B), or any of SEQ ID 1-27 (e.g., SEQ ID 5-27, e.g., SEQ ID 6); and
- m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), and n+p=2 (e.g., each of n and p is 1), and X2 is —S—; or
- m is 2-6 (e.g., 2), X is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, X2 is —C(Q1)(Q2)- and Q1 and Q2, together with the carbon atom to which each is attached forms C3-6 cycloalkyl that is optionally substituted with from 1-4 independently selected Rd and optionally fused to phenyl; or
- m is 2-6 (e.g., 2), X is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, X2 is —C(Q1)(Q2)- and Q1 and Q2 is an independently selected C1-4 alkyl (e.g., CH3); or
- m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, and X2 is: (v) C6-10 arylene (e.g., phenylene) optionally substituted with from 1-5 independently selected Re; or (vii) C3-10 cycloalkylene optionally substituted with from 1-4 independently selected Rd.
- In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, R5 has formula (XI). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), R3 is —C(O)OH, and R5 has formula (XI).
- In certain of these embodiments, m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), and n+p=2 (e.g., each of n and p is 1), and X2 is —S—. For example, L can be —CH2CH2NHC(O)CH2SCH2—.
- In certain of these embodiments, any one of SEQ ID 5-27 (e.g., SEQ ID 6) represents W.
- In certain formula (III), 6-membered ring embodiments, A1, A2, A3 and A4 are each independently selected from the group consisting of CH2, CHRb, or C(Rb)2.
- In certain formula (III), 6-membered ring embodiments, one or two (e.g., one) of A1, A2, A3 and A4 are independently selected from the group consisting of CHRb and C(Rb)2, and the others are CH2.
- In certain formula (III), 6-membered ring embodiments, A1, A2, A3 and A4 are each CH2.
- In certain formula (III), 6-membered ring embodiments, A1, A2 and A4 are each independently selected from the group consisting of CH2, CHRb, and C(Rb)2; and A3 is O; S; SO2; or N(Ra). In certain of these embodiments, one or two (e.g., one) of A2 and A4 are independently selected from the group consisting of CHRb and C(Rb)2, and the other (where applicable) is CH2. In other embodiments, A2 and A3 are both CH2. In certain of these embodiments, A1 is CH2. In certain of these embodiments, A3 is N(Ra) (e.g., A3 can be NH). In other embodiments, A3 is O. In still other embodiments, A3 is SO2.
- In certain formula (III), 6-membered ring embodiments, A1, A2 and A3 are each independently selected from the group consisting of CH2, CHRb, and C(Rb)2; and A4 is O; S; or N(Ra). In certain of these embodiments, one or two (e.g., one) of A2 and A4 are independently selected from the group consisting of CHRb and C(Rb)2, and the other (where applicable) is CH2. In other embodiments, A2 and A3 are both CH2. In certain of these embodiments, A1 is CH2. In certain of these embodiments, A4 is N(Ra) (e.g., A4 can be NH). In other embodiments, A4 is O.
- In certain formula (III), 6-membered ring embodiments, A1 is C(O); and A2, A3 and A4 are each independently selected from the group consisting of CH2, CHRb, or C(Rb)2. In certain of these embodiments, one or two (e.g., one) of A2, A3 and A4 are independently selected from the group consisting of CHRb and C(Rb)2, and the other(s) is/are CH2.
- In certain formula (III), 6-membered ring embodiments, A1 is C(O); and A2, A3 and A4 are each CH2.
- In certain formula (III), 6-membered ring embodiments, A1 is C(O); A2 and A4 are each independently selected from the group consisting of CH2, CHRb, and C(Rb)2; and A3 is O; S; SO2; or N(Ra). In certain of these embodiments, one or two (e.g., one) of A2 and A4 are independently selected from the group consisting of CHRb and C(Rb)2, and the other (where applicable) is CH2. In other embodiments, A2 and A4 are both CH2. In certain of these embodiments, A3 is N(Ra) (e.g., A3 can be NH). In other embodiments, A3 is O. In still other embodiments, A3 is SO2.
- In certain formula (III), 6-membered ring embodiments, A1 is C(O); A2 and A3 are each independently selected from the group consisting of CH2, CHRb, and C(Rb)2; and A4 is O; S; or N(Ra). In certain of these embodiments, one or two (e.g., one) of A2 and A3 are independently selected from the group consisting of CHRb and C(Rb)2, and the other (where applicable) is CH2. In other embodiments, A2 and A3 are both CH2. In certain of these embodiments, A4 is N(Ra) (e.g., A4 can be NH). In other embodiments, A4 is O. In certain formula (III), 6-membered ring embodiments, A1, A2, A3 and A4 are each independently selected from the group consisting of CH2, CHRb, or C(Rb)2.
- [12A] In some embodiments:
-
- the compound has formula (IA-A), (IA-AA), or (IA-AB);
- ring A is a saturated, monocyclic, 6-membered ring having formula (III) (i.e., A1 is not a bond);
- L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—; and
- W is represented by formula (X), (XII), (XIII), (XIV-AA), (XIV), (XIV-A), (XIV-B), (XV), or any of SEQ ID 1-34 (e.g., SEQ. ID 5-27; e.g., SEQ ID 5-29; (e.g., SEQ ID 6); e.g., SEQ ID 28-29; e.g., SEQ ID 30-34).
- In certain embodiments, m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), and n+p=2 (e.g., each of n and p is 1), and X2 is —S—; or
-
- m is 2-6 (e.g., 2), X is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, X2 is —C(Q1)(Q2)- and Q1 and Q2, together with the carbon atom to which each is attached forms C3-6 cycloalkyl that is optionally substituted with from 1-4 independently selected Rd and optionally fused to phenyl; or
- m is 2-6 (e.g., 2), X is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, X2 is —C(Q1)(Q2)- and Q1 and Q2 is an independently selected C1-4 alkyl (e.g., CH3); or
- m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, and X2 is: (v) C6-10 arylene (e.g., phenylene) optionally substituted with from 1-5 independently selected Rc; or (vii) C3-10 cycloalkylene optionally substituted with from 1-4 independently selected Rd.
- In certain embodiments, m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, and X2 is: heterocycloalkylene including from 4-6 (e.g., 4) ring atoms, wherein from 1-3 (e.g., 1) ring atoms are each independently selected from the group consisting of N(Ra), O, and S; and which is optionally substituted with from 1-5 independently selected Rd (e.g., X2 can be
- In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, R5 has formula (XI). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), R3 is —C(O)OH, and R5 has formula (XI). In certain embodiments, a′ is 1; each of R3a and R3b is H.
- In certain of these embodiments, m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), and n+p=2 (e.g., each of n and p is 1), and X2 is —S—. For example, L can be —CH2CH2NHC(O)CH2SCH2—.
- In certain of these embodiments, any one of SEQ ID 5-34 (e.g., SEQ ID 6) represents W.
- In certain formula (III), 6-membered ring embodiments, A1, A2, A3 and A4 are each independently selected from the group consisting of CH2, CHRb, or C(Rb)2.
- In certain formula (III), 6-membered ring embodiments, one or two (e.g., one) of A1, A2, A3 and A4 are independently selected from the group consisting of CHRb and C(Rb)2, and the others are CH2.
- In certain formula (III), 6-membered ring embodiments, A1, A2, A3 and A4 are each CH2.
- In certain formula (III), 6-membered ring embodiments, A1, A2 and A4 are each independently selected from the group consisting of CH2, CHRb, and C(Rb)2; and A3 is O; S; SO2; or N(Ra). In certain of these embodiments, one or two (e.g., one) of A2 and A4 are independently selected from the group consisting of CHRb and C(Rb)2, and the other (where applicable) is CH2. In other embodiments, A2 and A3 are both CH2. In certain of these embodiments, A1 is CH2. In certain of these embodiments, A3 is N(Ra) (e.g., A3 can be NH). In other embodiments, A3 is O. In still other embodiments, A3 is SO2.
- In certain formula (III), 6-membered ring embodiments, A1, A2 and A3 are each independently selected from the group consisting of CH2, CHRb, and C(Rb)2; and A4 is O; S; or N(Ra). In certain of these embodiments, one or two (e.g., one) of A2 and A4 are independently selected from the group consisting of CHRb and C(Rb)2, and the other (where applicable) is CH2. In other embodiments, A2 and A3 are both CH2. In certain of these embodiments, A1 is CH2. In certain of these embodiments, A4 is N(Ra) (e.g., A4 can be NH). In other embodiments, A4 is O.
- In certain formula (III), 6-membered ring embodiments, A1 is C(O); and A2, A3 and A4 are each independently selected from the group consisting of CH2, CHRb, or C(Rb)2. In certain of these embodiments, one or two (e.g., one) of A2, A3 and A4 are independently selected from the group consisting of CHRb and C(Rb)2, and the other(s) is/are CH2.
- In certain formula (III), 6-membered ring embodiments, A1 is C(O); and A2, A3 and A4 are each CH2.
- In certain formula (III), 6-membered ring embodiments, A1 is C(O); A2 and A4 are each independently selected from the group consisting of CH2, CHRb, and C(Rb)2; and A3 is O; S; SO2; or N(Ra). In certain of these embodiments, one or two (e.g., one) of A2 and A4 are independently selected from the group consisting of CHRb and C(Rb)2, and the other (where applicable) is CH2. In other embodiments, A2 and A4 are both CH2. In certain of these embodiments, A3 is N(Ra) (e.g., A3 can be NH). In other embodiments, A3 is O. In still other embodiments, A3 is SO2.
- In certain formula (III), 6-membered ring embodiments, A1 is C(O); A2 and A3 are each independently selected from the group consisting of CH2, CHRb, and C(Rb)2; and A4 is O; S; or N(Ra). In certain of these embodiments, one or two (e.g., one) of A2 and A3 are independently selected from the group consisting of CHRb and C(Rb)2, and the other (where applicable) is CH2. In other embodiments, A2 and A3 are both CH2. In certain of these embodiments, A4 is N(Ra) (e.g., A4 can be NH). In other embodiments, A4 is O. In certain formula (III), 6-membered ring embodiments, A1, A2, A3 and A4 are each independently selected from the group consisting of CH2, CHRb, or C(Rb)2.
- [13] In some embodiments:
-
- the compound has formula (IA-A), (IA-AA), or (IA-AB);
- ring A is a saturated, monocyclic, 5-membered ring having formula (III-A) (i.e., A1 in formula (III) is a bond);
- L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—,
- W is represented by formula (X), (XII), (XIII), (XIV), (XIV-A), (XIV-B), or any of SEQ ID 1-27 (e.g., SEQ ID 5-27, e.g., SEQ ID 6); and
- m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), and n+p=2 (e.g., each of n and p is 1), and X2 is —S—; or
- m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, X2 is —C(Q1)(Q2)- and Q1 and Q2, together with the carbon atom to which each is attached forms C3-6 cycloalkyl that is optionally substituted with from 1-4 independently selected Rd and optionally fused to phenyl; or
- m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, X2 is —C(Q1)(Q2)- and Q1 and Q2 is an independently selected C1-4 alkyl (e.g., CH3); or
- m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, and X2 is: (v) C6-10 arylene (e.g., phenylene) optionally substituted with from 1-5 independently selected Rc; or (vii) C3-10 cycloalkylene optionally substituted with from 1-4 independently selected Rd.
- In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, R5 has formula (XI). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), R3 is —C(O)OH, and R5 has formula (XI).
- In certain of these embodiments, m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), and n+p=2 (e.g., each of n and p is 1), and X2 is —S—. For example, L can be —CH2CH2NHC(O)CH2SCH2—.
- In certain of these embodiments, any one of SEQ ID 5-27 (e.g., SEQ ID 6) represents W.
- [13A] In some embodiments:
-
- the compound has formula (IA-A), (IA-AA), or (IA-AB);
- ring A is a saturated, monocyclic, 5-membered ring having formula (III-A) (i.e., A1 in formula (III) is a bond);
- L has formula (VIII): —(CH2)m—X1—(CH2)n—X2—(CH2)p—, and
- W is represented by formula (X), (XII), (XIII), (XIV-AA), (XIV), (XIV-A), (XIV-B), (XV), or any of SEQ ID 1-34 (e.g., SEQ. ID 5-27; e.g., SEQ ID 5-29; (e.g., SEQ ID 6); e.g., SEQ ID 28-29; e.g., SEQ ID 30-34).
- In certain embodiments, m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), and n+p=2 (e.g., each of n and p is 1), and X2 is —S—; or
-
- m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, X2 is —C(Q1)(Q2)-, and Q1 and Q2, together with the carbon atom to which each is attached forms C3-6 cycloalkyl that is optionally substituted with from 1-4 independently selected Rd and optionally fused to phenyl; or
- m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, X2 is —C(Q1)(Q2)- and Q1 and Q2 is an independently selected C1-4 alkyl (e.g., CH3); or
- m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, and X2 is: (v) C6-10 arylene (e.g., phenylene) optionally substituted with from 1-5 independently selected Rc; or (vii) C3-10 cycloalkylene optionally substituted with from 1-4 independently selected Rd.
- In certain embodiments, m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), n+p=0, and X2 is: heterocycloalkylene including from 4-6 (e.g., 4) ring atoms, wherein from 1-3 (e.g., 1) ring atoms are each independently selected from the group consisting of N(Ra), O, and S; and which is optionally substituted with from 1-5 independently selected Rd (e.g., X2 can be
- In certain embodiments, one, two, or three of R1, R2, and R4 are H. In certain embodiments, R3 is —C(O)OH. In certain embodiments, a is 0, 1, or 2 (e.g., 1). In certain embodiments, R5 has formula (XI). In certain embodiments, each of R1, R2, and R4 is H, a is 0, 1, or 2 (e.g., 1), R3 is —C(O)OH, and R5 has formula (XI). In certain embodiments, a′ is 1; each of R3a and R3b is H.
- In certain of these embodiments, m is 2-6 (e.g., 2), X1 is —N(R′)C(O)— (e.g., —N(H)C(O)—), and n+p=2 (e.g., each of n and p is 1), and X2 is —S—. For example, L can be —CH2CH2NHC(O)CH2SCH2—.
- In certain of these embodiments, any one of SEQ ID 5-34 (e.g., SEQ ID 6) represents W.
- Embodiments of combinations [1]-[13] can also include any one or more of the features delineated in the Detailed Descriptions and/or claims.
- Embodiments of combinations [1A]-[13A] can also include any one or more of the features delineated in the Detailed Descriptions and/or claims.
- The skilled artisan will recognize that some chemical structures described herein may be represented on paper by one or more other resonance forms; or may exist in one or more other tautomeric forms, even when kinetically, the artisan recognizes that such tautomeric forms represent only a very small portion of a sample of such compound(s). Such compounds are contemplated within the scope of this disclosure, though such resonance forms or tautomers are not explicitly represented herein.
- Pharmaceutical Compositions and Administration
- General
- In some embodiments, a chemical entity (e.g., a compound or a pharmaceutically acceptable salt and/or hydrate and/or prodrug of the compound) that modulates (e.g., agonizes or partially agonizes or antagonizes) glucagon-like peptide-1 receptor (“GLP-1R”) and/or the gastric inhibitory polypeptide receptor (“GIPR”), is administered as a pharmaceutical composition that includes the chemical entity and one or more pharmaceutically acceptable excipients, and optionally one or more additional therapeutic agents as described herein.
- In some embodiments, the chemical entities can be administered in combination with one or more conventional pharmaceutical excipients. Pharmaceutically acceptable excipients include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, self-emulsifying drug delivery systems (SEDDS) such as d-α-tocopherol polyethylene glycol 1000 succinate, surfactants used in pharmaceutical dosage forms such as Tweens, poloxamers or other similar polymeric delivery matrices, serum proteins, such as human serum albumin, buffer substances such as phosphates, tris, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium-chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethyl cellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, and wool fat. Cyclodextrins such as α-, β, and γ-cyclodextrin, or chemically modified derivatives such as hydroxyalkylcyclodextrins, including 2- and 3-hydroxypropyl-β-cyclodextrins, or other solubilized derivatives can also be used to enhance delivery of compounds described herein. Dosage forms or compositions containing a chemical entity as described herein in the range of 0.005% to 100% with the balance made up from non-toxic excipient may be prepared. The contemplated compositions may contain 0.001%-100% of a chemical entity provided herein, in one embodiment 0.1-95%, in another embodiment 75-85%, in a further embodiment 20-80%. Actual methods of preparing such dosage forms are known, or will be apparent, to those skilled in this art; for example, see Remington: The Science and Practice of Pharmacy, 22nd Edition (Pharmaceutical Press, London, U K. 2012).
- Routes of Administration and Composition Components
- In some embodiments, the chemical entities described herein or a pharmaceutical composition thereof can be administered to subject in need thereof by any accepted route of administration. Acceptable routes of administration include, but are not limited to, buccal, cutaneous, endocervical, endosinusial, endotracheal, enteral, epidural, interstitial, intra-abdominal, intra-arterial, intrabronchial, intrabursal, intracerebral, intracisternal, intracoronary, intradermal, intraductal, intraduodenal, intradural, intraepidermal, intraesophageal, intragastric, intragingival, intraileal, intralymphatic, intramedullary, intrameningeal, intramuscular, intraovarian, intraperitoneal, intraprostatic, intrapulmonary, intrasinal, intraspinal, intrasynovial, intratesticular, intrathecal, intratubular, intratumoral, intrauterine, intravascular, intravenous, nasal, nasogastric, oral, parenteral, percutaneous, peridural, rectal, respiratory (inhalation), subcutaneous, sublingual, submucosal, topical, transdermal, transmucosal, transtracheal, ureteral, urethral and vaginal. In certain embodiments, a preferred route of administration is parenteral (e.g., intratumoral).
- Compositions can be formulated for parenteral administration, e.g., formulated for injection via the intravenous, intramuscular, sub-cutaneous, or even intraperitoneal routes. Typically, such compositions can be prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for use to prepare solutions or suspensions upon the addition of a liquid prior to injection can also be prepared; and the preparations can also be emulsified. The preparation of such formulations will be known to those of skill in the art in light of the present disclosure.
- The pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions; formulations including sesame oil, peanut oil, or aqueous propylene glycol; and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. In general, the form must be sterile and must be fluid to the extent that it may be easily injected. It also should be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
- The carrier also can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetable oils. The proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion, and by the use of surfactants. The prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars or sodium chloride. Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.
- Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with various of the other ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum-drying and freeze-drying techniques, which yield a powder of the active ingredient, plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- Pharmacologically acceptable excipients usable in the rectal composition as a gel, cream, enema, or rectal suppository, include, without limitation, any one or more of cocoa butter glycerides, synthetic polymers such as polyvinylpyrrolidone, PEG (like PEG ointments), glycerine, glycerinated gelatin, hydrogenated vegetable oils, poloxamers, mixtures of polyethylene glycols of various molecular weights and fatty acid esters of polyethylene glycol Vaseline, anhydrous lanolin, shark liver oil, sodium saccharinate, menthol, sweet almond oil, sorbitol, sodium benzoate, anoxid SBN, vanilla essential oil, aerosol, parabens in phenoxyethanol, sodium methyl p-oxybenzoate, sodium propyl p-oxybenzoate, diethylamine, carbomers, carbopol, methyloxybenzoate, macrogol cetostearyl ether, cocoyl caprylocaprate, isopropyl alcohol, propylene glycol, liquid paraffin, xanthan gum, carboxy-metabisulfite, sodium edetate, sodium benzoate, potassium metabisulfite, grapefruit seed extract, methyl sulfonyl methane (MSM), lactic acid, glycine, vitamins, such as vitamin A and E and potassium acetate.
- In certain embodiments, suppositories can be prepared by mixing the chemical entities described herein with suitable non-irritating excipients or carriers such as cocoa butter, polyethylene glycol or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum and release the active compound. In other embodiments, compositions for rectal administration are in the form of an enema.
- In other embodiments, the compounds described herein or a pharmaceutical composition thereof are suitable for local delivery to the digestive or GI tract by way of oral administration (e.g., solid or liquid dosage forms).
- Solid dosage forms for oral administration include capsules, tablets, pills, powders, and granules. In such solid dosage forms, the chemical entity is mixed with one or more pharmaceutically acceptable excipients, such as sodium citrate or dicalcium phosphate and/or: a) fillers or extenders such as starches, lactose, sucrose, glucose, mannitol, and silicic acid, b) binders such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinylpyrrolidinone, sucrose, and acacia, c) humectants such as glycerol, d) disintegrating agents such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate, e) solution retarding agents such as paraffin, f) absorption accelerators such as quaternary ammonium compounds, g) wetting agents such as, for example, cetyl alcohol and glycerol monostearate, h) absorbents such as kaolin and bentonite clay, and i) lubricants such as talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate, and mixtures thereof. In the case of capsules, tablets and pills, the dosage form may also comprise buffering agents. Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.
- In one embodiment, the compositions will take the form of a unit dosage form such as a pill or tablet and thus the composition may contain, along with a chemical entity provided herein, a diluent such as lactose, sucrose, dicalcium phosphate, or the like; a lubricant such as magnesium stearate or the like; and a binder such as starch, gum acacia, polyvinylpyrrolidine, gelatin, cellulose, cellulose derivatives or the like. In another solid dosage form, a powder, marume, solution or suspension (e.g., in propylene carbonate, vegetable oils, PEG's,
poloxamer 124 or triglycerides) is encapsulated in a capsule (gelatin or cellulose base capsule). Unit dosage forms in which one or more chemical entities provided herein or additional active agents are physically separated are also contemplated; e.g., capsules with granules (or tablets in a capsule) of each drug; two-layer tablets; two-compartment gel caps, etc. Enteric coated or delayed release oral dosage forms are also contemplated. - Other physiologically acceptable compounds include wetting agents, emulsifying agents, dispersing agents or preservatives that are particularly useful for preventing the growth or action of microorganisms. Various preservatives are well known and include, for example, phenol and ascorbic acid.
- In certain embodiments the excipients are sterile and generally free of undesirable matter. These compositions can be sterilized by conventional, well-known sterilization techniques. For various oral dosage form excipients such as tablets and capsules, sterility is not required. The USP/NF standard is usually sufficient.
- Ocular compositions can include, without limitation, one or more of any of the following: viscogens (e.g., Carboxymethylcellulose, Glycerin, Polyvinylpyrrolidone, Polyethylene glycol); Stabilizers (e.g., Pluronic (triblock copolymers), Cyclodextrins); Preservatives (e.g., Benzalkonium chloride, ETDA, SofZia (boric acid, propylene glycol, sorbitol, and zinc chloride; Alcon Laboratories, Inc.), Purite (stabilized oxychloro complex; Allergan, Inc.)).
- Topical compositions can include ointments and creams. Ointments are semisolid preparations that are typically based on petrolatum or other petroleum derivatives. Creams containing the selected active agent are typically viscous liquid or semisolid emulsions, often either oil-in-water or water-in-oil. Cream bases are typically water-washable, and contain an oil phase, an emulsifier and an aqueous phase. The oil phase, also sometimes called the “internal” phase, is generally comprised of petrolatum and a fatty alcohol such as cetyl or stearyl alcohol; the aqueous phase usually, although not necessarily, exceeds the oil phase in volume, and generally contains a humectant. The emulsifier in a cream formulation is generally a nonionic, anionic, cationic or amphoteric surfactant. As with other carriers or vehicles, an ointment base should be inert, stable, nonirritating and non-sensitizing.
- In any of the foregoing embodiments, pharmaceutical compositions described herein can include one or more one or more of the following: lipids, interbilayer crosslinked multilamellar vesicles, biodegradable poly(D,L-lactic-co-glycolic acid) [PLGA]-based or poly anhydride-based nanoparticles or microparticles, and nanoporous particle-supported lipid bilayers.
- Dosages
- The dosages may be varied depending on the requirement of the patient, the severity of the condition being treating and the particular compound being employed. Proper dosage for a particular situation can be determined by one skilled in the medical arts. In some cases, the total daily dosage may be divided and administered in portions throughout the day or by means providing continuous delivery.
- In some embodiments, the compounds described herein are administered at a dosage of from about 0.0002 mg/Kg to about 100 mg/Kg (e.g., from about 0.0002 mg/Kg to about 50 mg/Kg; from about 0.0002 mg/Kg to about 25 mg/Kg; from about 0.0002 mg/Kg to about 10 mg/Kg; from about 0.0002 mg/Kg to about 5 mg/Kg; from about 0.0002 mg/Kg to about 1 mg/Kg; from about 0.0002 mg/Kg to about 0.5 mg/Kg; from about 0.0002 mg/Kg to about 0.1 mg/Kg; from about 0.001 mg/Kg to about 50 mg/Kg; from about 0.001 mg/Kg to about 25 mg/Kg; from about 0.001 mg/Kg to about 10 mg/Kg; from about 0.001 mg/Kg to about 5 mg/Kg; from about 0.001 mg/Kg to about 1 mg/Kg; from about 0.001 mg/Kg to about 0.5 mg/Kg; from about 0.001 mg/Kg to about 0.1 mg/Kg; from about 0.01 mg/Kg to about 50 mg/Kg; from about 0.01 mg/Kg to about 25 mg/Kg; from about 0.01 mg/Kg to about 10 mg/Kg; from about 0.01 mg/Kg to about 5 mg/Kg; from about 0.01 mg/Kg to about 1 mg/Kg; from about 0.01 mg/Kg to about 0.5 mg/Kg; from about 0.01 mg/Kg to about 0.1 mg/Kg; from about 0.1 mg/Kg to about 50 mg/Kg; from about 0.1 mg/Kg to about 25 mg/Kg; from about 0.1 mg/Kg to about 10 mg/Kg; from about 0.1 mg/Kg to about 5 mg/Kg; from about 0.1 mg/Kg to about 1 mg/Kg; from about 0.1 mg/Kg to about 0.5 mg/Kg).
- Regimens
- The foregoing dosages can be administered on a daily basis (e.g., as a single dose or as two or more divided doses) or non-daily basis (e.g., every other day, every two days, every three days, once weekly, twice weeks, once every two weeks, once a month).
- In some embodiments, the period of administration of a compound described herein is for 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, or more. In a further embodiment, a period of during which administration is stopped is for 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, or more. In an embodiment, a therapeutic compound is administered to an individual for a period of time followed by a separate period of time. In another embodiment, a therapeutic compound is administered for a first period and a second period following the first period, with administration stopped during the second period, followed by a third period where administration of the therapeutic compound is started and then a fourth period following the third period where administration is stopped. In an aspect of this embodiment, the period of administration of a therapeutic compound followed by a period where administration is stopped is repeated for a determined or undetermined period of time. In a further embodiment, a period of administration is for 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, or more. In a further embodiment, a period of during which administration is stopped is for 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, or more.
- Methods of Treatment
- This disclosure features methods for treating a subject (e.g., a human) having a disease, disorder, or condition in which modulation of GLP-1R and/or GIPR activities (e.g., repressed or impaired and/or elevated or unwanted GLP-1R and/or GIPR signaling) is beneficial for the treatment of the underlying pathology and/or symptoms and/or progression of the disease, disorder, or condition. In certain embodiments, the methods described herein can include or further include treating one or more conditions associated, co-morbid or sequela with any one or more of the conditions described herein.
- In certain embodiments, the chemical entities described herein induce blood glucose reduction (e.g., reduce blood glucose levels), promote insulin synthesis, stimulate insulin secretion, increase the mass of β-cells, modulate gastric acid secretion, modulate gastric emptying, and/or decrease glucagon production. In certain embodiments, the chemical entities described herein stabilize serum glucose and serum insulin levels.
- Indications
- Obesity
- In some embodiments, the condition, disease or disorder is obesity and conditions, diseases or disorders that are associated with obesity. Non-limiting examples of obesity and obesity related conditions include symptomatic obesity, simple obesity, childhood obesity, morbid obesity and abdominal obesity (central obesity characterized by abdominal adiposity). Non-limiting examples of symptomatic obesity include endocrine obesity (e.g., Cushing syndrome, hypothyroidism, insulinoma, obese type II diabetes, pseudohypoparathyroidism, hypogonadism), hypothalamic obesity, hereditary obesity (e.g., Prader-Willi syndrome, Laurence-Moon-Biedl syndrome), and drug-induced obesity (e.g., steroid, phenothiazine, insulin, sulfonylurea agent, or β-blocker-induced obesity).
- In some embodiments, the condition, disease or disorder is associated with obesity. Examples of such conditions, disease or disorders include, without limitation, glucose tolerance disorders, diabetes (e.g.,
type 2 diabetes, obese diabetes), lipid metabolism abnormality, hyperlipidemia, hypertension, cardiac failure, hyperuricemia, gout, fatty liver (including non-alcoholic steatohepatitis (NASH)), coronary heart disease (e.g., myocardial infarction, angina pectoris), cerebral infarction (e.g., brain thrombosis, transient cerebral ischemic attack), bone or articular disease (e.g., knee osteoarthritis, hip osteoarthritis, spondylitis deformans, lumbago), sleep apnea syndrome, obesity hypoventilation syndrome (Pickwickian syndrome), menstrual disorder (e.g., abnormal menstrual cycle, abnormality of menstrual flow and cycle, amenorrhea, abnormal catamenial symptom), visceral obesity syndrome, and metabolic syndrome. In certain embodiments, the chemical entities described herein can be used to treat subjects exhibiting symptoms of both obesity and insulin deficiency. - Diabetes
- In some embodiments, the condition, disease or disorder is diabetes. Non-limiting examples of diabetes include
type 1 diabetes,type 2 diabetes (e.g., diet-treated type 2-diabetes, sulfonylurea-treated type 2-diabetes, a far-advanced stage type 2-diabetes, long-term insulin-treated type 2-diabetes), diabetes mellitus (e.g., non-insulin-dependent diabetes mellitus, insulin-dependent diabetes mellitus), gestational diabetes, obese diabetes, autoimmune diabetes, and borderline type diabetes. - In some embodiments, the condition, disease or disorder is associated with diabetes (e.g., a complication of diabetes). Non-limiting examples of disorders associated with diabetes include obesity, obesity-related disorders, metabolic syndrome, neuropathy, nephropathy (e.g., diabetic nephropathy), retinopathy, diabetic cardiomyopathy, cataract, macroangiopathy, osteopenia, hyperosmolar diabetic coma, infectious disease (e.g., respiratory infection, urinary tract infection, gastrointestinal infection, dermal soft tissue infections, inferior limb infection), diabetic gangrene, xerostomia, hypacusis, cerebrovascular disorder, diabetic cachexia, delayed wound healing, diabetic dyslipidemia peripheral blood circulation disorder, cardiovascular risk factors. (e.g., coronary artery disease, peripheral artery disease, cerebrovascular disease, hypertension, and risk factors related to unmanaged cholesterol and/or lipid levels, and/or inflammation), NASH, bone fracture and cognitive dysfunction
- Other non-limiting examples of disorders related to diabetes include pre-diabetes, hyperlipidemia (e.g., hypertriglyceridemia, hypercholesterolemia, high LDL-cholesterolemia, low HDL-cholesterolemia, postprandial hyperlipemia), metabolic syndrome (e.g., metabolic disorder where activation of GLP-1R is beneficial, metabolic syndrome X), hypertension, impaired glucose tolerance (IGT), insulin resistance, and sarcopenia.
- In some embodiments, the condition, disease or disorder is diabetes and obesity (diabesity). In certain embodiments, the compounds described herein are also useful in improving the therapeutic effectiveness of metformin.
- Disorders of Metabolically Important Tissues
- In some embodiments, the condition, disease or disorder is a disorder of a metabolically important tissue.
- In some embodiments, the condition, disease or disorder is a fatty liver disease. Fatty liver diseases include, but are not limited to, non-alcoholic fatty acid liver disease (NAFLD), steatohepatitis, non-alcoholic steatohepatitis (NASH), fatty liver disease resulting from hepatitis, fatty liver disease resulting from obesity, fatty liver disease resulting from diabetes, fatty liver disease resulting from insulin resistance, fatty liver disease resulting from hypertriglyceridemia, Abetalipoproteinemia, glycogen storage diseases, Weber-Christian disease, Wolmans disease, acute fatty liver of pregnancy, and lipodystrophy.
- Non-alcoholic fatty liver disease (NAFLD) represents a spectrum of disease occurring in the absence of alcohol abuse and is typically characterized by the presence of steatosis (fat in the liver). NAFLD is believed to be linked to a variety of conditions, e.g., metabolic syndrome (including obesity, diabetes and hypertriglyceridemia) and insulin resistance. It can cause liver disease in adults and children and may ultimately lead to cirrhosis (Skelly et al., J Hepatol 2001; 35: 195-9; Chitturi et al., Hepatology 2002; 35(2):373-9). The severity of NAFLD ranges from the relatively benign isolated predominantly macrovesicular steatosis (i.e., nonalcoholic fatty liver or NAFL) to non-alcoholic steatohepatitis (NASH) (Angulo et al., J Gastroenterol Hepatol 2002; 17 Suppl:S186-90). In certain embodiments, the subject is a pediatric subject (e.g., 6-16 years old; or 6-12 years old; or 6-10 years old). In certain embodiments, the subject is a adult subject.
- Other non-limiting examples of disorders in metabolically important tissues include joint disorders (e.g., osteoarthritis, secondary osteoarthritis), steatosis (e.g. in the liver); gall stones; gallbladder disorders; gastroesophageal reflux; sleep apnea; hepatitis; fatty liver; bone disorder characterized by altered bone metabolism, such as osteoporosis, including post-menopausal osteoporosis, poor bone strength, osteopenia, Paget's disease, osteolytic metastasis in cancer patients, osteodystrophy in liver disease and the altered bone metabolism caused by renal failure or haemodialysis, bone fracture, bone surgery, aging, pregnancy, protection against bone fractures, and malnutrition polycystic ovary syndrome; renal disease (e.g., chronic renal failure, glomerulonephritis, glomerulosclerosis, nephrotic syndrome, hypertensive nephrosclerosis, end-stage renal disease); muscular dystrophy, angina pectoris, acute or chronic diarrhea, testicular dysfunction, respiratory dysfunction, frailty, sexual dysfunction (e.g., erectile dysfunction) and geriatric syndrome. In certain embodiments, the chemical entities described herein can be used for treating surgical trauma by improving recovery after surgery and/or by preventing the catabolic reaction caused by surgical trauma.
- Cardiovascular Diseases
- In some embodiments, the condition, disease or disorder is a cardiovascular disease. Non-limiting examples of cardiovascular disease include congestive heart failure, atherosclerosis, arteriosclerosis, coronary heart disease, or peripheral artery disease, stroke, coronary artery disease, congestive heart failure, coronary heart disease, hypertension, cardiac failure, cerebrovascular disorder (e.g., cerebral infarction), vascular dysfunction, myocardial infarction, elevated blood pressure (e.g., 130/85 mm Hg or higher), and prothrombotic state (exemplified by high fibrinogen or plasminogen activator inhibitor in the blood).
- Neurological Diseases
- In some embodiments, the condition, disease or disorder is a neurological disorder (e.g., neurodegenerative disorder) or a psychiatric disorder. Non-limiting examples of neurological disorders include brain insulin resistance, mild cognitive impairment (MCI), Alzheimer's disease (AD), Parkinson's disease (PD), anxiety, dementia (e.g., senile dementia), traumatic brain injury, Huntington's chores, tardive dyskinesia, hyperkinesia, mania, Morbus Parkinson, steel-Richard syndrome, Down's syndrome, myasthenia gravis, nerve trauma, brain trauma, vascular amyloidosis, cerebral hemorrhage I with amyloidosis, brain inflammation, Friedrich's ataxia, acute confusion disorder, amyotrophic lateral sclerosis (ALS), glaucoma, and apoptosis-mediated degenerative diseases of the central nervous system (e.g., Creutzfeldt-Jakob Disease, bovine spongiform encephalopathy (mad cow disease), chronic wasting syndrome). See, e.g., US20060275288A1.
- Non-limiting examples of psychiatric disorders include drug dependence/addiction (narcotics and amphetamines and attention deficit/hyperactivity disorder (ADHD). The chemical entities described herein can be useful in improving behavioral response to addictive drugs, decreasing drug dependence, prevention drug abuse relapse, and relieving anxiety caused by the absence of a given addictive substance. See, e.g., US20120021979A1.
- In certain embodiments, the chemical entities described herein are useful in improving learning and memory by enhancing neuronal plasticity and facilitation of cellular differentiation, and also in preserving dopamine neurons and motor function in Morbus Parkinson.
- Insulin-Related
- In some embodiments, the condition, disease or disorder is impaired fasting glucose (IFG), impaired fasting glycemia (IFG), hyperglycemia, insulin resistance (impaired glucose homeostasis), hyperinsulinemia, elevated blood levels of fatty acids or glycerol, a hypoglycemic condition, insulin resistant syndrome, paresthesia caused by hyperinsulinemia, hyperlipidaemia, hypercholesteremia, impaired wound healing, leptin resistance, glucose intolerance, increased fasting glucose, dyslipidemia (e.g., hyperlipidemia, atherogenic dyslipidemia characterized by high triglycerides and low HDL cholesterol), glucagonoma, hyperuricacidemia, hypoglycemia (e.g., nighttime hypoglycemia), and concomitant comatose endpoint associated with insulin.
- In certain embodiments, the chemical entities described herein can reduce or slow down the progression of borderline type, impaired fasting glucose or impaired fasting glycemia into diabetes.
- Autoimmune Disorders
- In some embodiments, the condition, disease or disorder is an autoimmune disorder. Non-limiting examples of autoimmune disorders include multiple sclerosis, experimental autoimmune encephalomyelitis, autoimmune disorder is associated with immune rejection, graft versus host disease, uveitis, optic neuropathies, optic neuritis, transverse myelitis, inflammatory bowel disease, rheumatoid arthritis, ankylosing spondylitis, systemic lupus erythematosus, myasthenia gravis, and Graves disease. See, e.g., US20120148586A1.
- Stomach and Intestine-Related Disorders
- In some embodiments, the condition, disease or disorder is a stomach or intestine related disorder. Non-limiting examples of these disorders include ulcers of any etiology (e.g. peptic ulcers, Zollinger-Ellison syndrome, drug-induced ulcers, ulcers related to infections or other pathogens), digestion disorders, malabsorption, short bowel syndrome, cul-de-sac syndrome, inflammatory bowel diseases (Crohn's disease and ulcerative colitis), celiac sprue, hypogammaglobulinemic sprue, chemotherapy and/or radiation therapy-induced mucositis and diarrhea, gastrointestinal inflammation, short bowel syndrome, colitis ulcerosa, gastric mucosal injury (e.g., gastric mucosal injury caused by aspirin), small intestinal mucosal injury, and cachexia (e.g., cancerous cachexia, tuberculous cachexia, cachexia associated with blood disease, cachexia associated with endocrine disease, cachexia associated with infectious disease, cachexia caused by acquired immunodeficiency syndrome).
- Body Weight
- In some embodiments, the chemical entities described herein can be used to reduce body weight (e.g., excess body weight), prevent body weight gain, induce weight loss, decrease body fat, or reduce food intake in a subject (e.g., a subject in need thereof). In certain embodiments, the weight increase in a subject may be attributed to excessive ingestion of food or unbalanced diets, or may be weight increase derived from a concomitant drug (e.g., insulin sensitizers having a PPARγ agonist-like action, such as troglitazone, rosiglitazone, englitazone, ciglitazone, pioglitazone and the like). Alternatively, the weight increase may be weight increase before reaching obesity, or may be weight increase in an obese subject. The weight increase may also be medication-induced weight gain or weight gain subsequent to cessation of smoking.
- In some embodiments, the condition, disease or disorder is an eating disorder, such as hyperphagia, binge eating, bulimia, or compulsive eating.
- Inflammatory Diseases
- In some embodiments, the condition, disease or disorder is an inflammatory disorder. Non-limiting examples of inflammatory disorders include chronic rheumatoid arthritis, spondylitis deformans, arthritis deformans, lumbago, gout, post-operational or post-traumatic inflammation, bloating, neuralgia, laryngopharyngitis, cystitis, pneumonia, pancreatitis, enteritis, inflammatory bowel disease (including inflammatory large bowel disease), inflammation in metabolically important tissues including liver, fat, pancreas, kidney and gut, and a proinflammatory state (e.g., elevated levels of proinflammatory cytokines or markers of inflammation-like C-reactive protein in the blood).
- Cancer
- In some embodiments, the condition, disease or disorder is cancer. Suitable examples of cancer include breast cancer (e.g., invasive ductal breast cancer, noninvasive ductal breast cancer, inflammatory breast cancer), prostate cancer (e.g., hormone-dependent prostate cancer, hormone-independent prostate cancer), pancreatic cancer (e.g., ductal pancreatic cancer), gastric cancer (e.g., papillary adenocarcinoma, mucous adenocarcinoma, adenosquamous carcinoma), lung cancer (e.g., non-small cell lung cancer, small-cell lung cancer, malignant mesothelioma), colon cancer (e.g., gastrointestinal stromal tumor), rectal cancer (e.g., gastrointestinal stromal tumor), colorectal cancer (e.g., familial colorectal cancer, hereditary non-polyposis colorectal cancer, gastrointestinal stromal tumor), small intestinal cancer (e.g., non-Hodgkin's lymphoma, gastrointestinal stromal tumor), esophageal cancer, duodenal cancer, tongue cancer, pharyngeal cancer (e.g., nasopharyngeal cancer, oropharynx cancer, hypopharyngeal cancer), salivary gland cancer, brain tumor (e.g., pineal astrocytoma, pilocytic astrocytoma, diffuse astrocytoma, anaplastic astrocytoma), neurilemmoma, liver cancer (e.g., primary liver cancer, extrahepatic bile duct cancer), renal cancer (e.g., renal cell cancer, transitional cell cancer of the renal pelvis and ureter), bile duct cancer, endometrial cancer, uterine cervical cancer, ovarian cancer (e.g., epithelial ovarian cancer, extragonadal germ cell tumor, ovarian germ cell tumor, ovarian tumor of low malignant potential), bladder cancer, urethral cancer, skin cancer (e.g., intraocular (ocular) melanoma, Merkel cell carcinoma), hemangioma, malignant lymphoma, malignant melanoma, thyroid cancer (e.g., medullary thyroid cancer), parathyroid cancer, nasal cavity cancer, sinus cancer, bone tumor (e.g., osteosarcoma, Ewing tumor, uterine sarcoma, soft tissue sarcoma), angiofibroma, sarcoma of the retina, penis cancer, testicular tumor, pediatric solid tumor (e.g., Wilms' tumor, childhood kidney tumor), Kaposi's sarcoma, Kaposi's sarcoma caused by AIDS, tumor of maxillary sinus, fibrous histiocytoma, leiomyosarcoma, rhabdomyosarcoma, and leukemia (e.g., acute myeloid leukemia, acute lymphoblastic leukemia).
- Combination Therapy
- This disclosure contemplates both monotherapy regimens as well as combination therapy regimens.
- In some embodiments, the methods described herein can further include administering one or more additional therapies (e.g., one or more additional therapeutic agents and/or one or more therapeutic regimens) in combination with administration of the compounds described herein.
- In some embodiments, the methods described herein include administering a compound described herein in combination with one or more of a diet therapy (e.g., diet therapy for diabetes), an exercise therapy, blood sugar monitoring, and diet modifications.
- In some embodiments, the compound described herein can be administered in combination with one or more of additional therapeutic agents.
- Representative additional therapeutic agents include, but are not limited to, anti-obesity agents, therapeutic agents for diabetes, therapeutic agents for diabetic complications, therapeutic agents for hyperlipidemia, antihypertensive agents, diuretics, chemotherapeutics, immunotherapeutics, anti-inflammatory drugs, antithrombotic agents, anti-oxidants, therapeutic agents for osteoporosis, vitamins, antidementia drugs, erectile dysfunction drugs, therapeutic drugs for urinary frequency or urinary incontinence, therapeutic agents for NAFLD, and therapeutic agents for dysuria.
- In some embodiments, the one or more additional therapeutic agents include those useful, e.g., as anti-obesity agents. Non-limiting examples include:
-
- monoamine uptake inhibitors (e.g., tramadol, phentermine, sibutramine, mazindol, fluoxetine, tesofensine);
- serotonin 2C receptor agonists (e.g., lorcaserin);
-
serotonin 6 receptor antagonists; - histamine H3 receptor modulator;
- GABA modulator (e.g., topiramate), including GABA receptor agonists (e.g., gabapentin, pregabalin);
- neuropeptide Y antagonists (e.g., velneperit);
- cannabinoid receptor antagonists (e.g., rimonabant, taranabant);
- ghrelin antagonists;
- ghrelin receptor antagonists;
- ghrelin acylation enzyme inhibitors;
- opioid receptor antagonists (e.g., GSK-1521498);
- orexin receptor antagonists;
-
melanocortin 4 receptor agonists; - 11β-hydroxysteroid dehydrogenase inhibitors (e.g., AZD-4017, BVT-3498, INCB-13739);
- pancreatic lipase inhibitors (e.g., orlistat, cetilistat);
- β3 agonists (e.g., N-5984);
- diacylglycerol acyltransferase 1 (DGAT1) inhibitors;
- acetylCoA carboxylase (ACC) inhibitors;
- stearoyl-CoA desaturated enzyme inhibitors;
- microsomal triglyceride transfer protein inhibitors (e.g., R-256918);
- Na-glucose cotransporter 2 (SGLT-2) inhibitors (e.g., JNJ-28431754, dapagliflozin, AVE2268, TS-033, YM543, TA-7284, ASP1941, remogliflozin);
- NFK inhibitors (e.g., HE-3286);
- PPAR agonists (e.g., GFT-505, DRF-11605, gemfibrozil and fenofibrate);
- phosphotyrosine phosphatase inhibitors (e.g., sodium vanadate, trodusquemin);
- GPR119 agonists (e.g., PSN-821, MBX-2982, APD597);
- glucokinase activators (e.g., piragliatin, AZD-1656, AZD6370, TTP-355, compounds described in W0006/112549, W0007/028135, W0008/047821, W0008/050821, W0008/136428 and W0008/156757);
- leptin, leptin derivatives (e.g., metreleptin), leptin resistance improving drugs;
- CNTF (ciliary neurotrophic factor);
- BDNF (brain-derived neurotrophic factor);
- cholecystokinin agonists, amylin preparations (e.g., pramlintide, AC-2307);
- neuropeptide Y agonists (e.g., PYY3-36, derivatives of PYY3-36, obineptide, TM-30339, TM-30335);
- oxyntomodulin (OXM) preparations;
- appetite suppressants (e.g. ephedrine);
- FGF21 preparations (e.g., animal FGF21 preparations extracted from the pancreas of bovine or swine; human FGF21 preparations genetically synthesized using Escherichia coli or yeast; fragments or derivatives of FGF21); and
- anorexigenic agents (e.g., P-57).
- In some embodiments, the one or more additional therapeutic agents include those useful, e.g., as anti-diabetic agents. Non-limiting examples include:
-
- insulin and insulin preparations (e.g., animal insulin preparations extracted from the pancreas of bovine or swine; human insulin preparations genetically synthesized using Escherichia coli or yeast; zinc insulin; protamine zinc insulin; fragment or derivative of insulin (e.g., INS-1), oral insulin preparation, synthetic human insulin);
- insulin sensitizers (e.g., pioglitazone or a salt thereof);
- biguanides (e.g., metformin, buformin or a salt thereof (e.g., hydrochloride, fumarate, succinate));
- glucagon analogs (e.g., any of glucagon analogs described, e.g., in WO 2010/011439);
- agents which antagonize the actions of or reduce secretion of glucagon;
- sulfonylurea agents (e.g., chlorpropamide, tolazamide, gliclazide, glimepiride, tolbutamide, glibenclamide, gliclazide, acetohexamide, glyclopyamide, glybuzole, glyburide);
- thiazolidinedione agents (e.g. rosiglitazone or pioglitazone);
- α-glucosidase inhibitors (e.g., voglibose, acarbose, miglitol, emiglitate);
- insulin secretagogues, such as prandial glucose regulators (sometimes called “short-acting secretagogues”), e.g., meglitinides (e.g. repaglinide and nateglinide);
- cholinesterase inhibitors (e.g., donepezil, galantamine, rivastigmine, tacrine);
- NMDA receptor antagonists;
- dual GLP-1/GIP receptor agonists (e.g., LBT-2000, ZPD1-70);
- GLP-1R agonists (e.g., exenatide, liraglutide, albiglutide, dulaglutide, AVE-0010, S4P and Boc5); and
- dipeptidyl peptidase IV (DPP-4) inhibitors (e.g., vildagliptin, dutogliptin, gemigliptin, alogliptin, saxagliptin, sitagliptin, linagliptin, berberine, adogliptin, B11356, GRC8200, MP-513, PF-00734200, PHX1149, SK-0403, ALS2-0426, TA-6666, TS-021, KRP-104, trelagliptin).
- In some embodiments, the one or more additional therapeutic agents include those useful, e.g., for treating NAFL and NASH. Non-limiting examples include glycyrrhizin, schisandra extract, ascorbic acid, glutathione, silymarin, lipoic acid, and d-alpha-tocopherol, ascorbic acid, glutathione, vitamin B-complex, glitazones/thiazolidinediones (e.g., troglitazone, rosiglitazone, pioglitazone), metformin, cystamine, sulfonylureas, alpha-glucosidase inhibitors, meglitinides, vitamin E, tetrahydrolipstatin, milk thistle protein, anti-virals, and anti-oxidants.
- In some embodiments, the one or more additional therapeutic agents include those useful, e.g., for treating diabetic complications. Non-limiting examples include:
-
- aldose reductase inhibitors (e.g., tolrestat, epalrestat, zopolrestat, fidarestat, CT-112, ranirestat, lidorestat);
- neurotrophic factor and increasing agents thereof (e.g., NGF, NT-3, BDNF, neurotrophic production/secretion promoting agents described in WO01/14372 (e.g., 4-(4-chlorophenyl)-2-(2-methyl-1-imidazolyl)-5-[3-(2-methylphenoxyl)propyl]oxazole), compounds described in WO2004/039365);
- PKC inhibitors (e.g., ruboxistaurin mesylate);
- AGE inhibitors (e.g., ALT946, N-phenacylthiazolium bromide (ALT766), EXO-226, pyridorin, pyridoxamine);
- serotonin and noradrenalin reuptake inhibitors (e.g., duloxetine);
- sodium channel inhibitors (e.g., lacosamide);
- active oxygen scavengers (e.g., thioctic acid);
- cerebral vasodilators (e.g., tiapuride, mexiletine);
- somatostatin receptor agonists (e.g., BIM23190); and
- apoptosis signal regulating kinase-1 (ASK-1) inhibitors.
- In some embodiments, the one or more additional therapeutic agents include those useful, e.g., for treating hyperlipidemia. Non-limiting examples include:
-
- HMG-COA reductase inhibitors (e.g., pravastatin, simvastatin, lovastatin, atorvastatin, fluvastatin, rosuvastatin, pitavastatin or a salt thereof (e.g., sodium salt, calcium salt));
- squalene synthase inhibitors (e.g., compounds described in WO97/10224, e.g., N-[[(3R,5S)-1-(3-acetoxy-2,2-dimethylpropyl)-7-chloro-5-(2,3-dimethoxyphenyl)-2-oxo-1,2,3,5-tetrahydro-4,1-benzoxazepin-3-yl]acetyl]piperidin-4-acetic acid);
- fibrate compounds (e.g., bezafibrate, clofibrate, simfibrate, clinofibrate);
- anion exchange resin (e.g., cholestyramine);
- nicotinic acid drugs (e.g., nicomol, niceritrol, niaspan);
- phytosterols (e.g., soysterol, gamma oryzanol (γ-oryzanol));
- cholesterol absorption inhibitors (e.g., zechia);
- CETP inhibitors (e.g., dalcetrapib, anacetrapib); and
- ω-3 fatty acid preparations (e.g., ω-3-fatty acid ethyl esters 90).
- In some embodiments, the one or more additional therapeutic agents include those useful, e.g., as anti-hypertensive agents. Non-limiting examples include:
-
- angiotensin converting enzyme inhibitors (e.g., captopril, enalapril, delapril);
- angiotensin II antagonists (e.g., candesartan cilexetil, candesartan, losartan, losartan potassium, eprosartan, valsartan, telmisartan, irbesartan, tasosartan, olmesartan, olmesartan medoxomil, azilsartan, azilsartan medoxomil);
- calcium antagonists (e.g., manidipine, nifedipine, amlodipine, efonidipine, nicardipine, cilnidipine); and
- β-blockers (e.g., metoprolol, atenolol, propranolol, carvedilol, pindolol).
- In some embodiments, the one or more additional therapeutic agents include those useful, e.g., as diuretics. Non-limiting examples include:
-
- xanthine derivatives (e.g., theobromine sodium salicylate, theobromine calcium salicylate);
- thiazide preparations (e.g., ethiazide, cyclopenthiazide, trichloromethiazide, hydrochlorothiazide, hydroflumethiazide, benzylhydrochlorothiazide, penfluthiazide, polythiazide, methyclothiazide);
- antialdosterone preparations (e.g., spironolactone, triamterene);
- carbonic anhydrase inhibitors (e.g., acetazolamide); and
- chlorobenzenesulfonamide agents (e.g., chlortalidone, mefruside, indapamide).
- In some embodiments, the one or more additional therapeutic agents include those useful, e.g., as immunotherapeutic agents. Non-limiting examples include: microbial or bacterial compounds (e.g., muramyl dipeptide derivative, picibanil); polysaccharides having immunoenhancing activity (e.g., lentinan, sizofiran, krestin); cytokines obtained by genetic engineering approaches (e.g., interferon, interleukin (IL) such as IL-1, IL-2, IL-12); and colony-stimulating factors (e.g., granulocyte colony-stimulating factor, erythropoietin).
- In some embodiments, the one or more additional therapeutic agents include those useful, e.g., as anti-thrombotic agents. Non-limiting examples include: heparins (e.g., heparin sodium, heparin calcium, enoxaparin sodium, dalteparin sodium); warfarin (e.g., warfarin potassium); anti-thrombin drugs (e.g., argatroban, dabigatran); FXa inhibitors (e.g., rivaroxaban, apixaban, edoxaban, YM150, compounds described in WO02/06234, WO2004/048363, WO2005/030740, WO2005/058823, and WO2005/113504); thrombolytic agents (e.g., urokinase, tisokinase, alteplase, nateplase, monteplase, pamiteplase); and platelet aggregation inhibitors (e.g., ticlopidine hydrochloride, clopidogrel, prasugrel, E5555, SHC530348, cilostazol, ethyl icosapentate, beraprost sodium, sarpogrelate hydrochloride).
- In some embodiments, the one or more additional therapeutic agents include those useful, e.g., for treating osteoporosis. Non-limiting examples include: alfacalcidol, calcitriol, elcatonin, calcitonin salmon, estriol, ipriflavone, pamidronate disodium, alendronate sodium hydrate, incadronate disodium, and risedronate disodium. Suitable examples of vitamins include vitamin B1 and vitamin B12. Suitable examples of erectile dysfunction drugs include apomorphine and sildenafil citrate. Suitable examples of therapeutic agents for urinary frequency or urinary incontinence include flavorxate hydrochloride, oxybutynin hydrochloride and propiverine hydrochloride. Suitable examples of therapeutic agents for dysuria include acetylcholine esterase inhibitors (e.g., distigmine). Suitable examples of anti-inflammatory agents include nonsteroidal anti-inflammatory drugs such as aspirin, acetaminophen, indomethacin.
- Other Additional Therapeutic Agents Include:
-
- agents that modulate hepatic glucose balance (e.g.,
fructose 1,6-bisphosphatase inhibitors, glycogen phosphorylase inhibitors, glycogen synthase kinase inhibitors, glucokinase activators); - agents designed to treat the complications of prolonged hyperglycemia, such as aldose reductase inhibitors (e.g. epalrestat and ranirestat);
- agents used to treat complications related to micro-angiopathies;
- anti-dyslipidemia agents, such as HMG-CoA reductase inhibitors (statins, e.g. rosuvastatin);
- cholesterol-lowering agents;
- bile acid sequestrants (e.g., cholestyramine);
- cholesterol absorption inhibitors (e.g. plant sterols such as phytosterols);
- cholesteryl ester transfer protein (CETP) inhibitors;
- inhibitors of the ileal bile acid transport system (IBAT inhibitors);
- bile acid binding resins;
- nicotinic acid (niacin) and analogues thereof,
- anti-oxidants, such as probucol;
- omega-3 fatty acids;
- antihypertensive agents, including adrenergic receptor antagonists, such as beta blockers (e.g. atenolol), alpha blockers (e.g. doxazosin), and mixed alpha/beta blockers (e.g. labetalol);
- adrenergic receptor agonists, including alpha-2 agonists (e.g. clonidine);
- angiotensin converting enzyme (ACE) inhibitors (e.g. lisinopril);
- calcium channel blockers, such as dihydropyridines (e.g. nifedipine), phenylalkylamines (e.g. verapamil), and benzothiazepines (e.g. diltiazem);
- angiotensin II receptor antagonists (e.g. candesartan);
- aldosterone receptor antagonists (e.g. eplerenone);
- centrally acting adrenergic drugs, such as central alpha agonists (e.g. clonidine);
- diuretic agents (e.g. furosemide);
- haemostasis modulators, including antithrombotics (e.g., activators of fibrinolysis), thrombin antagonists, factor VIIa inhibitors, anticoagulants (e.g., vitamin K antagonists such as warfarin), heparin and low molecular weight analogues thereof, factor Xa inhibitors, and direct thrombin inhibitors (e.g. argatroban);
- antiplatelet agents (e.g., cyclooxygenase inhibitors (e.g. aspirin));
- adenosine diphosphate (ADP) receptor inhibitors (e.g. clopidogrel);
- phosphodiesterase inhibitors (e.g. cilostazol);
- glycoprotein IIB/IIA inhibitors (e.g. tirofiban);
- adenosine reuptake inhibitors (e.g. dipyridamole);
- noradrenergic agents (e.g. phentermine);
- serotonergic agents (e.g. sibutramine);
- diacyl glycerolacyltransferase (DGAT) inhibitors;
- feeding behavior modifying agents;
- pyruvate dehydrogenase kinase (PDK) modulators;
- serotonin receptor modulators;
- monoamine transmission-modulating agents, such as selective serotonin reuptake inhibitors (SSRI) (e.g. fluoxetine), noradrenaline reuptake inhibitors (NARI), noradrenaline-serotonin reuptake inhibitors (SNRI), and monoamine oxidase inhibitors (MAOI) (e.g. toloxatone and amiflamine);
- compounds described in W0007/013694, WO2007/018314, WO2008/093639 and WO2008/099794;
- GPR40 agonists (e.g., fasiglifam or a hydrate thereof, compounds described in WO2004/041266, WO2004/106276, WO2005/063729, WO2005/063725, WO2005/087710, WO2005/095338, WO2007/013689 and WO2008/001931);
- SGLT1 inhibitors;
- adiponectin or agonist thereof;
- IKK inhibitors (e.g., AS-2868);
- somatostatin receptor agonists;
- ACC2 inhibitors;
- cachexia-ameliorating agents, such as a cyclooxygenase inhibitors (e.g., indomethacin), progesterone derivatives (e.g., megestrol acetate), glucocorticoids (e.g., dexamethasone), metoclopramide agents, tetrahydrocannabinol agents, agents for improving fat metabolism (e.g., eicosapentaenoic acid), growth hormones, IGF-1, antibodies against a cachexia-inducing factor TNF-α, LIF, IL-6, and oncostatin M;
- metabolism-modifying proteins or peptides such as glucokinase (GK), glucokinase regulatory protein (GKRP),
uncoupling proteins 2 and 3 (UCP2 and UCP3), peroxisome proliferator-activated receptor α (PPARα); - MC4r agonists;
- insulin receptor agonist;
-
PDE 5 inhibitors; - glycation inhibitors (e.g., ALT-711);
- nerve regeneration-promoting drugs (e.g., Y-128, VX853, prosaptide);
- antidepressants (e.g., desipramine, amitriptyline, imipramine);
- antiepileptic drugs (e.g., lamotrigine, trileptal, keppra, zonegran, pregabalin, harkoseride, carbamazepine);
- antiarrhythmic drugs (e.g., mexiletine);
- acetylcholine receptor ligands (e.g., ABT-594);
- endothelin receptor antagonists (e.g., ABT-627);
- narcotic analgesics (e.g., morphine);
- α2 receptor agonists (e.g., clonidine);
- local analgesics (e.g., capsaicin);
- antianxiety drugs (e.g., benzothiazepine);
- phosphodiesterase inhibitors (e.g., sildenafil);
- dopamine receptor agonists (e.g., apomorphine);
- cytotoxic antibodies (e.g., T-cell receptor and IL-2 receptor-specific antibodies);
- B cell depleting therapies (e.g., anti-CD20 antibody (e.g., rituxan), i-BLyS antibody);
- drugs affecting T cell migration (e.g.,
anti-integrin alpha 4/beta 1 antibody (e.g., tysabri); - drugs that act on immunophilins (e.g., cyclosporine, tacrolimus, sirolimus, rapamicin);
- interferons (e.g., IFN-β);
- immunomodulators (e.g., glatiramer);
- TNF-binding proteins (e.g., circulating receptors);
- immunosupressants (e.g., mycophenolate); and
- metaglidasen, AMG-131, balaglitazone, MBX-2044, rivoglitazone, aleglitazar, chiglitazar, lobeglitazone, PLX-204, PN-2034, GFT-505, THR-0921, exenatide, exendin-4, memantine, midazolam, ketoconazole, ethyl icosapentate, clonidine, azosemide, isosorbide, ethacrynic acid, piretanide, bumetanide, etoposide.
- agents that modulate hepatic glucose balance (e.g.,
- In certain embodiments, the second therapeutic agent or regimen is administered to the subject prior to contacting with or administering the chemical entity (e.g., about one hour prior, or about 6 hours prior, or about 12 hours prior, or about 24 hours prior, or about 48 hours prior, or about 1 week prior, or about 1 month prior).
- In other embodiments, the second therapeutic agent or regimen is administered to the subject at about the same time as contacting with or administering the chemical entity. By way of example, the second therapeutic agent or regimen and the chemical entity are provided to the subject simultaneously in the same dosage form. As another example, the second therapeutic agent or regimen and the chemical entity are provided to the subject concurrently in separate dosage forms.
- In still other embodiments, the second therapeutic agent or regimen is administered to the subject after contacting with or administering the chemical entity (e.g., about one hour after, or about 6 hours after, or about 12 hours after, or about 24 hours after, or about 48 hours after, or about 1 week after, or about 1 month after).
- Patient Selection
- In some embodiments, the methods described herein further include the step of identifying a subject (e.g., a patient) in need of such treatment (e.g., by way of biopsy, endoscopy, or other conventional method known in the art).
- Compound Preparation and Biological Assays
- As can be appreciated by the skilled artisan, methods of synthesizing the compounds of the formulae herein will be evident to those of ordinary skill in the art. Synthetic chemistry transformations and protecting group methodologies (protection and deprotection) useful in synthesizing the compounds described herein are known in the art and include, for example, those such as described in R. Larock, Comprehensive Organic Transformations, VCH Publishers (1989); T. W. Greene and R G M. Wuts, Protective Groups in Organic Synthesis, 2d. Ed., John Wiley and Sons (1991); L. Fieser and M. Fieser, Fieser and Fieser's Reagents for Organic Synthesis, John Wiley and Sons (1994); and L. Paquette, ed., Encyclopedia of Reagents for Organic Synthesis, John Wiley and Sons (1995), and subsequent editions thereof.
- In some embodiments, intermediates useful for preparing the compounds described herein can be prepared using the chemistries delineated in any one or more of the following schemes and non-limiting examples.
-
-
- AcOH=Acetic acid
- BOP=(Benzotriazol-1-yloxy)tris(dimethylamino)phosphonium
- hexafluorophosphate
- CDI=1,1-carbonyldiimidazole
- DCC=N,N′-dicyclohexylcarbodiimide
- DCM=Dichloromethane
- DIAD=Diisopropylazodicarboxylate
- DIPEA=N,N-diisopropylethylamine
- DMAP=4-Dimethylaminopyridine
- DMF=N,N-dimethylformamide
- DMSO=Dimethylsulfoxide
- EDC=1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride
- ESI-MS=Electrospray ionization mass spectrometry
- Et2O=Diethyl ether
- EtOAc=EtOAc
- EtOH=Ethanol
- HATU=1-[Bis(dimethylamino)methylene]-1H-1,2,3-triazolo[4,5-b]pyridinium
- 3-oxide hexafluorophosphate
- HOSu=N-hydroxysuccinimide
- HPLC=High performance liquid chromatography
- LC-MS=Liquid chromatography-mass spectrometry
- MeCN=Acetonitrile
- MeOH=Methanol
- NMR=Nuclear magnetic resonance
- Proton sponge=1,8-Bis(dimethylamino)naphthalene
- TBAB=Tetrabutylammonium bromide
- TBAF=Tetrabutylammonium fluoride
- TBAI=Tetrabutylammonium iodide
- TBSCl=tert-Butyldimethylsilyl chloride
- TEA=Triethylamine
- TFA=Trifluoroacetic acid
- TFAA=Trifluoroacetic anhydride
- THF=Tetrahydrofuran
- TIS=Triisopropylsilane
- TIPS=Triisopropylsilyl
- T3P=Propylphosphonic anhydride
- TLC=Thin layer chromatography
-
- In the sequences depicted above with the exception of Sequence Ta,
- corresponds to the
- moiety in any of the formulae described herein (wherein R1 is H).
- In sequence Ta above,
- corresponds to the
- moiety in any of the formulae described herein (wherein R4 is H).
- To amine or amine salt (1.0 equiv.) in DMF (I-2 mL) was added thiodiglycolic anhydride, 3-methylglutaric anhydride, or 3,3-dimethylglutaric anhydride (1.1-1.2 equiv), followed by DIPEA (2-5 equiv.). After 0.5-16 hours at ambient temperature, the reaction product was isolated by preparative HPLC (
Phenomenex Jupiter 10μM Proteo 90 Å LC column, 250×21.2 mm, with flow rate—15 mL/min, H2O/MeCN with 0.1% TFA). -
- To a slurry of diacid (1.8-3.9 mmol) and triethylamine (2.1-3.0 equiv.) in DCM (5-20 mL) was added pentafluorophenyl trifluoroacetate (2.0-2.1 equiv.). The reaction mixture was stirred at ambient temperature for 5-18 hours, then concentrated and purified by silica gel chromatography to afford the desired diester.
-
- To amine (0.1-0.4 mmol) and bis-(pentafluorophenyl)ester (1.0 equiv.) in DMF (1 mL), added DIPEA (3.0 equiv.). After 3 hours at ambient temperature, the reaction mixture was purified by preparative HPLC (
Phenomenex Jupiter 10μM Proteo 90 Å LC column, 250×21.2 mm, with flow rate—15 mL/min, H2O/MeCN with 0.1% TFA) to afford the desired substitution product. -
- To a solution of 1-(2-aminoethyl)pyrrolidin-2-one (103.1 mg, 0.80 mmol) and triethylamine (0.11 mL, 1.0 equiv.) in DCM (2.3 mL) was added chloroacetyl chloride (63.9 μL, 1.0 equiv.). The reaction mixture was stirred at ambient temperature for 1 hour, then concentrated to a residue which was re-dissolved in DMF (2 mL). Potassium thioacetate (137.7 mg, 1.0 equiv.) was added and the reaction mixture was stirred at ambient temperature for 30 minutes, then concentrated to a residue, which was purified by silica gel chromatography (0-15% MeOH in DCM) to afford I-3. ESI-MS found 245.2, C10H17N2O3S (MH+) requires 245.1.
-
- To a solution of 1-(2-aminoethyl)pyrrolidin-2-one (100.5 mg, 0.44 mmol) and triethylamine (61.8 μL, 1.0 equiv.) in DCM (1.1 mL) was added chloroacetyl chloride (35.2 μL, 1.0 equiv.). The reaction mixture was stirred at ambient temperature for 1 hour, then concentrated to a residue which was re-dissolved in DMF (2 mL). Potassium thioacetate (75 mg, 1.0 equiv.) was added and the reaction mixture was stirred at ambient temperature for 30 minutes, then concentrated to a residue, which was purified by silica gel chromatography (0-15% MeOH in DCM) to afford I-5 (69.3 mg, 51%, 2 steps). ESI-MS found 307.2, C14H15N2O4S (MH+) requires 307.1.
-
- Prepared according to GP1. Yield: 57.8 mg (64%). ESI-MS found 271.2, C11H15N2O4S (MH+) requires 271.1.
-
- Prepared according to GP1. Yield: 28.6 mg (69%). ESI-MS found 339.2, C12H14F3N2O4S (MH+) requires 339.1.
-
- Prepared according to GP1. Yield: 70.1 mg (100%). ESI-MS found 275.2, C10H15N2O5S (MH+) requires 275.1.
-
- Prepared according to GP1. Yield: 188.4 mg (73%). ESI-MS found 292.2, C9H13N2O5S2 (MH+) requires 292.1.
-
- Prepared according to GP1. Yield: 92.7 mg (68%). ESI-MS found 259.3, C10H15N2O4S (M−H+) requires 259.1.
-
- Prepared according to GP1. Yield: 73 mg. ESI-MS found 300.2, C12H18N3O4S (MH+) requires 300.1.
-
- Prepared according to GP1. Yield: 60.1 mg (87%). ESI-MS found 289.2, C11H17N2O5S (MH+) requires 289.1.
-
- Prepared according to GP1. Yield: 68.5 mg (98%). ESI-MS found 289.2, C11H17N2O5S (MH+) requires 289.1.
-
- Prepared according to GP1. Yield: 73.1 mg (95%). ESI-MS found 303.2, C12H19N2O5S (MH+) requires 303.1.
-
- To a solution of amine salt I-14 (65 mg, 0.33 mmol) and 2,2′-sulfinyldiacetic acid (114 mg, 2.1 equiv.) in DMF (1 mL) was added DIPEA (0.12 mL, 2.1 equiv.) and EDC (67 mg, 1.06 equiv.). The reaction mixture was stirred at ambient temperature for 16 hours. Additional DIPEA (0.06 mL, 1.0 equiv.) was then added. After an additional 24 hours, purification by preparative HPLC (H2O/MeCN with 0.1% TFA) afforded 106.9 mg (quantitative yield) of I-15 as a colorless oil. ESI-MS found 306.9, C9H11N2O6S2 (M−H+) requires 307.0.
-
- Diester I-16: Prepared according to GP2. Yield: 1.16 g (65%).
-
- Diester I-17: Prepared according to GP2. Yield: 599 mg (29%)
-
- Diester I-18: Prepared according to GP2. Yield: 778 mg (46%)
-
- Diester I-19: Prepared according to GP2. Yield: 569.8 mg (64%).
-
- Diester I-20: Prepared according to GP2. Yield: 399.3 mg (48%).
-
- Prepared according to GP3 from diester I-16. Yield: 43.2 mg (50%). ESI-MS found 485.1, C22H18F5N2O5 (MH+) requires 485.1.
-
- Prepared according to GP3 from diester I-16. Yield: 25.8 mg (33%). ESI-MS found 312.1, C12H11F5NO3 (MH+) requires 312.1.
- Prepared according to GP3 from diester I-16. Yield: 53.4 mg (55%). ESI-MS found 499.1, C23H20F5N2O5 (MH+) requires 499.1.
-
- Prepared according to GP3 from diester I-16. Yield: 56.7 mg (58%). ESI-MS found 471.1, C21H16F5N2O5 (MH+) requires 471.1.
-
- Prepared according to GP3 from diester I-16. Yield: 28.7 mg (33%). ESI-MS found 470.3, C21H17F5N3O4 (MH+) requires 470.1.
- Prepared according to GP3 from diester I-16. Yield: 57.4 mg (86%). ESI-MS found 485.3, C22H18F5N2O5 (MH+) requires 485.1.
-
- Prepared according to GP3 from diester I-16. Yield: 18.1 mg (27%).
- Prepared according to GP3 from diester I-16. Yield: 48 mg (33%). ESI-MS found 441.1, C16H14F5N2O5S (MH+) requires 441.1.
-
- Prepared according to GP3 from diester I-18. Yield: 66.1 mg (59%). ESI-MS found 453.1, C17H14F5N2O5S (MH+) requires 453.1.
-
- Prepared according to GP3 from diester I-17. Yield: 58.8 mg (48%). ESI-MS found 439.1, C16H12F5N2O5S (MH+) requires 439.1.
-
- Prepared according to GP3 from diester I-16. Yield: 47.9 mg (61%). ESI-MS found 423.1, C18H20F5N2O4 (MH+) requires 423.1.
-
- Prepared according to GP3 from diester I-19. Yield: 40 mg (30% yield). ESI-MS found 481.2, C19H18F5N2O5S (MH+) requires 481.1.
-
- I-33: Prepared according to GP3 from diester I-20. Yield: 8.6 mg (9% yield).
-
- To a slurry of 3-(2-aminoethyl)thiazolidine-2,4-dione hydrochloride (100 mg, 0.51 mmol) and thiodiglycolic anhydride (69 mg, 1.0 equiv.) in DCM (1 mL) was added DIPEA (0.18 mL, 2.0 equiv.). The reaction mixture was stirred at ambient temperature for 2 hours. Pentafluorophenol (98 mg, 1.0 equiv.) was then added, followed by EDC (100 mg, 1.0 equiv.). The reaction mixture was stirred for 16 hours, then concentrated and purified by silica gel chromatography (0-60% EtOAc in Hexanes) to afford 69.1 mg (30% yield) of I-34 as a white solid. ESI-MS found 459.1. C15H12F5N2O5S2 (MH+) requires 459.0.
-
- To a slurry of 2-(2-aminoethyl)isoindoline-1,3-dione hydrochloride (200 mg, 0.82 mmol) and thiodiglycolic anhydride (122 mg, 1.05 equiv.) in DCM (5 mL) and DMF (2 mL) was added TEA (0.27 mL, 2.2 equiv.). The reaction mixture was stirred at ambient temperature for 16 hours. Additional thiodiglycolic anhydride (23 mg, 0.2 equiv.) was added for completion of the reaction. The reaction mixture was concentrated and diluted with DCM (30 mL). The organic phase was washed with 1 M HCl (30 mL) and the aqueous phase was back-extracted with EtOAc (30 mL). The combined organic extracts were dried (MgSO4) and concentrated to a residue, which was purified by silica gel chromatography (10:1 DCM/MeOH with 1% AcOH) to afford 400 mg of intermediate acid, This acid was re-dissolved in DCM (5 mL). Pentafluorophenol (215 mg, 1.3 equiv.) was then added, followed by EDC (224 mg, 1.3 equiv.). The reaction mixture was stirred for 1 hour, and additional pentafluorophenol (108 mg, 0.65 equiv.) and EDC (112 mg, 0.65 equiv.) were added. After an additional 30 minutes, the reaction mixture was concentrated and purified by silica gel chromatography (0-100% EtOAc in Hexanes) to afford 250 mg (58% yield, 2 steps) of I-35 as a white solid. ESI-MS found 489.1. C20H14F5N2O5S (MH+) requires 489.1.
-
- Amine salt I-14 (81 mg, 0.41 mmol) and glutaric anhydride (49 mg, 1.04 equiv.) were suspended in DCM (4 mL), and DIPEA (0.14 mL, 2.0 equiv.) was added. The reaction mixture was stirred at ambient temperature for 15 hours, whereupon pentafluorophenol (80 mg, 1.06 equiv.) and EDC (81 mg, 1.02 equiv.) were added to the homogeneous solution. After an additional 4 hours, the reaction mixture was diluted with DCM (20 mL) and washed with 1 M HCl (5 mL) and brine (8 mL). The organic extracts were dried (Na2SO4) and concentrated to a residue, which was purified by silica gel chromatography (Hexanes/EtOAc) to afford 105 mg (58% yield) of I-36 as a white solid. ESI-MS found 441.0. C16H14F5N2O5S (MH+) requires 441.1.
-
- Amine salt I-14 (69 mg, 0.35 mmol) and succinic anhydride (35 mg, 1.0 equiv.) were suspended in DCM (5 mL), and DIPEA (0.12 mL, 2.0 equiv.) was added. The reaction mixture was stirred at ambient temperature for 16 hours, whereupon pentafluorophenol (80 mg, 1.24 equiv.) and EDC (74 mg, 1.1 equiv.) were added to the homogeneous solution. After an additional 4 hours, the reaction mixture was diluted with DCM (20 mL) and washed with 1 M HCl (5 mL) and brine (8 mL). The organic extracts were dried (Na2SO4) and concentrated to a residue, which was purified by silica gel chromatography (Hexanes/EtOAc) to afford 64 mg (43% yield) of I-37 as a white solid. ESI-MS found 427.0. C15H12F5N2O5S (MH+) requires 427.1.
-
- Amine salt I-14 (73 mg, 0.37 mmol) and diglycolic anhydride (43 mg, 1.0 equiv.) were suspended in DCM (5 mL), and DIPEA (0.14 mL, 2.2 equiv.) was added. The reaction mixture was stirred at ambient temperature for 17 hours, whereupon pentafluorophenol (86 mg, 1.26 equiv.) and EDC (78 mg, 1.1 equiv.) were added to the homogeneous solution. After an additional 6 hours, the reaction mixture was diluted with DCM (20 mL) and washed with 1 M HCl (5 mL) and brine (8 mL). The organic extracts were dried (Na2SO4) and concentrated to a residue, which was purified by silica gel chromatography (Hexanes/EtOAc) to afford 22 mg (14% yield) of I-38 as a white solid. ESI-MS found 443.0. C15H12F5N2O6S (MH+) requires 443.0.
-
- To a suspension of amine salt I-14 (99 mg, 0.50 mmol), adipic acid (73.7 mg, 1.0 equiv.) and EDC (98 mg, 1.02 equiv.) in DCM (5 mL) was added DIPEA (0.27 mL, 3.1 equiv.). The reaction mixture was stirred at ambient temperature for 60 hours at which point pentafluorophenol (98 mg, 1.06 equiv.) and additional EDC (102 mg, 1.05 equiv.) were added to the homogeneous solution. After an additional 4.5 hours, the reaction mixture was diluted with DCM (20 mL) and washed with 1 M HCl (5 mL) and brine (8 mL). The organic extracts were dried (Na2SO4) and concentrated to a residue, which was purified by silica gel chromatography (Hexanes/EtOAc) to afford 90 mg (39% yield) of I-39 as a white solid. ESI-MS found 455.0. C17H16F5N2O5S (MH+) requires 455.1.
-
- To a slurry of 2-(2-aminoethyl)isoindoline-1,3-dione hydrochloride (74.3 mg, 0.33 mmol) and succinic anhydride (39.4 mg, 1.2 equiv.) in DMF (1.5 mL) was added pyridine (79 μL, 3.0 equiv.). The reaction mixture was heated to 60° C. for 1 hour at which point acylation was complete. The reaction mixture was cooled to ambient temperature, and HOSu (75.5 mg, 2.0 equiv.) was added, followed by EDC (125.8 mg, 2.0 equiv.) The reaction mixture was stirred at ambient temperature for 4 hours. The reaction mixture was diluted saturated aqueous NH4Cl (8 mL) and H2O (5 mL) and extracted with EtOAc (3×5 mL). The organic extracts were combined, dried (MgSO4), and concentrated to afford a white solid. Silica gel chromatography (EtOAc) afforded 22.9 mg (18% yield) of ester I-40.
-
- To a solution of 2-(2-aminoethyl)isoindoline-1,3-dione hydrochloride (102.2 mg, 0.45 mmol) and glutaric anhydride (61.7 mg, 1.2 equiv.) in DMF (2 mL) was added DIPEA (196 μL, 2.5 equiv.). The reaction mixture was stirred for 22.5 hours at ambient temperature and HOSu (103.8 mg, 2.0 equiv.) was added, followed by EDC (172.8 mg, 2.0 equiv.). The reaction mixture was maintained at ambient temperature for an additional 16 hours, then diluted with H2O (10 mL) and extracted with EtOAc (3×5 mL). The combined organic extracts were dried (MgSO4) and concentrated to afford a residue, which was purified by silica gel chromatography (EtOAc) to afford 85.8 mg (47% yield, 2 steps) of I-41 as a white solid. ESI-MS found 402.3. C19H20N3O7 (MH+) requires 402.1.
-
- To amine salt I-14 (63.4 mg, 0.28 mmol) in DMF (1 mL) was added thiodiglycolic anhydride (44.7 mg, 1.2 equiv), followed by DIPEA (123 μL, 2.5 equiv.). After stirring at ambient temperature for 3 hours, purification by preparative HPLC (H2O/MeCN with 0.1% TFA) afforded 70.5 mg (78% yield) of carboxylic acid I-43 as a white solid. Carboxylic acid I-43 was dissolved in DMF (2 mL), and HOSu (38 mg, 1.5 equiv.) was added, followed by EDC (63.3 mg, 1.5 equiv.) The reaction mixture was stirred at ambient temperature for 18 hours, then subjected to preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 89.8 mg (98% yield) of ester I-42 as a white solid. ESI-MS found 418.2. C15H20N3O7S2 (MH+) requires 418.1.
-
- To a slurry of terephthalic acid (216.7 mg, 1.304 mmol) and HOSu (547.9 mg, 2.0 equiv.) in DCM (10 mL) was added pyridine (420 mL, 4.0 equiv.). The reaction mixture was cooled to 0-5° C. and trifluoroacetic anhydride (368 mL, 2.0 equiv.) was added. The reaction mixture was allowed to warm to ambient temperature, stirred for 16 hours, and then concentrated. EtOH (20 mL) was added to the residue and the slurry was filtered and dried to afford the crude bis-N-hydroxysuccinimide ester I-45 (403 mg, 86% yield), which was taken forward without further purification.
- To a solution of 3-(2-aminoethyl)thiazolidine-2,4-dione hydrochloride (34.3 mg, 0.174 mmol) in DMF (1 mL) was added diester I-45 (125.7 mg, 2.0 equiv.) and DIPEA (91 mL, 3.0 equiv.). The reaction mixture was maintained at ambient temperature for 17 hours and then purified by HPLC to afford 54 mg (76% yield) of I-44.
-
- I-48: Adipic acid bis-N-hydroxysuccinimide ester I-47 was prepared as described for diester I-45. Coupling with amine hydrochloride I-46 as described in the preparation of I-44 afforded 69.8 mg (69% yield) of I-48 after purification by preparative HPLC (H2O/MeCN with 0.1% TFA).
-
- Using a procedure similar to that described for the preparation of I-42, amine hydrochloride I-49 (85 mg, 0.353 mmol) afforded 62.5 mg (38% yield, 2 steps) of I-51.
-
- To a solution of benzoic acid (66.2 mg, 0.54 mmol) and tert-butyl (2-(methylamino)ethyl)carbamate (97.5 mg, 1.03 equiv.) in DMF (3 mL) was added HATU (216.8 mg, 1.05 equiv.) and DIPEA (0.1 mL, 1.06 equiv.). The reaction mixture was stirred at ambient temperature for 16 hours, then diluted with EtOAc (20 mL) and washed with water (10 mL), 1 M HCl (10 mL), 1 M NaOH (10 mL) and brine (10 mL). The combined organic extracts were dried (Na2SO4) and concentrated to afford intermediate amide I-52 (130.8 mg), which was then dissolved in 4 M HCl in dioxane (3 mL). After 1 hour, the reaction mixture was concentrated to afford the deprotected amine as a solid. This amine was suspended in DCM (3 mL) along with thiodiglycolic anhydride (60.4 mg, 0.97 equiv.), and DIPEA (0.17 mL, 2.1 equiv.) was added. The reaction mixture was stirred at ambient temperature for 2.5 hours, at which point HOSu (55.1 mg, 1.02 equiv.) and EDC (90 mg, 1.0 equiv.) were added. After 16 hours, the reaction mixture was diluted with DCM (20 mL) and washed with 1 M HCl (2×10 mL) and brine (8 mL). The organic extracts were dried (Na2SO4) and concentrated to a residue, which was purified by silica gel chromatography (EtOAc) to afford 34.5 mg (18% yield) of I-53. ESI-MS found 408.2. C18H22N3O6S (MH+) requires 408.1.
-
- To a solution of 3,3-dimethyldihydro-2H-pyran-2,6(3H)-dione (98.7 mg, 0.69 mmol) and tert-butyl (2-aminoethyl)carbamate hydrochloride (140 mg, 1.02 equiv.) in THF (6 mL) was added TEA (0.2 mL, 2.1 equiv.). The reaction mixture was heated to 60° C. for 48 hours. T3P (50% solution in EtOAc, 0.27 g, 0.6 equiv.) was added, followed by additional THF (3 mL). The reaction mixture was heated to 60° C. for 8 hours, at which time additional T3P (0.47 g, 1.1 equiv.) was added and the reaction mixture was heated to 60° C. for an additional 16 hours. The reaction mixture was diluted with EtOAc (20 mL) and washed with H2O (2×10 mL), saturated aqueous NaHCO3(10 mL), 1 M HCl (10 mL), and brine (10 mL). The organic extracts were dried (Na2SO4) and concentrated to afford a residue, which was purified by silica gel chromatography to afford the glutarimide I-54 (59 mg, 30% yield).
- Glutarimide I-54 (59 mg, 0.21 mmol) was dissolved in 4 M HCl in dioxane (3 mL). After 2 hours, the reaction mixture was concentrated to afford a white solid. This solid and thiodiglycolic anhydride (28.3 mg, 1.03 equiv.) were dissolved in DCM (3 mL), and TEA (90 μL, 3.1 equiv.) was added. After 25 minutes, the reaction mixture was concentrated and purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 40.5 mg (62% yield) of I-55. ESI-MS found 317.2, C13H21N2O5S (MH+) requires 317.1.
-
- To a solution of N-Fmoc-4-aminobutanoic acid (111.3 mg, 0.34 mmol) in DMF (1 mL) was added HOSu (59.1 mg, 1.5 equiv.) and EDC (98.3 mg, 1.5 equiv.). The reaction mixture was stirred at ambient temperature for 1.5 hours and then purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 126.2 mg (87% yield) of ester I-56 as a white solid.
-
- To a solution of N-Fmoc-4-aminopentanoic acid (106.4 mg, 0.31 mmol) in DMF (1 mL) was added HOSu (54.1 mg, 1.5 equiv.) and EDC (90.1 mg, 1.5 equiv.). The reaction mixture was stirred at ambient temperature for 4 hours, then purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 131.2 mg (96% yield) of ester I-57 as a white solid.
-
- To a solution of amine salt I-14 (202.3 mg, 1.03 mmol) and TEA (0.43 mL, 3.0 equiv.) in DCM (5 mL) was added 2-nitrobenzenesulfonyl chloride (273.6 mg, 1.2 equiv.). The reaction mixture was stirred at ambient temperature for 3 hours, then concentrated and the residue purified by silica gel chromatography (40% EtOAc in hexanes) to afford sulfonamide I-58 (217.7 mg, 61% yield) as a pale yellow solid.
- Sulfonamide I-58 (79.7 mg, 0.23 mmol) was dissolved in acetone (3 mL). Potassium carbonate (65.5 mg, 2.0 equiv.) was added, followed by methyl iodide (29 μL, 2.0 equiv.). The reaction mixture was stirred at ambient temperature for 1 hour, then carefully acidified by addition of 1 M HCl (5 mL) and extracted with EtOAc (2×7 mL). The combined organic extracts were dried (MgSO4) and concentrated to a residue, which was purified by preparative TLC (5:1 Toluene/MeCN, 3 elutions) to afford N-methylsulfonamide I-59 (47.7 mg, 58% yield) as a colorless oil.
- To N-methylsulfonamide I-59 (47.7 mg, 0.13 mmol) in DMF (1.6 mL) was added 1,10-decanedithiol (41.1 mg, 1.5 equiv.) and cesium carbonate (64.8 mg, 1.5 equiv.). The reaction mixture was stirred at ambient temperature for 4 hours and then filtered. Thiodiglycolic anhydride (26.3 mg, 1.5 equiv.) was added to the filtrate and the reaction mixture maintained at ambient temperature for 2 hours and then diluted with H2O (0.5 mL). The slurry was clarified by centrifugation and the supernatant was purified directly by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 14.4 mg (35% yield) of I-60. ESI-MS found 307.1, C10H15N2O5S2 (MH+) requires 307.0.
-
- To a solution of beta-alanine-tert-butyl ester hydrochloride (221.3 mg, 1.22 mmol) and CDI (197.5 mg, 1.0 equiv.) in DMF (3 mL) was added DIPEA (1.1 mL, 5.0 equiv). The reaction mixture was stirred for 2 hours, and amine hydrochloride I-14 (239.5 mg, 1.0 equiv.) was added. The reaction mixture was heated to 40° C. for 18 hours, and then concentrated under reduced pressure. TFA (5 mL) was added to the residue. The reaction mixture was maintained at ambient temperature for 2 hours, then concentrated under reduced pressure, and purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 17 mg (5% yield) of I-61 as a colorless oil. ESI-MS found 276.3, C9H14N3O5S (MH+) requires 276.1.
-
- 2-(2-Aminoethyl)isoindoline-1,3-dione hydrochloride (316.1 mg, 1.395 mmol) was dissolved in glacial AcOH (7 mL). Zinc dust (912.2 mg, 10 equiv.) was added, and the reaction mixture was heated to 110° C. for 18.5 hours, filtered hot, and concentrated under reduced pressure to afford the crude reduction product (900 mg). Half of this material was dissolved in MeCN (5 mL). Thiodiglycolic anhydride (120 mg, 0.91 mmol) was added, followed by triethylamine (486 μL, 5 equiv.). The reaction mixture was stirred at ambient temperature for 16 hours, concentrated, and purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 20.4 mg (10% yield) of I-62 as a colorless oil. ESI-MS found 309.2, C14H17N2O4S (MH+) requires 309.1.
-
- To a solution of (1R,5S)-3-oxabicyclo[3.1.0]hexane-2,4-dione (168.3 mg, 1.50 mmol) in DMF (5 mL) was added N-tert-butyloxycarbonyl ethylenediamine (360.8 mg, 1.5 equiv.). The reaction mixture was stirred at ambient temperature for 30 minutes, and then heated at 120° C. for 4.5 hours. The reaction mixture was then cooled and diluted with EtOAc (50 mL). The solution was washed with saturated aqueous NH4Cl (20 mL) and water (3×20 mL). The combined washes were back-extracted with EtOAc (30 mL). The combined organic extracts were washed with brine (20 mL), dried (MgSO4), and concentrated to afford a residue, which was purified by silica gel chromatography (0-60% EtOAc in hexanes) to afford 174.3 mg (46% yield) of carbamate I-63 as a white solid. To 34.8 mg (0.137 mmol) of carbamate I-63 was added TFA (1 mL). The reaction mixture was maintained at ambient temperature for 30 minutes and then concentrated. The residue was re-dissolved in DMF (0.8 mL), and DIPEA (119.2 μL, 5.0 equiv.) was added, followed by thiodiglycolic anhydride (21.7 mg, 1.2 equiv.). The reaction mixture was maintained at ambient temperature for 2 hours and then purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 31.6 mg (81% yield) of I-64. ESI-MS found 287.0, C11H15N2O5S (MH+) requires 287.1.
-
- To a solution of 3-methylglutaric anhydride (247 mg, 1.93 mmol) in DMF (1 mL) was added N-benzyloxycarbonyl ethylenediamine (374.4 mg, 1.0 equiv.). The reaction mixture was stirred at ambient temperature for 1.5 hours. AcOH (2 mL) was then added. The reaction mixture was heated to 110° C. for 21.5 hours and then cooled to ambient temperature. The reaction mixture was diluted with water (10 mL) and extracted with EtOAc (3×5 mL). The combined extracts were dried (MgSO4) and concentrated to a residue. Purification by silica gel chromatography (0-63% EtOAc in hexanes) afforded carbamate I-65 (432.8 mg, 74% yield) as a white solid.
- A solution of HBr in AcOH (33% v/v, 3 mL) was added to carbamate I-65 (104 mg, 0.34 mmol). The reaction mixture was sonicated for 5 minutes to solubilize the solids and then maintained at ambient temperature for 45 minutes, after which it was concentrated under reduced pressure. The residue was triturated with Et2O (10 mL) and the supernatant was discarded. The residue was dissolved in DMF (1.2 mL). DIPEA (179 μL, 3.0 equiv.) was added, followed by thiodiglycolic anhydride (49.7 mg, 1.1 equiv.). The reaction mixture was maintained at ambient temperature for 1.5 hours and then purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 69 mg (67% yield) of I-66. ESI-MS found 303.3, C12H18N2O5S (MH+) requires 303.1.
-
- A solution of 3-phenyldihydrofuran-2,5-dione (71.2 mg, 0.40 mmol) and (2-aminoethyl)carbamate (64.1 mg, 1.0 equiv.) in 1 mL of anhydrous dioxane was stirred over 4 Å molecular sieves for 5.5 hours at ambient temperature. The reaction mixture was filtered and concentrated under reduced pressure. The residue obtained was dissolved in 4N HCl in dioxane (3 mL). After stirring at ambient temperature for 16 hours, the reaction mixture was concentrated under reduced pressure to afford the crude amine hydrochloride. Amine hydrochloride (39 mg, 0.153 mmol) was converted to 17.6 mg of acid I-67 (33% yield) following GP1. ESI-MS: Found 348.9, C16H18N2O5S (MH−) requires 349.1.
-
- Prepared according to GP1. Yield: 68.1 mg (97%). ESI-MS found 322.2, C14H16N3O4S (MH+) requires 322.1.
-
- Prepared according to GP1. Yield: 48.1 mg (55%). ESI-MS found 289.2, C15H19N2O4S (MH+) requires 289.1.
-
- Prepared according to GP1. Yield: 37.7 mg (73%). ESI-MS found 323.2, C12H21N2O4S (MH+) requires 323.1.
-
- Prepared according to GP1. Yield: 9.9 mg (20%). ESI-MS found 276.1, C9H14N3O5S (MH+) requires 276.1.
-
- Prepared according to GP1. Yield: 60 mg (88%). ESI-MS found 304.2, C11H18N3O5S (MH+) requires 304.1.
-
- To a solution of methyl 2-bromopropanoate (200 μL, 1.79 mmol) in THF (9 mL) were added thiourea (177 mg, 1.3 equiv.) and sodium acetate (293 mg, 2.0 equiv.). The reaction mixture was heated under reflux for 20 hours. 6N HCl (4 mL) was then added. The reaction mixture was heated under reflux for an additional 16 hours and then allowed to cool to ambient temperature. Water was then added, and the reaction mixture was extracted with EtOAc. The combined organic extracts were washed with brine, dried (sodium sulfate), and concentrated. The residue obtained was subjected to silica gel chromatography (0 to 7% MeOH in DCM) to afford 235 mg of 5-methylthiazolidine-2,4-dione as a clear oil (>95% yield).
- To a solution of 5-methylthiazolidine-2,4-dione (112 mg, 0.854 mmol) in DMF (6 mL) at 0° C. was added sodium hydride (41 mg of a 60% dispersion in mineral oil, 1.2 equiv.), and the resulting slurry was stirred for 30 minutes. A solution of tert-butyl (2-bromoethyl)carbamate (304 mg, 1.6 equiv.) in DMF (1 mL) was then added and the reaction mixture was allowed to warm to ambient temperature and stirred for two hours. The reaction was quenched with 45 mL of saturated NH4Cl solution and then extracted three times with EtOAc. The combined organic extracts were washed with brine, dried (Na2SO4), and concentrated in vacuo to afford a residue, which was purified by silica gel chromatography to afford 202 mg (86% yield) of carbamate I-73. Deprotection of carbamate I-73 in TFA/DCM (1:1 v/v) for 2 hours at ambient temperature was followed by concentration of the reaction mixture in vacuo to give a crude trifluoroacetate salt, which was converted to 99.9 mg of acid I-74 (44% yield) following GP1. ESI-MS: Found 305.1, C10H13N2O5S2 (M−H)− requires 305.0.
-
- To a solution of 5,5-dimethylthiazolidine-2,4-dione (163 mg, 1.12 mmol) and tert-butyl (2-bromoethyl)carbamate (377 mg, 1.5 equiv.) in 5 mL of anhydrous DMF was added potassium carbonate (309 mg, 2.0 equiv.), and the resulting suspension was stirred for 18 hours at ambient temperature. The reaction mixture was diluted with 50 mL of EtOAc. The organic phase was washed twice with water, brine, dried over sodium sulfate, and concentrated in vacuo to afford a residue, which was purified by silica gel chromatography to afford 275 mg (83% yield) of carbamate I-75. Deprotection of carbamate I-73 in TFA/DCM (1:1 v/v) for two hours at ambient temperature was followed by concentration of the reaction mixture in vacuo to give a crude trifluoroacetate salt. This amine TFA salt (66 mg, ca. 0.218 mmol) was converted to 36 mg of acid I-76 (52% yield) following GP1. ESI-MS: Found 319.0, C11H15N2O5S2 (M−H)− requires 319.1.
-
- I-79: to a solution of (S)-3-hydroxypyrrolidinone (488 mg, 4.83 mmol) in DMF (10 mL), was added imidazole (493 mg, 1.5 equiv.), followed by triisopropylsilyl chloride (1.12 g, 1.2 equiv.). The reaction mixture was stirred at ambient temperature. On completion of the reaction, the reaction mixture was diluted with EtOAc (100 mL) and washed with H2O (5×20 mL). The aqueous washes were combined and back-extracted with EtOAc (50 mL). The combined organic extracts were washed with brine (50 mL), dried (MgSO4) and concentrated to afford a colorless oil. Purification by silica gel chromatography (12 g pre-packed column, eluting with 35-60% EtOAc in Hexanes) afforded 1.23 g (99% yield) of the TIPS-protected alcohol as a colorless oil.
- The silyl ether was then dissolved in DMF (7 mL). This solution was added to a suspension of NaH (574 mg of 60% dispersion in mineral oil, 3.0 equiv.) in DMF (15 mL) that had been pre-cooled to 0-5° C. After 4 minutes, (2-bromoethoxy)(tert-butyl)dimethylsilane (1.37 g, 1.2 equiv.) was added. The reaction mixture was allowed to warm to ambient temperature. After 1.5 hours, the reaction mixture was quenched with saturated aqueous NH4Cl (20 mL), and diluted with brine (100 mL). The aqueous phase was extracted with EtOAc (3×70 mL). The combined EtOAc extracts were dried (MgSO4) and concentrated to afford a colorless oil. Purification by silica gel chromatography (24 g pre-packed column, eluting with 30% EtOAc in Hexanes) afforded 1.38 g (69% yield) of the bis-silyl ether I-77 as a colorless oil. This bis-silyl ether was dissolved in THF (12 mL). IN HCl (4 mL) was then added. The reaction mixture was stirred at ambient temperature for 2 hours, then diluted with H2O (100 mL) and extracted with EtOAc (3×60 mL). The combined organic extracts were dried (Na2SO4) and concentrated to afford a colorless oil. Purification by silica gel chromatography (24 g pre-packed column, eluting with 80-100% EtOAc in Hexanes) afforded 0.85 g (85% yield) of the deprotection product. This deprotected silyl ether was dissolved in THE (20 mL) in the presence of triphenylphosphine (1.11 g, 1.5 equiv.) and phthalimide (622 mg, 1.5 equiv.). The solution was cooled to 0-5° C., and DIAD (833 μL, 1.5 equiv.) was added. After 1.5 hours, the reaction mixture was concentrated to a yellow oil, which was purified by silica gel chromatography (40 g pre-packed column, eluting with 44% EtOAc in Hexanes) to afford 2.3 g of phthalimide I-78 (˜50% pure, with diisopropylhydrazine-1,2-dicarboxylate as impurity).
- To a solution of phthalimide I-78 (254 mg, 0.59 mmol, ˜50% pure, with diisopropylhydrazine-1,2-dicarboxylate as impurity) in EtOH (3 mL) was added hydrazine hydrate (183 μL, 10.0 equiv.). The reaction mixture was heated to 80° C. for 20 minutes, cooled and concentrated. The residue was re-suspended in MeOH (5 mL) and filtered. The filtrate was concentrated to a residue and TBAF (1 M in THF, 1.2 mL, 2.0 equiv. based on phthalimide I-78) was added. The reaction mixture was stirred at ambient temperature for 19 hours, then concentrated. The residue was re-dissolved in DMF (2 mL) and thiodiglycolic anhydride (78 mg, 1.0 equiv. based on phthalimide I-78) was added. After 2 hours, the reaction mixture was subjected to purification by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 10.6 mg of the desired carboxylic acid I-79 as a colorless oil. ESI-MS: Found 277.2, C10H17N2O5S (MH+) requires 277.1.
- I-80: Analogous procedure was used for the preparation of the enantiomer, I-80. ESI-MS: Found 277.2, C10H17N2O5S (MH+) requires 277.1.
-
- A slurry of (3R,5S)-3,5-dimethyldihydro-2H-pyran-2,6(3H)-dione (102.8 mg, 0.723 mmol), benzyl (2-aminoethyl)carbamate hydrochloride (166.8 mg, 1.0 equiv.), T3P (50% w/v solution in DMF, 0.92 mL, 2.0 equiv.) and DIPEA (378 μL, 3.0 equiv.) in DMF (2 mL) was stirred at ambient temperature for 1 hour, then heated to 80° C. for 2 hours. The reaction mixture was cooled to ambient temperature, diluted with brine (10 mL), and then extracted with EtOAc (3×15 mL). The combined organic extracts were dried (MgSO4) and concentrated to afford an oil, which was purified by silica gel chromatography (12 g pre-packed column, eluting at 51% EtOAc/Hexanes) to afford imide I-81 (77 mg, 33% yield) as a colorless oil.
- To imide I-81 (77 mg, 0.24 mmol) was added 33% v/v HBr/AcOH (3 mL). The reaction mixture was maintained at ambient temperature for 1 hour and then concentrated. The residue was triturated with Et2O (10 mL) and the Et2O was discarded. The remaining residue was dissolved in DMF (1.5 mL). Thiodiglycolic anhydride (32 mg, 1.0 equiv. based on imide I-81) was added, followed by DIPEA (126 μL, 3.0 equiv.). The reaction mixture was maintained at ambient temperature for 20 hours and then purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 59.4 mg (78% yield) of I-82 as a colorless oil. ESI-MS: Found 317.3, C13H21N2O5S (MH+) requires 317.1.
-
- To a slurry of 447.7 mg (5.0 equiv.) of sodium hydride (60% dispersion in mineral oil) in DMF (5 mL) that had been cooled to 0-5° C. was added a solution of 2,2-dimethylpyrollidinone (253.3 mg, 2.238 mmol) in DMF (7 mL). The reaction mixture was stirred at 0-5° C. for 10 minutes and (2-bromoethoxy)(tert-butyl)dimethylsilane (642.5 mg, 1.2 equiv.) was added in one portion. The reaction mixture was stirred for 10 minutes at 0-5° C., then allowed to warm to ambient temperature. After 18 hours, the reaction mixture was cooled to 0-5° C., and the reaction was quenched with saturated aqueous NH4Cl (10 mL). The reaction mixture was diluted with 50% brine (100 mL) and extracted with EtOAc (3×50 mL). The organic extracts were combined, dried (Na2SO4), and concentrated to afford a colorless oil which was then dissolved in THE (12 mL). Aqueous HCl (1 M, 4 mL) was added, and the reaction mixture was stirred at ambient temperature for 5 hours. The reaction was quenched with saturated aqueous NaHCO3(10 mL) and diluted with brine (50 mL), then extracted with EtOAc (3×50 mL). The organic extracts were combined, dried (Na2SO4) and concentrated to afford a colorless oil, which was purified by silica gel chromatography (Hexanes/Acetone 0-100% gradient) to afford intermediate alcohol I-83 (183.8 mg, 52% yield over 2 steps) as a colorless oil.
- To a solution of alcohol I-83 (183.8 mg, 1.17 mmol), phthalimide (258 mg, 1.5 equiv.) and triphenylphosphine (460 mg, 1.5 equiv.) in THF (6 mL) that had been cooled to 0-5° C. was added DIAD (0.35 mL, 1.5 equiv.). The reaction mixture was allowed to warm to ambient temperature and concentrated after 2.5 hours. Purification of the resulting residue by silica gel chromatography (EtOAc) afforded phthalimide I-84 (263.2 mg, 79% yield) as a colorless oil.
- To a solution of phthalimide I-84 (263.2 mg, 0.92 mmol) in MeOH (5 mL) was added hydrazine hydrate (0.29 mL, 10.0 Equiv). The reaction mixture was stirred at ambient temperature for 24 hours and then filtered. The filter cake was washed with MeOH (10 mL). The combined filtrate and wash were concentrated to a residue, which was re-dissolved in DMF (3 mL). Thiodiglycolic anhydride (121.5 mg, 1.0 equiv.) was added and the reaction mixture was stirred at ambient temperature for 4 hours, then purified by preparative HPLC (0-30% MeCN/25 mM NH4OAc gradient over 35 minutes) to afford 22.8 mg (9% yield, 2 steps) of I-85 as a colorless oil. ESI-MS: Found 289.2, C12H21N2O4S (MH+) requires 289.1.
-
- To a solution of 1-(2-hydroxyethyl)azepan-2-one (97 mg, 0.62 mmol), triphenylphosphine (242.9 mg, 1.5 equiv.), and phthalimide (136.1 mg, 1.5 equiv.) in THF (3 mL) at ambient temperature was added DIAD (0.18 mL, 1.5 equiv.). The reaction mixture was allowed to warm to ambient temperature and concentrated after 2.5 hours. Purification of the resulting residue by silica gel chromatography (EtOAc) afforded phthalimide I-86, which co-eluted with triphenylphosphine oxide. The phthalimide was dissolved in EtOH (10 mL) and hydrazine hydrate (0.19 mL, 10 equiv.) was added. The reaction mixture was heated to 80° C. for 1.5 hours and then cooled to ambient temperature and filtered. The filtrate was concentrated to afford a residue. DMF (3 mL) was added, and the suspension afforded was clarified by centrifugation. Thiodiglycolic anhydride (81.5 mg, 1.0 equiv.) was added to the supernatant and the reaction mixture was maintained at ambient temperature for 24 hours. Purification by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 34.1 mg (19% yield, 3 steps) of I-87 as a colorless oil. ESI-MS: Found 289.2, C12H21N2O4S (MH+) requires 289.1.
-
- I-89: a slurry of (S)-2-methylglutaric acid (68.5 mg, 0.469 mmol), benzyl (2-aminoethyl)carbamate (91.1 mg, 1.0 equiv.), T3P (50% w/v solution in DMF, 1.5 mL, 5.0 equiv.), and DIPEA (817 μL, 10.0 equiv.) in DMF (3 mL) was stirred at ambient temperature for 63 hours and then heated to 80° C. for 4 hours. The reaction mixture was cooled and diluted with EtOAc (10 mL) and saturated aqueous NaHCO3(10 mL). The phases were separated, and the aqueous phase was extracted with EtOAc (2×10 mL). The combined organic extracts were dried (MgSO4) and concentrated to afford a colorless oil, which was purified by silica gel chromatography to afford imide I-88 (25.8 mg, 18% yield) as a colorless oil.
- To imide I-88 (25.8 mg, 0.085 mmol) was added 33% v/v HBr/AcOH (2 mL). The reaction mixture was maintained at ambient temperature for 1 hour and then concentrated. The residue was triturated with Et2O (10 mL) and the Et2O was discarded. The remaining residue was dissolved in DMF (1 mL). Thiodiglycolic anhydride (13.4 mg, 1.2 equiv. based on imide I-88) was added, followed by DIPEA (74 μL, 5.0 equiv.). The reaction mixture was maintained at ambient temperature for 16 hours and then purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 20.6 mg (81% yield) of I-89 as a colorless oil. ESI-MS: Found 303.2, C12H19N2O5S (MH+) requires 303.1.
- I-90: an analogous procedure was used to prepare enantiomeric building block I-90. Yield: 43 mg (62%). ESI-MS: Found 303.2, C12H19N2O5S (MH+) requires 303.1.
-
- To a solution of anhydride I-93 (106.8 mg, 0.85 mmol) in DMF (2 mL) was added tert-butyl (2-aminoethyl)carbamate (203.5 mg, 1.5 equiv.). The reaction mixture was maintained at ambient temperature for 1.5 hours and then heated to 120° C. for 6 hours and 90° C. for 60 hours. The reaction mixture was cooled, diluted with H2O (10 mL), and then extracted with EtOAc (3×6 mL). The combined organic extracts were dried (MgSO4) and concentrated to afford a brown solid, which was purified by silica gel chromatography (12 g pre-packed column, 63% EtOAc/Hexanes) to afford imide I-91 (165.3 mg, 73% yield) as a colorless oil.
- To imide I-91 (43.3 mg (0.161 mmol) was added TFA (2 mL). After 15 minutes at ambient temperature the reaction mixture was concentrated to a residue, which was redissolved in DMF (1 mL). Thiodiglycolic anhydride (23.5 mg, 1.1 equiv. based on imide I-91) was added, followed by DIPEA (84 μL, 3.0 equiv.). The reaction mixture was maintained at ambient temperature for 24 hours and then purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 42.4 mg (87% yield) of I-92 as a colorless oil. ESI-MS: Found 301.2, C12H17N2O5S (MH+) requires 301.1.
-
- To a solution of 2-(3-aminopropyl)isoindoline-1,3-dione hydrochloride (49.8 mg, 0.207 mmol), malonic acid (43.1 mg, 2.0 equiv.), and DIPEA (0.11 mL, 3.0 equiv.) in DMF (0.9 mL) was added HATU (157.3 mg, 2.0 equiv.). The reaction mixture was agitated at ambient temperature for 3 hours and then purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 6.7 mg (11% yield) of I-94 as a colorless oil. ESI-MS: Found 291.1, C14H15N2O5 (MH+) requires 291.1.
-
- 5-methylisobenzofuran-1,3-dione (305 mg, 1.88 mmol) was dissolved in DMF (5 mL). Tert-butyl (3-aminopropyl)carbamate hydrochloride (595 mg, 1.5 equiv.) was added, followed by DIPEA (983 μL, 3.0 equiv.). The reaction mixture was heated to 110° C. for 18 hours. The reaction mixture was then cooled and diluted with EtOAc (50 mL). The EtOAc solution was washed with saturated aq. NH4Cl (20 mL) and H2O (3×20 mL). The aqueous washes were back-extracted with EtOAc (30 mL). The combined organic extracts were washed with brine (20 mL), dried (MgSO4), and concentrated to a solid which was purified by silica gel chromatography (39% EtOAc/Hexanes) to afford 481 mg (80% yield) of intermediate carbamate I-95 as a white solid.
- To carbamate I-95 (40.6 mg, 0.128 mmol) was added TFA (1 mL). After 30 minutes at ambient temperature, the TFA was removed in vacuo. Malonic acid (26.5 mg, 2.0 equiv.) was added, followed by DIPEA (67 μL, 3.0 equiv.) and HATU (97 mg, 2.0 equiv.) The reaction mixture was stirred at ambient temperature for 1 hour, then purified directly by HPLC (H2O/MeCN with 0.1% TFA) to afford 13.1 mg (34% yield) of I-96. ESI-MS found 305.3, C15H17N2O5 (MH+) requires 305.1.
-
- Using a procedure similar to that described for the preparation of I-96, 295 mg (1.82 mmol) of 5-methylisobenzofuran-1,3-dione afforded 356.7 mg (64% yield) of phthalimide I-97. Phthalimide I-97 (44.2 mg, 0.145 mmol) then afforded 18.5 mg (44% yield, 2 steps) of I-98. ESI-MS found 291.2, C14H15N2O5 (MW) requires 291.1.
-
- To (R)-2-methylsuccinic acid (174.5 mg, 1.32 mmol) in DMF (2 mL) was added benzyl (2-aminoethyl)carbamate hydrochloride (304.7 mg, 1.0 equiv.), DIPEA (0.69 mL, 3.0 equiv.), and propylphosphonic anhydride (50% in DMF, 2.5 mL, 3.0 equiv.). The reaction mixture was heated to 80° C. for 1.5 hours, then cooled and concentrated. The resulting residue was purified by silica gel chromatography to afford 48 mg (13%) of the intermediate succinimide I-99. HBr (33% solution in AcOH, 2 mL) was added to I-99. The reaction mixture was maintained at ambient temperature for 45 minutes, then concentrated under reduced pressure. The residue afforded was triturated with Et2O (10 mL) and then redissolved in DMF (0.7 mL). DIPEA (86 μL, 3.0 equiv) was added, followed by thiodiglycolic anhydride (21.8 mg, 1.0 equiv.). The reaction mixture was maintained at ambient temperature for 3 hours and then purified by preparative HPLC (0-100% acetonitrile in water with 0.1% TFA) to afford 15.3 mg (32% yield) of I-100. ESI-MS found 289.2, C11H17N2O5S (MH+) requires 289.1.
- I-101: an analogous procedure was used to synthesize enantiomeric building block I-101. Yield 16.2 mg (6% yield, 3 steps). ESI-MS found 289.2, C11H17N2O5S (MH+) requires 289.1.
-
- A solution of tert-butyl (2-aminoethyl)carbamate (415 mg, 2.6 mmol) and thiodiglycolic anhydride (376 mg, 1.1 equiv.) in 5 mL of DMF was treated with TEA (1.27 mL, 1.4 equiv.). The reaction mixture was stirred for 3 hours at ambient temperature at which time allyl bromide (336 μL, 1.5 equiv.) was added and the reaction mixture was stirred for an additional 72 hours. The reaction mixture was then diluted with EtOAc (40 mL). The organic phase was washed with saturated aqueous NaHCO3, brine, dried (Na2SO4), and concentrated in vacuo. Purification by flash chromatography (0% to 70% EtOAc in hexanes) afforded 250 mg of I-102 as a clear oil (75% yield). ESI-MS found 331.2, C14H23N2O5S (M−H)− requires 331.1
- A solution of I-102 (135 mg, 0.406 mmol) in 1 mL of dioxane was treated with 3 mL of 4N HCl/dioxane and stirred for 2 hours. The reaction mixture was concentrated under reduced pressure and then placed under high vacuum for 8 hours to afford 112 mg of intermediate hydrochloride salt, a portion of which (84.1 mg, 0.313 mmol) was suspended in 5 mL of DCM, treated with DIPEA (223 μL, 4.0 equiv.) and sonicated for 5 minutes. The resulting suspension was filtered through a plug of cotton, treated with proton sponge (201 mg, 3.0 equiv.), and added to a solution of triphosgene (56 mg, 0.6 equiv.) in 5 mL of DCM at 0° C. under N2. After stirring for 4 hours at 0-5° C., the reaction mixture was allowed to warm to ambient temperature, and stirring was continued another 24 hours. The reaction mixture was then diluted with 45 mL of DCM. The organic phase was washed twice with 1 M aqueous NaHSO4, brine, dried over Na2SO4 and concentrated in vacuo. The resulting residue was purified by preparative HPLC (0-100% acetonitrile in water with 0.1% TFA) to afford 32 mg of I-103 as a white solid (31% yield). ESI-MS found 259.2, C10H13N2O4S (MH+) requires 259.1
- A solution of I-103 (42 mg, 0.161 mmol) in 4 mL of DCM was treated with Pd(PPh3)4 (46.6 mg, 0.25 equiv.) and phenylsilane (79 μL, 4.0 equiv.) and the reaction mixture was stirred at ambient temperature for one hour. The reaction mixture was then concentrated in vacuo and the residue was suspended in 2.5 mL of 3:1 v/v DMSO/H2O and filtered to give a clear solution, which was then purified directly by preparative HPLC (0-100% acetonitrile in water with 0.1% TFA) to afford 18.5 mg of I-104 as a white solid (53% yield). ESI-MS found 217.1, C7H9N2O4S (MH−) requires 217.0.
-
- A solution of anhydride I-107 (42 mg, 0.300 mmol) and tert-butyl (2-aminoethyl)carbamate (57.6 mg, 1.2 equiv.) in 3 mL of anhydrous dioxane were stirred over 4 Å molecular sieves for 1 hour and then decanted. 4N hydrogen chloride in dioxane (2 mL) was added to the supernatant and the reaction mixture was stirred for 16 hours and then concentrated in vacuo to afford the crude hydrochloride salt I-105. The crude hydrochloride salt was converted to 27.3 mg of acid I-106 (29% yield over 3 steps) using GP1. ESI-MS found 312.9, C13H18N2O5S (MH−) requires 313.1.
-
- To a solution of 3,4-dihydro-1,8-naphthyridin-2(1H)-one (106 mg, 0.714 mmol) in 2.4 mL of anhydrous DMF at 0° C. was added sodium hydride (34.4 mg of a 60% dispersion in mineral oil, 1.2 equiv.), and the resulting suspension was stirred 10 minutes. Tert-butyl (2-bromoethyl)carbamate (176 mg, 1.1 equiv.) was added in two portions and the solution was allowed to warm to ambient temperature and stirred for two hours. The reaction was quenched with 25 mL of saturated ammonium chloride solution and then extracted three times with EtOAc. The combined organic extracts were washed with brine, dried over sodium sulfate and concentrated in vacuo to afford a residue, which was purified by silica gel chromatography to afford 104 mg (50% yield) of carbamate I-108. Carbamate I-108 (84 mg, 0.287 mmol) was deprotected with TFA/DCM (1:1 v/v) for two hours at ambient temperature. The reaction mixture was concentrated under reduced pressure to afford a crude trifluoroacetate salt, which was dissolved in 1 mL of DMF and 5 mL of DCM and treated with a solution of thiodiglycolic anhydride (37 mg, 1.0 equiv. based on carbamate I-108) and DIPEA (200 μL, 4.0 equiv.) in 1 mL of DMF. The reaction mixture was stirred for 2 hours. A solution of EDC (72 mg, 1.3 equiv.) and pentafluorophenol (67 mg, 1.3 equiv.) in 1 mL of DMF was then added; stirring was continued for 18 hours. The reaction mixture was then diluted with 50 mL of DCM. The organic phase was washed with 1N aqueous NaHSO4 then brine, dried over Na2SO4 and concentrated under reduced pressure to afford a residue, which was purified by flash chromatography (0 to 80% ethyl acetate in hexanes) to afford 97 mg of ester I-109 (69% yield). ESI-MS found 489.9, C20H15F5N3O4S (M−H)− requires 490.1.
-
- A solution of 5-nitroisobenzofuran-1,3-dione (295 mg, 1.53 mmol) and tert-butyl (2-aminoethyl)carbamate (367 mg, 1.5 equiv.) in 9 mL of anhydrous DMF was stirred for 30 minutes at ambient temperature and then for 2 hours at 120° C. The reaction mixture was allowed to cool to ambient temperature and diluted with 40 mL of EtOAc. The organic phase was washed with water and brine. The combined organic phase was then dried over sodium sulfate and concentrated under reduced pressure to a residue, which was purified by silica gel chromatography to afford 302 mg (90% yield) of carbamate I-110.
- Carbamate I-110 (132 mg, 0.395 mmol) was deprotected with TFA/DCM (1:1 v/v) for two hours at ambient temperature, and the reaction mixture was concentrated under reduced pressure to afford the crude trifluoroacetate salt. The crude trifluoroacetate salt was dissolved in 4 mL of DMF and treated with a solution of thiodiglycolic anhydride (58.5 mg, 1.1 equiv. based on carbamate I-110) and DIPEA (85 μL, 1.2 equiv.) in 1 mL of DCM. The reaction mixture was stirred for 18 hours and then a solution of EDC (68 mg, 0.8 equiv.) and pentafluorophenol (58 mg, 0.8 equiv.) in 1 mL of DMF was added and stirring was continued for 1 hour. The reaction mixture was then diluted with 30 mL of DCM. The organic phase was washed with 1N aqueous NaHSO4 and brine, dried over Na2SO4, and concentrated under reduced pressure to afford a residue which was purified by flash chromatography (0 to 60% ethyl acetate in hexanes) to afford 111 mg of ester I-111 (46% yield). ESI-MS found 533.8, C20H12F5N3O7S (MH+) requires 534.0.
-
- A suspension of 4-nitroisobenzofuran-1,3-dione (145 mg, 0.765 mmol) and tert-butyl (2-aminoethyl)carbamate (184 mg, 1.5 equiv.) were stirred over 4 Å molecular sieves in a sealed tube at 130° C. for 16 hours. The reaction mixture was filtered, concentrated in vacuo, and purified by silica gel chromatography to afford 82 mg (32% yield) of carbamate I-112 which was deprotected in 1:1 DCM/TFA for two hours at ambient temperature followed by concentration in vacuo to give a crude trifluoroacetate salt. The salt was dissolved in 4 mL of DMF and treated with a solution of thiodiglycolic anhydride (32 mg, 0.24 mmol) and DIPEA (48 μL, 0.27 mmol) in 1 mL of DMF. The reaction mixture was stirred for 2 hours and then a solution of EDC (68 mg, 0.32 mmol) and pentafluorophenol (58 mg, 0.32 mmol) in 1 mL of DMF was added; stirring was continued for one hour. The reaction mixture was then diluted with 30 mL DCM, and the organic phase was washed with 1N NaHSO4 and brine, dried over Na2SO4, and concentrated under reduced pressure to afford a residue which was purified by flash chromatography (0 to 60% ethyl acetate in hexanes) to afford 50 mg of I-113 (39% yield). ESI-MS found 533.8, C20H12F5N3O7S (MH+) requires 534.0.
-
- To a solution of thiazolidin-2-one (103 mg, 1.0 mmol) in 2 mL of anhydrous DMF at 0° C. was added sodium hydride (48 mg of a 60% dispersion in mineral oil, 1.2 equiv.) and the resulting suspension was stirred for 10 minutes. Tert-butyl (2-bromoethyl)carbamate (356 mg, 1.6 equiv.) in 2 mL of anhydrous DMF was added, and the solution was allowed to warm to ambient temperature and stirred for two hours. The reaction was quenched with 45 mL of saturated ammonium chloride solution. The reaction mixture was extracted three times with EtOAc. The combined organic extracts were washed with brine, dried over sodium sulfate, and concentrated in vacuo to afford a residue which was purified by silica gel chromatography to afford 125 mg (51% yield) of carbamate I-114. I-114 was deprotected in TFA/DCM (1:1 v/v) for two hours at ambient temperature followed by concentration in vacuo to give a crude trifluoroacetate salt, which was converted to 107 mg of acid I-115 (76% yield) following GP1. ESI-MS found 279.1 C9H14N2O4S2 (MH+) requires 279.0.
-
- To 4-aminobutanoic acid (100 mg, 0.97 mmol) in AcOH was added phthalic anhydride (151 mg, 1.05 equiv.) and potassium acetate (286 mg, 3.0 equiv.). The reaction mixture was heated to 100° C. for 16 hours when LC-MS analysis indicated complete formation of phthalimide I-116. The reaction mixture was cooled and concentrated. The resulting residue was taken up in EtOAc; the organic extract was washed with 1 M HCl, dried, and concentrated to afford the crude phthalimide I-116 which was re-dissolved in DMF. HATU (400 mg, 1.1 equiv.) was added, followed by DIPEA (607 μL, 3.5 equiv.) and β-alanine-tert-butyl ester hydrochloride (200 mg, 1.1 equiv.) The reaction mixture was stirred at ambient temperature until the reaction was deemed complete by LC-MS. The reaction mixture was concentrated to a residue, which was taken up in EtOAc and the organic extract was washed with 1 M HCl, dried and concentrated. The resulting residue was purified by silica gel chromatography to afford 167 mg (48% yield, 2 steps) of phthalimide I-117. The tert-butyl ester of Phthalimide I-117 was deprotected to afford I-118 using TFA prior to coupling to the resin-bound peptide, MS (ESI) m/z calcd for C15H15N2O5 [M−H]−: 303.1; found 302.9.
-
- A solution of phthalic anhydride (2.26 g, 20.0 mmol), 3-aminopropanoic acid (1.87 g, 21.0 mmol) and potassium acetate (3.32 g, 1.9 equiv.) in AcOH was stirred 4 hours at 100° C., cooled to ambient temperature, and concentrated in vacuo. The resulting residue was dissolved in EtOAc, washed with 1N HCl then brine, dried over sodium sulfate, and concentrated in vacuo to afford 4.25 g of the crude acid I-119 (97% yield). A portion of this material (59 mg, ca. 0.270 mmol) was dissolved in DMF and HATU (113 mg, 1.1 equiv.), tert-butyl 4-aminobutanoate hydrochloride (58 mg, 1.1 equiv.), and DIPEA (156 μL, 3.5 equiv.) were added. The reaction mixture was stirred at ambient temperature for 18 hours and then concentrated in vacuo. The residue was dissolved in EtOAc, and the resulting solution was washed with 1 M HCl, dried over sodium sulfate, and concentrated in vacuo. Purification by flash chromatography using hexanes/EtOAc followed by treatment with 1:1 DCM/TFA for 2 hours, concentration in vacuo and flash chromatography of the resulting residue with 20% MeOH and 1% AcOH in DCM afforded 39 mg of I-120 (108 mmol, 40% over two steps).
-
- A solution of 5-methylisobenzofuran-1,3-dione (162 mg, 1.0 mmol), tert-butyl (2-aminoethyl)carbamate hydrochloride (207 mg, 1.05 equiv.) and TEA (278 μL, 2.0 equiv.) in DCM was stirred for 18 hours at ambient temperature. Then 4A molecular sieves and DMF were added and the reaction mixture was stirred at 75° C. for 18 hours. The reaction mixture was diluted with EtOAc, filtered, washed with saturated sodium bicarbonate and brine, then dried over sodium sulfate, and concentrated in vacuo to afford 300 mg of the intermediate imide I-121 (99% yield). This material was deprotected by treatment with 4 N HCl in dioxane followed by concentration in vacuo. A portion of the crude amine hydrochloride (30 mg, 0.125 mmol) was suspended in DCM and treated with thiodiglycolic anhydride (20 mg, 1.2 equiv.) and DIPEA (48 μL, 2.2 equiv.). The reaction mixture was stirred for 4 hours, concentrated in vacuo, and the residue was dissolved in EtOAc. The solution was washed with 1 M HCl and brine, dried over sodium sulfate, and concentrated in vacuo to afford 43 mg of the crude acid. A solution of this material, pentafluorophenol (35 mg, 0.188 mmol) and EDC (36 mg, 0.188 mmol) in DCM was stirred for one hour and then concentrated in vacuo. The residue obtained was dissolved in EtOAc, and the solution was washed with 1 M HCl, brine, dried over sodium sulfate and concentrated in vacuo. Purification by flash chromatography using EtOAc in hexanes afforded 66 mg of I-122 (quantitative yield).
-
- A solution of furo[3,4-c]pyridine-1,3-dione (100 mg, 0.671 mmol) and tert-butyl (2-aminoethyl)carbamate (112 mg, 1.05 equiv.) in DMF was stirred at 130° C. for 18 hours and then allowed to cool to ambient temperature. The reaction mixture was diluted with EtOAc and washed with 1 M HCl and brine. The combined aqueous washes were back-extracted with EtOAc. The combined organic extracts were dried over sodium sulfate and concentrated in vacuo. The resulting crude carbamate I-123 was stirred in 1:1 DCM/TFA for 2 hours, after which removal of the solvent afforded a primary amine salt, which was suspended in DCM and treated with thiodiglycolic anhydride (98 mg, 1.1 equiv.) and DIPEA (388 μL, 1.1 equiv.). The reaction mixture was stirred 4 hours. Pentafluorophenol (184 mg, 1.5 equiv.) and EDC (194 mg, 1.5 equiv.) were added; stirring was continued for 2 hours. The reaction mixture was diluted with EtOAc and the solution was washed with 1 M HCl then brine, dried over sodium sulfate and concentrated in vacuo. Purification by flash chromatography using EtOAc in hexanes afforded 200 mg of I-124 (61% yield).
-
- A solution of 1H,3H-benzo[de]isochromene-1,3-dione (100 mg, 0.505 mmol) and tert-butyl (2-aminoethyl)carbamate (85 mg, 1.05 equiv.) in DMF was stirred at 130° C. for 3 hours and allowed to cool to ambient temperature. The reaction mixture was diluted with EtOAc and washed with 1 M HCl and brine. The combined aqueous washes were extracted with EtOAc. The combined organic extracts were dried over sodium sulfate and concentrated in vacuo. The resulting crude carbamate I-125 was stirred in 1:1 DCM/TFA for 2 hours, after which removal of the solvent afforded a primary amine salt. The amine salt was suspended in DCM and treated with thiodiglycolic anhydride (73 mg, 1.1 equiv.) and DIPEA (219 μL, 2.5 equiv.). The reaction mixture was stirred 4 hours. Pentafluorophenol (139 mg, 1.5 equiv.) and EDC (207 mg, 2.0 equiv.) were added; stirring was continued for 2 hours. The reaction mixture was diluted with EtOAc and the solution was washed with 1 M HCl then brine, dried over sodium sulfate and concentrated in vacuo. Purification by flash chromatography using EtOAc in hexanes afforded I-126.
- Synthesis of I-127 is Depicted in Scheme 51:
- A solution of tert-butyl (2-aminoethyl)carbamate hydrochloride (207 mg, 1.05 mmol), thiodiglycolic anhydride (132 mg, 0.95 equiv.) and DIPEA (365 μL, 2.0 equiv.) in DCM was stirred 2 hours, concentrated in vacuo. The residue obtained was dissolved in EtOAc. This solution was washed with 1 M HCl and brine, dried over sodium sulfate and concentrated in vacuo to afford 366 mg of the crude carbamate, which was deprotected by treatment with 1:1 v/v TFA/DCM to afford the crude amine-TFA salt, I-127.
-
- A solution of amine salt I-127 (34 mg, 0.111 mmol), (meso)-hexahydroisobenzofuran-1,3-dione (21 mg, 1.2 equiv.), and potassium acetate (33 mg, 3.0 equiv.) in AcOH was heated to 100° C. for 18 hours. The resulting mixture was cooled to ambient temperature and concentrated in vacuo. The residue was dissolved in EtOAc and washed with 1 M HCl then brine, and the combined aqueous washes were back-extracted with EtOAc. The combined organic extracts were dried over sodium sulfate and concentrated in vacuo. The resulting residue was purified by flash chromatography using 15% MeOH in DCM with 1% AcOH to afford 32 mg of intermediate acid I-128 (88% yield). This material was dissolved in DCM along with pentafluorophenol (18.4 mg, 0.100 mmol) and EDC (19 mg, 0.100 mmol). The resulting reaction mixture was stirred for 2 hours and concentrated in vacuo. The residue was dissolved in EtOAc. The resulting solution was washed with 1 M HCl and brine, then dried over sodium sulfate and concentrated in vacuo. Purification of the residue by flash chromatography using EtOAc in hexanes afforded 43 mg of I-129 (78% yield over two steps).
-
- A solution of amine salt I-127 (34 mg, 0.111 mmol), furo[3,4-b]pyridine-5,7-dione (20 mg, 1.2 equiv.) and potassium acetate (33 mg, 3.0 equiv.) in AcOH was heated to 100° C. for 18 hours then cooled to ambient temperature and concentrated in vacuo. The residue was dissolved in EtOAc and the solution was washed with 1 M HCl and then brine. The combined aqueous washes were back-extracted with EtOAc. The combined organic extracts were dried over sodium sulfate and concentrated in vacuo. The resulting residue was purified by flash chromatography using 15% MeOH in DCM with 1% AcOH to afford 14 mg of intermediate acid I-130 (39% yield). This material was dissolved in DCM along with pentafluorophenol (12 mg, 0.065 mmol) and EDC (16 mg, 0.086 mmol). The resulting solution was stirred for 2 hours, concentrated in vacuo and the residue was dissolved in EtOAc. The resulting solution was washed with 1 M HCl and brine, then dried over sodium sulfate and concentrated in vacuo. Purification of the residue by flash chromatography using EtOAc in hexanes afforded 17 mg of I-131 (81% yield).
-
- A solution of amine salt I-127 (30 mg, 0.098 mmol), 5-chloroisobenzofuran-1,3-dione (21 mg, 1.2 equiv.), and potassium acetate (29 mg, 3.0 equiv.) in AcOH was heated to 100° C. for 18 hours then cooled to ambient temperature and concentrated in vacuo. The residue was dissolved in EtOAc and the solution was washed with 1 M HCl and then brine. The combined aqueous washes were extracted with EtOAc. The combined organic extracts were dried over sodium sulfate and concentrated in vacuo. The resulting residue was purified by flash chromatography using 15% MeOH in DCM with 1% AcOH to afford 29 mg of intermediate acid I-132 (69%). This material was dissolved in DCM along with pentafluorophenol (18 mg, 0.100 mmol) and EDC (26 mg, 0.139 mmol). The resulting reaction mixture was stirred for 2 hours and concentrated in vacuo; the residue was re-dissolved in EtOAc. The resulting solution was washed with 1 M HCl and brine, dried over sodium sulfate, concentrated in vacuo. Purification of the residue by flash chromatography using EtOAc in hexanes afforded 21 mg of I-133 (60% yield).
-
- A solution of amine salt I-127 (23 mg, 0.075 mmol), 4-chloroisobenzofuran-1,3-dione (16 mg, 1.2 equiv.) and potassium acetate (22 mg, 3.0 equiv.) in AcOH was heated to 100° C. for 18 hours, cooled to ambient temperature, and concentrated in vacuo. The residue was dissolved in EtOAc and washed with 1 M HCl then brine, and the combined aqueous washes were back-extracted with EtOAc. The combined organic extracts were dried over sodium sulfate and concentrated in vacuo. The resulting residue was purified by flash chromatography using 15% MeOH in DCM with 1% AcOH to afford 21 mg of intermediate acid I-134 (79% yield). This material was dissolved in DCM along with pentafluorophenol (16 mg, 0.089 mmol) and EDC (23 mg, 0.118 mmol). The resulting reaction mixture was stirred for 2 hours and concentrated in vacuo. The residue was dissolved in EtOAc. The resulting solution was washed with 1 M HCl and brine, then dried over sodium sulfate and concentrated in vacuo. Purification of the residue by flash chromatography using EtOAc in hexanes afforded 20 mg of I-135 (0.038 mmol, 65% yield).
-
- A solution of amine salt I-127 (43 mg, 0.14 mmol), naphtho[2,3-c]furan-1,3-dione (33 mg, 1.2 equiv.), and potassium acetate (42 mg, 3.0 equiv.) in AcOH was heated to 100° C. for 18 hours. The reaction mixture was then cooled to ambient temperature and concentrated in vacuo. The residue afforded was dissolved in EtOAc, and the solution was washed with 1 M HCl and brine. The combined aqueous washes were back-extracted with EtOAc. The combined organic extracts were dried over sodium sulfate and concentrated in vacuo. The resulting residue was purified by flash chromatography using 15% MeOH in DCM with 1% AcOH to afford 20 mg of intermediate acid I-136 (38% yield). This material was dissolved in DCM along with pentafluorophenol (15 mg, 0.081 mmol) and EDC (16 mg, 0.081 mmol). The resulting reaction mixture was stirred for 2 hours, concentrated in vacuo and the residue was re-dissolved in EtOAc. The resulting solution was washed with 1 M HCl and brine, then dried over sodium sulfate and concentrated in vacuo. Purification of the residue by flash chromatography using EtOAc in hexanes afforded 31 mg of I-137 (98% yield).
-
- A solution of amine salt I-127 (36 mg, 0.117 mmol), 5-(tert-butyl)isobenzofuran-1,3-dione (29 mg, 1.2 equiv.) and potassium acetate (11 mg, 1.0 equiv.) in AcOH was heated to 100° C. for 18 hours. The reaction mixture was then cooled to ambient temperature and concentrated in vacuo. The residue was dissolved in EtOAc and the solution was washed with 1 M HCl then brine, and the combined aqueous washes were back-extracted with EtOAc. The combined organic extracts were dried over sodium sulfate and concentrated in vacuo. The resulting residue was purified by flash chromatography using 15% MeOH in DCM with 1% AcOH to afford 49 mg of intermediate acid I-138 containing dicarboxylic acid impurities. This material was dissolved in DCM along with pentafluorophenol (18.4 mg, 0.100 mmol) and EDC (19 mg, 0.100 mmol). The resulting reaction mixture was stirred for 2 hours, concentrated in vacuo, and the residue was re-dissolved in EtOAc. The resulting solution was washed with 1 M HCl and brine, dried over sodium sulfate, and concentrated in vacuo. Purification of the residue by flash chromatography using EtOAc in hexanes afforded 22 mg of I-139 (37% yield over two steps).
-
- To a slurry of 3-(2-aminoethyl)thiazolidine-2,4-dione hydrochloride (43.8 mg, 0.22 mmol) and dicarboxylic acid I-140 (81.1 mg, 2.0 equiv.) in DMF (1 mL) was added DIPEA (117 μL, 3.0 equiv.) and HATU (127.2 mg, 1.5 equiv.). The reaction mixture was agitated at ambient temperature for 2.5 hours and then purified directly by preparative HPLC (0-100% acetonitrile in water with 0.1% TFA) to afford 62.1 mg (86% yield) of I-141 as a white solid. ESI-MS found 325.1, C9H13N2O7S2 (MH+) requires 325.1.
-
- To a solution of 3,3-dimethylpiperidin-2-one (240 mg, 1.88 mmol) in DMF (5 mL) at 0° C. under N2 was added a slurry of NaH (574 mg of 60% dispersion in mineral oil, 3.0 equiv.) in DMF (15 mL). After 20 minutes, (2-bromoethoxy)(tert-butyl)dimethylsilane (673 mg, 1.5 equiv.) was added. The reaction mixture was allowed to warm to ambient temperature. After 18 hours, the reaction mixture was quenched with saturated aqueous NH4Cl (10 mL) and diluted with water (50 mL). The aqueous phase was extracted with EtOAc (3×50 mL). The combined EtOAc extracts were dried (Na2SO4) and concentrated to afford a colorless oil. Purification by silica gel chromatography (12 g pre-packed column, 0 to 25% EtOAc in Hexanes) afforded 181 mg (34% yield) of the silyl ether I-142 as a colorless oil. This material (90 mg, 0.315 mmol) was dissolved in THF (3 mL) and treated with 1 M TBAF solution in THF (0.95 mL, 3 equiv.) and the resulting solution was stirred at ambient temperature for 2 hours. The reaction mixture was then concentrated under reduced pressure to afford a residue, which was purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to provide 37.7 mg of alcohol I-143 (70% yield).
- Alcohol I-143 was dissolved in THF (6 mL) in the presence of triphenylphosphine (85.7 mg, 1.5 equiv.) and phthalimide (48.1 mg, 1.5 equiv.). The solution was cooled to 0-5° C., and DIAD (64 μL, 1.5 equiv.) was added; the reaction mixture was allowed to warm to ambient temperature. After 1.5 hours, the reaction mixture was concentrated to a yellow oil, which was purified by silica gel chromatography (12 g pre-packed column, eluting with 0 to 35% Acetonitrile in DCM) to afford 42.5 mg of phthalimide I-144 (65% yield) as a colorless oil.
- To a solution of phthalimide I-144 (42.5 mg, 0.142 mmol) in MeOH (2 mL) was added hydrazine hydrate (44.2 μL, 10.0 equiv.). The reaction mixture was heated to 45° C. for 2 hours, cooled and concentrated under reduced pressure. The residue was re-dissolved in DMF (2 mL) and thiodiglycolic anhydride (22.5 mg, 1.2 equiv. based on phthalimide I-144) was added. After 2 hours, the reaction mixture was subjected to purification by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 13.0 mg (30% yield) of the desired carboxylic acid I-145 as a colorless oil. ESI-MS: Found 301.2, C13H21N2O4S (M−H)− requires 301.1.
-
- A suspension of 2-(2-oxopiperidin-1-yl)acetic acid (46 mg, 0.292 mmol) and tert-butyl 4-aminobutanoate hydrochloride (68 mg, 1.2 equiv.) in 0.5 mL of DCM was treated with DMAP (78 mg, 2.2 equiv.) and then EDC (67 mg, 1.2 equiv.). The mixture was allowed to stir at ambient temperature for 72 hours. The reaction mixture was diluted with 8 mL of DCM, and the organic phase was washed with 1N NaHSO3, brine, dried over Na2SO4, and concentrated in vacuo. The resulting crude ester was dissolved in 1 mL of DCM and treated with 1 mL of TFA, and the resulting solution was concentrated under a stream of nitrogen and held under high vacuum for 2 hours. Half of the crude product was purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 27.6 mg (78% yield based on 0.146 mmol) of carboxylic acid I-146. ESI-MS: Found 243.3, C11H19N2O4 (MH+) requires 243.3.
-
- A suspension of 3-(2-oxopiperidin-1-yl)propanoic acid (50 mg, 0.292 mmol) and tert-butyl 4-aminobutanoate hydrochloride (68 mg, 1.2 equiv.) in 0.5 mL of DCM was treated with DMAP (78 mg, 2.2 equiv.) and then EDC (67 mg, 1.2 equiv.). The mixture was allowed to stir at ambient temperature for 72 hours. The reaction mixture was diluted with 8 mL of DCM, and the organic phase was washed with 1N NaHSO3, brine, dried over Na2SO4 and concentrated in vacuo. The resulting crude ester was dissolved in 1 mL of DCM and treated with 1 mL of TFA and the resulting solution was concentrated under a stream of nitrogen and held under high vacuum for 2 hours. Half of the crude product was then purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 32.8 mg (87% yield based on 0.146 mmol) of carboxylic acid I-147. ESI-MS: Found 255.1, C12H19N2O4 (M−H)− requires 255.3.
-
- To a suspension of 1-(2-aminoethyl)piperidin-2-one hydrobromide (71.2 mg, 0.319 mmol), adipic acid (54.0 mg, 1.2 equiv.) and DCC (78.8 mg, 1.2 equiv.) was added TEA (53 μL, 1.2 equiv.). The resulting solution was stirred at ambient temperature for 72 hours, then filtered through celite, and concentrated in vacuo. Purification by preparative HPLC (H2O/MeCN with 0.1% TFA) afforded 24 mg (23% yield) of carboxylic acid I-148. ESI-MS: Found 269.3, C13H21N2O4 (M−H)− requires 269.3.
-
- To a solution of 4,4-dimethylpiperidine-2,6-dione (28 mg, 0.20 mmol) and tert-butyl (2-bromoethyl)carbamate (45 mg, 1.0 equiv.) in 1 mL of anhydrous DMF was added potassium carbonate (41 mg, 1.5 equiv.), and the resulting suspension was stirred for 22 hours at ambient temperature. The reaction mixture was filtered and purified directly by preparative HPLC to afford 23 mg (40% yield) of carbamate I-149. Carbamate I-149 was subjected to deprotection in 2:1 DCM/TFA for 10 minutes at ambient temperature. The reaction mixture was then concentrated in vacuo to give a crude trifluoroacetate salt, which was converted to 19 mg (74% yield) of acid I-150 using GP1. ESI-MS found 317.0, C13H20N2O5S (MH+) requires 317.1.
-
- A solution of rac-3-phenyldihydro-2H-pyran-2,6(3H)-dione (38 mg, 0.20 mmol) and tert-butyl (2-aminoethyl)carbamate (38 mg, 1.2 equiv.) in 0.6 mL of
anhydrous 1,4-dioxane was stirred for 35 minutes at ambient temperature. HCl in 1,4-dioxane (4N, 1.5 mL) was then added and the reaction mixture was stirred for an additional 8 days. The reaction mixture was then concentrated in vacuo to give a crude hydrochloride salt, which was converted to 17.5 mg of I-152 (39% yield overall) following GP1. ESI-MS found 365.0, C17H20N2O5S (MH+) requires 365.1. -
- Meso-2,3-dimethylsuccinic acid (44 mg, 0.30 mmol) was dissolved in 0.2 mL of TFAA at 0° C. The solution was allowed to slowly warm to room temperature and stirred for 70 minutes. Concentration of the reaction mixture in vacuo gave the crude anhydride I-153, which was dissolved in 1 mL of
anhydrous 1,4-dioxane and treated with tert-butyl (2-aminoethyl)carbamate (58 mg, 1.2 equiv.). The reaction mixture was stirred for 40 minutes at ambient temperature. 4N HCl in 1,4-dioxane (1.5 mL) was then added, and the reaction mixture was stirred for an additional 136 hours and then concentrated in vacuo to give a crude hydrochloride salt I-154 which was converted to 52 mg of carboxylic acid I-155 (57% yield overall) following GP1. ESI-MS found 303.0, C12H18N2O5S (MH+) requires 303.1. -
- A solution of 4,5,6,7-tetrahydroisobenzofuran-1,3-dione (46 mg, 0.30 mmol) and tert-butyl (2-aminoethyl)carbamate (58 mg, 1.2 equiv.) in 0.8 mL of
anhydrous 1,4-dioxane was stirred 50 minutes at ambient temperature. 4N HCl in 1,4-dioxane (1 mL) was then added, and the reaction mixture was stirred for an additional 5 hours and then concentrated in vacuo to give a crude hydrochloride salt I-156, which was converted to 55.5 mg of I-157 (57% yield overall) following GP1. ESI-MS found 327.0, C14H18N2O5S (MH+) requires 327.1. -
- A solution of rac-3-isopropyl-3-methyldihydrofuran-2,5-dione (47 mg, 0.30 mmol) and tert-butyl (2-aminoethyl)carbamate (58 mg, 1.2 equiv.) in 0.8 mL anhydrous 1,4-dioxane was stirred for 15 minutes at ambient temperature. 4N HCl in 1,4-dioxane (0.8 mL) was then added, and the reaction mixture was stirred for an additional 41 hours and then concentrated in vacuo to give a crude hydrochloride salt I-158, which was converted to 82.0 mg of I-159 (83% yield overall) following GP1. ESI-MS found 331.0, C14H22N2O5S (MH+) requires 331.1.
-
- A solution of 2-oxaspiro[4.4]nonane-1,3-dione (46 mg, 0.30 mmol) and tert-butyl (2-aminoethyl)carbamate (58 mg, 1.2 equiv.) in 0.8 mL of
anhydrous 1,4-dioxane was stirred for 70 minutes at ambient temperature. 4N HCl in 1,4-dioxane (1 mL) was then added, and the reaction mixture was stirred for an additional 66 hours and then concentrated in vacuo to give a crude hydrochloride salt I-160, which was converted to 66.0 mg of I-161 (67% yield overall) following GP1. ESI-MS found 329.0, C14H20N2O5S (MH+) requires 329.1. -
- A solution of 3,3-dimethyldihydrofuran-2,5-dione (38 mg, 0.30 mmol) and tert-butyl (2-aminoethyl)carbamate (58 mg, 1.2 equiv.) in 0.8 mL of
anhydrous 1,4-dioxane was stirred for 100 minutes at ambient temperature. Then 4N HCl in 1,4-dioxane (0.8 mL) was then added, and the reaction mixture was stirred for an additional 69 hours and then concentrated in vacuo to give a crude hydrochloride salt I-162, which was converted to 62.5 mg of I-163 (69% yield overall) following GP1. ESI-MS found 303.0, C12H18N2O5S (MH+) requires 303.1. -
- A solution of 6,6-dimethyl-3-oxabicyclo[3.1.0]hexane-2,4-dione (70 mg, 0.50 mmol) and tert-butyl (2-aminoethyl)carbamate (120 mg, 1.5 equiv.) in 3 mL of anhydrous DMF was stirred for 30 minutes at ambient temperature and then for 91 hours at 120° C. The reaction mixture was purified directly by preparative HPLC to afford 99 mg (0.35 mmol, 70% yield) of carbamate I-164. A portion of the carbamate I-164 (56 mg, 0.20 mmol) was deprotected in 2:1 v/v DCM/TFA for twenty minutes at ambient temperature. The reaction mixture was concentrated in vacuo to give a crude trifluoroacetate salt, which was converted to 56 mg of I-165 (89% yield) following GP1. ESI-MS found 315.0, C13H18N2O5S (MH+) requires 315.1.
-
- To 4,6-dimethyl-2H-pyran-2-one (222.8 mg, 1.79 mmol) in MeOH (5 mL) was added N-tert-butyloxycarbonylethylene diamine (496 mg, 1.7 equiv.) and TEA (0.75 mL, 3.0 equiv.). The reaction mixture was heated to 60° C. for 48 hours, then to 100° C. for a further 5 hours to ensure completion of the reaction. The reaction mixture was concentrated and purified by silica gel chromatography to afford the intermediate carbamate, I-166.
- Carbamate I-166 (33 mg, 0.12 mmol) was treated with TFA for deprotection. After concentration of the reaction mixture, the resulting amine salt was converted to 33.4 mg of I-167 (90% yield) following GP1. ESI-MS found 299.8, C13H19N2O4S (MH+) requires 299.1.
-
- 1-(2-aminoethyl)piperidin-2-one hydrobromide (54.5 mg, 0.24 mmol) was dissolved in DMF (1 mL). DIPEA (128 μL, 3.0 equiv.) was added, followed by succinic anhydride (26.9 mg, 1.1 equiv.). The reaction mixture was agitated at ambient temperature for 3 hours and then directly purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 48.2 mg (81% yield) of acid I-168 as a white solid. ESI-MS found 243.3. C11H19N2O4 (MH+) requires 243.1.
-
- 1-(2-aminoethyl)piperidin-2-one hydrobromide (64.9 mg, 0.29 mmol) was dissolved in DMF (1 mL). DIPEA (152 μL, 3.0 equiv.) was added, followed by glutaric anhydride (36.5 mg, 1.1 equiv.). The reaction mixture was agitated at ambient temperature for 3 hours and then directly purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 76.8 mg (quantitative yield) of acid I-169 as a white solid. ESI-MS found 256.1. C12H21N2O4 (MH+) requires 256.1.
-
- 1-(2-aminoethyl)piperidin-2-one hydrobromide (178.2 mg, 0.8 mmol) was dissolved in DMF (0.9 mL). DIPEA (417 μL, 3.0 equiv.) was added, followed by 2,2-dimethylsuccinic anhydride (133 mg, 1.3 equiv.). The reaction mixture was agitated at ambient temperature for 12 hours and then directly purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 51.7 mg (24% yield) of acid I-170 as a white solid. ESI-MS found 271.2. C13H23N2O4 (MH+) requires 271.2.
-
- To a solution of 1-methylimidazolidine-2,4-dione (44 mg, 0.20 mmol) and tert-butyl (2-bromoethyl)carbamate (377 mg, 8.4 equiv.) in 1.5 mL of anhydrous DMF was added potassium carbonate (41 mg, 0.30 mmol) and the resulting suspension was stirred for 20 hours at ambient temperature. The reaction mixture was then filtered, and the filtrate was subjected to preparative HPLC to afford 23 mg (0.089 mmol, 45% yield) of carbamate I-171 which was deprotected in 2:1 v/v DCM/TFA for 15 minutes at ambient temperature. The reaction mixture was concentrated under reduced pressure to give a crude trifluoroacetate salt. A portion of this salt (66 mg, 0.218 mmol) was converted to 9 mg of acid I-172 using GP1 (35% yield). ESI-MS found 290.0, C10H15N3O5S (MH+) requires 290.1.
-
- To a solution of carboxylic acid I-173 (125.3 mg, 0.73 mmol) and beta-alanine tert-butyl ester hydrochloride (146.3 mg, 1.1 equiv.) in DMF (3 mL) was added DIPEA (382 μL, 3.0 equiv.), followed by HATU (417.4 mg, 1.5 equiv.). The reaction mixture was stirred at ambient temperature for 16 hours, then diluted with H2O (30 mL) and extracted with EtOAc (3×30 mL). The combined organic extracts were washed with brine (30 mL), dried (MgSO4), and concentrated to afford a brown oil. TFA (5 mL) was added to this oil and the reaction mixture was stirred for 1 hour at ambient temperature. The reaction mixture was then concentrated and purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford I-174 (153.4 mg, 87% yield over 2 steps) as a colorless oil. ESI-MS found 243.3, C11H19N2O4 (MH+) requires 243.1.
-
- Using a procedure similar to that employed for the synthesis of I-174, carboxylic acid I-175 (102.4 mg, 0.65 mmol) afforded 123.5 mg (83% yield, 2 steps) of I-176 as a white solid. ESI-MS found 229.2, C10H17N2O4 (MH+) requires 229.1.
-
- To a solution of carboxylic acid I-177 (79.1 mg, 0.46 mmol) and amine hydrochloride I-178 (77.5 mg, 1.0 equiv.) in DMF (1 mL) was added DIPEA (241 μL, 3.0 equiv.), followed by HATU (263.5 mg, 1.5 equiv.). The reaction mixture was stirred at ambient temperature for 3 hours, and then purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford the intermediate amide I-179 (190.2 mg) as a brown oil. This oil was redissolved in MeOH (3 mL). A solution of LiOH (22.1 mg, 2 equiv. based on carboxylic acid I-177) in H2O (1 mL) was added. The reaction mixture was heated to 50° C. for 18 hours and then concentrated to remove MeOH. HCl (6 M) was added to acidify the solution to pH<2, and the crude material was purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford I-180 (110.4 mg, 88% yield over 2 steps) as a colorless oil. ESI-MS found 271.2, C13H23N2O4 (MH+) requires 271.2.
-
- Using a procedure similar to that employed for the synthesis of I-180, carboxylic acid I-177 (77 mg, 0.45 mmol) afforded 62.4 mg (51% yield, 2 steps) of I-183 as a colorless oil. ESI-MS found 271.2, C13H23N2O4 (MH+) requires 271.2.
-
- To a solution of carboxylic acid I-175 (72 mg, 0.46 mmol) and glycine tert-butyl ester hydrochloride (76.8 mg, 1.0 equiv.) in DMF (1.1 mL) was added DIPEA (240 μL, 3.0 equiv.), followed by HATU (261.5 mg, 1.5 equiv.). The reaction mixture was stirred at ambient temperature for 21 hours, then diluted with H2O (1 mL), and purified by preparative HPLC (H2O/MeCN with 0.1% AcOH) to afford the amide coupling product. TFA (5 mL) was added to this amide, and the reaction mixture was maintained at ambient temperature for 2 hours. The reaction mixture was then concentrated and purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford I-184 (84 mg, 86% yield over 2 steps) as a colorless oil. ESI-MS found 213.1 C9H13N2O4 (M−H)− requires 213.1.
-
- Using a procedure similar to that employed for the synthesis of I-184, carboxylic acid I-177 (72.4 mg, 0.42 mmol) afforded 104.1 mg (quant., 2 steps) of I-185 as a colorless oil. ESI-MS found 229.2 C10H17N2O4 (MH+) requires 229.1.
-
- To a solution of carboxylic acid I-186 (96.4 mg, 0.51 mmol) and □-aminoisobutyric acid tert-butyl ester hydrochloride (119.7 mg, 1.2 equiv.) in DMF (2 mL) was added DIPEA (178 μL, 2.0 equiv.), followed by HATU (290.6 mg, 1.5 equiv.). The reaction mixture was stirred at ambient temperature for 3 hours, then concentrated. TFA (5 mL) was added to the residue. The reaction mixture was stirred at ambient temperature for 1 hour and then concentrated under reduced pressure. The residue was purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 74 mg (53% yield, 2 steps) of I-187 as a white solid. ESI-MS found 273.1, C10H13N2O5S (M−H)− requires 273.1.
-
- To a solution of amine hydrochloride I-14 (46.8 mg, 0.24 mmol) and fumaric acid (55.2 mg, 2.0 equiv.) in DMF (1.2 mL) was added DIPEA (124 μL, 3.0 equiv.), followed by HATU (135.7 mg, 1.5 equiv.). The reaction mixture was stirred at ambient temperature for 3.5 hours, then diluted with H2O (0.3 mL), and purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 45 mg (73% yield) of I-188 as a white solid. ESI-MS found 257.1, C9H9N2O5S (M−H+) requires 257.1.
-
- To a solution of dicarboxylic acid I-189 (101.5 mg, 0.65 mmol) and HOSu (149.6 mg, 2.0 equiv.) in DCM (4 mL) was added pyridine (209 μL, 4.0 equiv.). The solution was cooled to 0-5° C. and TFAA (183 μL, 2.0 equiv.) was added. The reaction mixture was allowed to warm to ambient temperature, stirred for 16 hours, and then concentrated. EtOH (10 mL) was added and the precipitated solids were collected by filtration and dried in vacuo to afford 218 mg of crude diester I-190, which was taken forward to the next step without further purification.
- To a solution of amine salt I-14 (42.6 mg, 0.22 mmol) and diester I-190 (151.7 mg, ca. 2.0 equiv.) in DMF (1.3 mL) was added DIPEA (76 μL, 2.0 equiv.). The reaction mixture was agitated for 16 hours and then purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 29 mg (34% yield) of I-191 as a colorless oil.
-
- Diester I-193 and activated ester I-194 were prepared as described for I-191. Yield: 13 mg (10% yield) of I-194 as a colorless oil.
-
- Diester I-196 and activated ester I-194 were prepared as described for I-191. Yield: 33.8 mg (31% yield) of I-197 as a white solid.
-
- To a solution of thiazolidinedione I-198 (1.0 g, 8.55 mmol) in anhydrous DMF (10 mL) was added NaH (376.7 mg, 9.41 mmol, 1.1 equiv.), and the reaction mixture was stirred for 30 minutes at ambient temperature. Methyl-7-bromoheptanoate (2.09 g, 1.1 equiv.) was added dropwise, and the mixture was stirred at ambient temperature for 16 hours. The reaction was monitored by TLC. The reaction mixture was quenched with H2O (20 mL) and extracted with EtOAc (3×20 mL). The combined organic extracts were concentrated and the residue obtained was purified by preparative TLC (Petroleum ether/EtOAc=1:1) to afford I-199 (900 mg, 41%) as a white solid.
- TLC: (Petroleum ether/EtOAc=1:1),
UV 254 nm - Rf (compound I-198)=0.4
- Rf (compound I-199)=0.5
- A solution of thiazolidinedione I-199 (900 mg, 3.47 mmol) in 40% aqueous HBr (10 mL) was refluxed at 110° C. for 4 hours. The reaction was monitored by TLC. Water (10 mL) was added and the reaction mixture was extracted with EtOAc (3×40 mL). The combined organic extracts were dried over Na2SO4, filtered, concentrated and the residue obtained was purified by preparative TLC (Petroleum ether/EtOAc=1:1) to afford I-200 (360 mg, 42%) as a white solid.
- TLC: Petroleum ether/EtOAc=1:1,
UV 254 nm - Rf (compound I-199)=0.5
- Rf (I-200)=0.1
- 1H NMR (400 MHz, d6-DMSO) δ 11.92 (s, 1H), 4.17 (s, 2H), 3.47 (t, J=6.8 Hz, 2H), 2.18 (t, J=7.2 Hz, 2H), 1.57-1.37 (m, 4H), 1.34-1.12 (m, 4H).
-
- To a solution of thiazolidinedione I-198 (246 mg, 2.1 mmol) in anhydrous DMF (5 mL) was added NaH (53 mg, 1.1 equiv.) and the reaction mixture was stirred for 30 minutes at ambient temperature. Methyl-8-bromooctanoate (500 mg, 1.0 equiv.) was added dropwise. The mixture was stirred at ambient temperature for 16 hours. The reaction was monitored by TLC. The reaction mixture was quenched with H2O (20 mL) and extracted with EtOAc (3×20 mL). The combined organic extracts were dried over Na2SO4, concentrated and the residue obtained was purified by preparative TLC (Petroleum ether/EtOAc=1:1) to afford intermediate ester I-201 (300 mg, 52%) as a white solid.
- TLC: Petroleum ether/EtOAc=1:1,
UV 254 nm - Rf (compound I-198)=0.4
- Rf (compound I-201)=0.5
- A solution of ester I-201 (300 mg, 1.1 mmol) in 40% aqueous HBr (5 mL) was refluxed at 110° C. for 4 hours. The reaction was monitored by TLC. Water (20 mL) was added and the reaction mixture was extracted with EtOAc (3×20 mL). The combined organic extracts were dried over Na2SO4, filtered, and concentrated to a residue, which was purified by preparative TLC (Petroleum Ether/EtOAc=1:1) to afford I-202 (144 mg, 51%) as a white solid.
- TLC: Petroleum Ether/EtOAc=1:1,
UV 254 nm - Rf (compound I-202)=0.5
- Rf (I-202)=0.1
- 1H NMR (400 MHz, d6-DMSO) δ 11.96 (s, 1H), 4.17 (s, 2H), 3.46 (t, J=6.8 Hz, 2H), 2.18 (t, J=7.6 Hz, 2H), 1.52-1.43 (m, 4H), 0.39-1.13 (m, 6H).
-
- To a solution of thiazolidinedione I-198 (246 mg, 2.1 mmol) in anhydrous DMF (5 mL) was added NaH (53 mg, 1.1 equiv.) and the mixture was stirred for 30 minutes at ambient temperature. Methyl-9-bromononanoate (500 mg, 0.95 equiv.) was added dropwise and the mixture was stirred at ambient temperature for 4 hours. The reaction was monitored by TLC. The reaction mixture was quenched with H2O (20 mL) and extracted with EtOAc (3×20 mL). The combined organic extracts were dried over Na2SO4, concentrated, and the residue obtained was purified by preparative TLC (Petroleum Ether/EtOAc=1:1) to afford ester I-203 (287 mg, 48%) as a white solid.
- TLC: Petroleum Ether/EtOAc=1:1,
UV 254 nm - Rf (compound I-198)=0.4
- Rf (ester I-203)=0.5
- A solution of ester I-203 (287 mg, 1.0 mmol) in 40% aqueous HBr (5 mL) was refluxed at 110° C. for 4 hours. The reaction was monitored by TLC. Water (10 mL) was added, and the reaction mixture was extracted with EtOAc (3×20 mL). The combined organic extracts were dried over Na2SO4, filtered, concentrated, and the residue obtained was purified by preparatory TLC (Petroleum Ether/EtOAc=1:1) to afford I-204 (122 mg, 45%) as a white solid.
- TLC: Petroleum Ether/EtOAc=1:1,
UV 254 nm - Rf (compound I-203)=0.5
- Rf (I-204)=0.1
- 1H NMR (400 MHz, DMSO) δ 11.98 (s, 1H), 4.17 (s, 2H), 3.44 (t, J=6.0 Hz, 2H), 2.48 (t, J=6.0 Hz, 2H), 1.55-1.36 (m, 4H), 1.32-1.09 (m, 8H).
-
- To a solution of thiazolidinedione I-198 (1.0 g, 8.55 mmol) in anhydrous DMF (10 mL) was added 60% NaH (376 mg, 1.1 equiv.) and the reaction mixture was stirred at ambient temperature for 1 hour. Tert-butyl (3-bromopropyl)carbamate (2.24 g, 1.1 equiv.) was added and the reaction mixture was stirred at ambient temperature for 3 hours. The reaction was monitored by TLC. The reaction mixture was quenched with H2O (20 mL) and extracted with EtOAc (3×20 mL). The combined organic extracts were washed with brine, dried over Na2SO4, concentrated, and the residue obtained was purified by preparative TLC (Petroleum Ether/EtOAc=1:1) to afford carbamate I-205 (889 mg, 38%) as a light yellow solid.
- TLC: Petroleum Ether/EtOAc=1:1,
UV 254 nm - Rf (compound I-198)=0.5
- Rf (carbamate I-205)=0.6
- To a solution of carbamate I-205 (500 mg, 1.82 mmol) in DCM (5 mL) was added TFA (0.5 mL). The reaction mixture was stirred at ambient temperature for 1 hour. The reaction was monitored by TLC. The reaction mixture was concentrated under reduced pressure to afford amine I-206 (315 mg, 99%) as a light yellow solid.
- TLC: Petroleum Ether/EtOAc=1:1,
UV 254 nm - Rf (compound I-205)=0.6
- Rf (compound amine I-206)=0.1
- A solution of amine I-206 (315 mg, 1.81 mmol), carboxylic acid I-207 (263 mg, 1.0 equiv.), HATU (688 mg, 1.1 equiv.), and DIPEA (851 mg, 4.0 equiv.) in anhydrous DMF (3 mL) was stirred at ambient temperature for 16 hours. The reaction was monitored by TLC. The reaction mixture was quenched with H2O (5 mL) and extracted with EtOAc (3×5 mL). The combined organic extracts were dried over Na2SO4, and concentrated to a residue that was purified by preparative TLC (Petroleum Ether/EtOAc=1:1) to afford amide I-208 (250 mg, 48%) as a light yellow solid.
- TLC: Petroleum Ether/EtOAc=1:1,
UV 254 nm - Rf (amine I-206)=0.1
- Rf (amide I-208)=0.6
- To a solution of amide I-208 (250 mg, 0.79 mmol) in DCM (3 mL) was added TFA (0.3 mL). The mixture was stirred at ambient temperature for 4 hours. The reaction was monitored by TLC. The reaction mixture was concentrated to afford a residue, which was purified by preparative HPLC to yield acid I-209 (50 mg, 24%) as a white solid.
- TLC: Petroleum Ether/EtOAc=1:1,
UV 254 nm - Rf (amide I-208)=0.6
- Rf (I-209)=0.1
- 1H NMR (400 MHz, DMSO): δ 12.48 (br. s, 1H), 8.06 (s, 1H), 4.16 (s, 2H), 3.49 (t, J=6.8 Hz, 2H), 3.08 (s, 2H), 3.06-3.00 (m, 2H), 1.65-1.57 (m, 2H).
-
- A solution of thiazolidinedione I-198 (5.0 g, 42.7 mmol) and KOH (2.63 g, 1.1 equiv.) in EtOH (50 mL) was refluxed for 4 hours. The reaction mixture was concentrated to give the crude potassium salt (6.62 g) as a white solid. To a solution of this salt (6.62 g, 42.7 mmol) in DMF (70 mL) was added K2CO3 (25 g, 170.8 mmol, 4.0 equiv.) and methyl-3-bromopropionate (21.4 g, 3.0 equiv.). The reaction mixture was stirred at ambient temperature for 16 hours. The reaction was monitored by TLC and quenched with H2O (100 mL), then extracted with EtOAc (3×80 mL). The combined organic extracts were washed with brine, dried over Na2SO4 and concentrated under reduced pressure to a residue, which was purified by flash chromatography on silica (Petroleum Ether/EtOAc=20:1-5:1) to afford ester I-210 (2.8 g, 32%) as a light yellow oil.
- TLC: Petroleum Ether/EtOAc=1:1,
UV 254 nm - Rf (compound I-198)=0.1
- Rf (compound I-210)=0.5
- A solution of ester I-210 (3.16 g, 15.56 mmol) in 45% HBr (25 mL) was refluxed at 110° C. for 4 hours. The reaction was monitored by TLC. Water (25 mL) was added and the reaction mixture was extracted with EtOAc (3×20 mL). The combined extracts were washed with brine, dried over Na2SO4, filtered, and concentrated to a residue, which was purified by preparative TLC (Petroleum Ether/EtOAc=1:1) to afford carboxylic acid I-211(2.73 g, 93%) as a white solid.
- TLC: Petroleum Ether/EtOAc=1:1,
UV 254 nm - Rf (ester I-210)=0.5
- Rf (carboxylic acid I-211)=0.1
- A solution of carboxylic acid I-211 (719 mg, 3.8 mmol), gamma-aminobutyric acid tert-butyl ester (550 mg, 3.45 mmol, 1.0 equiv.), BOP (2.52 g, 1.1 equiv.) and DIPEA (2.25 g, 4.0 equiv.) in anhydrous DMF (8 mL) was stirred at ambient temperature for 16 hours. The reaction was monitored by TLC. The reaction mixture was quenched with H2O (10 mL) and extracted with EtOAc (3×10 mL). The combined organic extracts were dried over Na2SO4, concentrated and the residue obtained was purified by preparative TLC (Petroleum Ether/EtOAc=1:1) to afford amide I-212 (600 mg, 52%) as a light yellow solid.
- TLC: Petroleum Ether/EtOAc=1:1,
UV 254 nm - Rf (carboxylic acid I-211)=0.1
- Rf (amide I-212)=0.5
- To a solution of amide I-212 (300 mg, 0.91 mmol) in DCM (3 mL) was added TFA (0.3 mL). The reaction mixture was stirred at ambient temperature for 2 hours. The reaction was monitored by TLC. The reaction mixture was concentrated and the residue obtained was purified by preparative HPLC to afford I-213 (52 mg, 21%) as a white solid.
- TLC: Petroleum Ether/EtOAc=1:1,
UV 254 nm - Rf (carboxylic acid I-211)=0.5
- Rf (I-213)=0.1
- 1H NMR (400 MHz, DMSO) δ 12.05 (s, 1H), 7.98 (t, J=5.2 Hz, 1H), 4.14 (s, 2H), 3.66 (t, J=7.6 Hz, 2H), 3.02-2.96 (m, 2H), 2.31 (t, J=7.2 Hz, 2H), 2.20 (t, J=7.6 Hz, 2H), 1.61-1.53 (m, 2H).
-
- To a solution of thiazolidinedione I-198 (1.62 g, 13.8 mmol) in anhydrous DMF (15 mL) was added NaH (552 mg, 1.0 equiv.) and the reaction mixture was stirred for 10 min at ambient temperature. Methyl-4-bromobutanoate (2.5 g, 1.0 equiv.) was added dropwise, and the reaction mixture was stirred at ambient temperature for 4 hours. The reaction was monitored by TLC. H2O (20 mL) was added and the mixture was extracted with EtOAc (3×20 mL). The combined organic extracts were washed with 5% HCl solution, dried over Na2SO4, and concentrated; the residue obtained was purified by preparative TLC (Petroleum Ether/EtOAc=2:1) to afford ester I-214 (1.8 g, 60% yield) as a colorless oil.
- TLC: Petroleum Ether/EtOAc=1:1,
UV 254 nm - Rf (compound I-198)=0.2
- Rf (ester I-214)=0.5
- A solution of ester I-214 (1.8 g, 8.29 mmol) in 40% HBr (15 mL) was refluxed at 110° C. for 4 hours. The reaction was monitored by TLC. Water (15 mL) was added, and the reaction was extracted with EtOAc (3×50 mL). The combined organic extracts were dried over Na2SO4, filtered, and concentrated; the residue obtained was purified by preparative TLC (EtOAc) to afford carboxylic acid I-215 (1.3 g, 77%) as a white solid.
- TLC: Petroleum Ether/EtOAc=2:1,
UV 254 nm - Rf (ester I-214)=0.6
- Rf (carboxylic acid I-215)=0.3
- A solution of carboxylic acid I-215 (200 mg, 1.0 mmol), DIPEA (387 mg, 3.0 equiv.), β-alanine-tert-butyl ester (143 mg, 1.0 equiv.) and HATU (564 mg, 1.5 equiv.) in anhydrous DMF (2 mL) was stirred at ambient temperature for 16 hours. The reaction was monitored by TLC. H2O (10 mL) was added and the reaction mixture was extracted with DCM (3×10 mL). The combined organic extracts were dried over Na2SO4, and concentrated; the residue obtained was purified by preparative TLC (Petroleum Ether/EtOAc=1:2) to afford amide I-216 (150 mg, 46%) as a light yellow oil.
- TLC: Petroleum Ether/EtOAc=1:1,
UV 254 nm - Rf (carboxylic acid I-215)=0.2
- Rf (amide I-216)=0.7
- To a solution of amide I-216 (150 mg, 0.455 mmol) in DCM (2 mL) was added TFA (2 mL). The reaction mixture was stirred at ambient temperature for 2 hours. The reaction was monitored by LC-MS. The reaction mixture was concentrated, and the residue obtained was purified by preparative HPLC to afford I-217 (30 mg, 24%) as a colorless oil.
- LC-MS: 275 (M+1)
- 1H NMR (400 MHz, CD3OD): δ 4.06 (s, 2H), 3.63 (t, J=6.4 Hz, 2H), 3.42-3.38 (m, 2H), 2.50 (t, J=7.6 Hz, 2H), 2.20 (t, J=7.2 Hz, 2H), 1.90-1.85 (m, 2H).
-
- To a solution of thiazolidinedione I-198 (2 g, 17.1 mmol) in anhydrous DMF (25 mL) was added NaH (820 mg, 1.2 equiv.), and the reaction mixture was stirred for 10 minutes at ambient temperature. Methyl-5-bromopentanoate (3.66 g, 1.1 equiv.) was added dropwise to the reaction and the mixture was stirred at ambient temperature for 4 hours. The reaction was monitored by TLC. H2O (40 mL) was added, and the reaction mixture was extracted with EtOAc (3×30 mL). The combined organic extracts were washed with 5% HCl solution, dried over MgSO4, and concentrated. The residue obtained was purified by preparative TLC (Petroleum Ether/EtOAc=2:1) to afford ester I-218 (1.23 g, 31%) as a colorless oil.
- TLC: Petroleum Ether/EtOAc=2:1,
UV 254 nm - Rf (compound I-198)=0.2
- Rf (ester I-218)=0.5
- A solution of ester I-218 (1.23 g, 5.32 mmol) in 40% HBr (12 mL) was refluxed at 110° C. for 4 hours. The reaction was monitored by TLC. Water (12 mL) was added, and the reaction mixture was extracted with EtOAc (3×50 mL). The combined organic extracts were dried over MgSO4, filtered, and concentrated; the residue obtained was purified by preparative TLC (EtOAc) to afford carboxylic acid I-219 (777 mg, 67%) as a white solid.
- TLC: Petroleum Ether/EtOAc=2:1,
UV 254 nm - Rf (ester I-218)=0.6
- Rf (carboxylic acid I-219)=0.3
- A solution of carboxylic acid I-219 (200 mg, 0.922 mmol), DIPEA (142 mg, 1.2 equiv.), glycine-tert-butyl ester (145 mg, 1.2 equiv.) and HATU (420 mg, 1.2 equiv.) in anhydrous DMF (5 mL) was stirred at ambient temperature for 4 hours. The reaction was monitored by TLC. H2O (10 mL) was added and the reaction mixture was extracted with DCM (3×10 mL). The combined organic extracts were dried over Na2SO4, and concentrated. The residue obtained was purified by preparative TLC (Petroleum Ether/EtOAc=1:2) to give amide I-220 (200 mg, 66%) as a yellow oil.
- TLC: Petroleum Ether/EtOAc=1:1,
UV 254 nm - Rf (carboxylic acid I-219)=0.2
- Rf (amide I-220)=0.7
- To a solution of amide I-220 (200 mg, 0.606 mmol) in DCM (2 mL) was added TFA (2 mL). The reaction mixture was stirred at ambient temperature for 2 hours. The reaction was monitored by LC-MS. The reaction mixture was concentrated, and the residue obtained was purified by preparative HPLC to give I-221 (77 mg, 46%) as a white solid.
- LC-MS: 275 (M+1)
- 1H NMR (400 MHz, CD3OD): δ 4.07 (s, 2H), 3.88 (s, 2H), 3.63 (t, J=6.4 Hz, 2H), 2.29 (t, J=6.4 Hz, 2H), 1.63-1.30 (m, 4H).
-
- The chemical structure of the target compound was confirmed by 1H NMR and LC-MS with the purity >95% (
HPLC 214 & 254 nm). - A mixture of (R)-2-hydroxysuccinic acid (cas: 636-61-3, 2 g, 14.92 mmol), tert-butyl (2-aminoethyl)carbamate (cas: 57260-73-8, 2 g, 1.0 equiv.) in toluene (25 mL) was refluxed at 130° C. for 2 hours. The reaction mixture was then cooled to ambient temperature and concentrated to give the crude product. The crude product was purified by silica gel chromatography to provide I-222 as a pale yellow oil (0.624 g, 17% yield). MS (ESI, pos. ion) m/z: 281 (M+Na).
- To a solution of tert-butyl (R)-(2-(3-hydroxy-2,5-dioxopyrrolidin-1-yl)ethyl)carbamate (0.624 g, 2.42 mmol) in anhydrous MeCN (10 mL) at 0-5° C. was added Ag2O (1.12 g, 2.0 equiv.) under N2. The reaction mixture was then stirred for 5 minutes and Mel (0.309 g, 0.9 equiv.) was added to the reaction. The reaction mixture was allowed to warm to ambient temperature and stirred for another 10 hours, then filtered. The filtrate was concentrated in vacuo to give the crude product, which was purified by preparative TLC (Petroleum ether:EtOAc=1:2) to provide I-223 as a pale oil (0.2 g, 30% yield). MS (ESI, pos. ion) m/z: 295 (M+Na).
- A solution of tert-butyl (R)-(2-(3-methoxy-2,5-dioxopyrrolidin-1-yl)ethyl)carbamate (200 mg, 0.735 mmol) in TFA/DCM (1:3 v/v, 8 mL) was stirred at 25° C. for 1 hour. When LC-MS analysis indicated that the reaction was complete, the reaction mixture was concentrated under reduced pressure to afford the crude amine TFA salt I-224 (390 mg) as a pale oil, which was used directly in next step. MS (ESI, pos. ion) m/z: 173 (M+1)
- To a solution of (R)-1-(2-aminoethyl)-3-methoxypyrrolidine-2,5-dione (390 mg, 1.37 mmol) and thiodiglycolic anhydride (217 mg, 1.2 equiv.) in 5 mL of DCM was added TEA (166 mg, 1.2 equiv.). The reaction mixture was stirred for 2 hours, and then concentrated in vacuo to give the crude product. The crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% TFA)) to afford I-225 (130 mg, 19% yield) as a pale oil. MS (ESI, pos. ion) m/z: 305 (M+1). 1H NMR (400 MHz, DMSO) δ 8.14 (m, 1H), 4.31 (m, 1H), 3.47-3.39 (m, 5H), 3.33 (s, 2H), 3.28-3.17 (m, 2H), 3.14 (s, 2H), 2.96 (m, 1H), 2.55 (m, 1H).
-
- The synthetic route for I-229 was similar with I-225 and commenced with (S)-2-hydroxysuccinic acid (cas: 97-67-6). I-229 (pale oil, 120 mg, 15% yield) was isolated by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% TFA)). MS (ESI, pos. ion) m/z: 305 (M+1). 1H NMR (400 MHz, CDCl3) δ 7.41 (s, 1H), 5.68 (s, 1H), 4.28 (m, 1H), 3.71 (m, 2H), 3.60 (s, 3H), 3.56-3.50 (m, 2H), 3.33 (m, 4H), 3.05 (m, 1H), 2.70-2.62 (m, 1H).
-
- (2-bromoethoxy)(tert-butyl)dimethylsilane (cas: 86864-60-0, 3.18 g, 15 mmol) in 20 mL of THE was added dropwise to an ice-cooled suspension of 4-methylpyrrolidin-2-one (cas: 2996-58-9, 1 g, 1.0 equiv.), NaI (1.5 g, 1.0 equiv.) and NaH (2.4 g, 6.0 equiv.) in THF (50 mL) with stirring under N2. After 2 hours, the ice bath was removed and the reaction mixture was heated to reflux overnight. The reaction was quenched with H2O (50 mL). After removal of the solvent under reduced pressure, the residue was partitioned between EtOAc and H2O. The aqueous layer was extracted with EtOAc (3×20 mL). The combined organic extracts were dried over MgSO4, concentrated and the residue obtained was purified by silica gel chromatography to afford 360 mg (14%) of I-230 as a pale oil. MS (ESI, pos. ion) m/z: 258 (M+1).
- To 1-(2-((tert-butyldimethylsilyl)oxy)ethyl)-methylpyrrolidin-2-one I-230 (550 mg, 2.14 mmol) in MeOH (5 ml) was added 10 mL of HCl (4 M in MeOH). After 10 min, MeOH was removed under reduced pressure to afford 300 mg of the crude alcohol I-231 as a light yellow oil, which was taken forward to the next step without purification.
- To a stirred solution of 1-(2-hydroxyethyl)-4-methylpyrrolidin-2-one I-231 (96 mg, 0.66 mmol), phthalimide (cas: 85-41-6, 105 mg, 1.0 equiv.) and triphenylphosphine (260 mg, 1.0 equiv.) in anhydrous THF (10 mL) was added a solution of DIAD (400 mg, 3.0 equiv.) in anhydrous THF (2 mL) dropwise at 0° C. The reaction mixture was allowed to warm to ambient temperature and stirred for 8 hours. The reaction was monitored by LC-MS. Upon completion of the reaction, the reaction mixture was filtered. The filtrate was concentrated, and the resulting residue was purified by silica gel chromatography (10-80% EtOAc in hexanes) to give 145 mg of I-232 (60% purity) as light oil. MS (ESI, pos. ion) m/z: 273.1 (M+1).
- The racemic mixture I-232 was subjected to chromatographic separation using a chiral column to afford the two enantiomers (CHIRALPAK AD column, (Hexane/EtOH=50/50 (v/v)), but their absolute configuration was not established.
- To a stirred solution of each enantiomer of 2-(2-(4-methyl-2-oxopyrrolidin-1-yl)ethyl)isoindoline-1,3-dione, I-232 (145 mg, 0.53 mmol) in MeOH (10 mL) was added hydrazine monohydrate (40 mg, 1.5 equiv.). The reaction mixture was stirred at ambient temperature for 18 hours and then filtered. The filtrate was concentrated. The residue was dissolved in DCM, and the precipitate was again filtered off. After concentration of the filtrate, the 72 mg (78%) of crude amine I-233 was used in the next step without purification. MS (ESI, pos. ion) m/z: 143.1 (M+1).
- To a stirred solution of each enantiomer of 1-(2-aminoethyl)-4-methylpyrrolidin-2-one, I-233 (144 mg, 1.06 mmol) in DCM (10 mL) at ambient temperature was added thiodiglycolic anhydride (cas: 3261-87-8, 210 mg, 1.6 mmol), and the resulting solution was stirred at ambient temperature for 1 hour. The reaction mixture was concentrated and purified by preparative HPLC to give 150 mg (55%) of I-234 as a light oil. MS (ESI, pos. ion) m/z: 275.1 (M+1).
- (R*)-I-234: 1H NMR (400 MHz, CDCl3) δ 7.30 (s, 1H), 3.71-3.61 (m, 1H), 3.58-3.39 (m, 4H), 3.36 (s, 2H), 3.20 (d, 2H), 3.10 (dd, 1H), 2.65 (dd, 1H), 2.49 (td, 1H), 2.13 (dd, 1H), 1.14 (s, 3H).
- (S*)-I-234: 1H NMR (400 MHz, CDCl3) δ 7.35 (s, 1H), 3.71-3.61 (m, 1H), 3.58-3.39 (m, 4H), 3.36 (s, 2H), 3.20 (d, 2H), 3.10 (dd, 1H), 2.65 (dd, 1H), 2.49 (td, 1H), 2.13 (dd, 1H), 1.12 (s, 3H).
-
- To a solution of 2-(2-bromoethyl)isoindoline-1,3-dione (cas: 574-98-1, 20 g, 79 mmol) and tert-butyl hydrazinecarboxylate (cas: 870-46-2, 16 g, 1.5 equiv.) in DMF (100 mL) was added K2CO3 (28 g, 2 equiv.). The solution was heated to 90° C. and stirred for 12 hours. Upon completion of the reaction, the reaction was quenched with water (100 mL) and extracted with EtOAc (3×100 mL). After drying with Na2SO4, the combined organic extracts were concentrated, and the crude product was purified by silica gel chromatography to provide 5 g of I-235 as a pale oil (21% yield). MS (ESI, pos. ion) m/z: 328.2 (M+23).
- A solution of tert-butyl 2-(2-(1,3-dioxoisoindolin-2-yl)ethyl)hydrazine-1-carboxylate (5 g, 16.4 mmol), 3-bromopropanoyl chloride (3.6 g, 1.5 equiv.) and K2CO3 (37 g, 2 equiv.) in DMF (80 mL) was heated to 90° C. for 16 hours. Upon completion of the reaction, the reaction was quenched with water (80 mL) and extracted with EtOAc (3×80 mL). After drying with Na2SO4, the combined organic extracts were concentrated, and the crude product was purified by silica gel chromatography to afford 3.2 g (54% yield) of I-236 as a pale oil. MS (ESI, pos. ion) m/z: 382.2 (M+23).
- A solution of tert-butyl 2-(2-(1,3-dioxoisoindolin-2-yl)ethyl)-3-oxopyrazolidine-1-carboxylate (3.2 g, 8.9 mmol) in HCl (4 M in dioxane, 15 mL) was stirred at ambient temperature for 0.5 hours. Upon completion of the reaction, the reaction mixture was concentrated to afford the crude pyrazolone I-237 (3.5 g) as a white solid, which was used directly in the next step. MS (ESI, pos. ion) m/z: 260.2 (M+1).
- To a solution of 2-(2-(5-oxopyrazolidin-1-yl)ethyl)isoindoline-1,3-dione (3.5 g, ca. 8.9 mmol) and paraformaldehyde (2.7 g, 10 equiv.) in THE was added 2 drops of AcOH. After 1 hour, NaCNBH3 (cas: 25895-60-7, 2.8 g, 5 equiv.) was added to the reaction mixture at 0° C. The reaction mixture was stirred for 12 hours, then quenched with water (30 mL), and extracted with DCM:MeOH (10:1) (3×40 mL). The combined organic extracts were dried over Na2SO4, and concentrated to a residue which was purified by silica gel chromatography to afford I-238 (0.6 g, 24% yield over 2 steps) as a yellow solid. MS (ESI, pos. ion) m/z: 274.2 (M+1).
- To a solution of 2-(2-(2-methyl-5-oxopyrazolidin-1-yl)ethyl)isoindoline-1,3-dione (600 mg, 2.2 mmol) in MeOH (50 mL) at 0-5° C. was added NH2NH2 (85% in H2O, 1.5 mL, 2.5 equiv.). The reaction mixture was allowed to warm to ambient temperature, stirred for 12 hours, and then filtered. The filtrate was concentrated to afford the crude amine I-239 (0.4 g) as a pale oil, which was used directly for the next step. MS (ESI, pos. ion) m/z: 144.2 (M+23).
- A solution of 2-(2-aminoethyl)-1-methylpyrazolidin-3-one (400 mg, 2.8 mmol) and thiodiglycolic anhydride (990 mg, 2.5 equiv.) in 10 mL of DCM was stirred for 0.5 hours and then concentrated in vacuo to afford the crude product. Half of this crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA), gradient: 5-15% MeCN) to afford 56 mg (15% yield) of I-240 as a white solid. MS (ESI, pos. ion) m/z: 276.2 (M+1). 1H NMR (400 MHz, D2O) δ 3.75-3.70 (m, 2H), 3.38-3.34 (m, 4H), 3.29 (s, 2H), 3.25 (s, 2H), 3.02-2.85 (m, 1H), 2.81-2.77 (m, 3H), 2.55-2.42 (m, 1H).
-
- To a solution of tert-butyl 2-(2-(1,3-dioxoisoindolin-2-yl)ethyl)-3-oxopyrazolidine-1-carboxylate, I-236 (2 g, 5.5 mmol) in MeOH (50 mL) at 0-5° C. was added NH2NH2 (85% in H2O, 1 mL, 2.5 equiv.). The reaction mixture was allowed to warm to ambient temperature, stirred for 12 hours, and then filtered. The filtrate was concentrated under reduced pressure to afford the crude amine I-241 (0.7 g) as a pale oil, which was used directly for next step. MS (ESI, pos. ion) m/z: 252.2 (M+23).
- A solution of tert-butyl 2-(2-aminoethyl)-3-oxopyrazolidine-1-carboxylate I-241 (700 mg, 3 mmol), thiodiglycolic anhydride (990 mg, 2.5 equiv.), and TEA (0.8 mL, 2 equiv.) in 10 mL of DCM was stirred for 0.5 hours. The reaction mixture was then concentrated in vacuo to afford the crude product as a pale oil. Half of this crude product was purified by preparative HPLC to afford 270 mg (49% yield) of I-242 as a white solid. MS (ESI, pos. ion) m/z: 384.2 (M+23).
- A solution of 2-((2-((2-(2-(tert-butoxycarbonyl)-5-oxopyrazolidin-1-yl)ethyl)amino)-2-oxoethyl)thio)acetic acid I-242 (270 mg, 0.74 mmol) in HCl (4 M in dioxane) (10 mL) was stirred at 20° C. for 0.5 hours. The reaction mixture was then concentrated and the residue obtained was purified by preparative HPLC (MeCN/H2O with 0.1% TFA), gradient: 10-20% MeCN) to afford 160 mg (81% yield) of I-243 as a pale oil. MS (ESI, pos. ion) m/z: 262.2 (M+1). 1H NMR (400 MHz, DMSO) δ 8.19 (s, 1H), 3.39 (dd, 2H), 3.34 (d, 4H), 3.25 (dd, 2H), 3.20 (s, 2H), 2.44 (t, 3H).
-
- To a solution of piperidin-2-one (cas: 675-20-7, 6 g, 60 mmol) in THF (200 mL) at 0-5° C. was added NaH (4.8 g, 2 equiv., 60% dispersion in mineral oil) in portions under N2. The reaction mixture was stirred for 0.5 hours. (2-bromoethoxy)(tert-butyl)dimethylsilane (cas: 86864-60-0, 4.9 g, 1.2 equiv.) was then added and the reaction mixture was heated to reflux for 6 hours. The reaction was then quenched with water (50 mL), and extracted with EtOAc (3×80 mL). The combined organic extracts were washed with water (50 mL), brine (50 mL), dried with Na2SO4, and concentrated under reduced pressure to a residue, which was purified by silica gel chromatography to afford I-244 as a pale oil (2 g, 13% yield). MS (ESI, pos. ion) m/z: 258 (M+1).
- To a solution of 1-(2-((tert-butyldimethylsilyl)oxy)ethyl)piperidin-2-one I-244 (2 g, 7.8 mmol) in MeOH (15 mL) at 0-5° C. was added HCl in MeOH (30% v/v, 10 mL) under N2. The reaction mixture was stirred for 0.5 hours, then concentrated under reduced pressure to afford the crude alcohol I-245 as a pale oil (1.2 g), which was used directly for next step. MS (ESI, pos. ion) m/z: 144 (M+1).
- To a solution of 1-(2-hydroxyethyl)piperidin-2-one I-245 (1.2 g, 8.4 mmol) in THE (15 mL) at 0-5° C. was added phthalimide (1.85 g, 1.5 equiv.) and PPh3 (3.9 g, 1.8 equiv.) and the reaction mixture was stirred for 0.5 hours under N2. DIAD (3.4 g, 2.0 equiv.) was added and the reaction mixture was allowed to warm to ambient temperature and stirred for 2 hours. The reaction mixture was then filtered, and the filtrate was concentrated under reduced pressure to afford a pale oil, which was purified by silica gel chromatography to afford I-246 (purity: 60%, 0.7 g, 35% yield). MS (ESI, pos. ion) m/z: 273 (M+1).
- To a solution of 2-(2-(2-oxopiperidin-1-yl)ethyl)isoindoline-1,3-dione I-246 (0.7 g, 2.6 mmol) in MeOH (10 mL) at 0-5° C. was added NH2NH2 (85% in H2O, 0.2 mL, 1.2 equiv.). The reaction mixture was allowed to warm to ambient temperature and stirred for 12 hours, then filtered, and the filtrate was concentrated under reduced pressure to afford the crude amine I-247 (0.4 g) as a pale oil, which was used directly for next step. MS (ESI, pos. ion) m/z: 143 (M+1).
- A solution of 1-(2-aminoethyl)piperidin-2-one I-247 (400 mg, 2.8 mmol) and thiodiglycolic anhydride (924 mg, 2.5 equiv.) in 20 mL of DCM was stirred for 0.5 hours, and then concentrated in vacuo to give the crude product as a pale oil. The crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% formic acid), Gradient:5-15% MeCN) to afford 200 mg of I-248 (26% yield) as a pale oil. MS (ESI, pos. ion) m/z: 275.2 (M+1). 1H NMR (400 MHz, CDCl3): δ 7.57 (s, 1H), 6.48 (s, 2H), 3.83-3.07 (m, 10H), 2.44 (s, 2H), 1.82 (s, 4H).
-
- A solution of 2-cyclopentylethan-1-amine (cas: 5763-55-3, 200 mg, 1.8 mmol) and thiodiglycolic anhydride (594 mg, 2.5 equiv.) in 5 mL of DCM was stirred for 0.5 hours, and then concentrated in vacuo to afford a pale oil, which was purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% TFA), Gradient: 30-40% MeCN) to provide 250 mg (56% yield) of I-249 as a white solid. MS (ESI, pos. ion) m/z: 246.2 (M+1). 1H NMR (400 MHz, CDCl3): δ 6.64 (s, 1H), 3.47-3.22 (m, 6H), 1.79 (s, 3H), 1.68-1.47 (m, 6H), 1.11 (d, 2H).
-
- The chemical structure of the target compound was confirmed by 1H NMR and LC-MS with the purity >95% (
HPLC 214 & 254 nm). - To a solution of 1-(2-aminoethyl)cyclopentan-1-ol (cas: 859629-83-7, 0.1 g, 0.774 mmol) and thiodiglycolic anhydride (0.102 g, 1.0 equiv.) in DCM (5 mL) was added TEA (93 mg, 1.2 equiv.) and the reaction mixture was stirred for 4 hours at ambient temperature, then concentrated under reduced pressure to afford the crude product. The crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% TFA)) to afford I-250 (50 mg, 24% yield) as a pale oil. MS (ESI, pos. ion) m/z: 262.2 (M+1). 1H NMR (400 MHz, DMSO): δ 12.63 (s, 1H), 7.97 (s, 1H), 4.09 (m, 1H), 3.35 (s, 2H), 3.20-3.12 (m, 4H), 1.75-1.35 (m, 10H).
-
- To a solution of (R)-4-hydroxypyrrolidin-2-one (cas: 22677-21-0, 2.02 g, 20 mmol) in DMF (10 ml) at 0-5° C. was added tert-butylchlorodimethylsilane (3.62 g, 24 mmol, 1.2 equiv.) and imidazole (3.40 g, 50 mmol, 2.5 equiv.). The reaction mixture was allowed to warm to ambient temperature and stirred for 12 hours. Water (50 mL) was then added, and the reaction mixture was stirred for 10 minutes. The white solid that precipitated was filtered and washed with water (10 mL) and dried under high vacuum to afford I-251 (4.05 g, 95% yield). MS (ESI, pos. ion) m/z: 216.1 (M+1).
- To a solution of (R)-4-((tert-butyldimethylsilyl)oxy)pyrrolidin-2-one, I-251 (3.8 g, 17.37 mmol) in THE (30 mL) was added methyl 2-bromoacetate (cas:96-32-2, 4.03 g, 1.5 equiv.), potassium carbonate (0.84 g, 2.5 equiv.) and TBAB (4.94 g, 0.2 equiv.) under N2. The reaction mixture was stirred at ambient temperature for 12 hours. The reaction was then quenched with water (10 mL), extracted with EtOAc (3×50 mL). The combined organic extracts were then washed with water (20 mL), brine (20 mL), dried (Na2SO4), and concentrated under reduced pressure to a residue, which was purified by silica gel chromatography to afford I-252 (0.71 g, 27% yield) as a pale oil. MS (ESI, pos. ion) m/z: 288.1 (M+1).
- To a solution of methyl (R)-2-(4-((tert-butyldimethylsilyl)oxy)-2-oxopyrrolidin-1-yl)acetate, I-252 (0.71 g, 2.47 mmol) in t-BuOH (10 mL) was added sodium borohydride (0.38 g, 4.0 equiv.) in MeOH (0.5 mL) under N2. The reaction mixture was stirred for 2 hours at 80° C., then concentrated under reduced pressure to a residue. The residue was diluted with water (2 mL), and extracted with EtOAc (3×20 mL). The combined organic extracts were then washed with water (20 mL), brine (20 mL), dried (Na2SO4), and concentrated under reduced pressure to a residue, which was purified by silica gel chromatography to afford I-253 as a pale oil (0.43 g, 69% yield). MS (ESI, pos. ion) m/z: 260.2 (M+1).
- To a solution of (R)-4-((tert-butyldimethylsilyl)oxy)-1-(2-hydroxyethyl)pyrrolidin-2-one, I-253 (0.43 g, 1.66 mmol) in THE (5 mL) at 0-5° C. was added phthalimide (0.27 g, 1.1 equiv.) and PPh3 (0.76 g, 1.5 equiv.). The reaction mixture was stirred for 0.5 hours under N2, and DIAD (1.01 g, 3.0 equiv.) was added to the solution. The reaction mixture was allowed to warm to ambient temperature and stirred for 12 hours. The resulting mixture was quenched with water (5 mL) and extracted with DCM (3×20 mL). The combined organic extracts were washed with water (20 mL), brine (20 mL), dried (Na2SO4), and concentrated under reduced pressure to a residue, which was purified by silica gel chromatography to afford I-254 as a pale oil (0.48 g, 75% yield). MS (ESI, pos. ion) m/z: 389.2 (M+1).
- To a solution of (R)-2-(2-(4-((tert-butyldimethylsilyl)oxy)-2-oxopyrrolidin-1-yl)ethyl)isoindoline-1,3-dione, I-254 (0.48 g, 1.24 mmol) in MeOH (10 mL) at 0-5° C. was added NH2NH2 (85% in H2O, 0.06 g, 1.2 equiv.). The reaction mixture was allowed to warm to ambient temperature and stirred for 12 hours and then filtered. The filtrate was concentrated under reduced pressure to afford the crude amine, I-255 (0.3 g) as a pale oil, which was used directly for next step. MS (ESI, pos. ion) m/z: 259.2 (M+1).
- To a solution of (R)-1-(2-aminoethyl)-4-((tert-butyldimethylsilyl)oxy)pyrrolidin-2-one, I-255 (0.302 mg, 1.17 mmol) in DCM (10 mL) was added thiodiglycolic anhydride (0.20 mg, 1.52 mmol, 1.3 equiv.). The reaction mixture was stirred for 2 hours at 20° C. and then concentrated under reduced pressure to afford the crude product (0.5 g) as a pale oil. The crude product I-256 was used directly for the next step. MS (ESI, pos. ion) m/z: 391.2 (M+1).
- To a solution of (R)-2-((2-((2-(4-((tert-butyldimethylsilyl)oxy)-2-oxopyrrolidin-1-yl)ethyl)amino)-2-oxoethyl)thio)acetic acid (0.50 g, 1.28 mmol) in DCM (5 mL) at 0-5° C. was added HCl in EtOAc (2 M, 1.5 mL) under N2. The reaction mixture was stirred for 1 hour. The reaction mixture was then concentrated under reduced pressure to afford the crude product as a pale oil. The crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA), Gradient: 2-8% MeCN) to give 33.3 mg (9% yield) of I-257 as a pale oil. MS (ESI, pos. ion) m/z: 277.1 (M+1). 1H NMR (400 MHz, CDCl3):7.46 (s, 1H), 4.49-4.45 (m, 1H), 4.01 (ddd, 1H), 3.80 (ddd, 1H), 3.70 (dt, 2H), 3.39 (s, 2H), 3.35-3.28 (m, 1H), 3.20 (q, 2H), 3.08 (d, 1H), 2.81-2.74 (m, 1H), 2.57 (s, 1H).
-
- To a solution of (S)-4-hydroxypyrrolidin-2-one (cas: 68108-18-9, 5.0 g, 49.5 mmol) in DMF (20 mL) at 0-5° C. was added tert-butylchlorodimethylsilane (8.9 g, 1.2 equiv.) and imidazole (8.4 g, 2.5 equiv.). The reaction mixture was allowed to warm to ambient temperature and stirred for 12 hours. Water (50 mL) was then added and the reaction mixture was stirred for 10 minutes. The white precipitate that was formed was filtered and washed with water (15 mL) and then dried under high vacuum to afford I-258 (9.8 g, 92% yield). MS (ESI, pos. ion) m/z: 216.1 (M+1).
- To a solution of (S)-4-((tert-butyldimethylsilyl)oxy)pyrrolidin-2-one, I-258 (4.9 g, 22.79 mmol) in THE (40 mL) was added methyl 2-bromoacetate (5.2 g, 1.5 equiv.), potassium carbonate (7.9 g, 2.5 equiv.) and TBAB (1.47 g, 0.2 equiv.) under N2. The reaction mixture was stirred for 12 hours at 20° C., quenched with water (10 mL), and extracted with EtOAc (3×50 mL). The combined organic extracts were washed with water (20 mL), brine (20 mL), dried (Na2SO4), and concentrated under reduced pressure to afford a residue, which was purified by silica gel chromatography to afford I-259 as a pale oil (1.1 g, 29% yield). MS (ESI, pos. ion) m/z: 288.1 (M+1).
- To a solution of methyl (S)-2-(4-((tert-butyldimethylsilyl)oxy)-2-oxopyrrolidin-1-yl)acetate, I-259 (1.1 g, 3.8 mmol) in t-BuOH (15 mL) was added sodium borohydride (0.58 g, 4.0 equiv.) in MeOH (1 mL) under N2. The reaction mixture was stirred for 2 hours at 80° C. and then concentrated under reduced pressure to afford a residue. The residue was diluted with water (2 mL) and extracted with EtOAc (3×50 mL). The combined organic extracts were washed with water (20 mL), brine (20 mL), dried (Na2SO4), and concentrated under reduced pressure to afford a residue, which was purified by silica gel chromatography to afford I-260 as a pale oil (0.82 g, 83% yield). MS (ESI, pos. ion) m/z: 260.2 (M+1).
- To a solution of (S)-4-((tert-butyldimethylsilyl)oxy)-1-(2-hydroxyethyl)pyrrolidin-2-one, I-260 (0.82 g, 3.17 mmol) in THE (10 mL) at 0-5° C. was added phthalimide (0.51 g, 1.1 equiv.) and PPh3 (1.45 g, 1.5 equiv.). The reaction mixture was stirred for 0.5 hours under N2 and DIAD (1.92 g, 3.0 equiv.) was added to the solution. The reaction mixture was allowed to warm to ambient temperature and stirred for 12 hours. The reaction was quenched with water (5 mL) and extracted with DCM (3×50 mL). The combined organic extracts were washed with water (20 mL), brine (20 mL), dried (Na2SO4) and concentrated under reduced pressure to afford a residue, which was purified by silica gel chromatography to afford I-261 as a pale oil (1.15 g, 94% yield). MS (ESI, pos. ion) m/z: 389.2 (M+1).
- To a solution of (S)-2-(2-(4-((tert-butyldimethylsilyl)oxy)-2-oxopyrrolidin-1-yl)ethyl)isoindoline-1,3-dione, I-261 (1.05 g, 1.24 mmol) in MeOH (10 mL) at 0-5° C. was added NH2NH2 (85% in H2O, 0.12 g, 1.2 equiv.). The reaction mixture was allowed to warm to ambient temperature, stirred for 12 hours, and then filtered. The filtrate was concentrated under reduced pressure to afford the crude amine, I-262 (0.71 g) as a pale oil, which was used directly for the next step. MS (ESI, pos. ion) m/z: 259.2 (M+1).
- To a solution of (S)-1-(2-aminoethyl)-4-((tert-butyldimethylsilyl)oxy)pyrrolidin-2-one (0.61 mg, 2.36 mmol) in DCM (10 mL) was added thiodiglycolic anhydride (0.41 mg, 1.3 equiv.) and TEA (0.05 g, 0.2 equiv.). The reaction mixture was stirred for 2 hours at 20° C. and was then concentrated under reduced pressure to give the crude product, I-263 (0.89 g) as a pale oil. The crude product was used directly for next step. MS (ESI, pos. ion) m/z: 391.2 (M+1).
- To a solution of (S)-2-((2-((2-(4-((tert-butyldimethylsilyl)oxy)-2-oxopyrrolidin-1-yl)ethyl)amino)-2-oxoethyl)thio)acetic acid, I-263 (0.89 g, ca. 2.97 mmol) in DCM (10 mL) at 0-5° C. was added HCl in EtOAc (2 M, 2.5 mL) under N2. The reaction mixture was stirred for 1 hour and then concentrated under reduced pressure to afford the crude product as a pale oil. The crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% TFA), Gradient: 2-8% MeCN) to give 90 mg (11% yield) of I-264 as a pale oil. MS (ESI, pos. ion) m/z: 277.1 (M+1). 1H NMR (400 MHz, CDCl3): 7.40 (s, 1H), 4.44 (dd, 1H), 3.99 (dd, 1H), 3.76 (s, 1H), 3.69 (dt, 2H), 3.37 (s, 2H), 3.33-3.26 (m, 1H), 3.19 (q, 2H), 3.06 (d, J=14.4 Hz, 1H), 2.75 (ddd, 1H), 2.52 (d, 1H).
-
- The chemical structure of the target compound was confirmed by H NMR and LC-MS with the purity >95% (
HPLC 214 & 254 nm). - To a solution of (R)-5-(hydroxymethyl)pyrrolidin-2-one (cas: 66673-40-3, 2 g, 17.4 mmol) in DCM (15 mL) was added imidazole (2.36 g, 2.0 equiv.) and TBSCl (3.14 g, 1.2 equiv.). The reaction mixture was stirred for 7 hours and was then quenched with water (20 mL). The aqueous phase was extracted with EtOAc (3×20 mL). The combined organic extracts were washed with water, brine, dried (Na2SO4), and concentrated under reduced pressure to afford a residue, which was purified by silica gel chromatography to provide silyl ether I-265(2.9 g, 73% yield) as a pale yellow oil. MS (ESI, pos. ion) m/z: 230 (M+1).
- To a solution of (R)-5-(((tert-butyldimethylsilyl)oxy)methyl)pyrrolidin-2-one, I-265 (0.4 g, 1.75 mmol) in THE (10 mL) were added methyl 2-bromoacetate (0.4 g, 1.5 equiv.), K2CO3 (0.605 g, 2.5 equiv.), and TBAB (0.112 g, 2.0 equiv.). The reaction mixture was then stirred at ambient temperature for 10 hours and then quenched with water (20 mL). The aqueous phase was extracted with EtOAc (3×20 mL). The combined organic extracts were washed with water, brine, dried (Na2SO4), and concentrated under reduced pressure to a residue, which was purified by silica gel chromatography to provide ester I-266 (100 mg, 19%) as a pale yellow oil. MS (ESI, pos. ion) m/z: 302 (M+1).
- To a solution of methyl (R)-2-(2-(((tert-butyldimethylsilyl)oxy)methyl)-5-oxopyrrolidin-1-yl)acetate, I-266 (0.2 g, 0.66 mmol) in t-BuOH (5 mL) and MeOH (0.2 mL) was added NaH4 (0.1 g, 4.0 equiv.) in one portion. The reaction mixture was heated to 80° C. for 2 hours and then cooled to ambient temperature and quenched with water (20 mL). The aqueous phase was then extracted with EtOAc (3×20 mL). The combined organic extracts were washed with water, brine, dried (Na2SO4) and concentrated under reduced pressure to a residue (220 mg), which was used directly for next step. MS (ESI, pos. ion) m/z: 274 (M+1).
- To a solution of (R)-5-(((tert-butyldimethylsilyl)oxy)methyl)-1-(2-hydroxyethyl) pyrrolidin-2-one, I-267 (0.22 g, 0.81 mmol), phthalimide (0.13 g, 1.1 equiv.) and PPh3 (0.318 g, 1.5 equiv.) in anhydrous THF (5 mL) at 0-5° C. was added DIAD (0.49 g, 3.0 equiv.) under N2. The reaction mixture was allowed to warm to ambient temperature and stirred for 7 hours and then concentrated under reduced pressure to a residue, which was and purified by preparative HPLC to afford the imide I-268 (145 mg, 28% yield). MS (ESI, pos. ion) m/z: 403 (M+1).
- To a solution of (R)-2-(2-(2-(((tert-butyldimethylsilyl)oxy)methyl)-5-oxopyrrolidin-1-yl)ethyl)isoindoline-1,3-dione, I-268 (0.345 g, 0.858 mmol) in MeOH (10 mL) was added hydrazine hydrate (85% in H2O, 0.05 g, 1.5 equiv.). The reaction mixture was stirred for 12 hours at ambient temperature and then filtered. The filtrate was concentrated under reduced pressure to give the crude product, I-269 (307 mg), which was used directly in next step. MS (ESI, pos. ion) m/z: 273 (M+1).
- To a solution of (R)-1-(2-aminoethyl)-5-(((tert-butyldimethylsilyl)oxy)methyl)pyrrolidin-2-one, I-269 (0.307 g, ca. 1.13 mmol) in DCM (5 mL) was added thiodiglycolic anhydride (178 mg, 1.2 equiv.) and TEA (22.8 mg, 0.2 equiv.). The reaction mixture was stirred for 2 hours and then concentrated in vacuo to give crude acid I-270 as a pale oil (0.5 g). The crude product was used directly for next step. MS (ESI, pos. ion) m/z: 405 (M+1).
- To a solution of (R)-2-((2-((2-(2-(((tert-butyldimethylsilyl)oxy)methyl)-5-oxopyrrolidin-1-yl)ethyl)amino)-2-oxoethyl)thio)acetic acid, I-270 (0.5 g, ca. 1.23 mmol) was added HCl in EtOAc (2 M, 5 mL) and the reaction mixture was stirred for 2 hours and then concentrated in vacuo to afford the crude product. The crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% TFA)) to afford I-271 (0.1 g, 28% yield). MS (ESI, pos. ion) m/z: 291 (M+1). 1H NMR (400 MHz, DMSO) δ 12.64 (s, 1H), 8.08 (m, 1H), 4.84 (s, 1H), 3.66 (m, 4.0 Hz, 1H), 3.56-3.47 (m, 2H), 3.41 (s, 3H), 3.28-3.09 (m, 4H), 3.02 m, 1H), 2.22 (m, 1H), 2.14 (m, 1H), 1.96 (m, 1H), 1.76 (m, 1H).
-
- The chemical structure of the target compound was confirmed by 1H NMR and LC-MS with the purity >95% (
HPLC 214 & 254 nm). - The synthetic route for I-278 was similar to that for the synthesis of I-271 and commenced with (S)-5-(hydroxymethyl)pyrrolidin-2-one (cas: 17342-08-4). (S)-2-((2-((2-(2-(hydroxymethyl)-5-oxopyrrolidin-1-yl)ethyl)amino)-2-oxoethyl)thio)acetic acid, I-278 (pale oil, 120 mg, 15% yield) was isolated by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA). MS (ESI, pos. ion) m/z: 291 (M+1). 1H NMR (400 MHz, DMSO) δ 12.59 (s, 1H), 8.08 (m, 1H), 4.80 (s, 1H), 3.66 (m, 1H), 3.56-3.48 (m, 2H), 3.40 (m, 3H), 3.28-3.10 (m, 4H), 3.06-2.96 (m, 1H), 2.28-2.17 (m, 1H), 2.17-2.06 (m, 1H), 1.96 (m, 1H), 1.80-1.70 (m, 1H).
-
- To a solution of 3-(2-aminoethyl)oxazolidin-2-one (cas:141778-93-0, 300 mg, 1.8 mmol) in DCM (20 mL) was added thiodiglycolic anhydride (360 mg, 1.5 equiv.) and TEA (90 mg, 0.5 equiv.). The reaction mixture was stirred at ambient temperature for 1 hour and then concentrated in vacuo. The residue obtained was purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% TFA), Gradient: 1-3% MeCN) to afford 87 mg (27% yield) of I-279 as a white solid. MS (ESI, pos. ion) m/z: 263.1 (M+1). 1H NMR (400 MHz, DMSO) δ 12.58 (s, 1H), 8.15 (m, 1H), 4.26-4.20 (m, 2H), 3.59-3.52 (m, 2H), 3.35 (s, 2H), 3.26-3.17 (m, 6H).
-
- The chemical structure of the target compound was confirmed by 1H NMR and LC-MS with the purity >95% (
HPLC 214 & 254 nm). - Step 1: Tert-butyl (2-(2,4-dioxooxazolidin-3-yl)ethyl)carbamate (I-280)
- To a solution of oxazolidine-2,4-dione (cas: 2346-26-1, 0.1 g, 0.99 mmol) in DMF (5 mL) was added tert-butyl (2-bromoethyl) carbamate (cas: 39684-80-5, 0.265 g, 1.2 equiv.) and K2CO3 (0.274 g, 2.0 equiv.). The reaction mixture was heated to 70° C. for 2 hours. The reaction mixture was then cooled to ambient temperature, and quenched with water (20 mL). The aqueous phase was extracted with EtOAc (3×20 mL). The combined organic extracts were washed with water, brine, dried (Na2SO4), and concentrated under reduced pressure to afford a residue, which was purified by preparative TLC (Petroleum:EtOAc=1:1) to provide carbamate I-280 as a pale yellow oil (0.1 g, 41% yield). MS (ESI, pos. ion) m/z: 267 (M+Na).
- To a solution of tert-butyl (2-(2,4-dioxooxazolidin-3-yl)ethyl)carbamate, I-280 (0.1 g, 0.41 mmol) in DCM (2 ml) that had been pre-cooled to 0-5° C. was added a solution of TFA/DCM (1:1 v/v, 2 mL). The reaction mixture was then stirred at ambient temperature for 2 hours. When LC-MS showed that the reaction went to completion, the reaction solution was concentrated under reduced pressure to give the crude product, I-281 (pale oil, 176 mg). The crude product was used directly for next step. MS (ESI, pos. ion) m/z: 145 (M+1).
- To a solution of 3-(2-aminoethyl)oxazolidine-2,4-dione, I-281 (0.17 g, 1.17 mmol) and thiodiglycolic anhydride (0.087 g, 1.6 equiv. based on carbamate I-280) in DCM (5 mL) was added TEA (80 mg, 0.792 mmol). After 4 hours, the reaction mixture was concentrated to give the crude product. The crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA) to afford I-282 as a pale oil (50 mg, 2% yield). MS (ESI, pos. ion) m/z: 277.1 (M+1). 1H NMR (400 MHz, DMSO): δ 8.21 (m, 1H), 4.77 (s, 2H), 3.47 (m, 2H), 3.33 (s, 2H), 3.28 (m, 2H), 3.16 (s, 2H).
-
- The chemical structure of the target compound was confirmed by 1H NMR and LC-MS with the purity >95% (
HPLC 214 & 254 nm). - To a solution of (S)-5-oxotetrahydrofuran-2-carboxylic acid (cas: 21461-84-7, 7 g, 53.8 mmol) was added SOCl2 (17.95 g, 2.8 equiv., 11 mL) and the reaction mixture was refluxed at 80° C. for 4 hours under N2. The reaction mixture was then allowed to cool to ambient temperature and stirred for 12 hours. The excess SOCl2 was removed under reduced pressure. The residue was diluted with DCM (70 mL); a solution of MeOH (2.1 mL, 53.8 mmoL) and TEA (6.56 g, 64.5 mmoL) was added at −20° C. The reaction mixture was warmed to ambient temperature and stirred for 12 hours. The reaction was then quenched with H2O (40 mL) and extracted with EtOAc (20 mL×3). The combined organic extracts were dried over MgSO4 and concentrated under reduced pressure to give the crude product. The crude product was purified by silica gel chromatography (Petroleum ether:EtOAc=1:1) to afford I-283 as a pale oil (4.5 g, 58% yield). MS (ESI, pos. ion) m/z: 236 (M+1).
- To a solution of methyl (S)-5-oxotetrahydrofuran-2-carboxylate, I-283 (3 g, 20.83 mmol) in DCM (20 mL) was added tert-butyl (2-aminoethyl)carbamate (cas: 57260-73-8, 230 mg). The reaction mixture was then stirred at ambient temperature for 48 hours. When the LC-MS showed the reaction went to completion, the reaction mixture was concentrated under reduced pressure to give the crude product, I-284. The crude product (3.5 g, 83% yield) was used directly in next step. MS (ESI, pos. ion) m/z: 205 (M+1).
- To a solution of methyl (S)-5-((2-aminoethyl)amino)-2-hydroxy-5-oxopentanoate, I-284 (3.5 g, 13.98 mmol) in anhydrous DMF (30 mL) was added imidazole (2.38 g, 2.5 equiv.) and TBSCl (3.79 g, 1.8 equiv.). The reaction mixture was stirred at ambient temperature for 3 hours. The reaction was quenched with H2O (20 mL) and extracted with EtOAc (20 mL×3). The combined organic extracts were concentrated to afford the crude product. The crude product was purified by silica gel chromatography (Petroleum ether:EtOAc=1:3) to provide I-285 as a pale oil (3.6 g, 49% yield). MS (ESI, pos. ion) m/z: 419 (M+1).
- A solution of methyl (S)-5-((2-((tert-butoxycarbonyl)amino)ethyl)amino)-2-((tert-butyldimethylsilyl)oxy)-5-oxopentanoate, I-285 (2 g, 5.48 mmol) and NaBH4 (0.373 g, 1.8 equiv.) in THE (anhydrous, 26 mL) was added to a solution of iodine (1.25 g, 0.9 equiv.) in THE (anhydrous, 10 mL) at 20° C. under N2. The reaction mixture was gradually warmed to ambient temperature over 8 hours. When the LC-MS showed that the reaction went to completion, the reaction was quenched with H2O (20 mL) and extracted with EtOAc (30 mL×3). The combined organic extracts were dried over MgSO4 and concentrated to give the crude product. The crude product, I-286 (1.8 g, 93% yield) was used directly in next step. MS (ESI, pos. ion) m/z: 404 (M+1).
- To a solution of methyl (S)-8-((tert-butoxycarbonyl)amino)-2-((tert-butyldimethylsilyl)oxy)octanoate, I-286 (3.6 g, 8.9 mmol) in DCM (30 mL) was added TEA (0.27 g, 0.3 mmol). The reaction mixture was stirred for 48 hours and was concentrated under reduced pressure to give the crude product. The crude product was purified by silica gel chromatography (Petroleum ether:EtOAc=3:1) to provide lactam I-287 as a pale oil (1.2 g, 36% yield). MS (ESI, pos. ion) m/z: 373 (M+1), 395 (M+Na).
- A solution of tert-butyl (S)-(2-(3-((tert-butyldimethylsilyl)oxy)-2-oxopiperidin-1-yl)ethyl)carbamate, I-287 (1.2 g, 3.22 mmol) was added to a solution of TFA/DCM (1 mL/3 mL) at 0° C. The reaction mixture was stirred for 2 hours and concentrated under reduced pressure to afford the crude product. The crude product, I-288 (0.8 g, pale oil) was used directly for next step. MS (ESI, pos. ion) m/z: 159 (M+1).
- To a solution of (S)-1-(2-aminoethyl)-3-hydroxypiperidin-2-one, I-288 (0.89 g, 5.6 mmol) and thiodiglycolic anhydride (1.11 g, ca. 1.5 equiv.) in 10 mL of DCM was added TEA (0.114 g, 0.2 equiv.). The reaction mixture was stirred for 2 hours and concentrated under reduced pressure to give the crude product. The crude product was purified by preparative HPLC (Mobile Phase:MeCN/H2O (0.1% TFA), Gradient:5-15% MeCN) to give I-289 (50 mg, 3% yield) as a pale oil. MS (ESI, pos. ion) m/z: 291.1 (M+1). 1H NMR (400 MHz, DMSO) δ 12.63 (s, 1H), 8.11 (m, 1H), 3.84 (m, 1H), 3.45-3.37 (m, 2H), 3.35 (s, 2H), 3.30-3.24 (m, 2H), 3.24-3.19 (m, 3H), 3.18 (s, 2H), 1.99-1.89 (m, 1H), 1.81 (m, 1H), 1.70 (m, 1H), 1.64-1.52 (m, 1H).
-
- The synthetic route for I-296 was similar to that of I-288 and commenced with (R)-5-oxotetrahydrofuran-2-carboxylic acid (cas: 53558-93-3). I-296 (pale oil, 39 mg, 3% yield) was isolated by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% TFA), Gradient: 5-15% MeCN). MS (ESI, pos. ion) m/z: 291.1 (M+1). 1H NMR (400 MHz, DMSO) δ 12.59 (s, 1H), 8.10 (s, 1H), 5.00 (s, 1H), 3.84 (m, 1H), 3.42 (s, 2H), 3.28 (m, 3H), 3.21 (m, 3H), 3.18 (s, 2H), 1.95 (m, 1H), 1.87-1.76 (m, 1H), 1.75-1.65 (m, 1H), 1.58 (m, 1H).
-
- A solution of tert-butyl (2-aminoethyl)carbamate (cas: 57260-73-8, 3.2 g, 20 mmol), methyl 2-bromoacetate (cas: 96-32-2, 3.0 g, 1 equiv.) and TEA (4 mL, 2.9 equiv.) in 100 mL of THE was stirred at ambient temperature for 4 hours. Upon completion of the reaction, the reaction mixture was filtered and the filtrate was concentrated and the crude product, I-297 (5.3 g) was used in next step directly. MS (ESI, pos. ion) m/z: 255.2 (M+23).
- A solution of methyl (2-((tert-butoxycarbonyl)amino)ethyl)glycinate, I-297 and trimethylsilyl isocyanate (cas: 1118-02-1, 4.5 mL, 1.7 equiv.) in DCE (50 mL) was heated to 90° C. for 48 hours. LC-MS at this point indicated that the reaction was not complete. The reaction mixture was concentrated, and purified by silica gel chromatography to afford I-298 as a pale oil (4.2 g, 76% over 2 steps). MS (ESI, pos. ion) m/z: 298.2 (M+23).
- Methyl N-(2-((tert-butoxycarbonyl)amino)ethyl)-N-carbamoylglycinate, I-298 (4.2 g, 15 mmol) in toluene (20 mL) was heated to 140° C. under Microwave irradiation for 30 minutes. The reaction mixture was then concentrated and purified by silica gel chromatography to afford I-299 as a pale oil (1.5 g, 41% yield). MS (ESI, pos. ion) m/z: 266.2 (M+23).
- A solution of tert-butyl (2-(2,4-dioxoimidazolidin-1-yl)ethyl)carbamate, I-299 (1.2 g. 4.9 mmol) in HCl (4 M in dioxane) (18 mL) was stirred at ambient temperature for 2 hours. Upon completion of the reaction, the reaction mixture was concentrated and the crude amine I-300 was used in the next step directly. MS (ESI, pos. ion) m/z: 144.2 (M+1).
- A solution of 1-(2-aminoethyl)imidazolidine-2,4-dione, I-300 (crude, ca. 4.9 mmol) and thiodiglycolic anhydride (1.2 g, 1.8 equiv.) in 30 mL of DCM was stirred for 15 min. Upon completion of the reaction, the reaction mixture was concentrated in vacuo to give the crude product as a pale oil. Half the crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA), Gradient: 1-3% MeCN) to give 130 mg of I-301 as a white solid (19% yield). MS (ESI, pos. ion) m/z: 276.2 (M+1). 1H NMR (400 MHz, DMSO) δ 12.61 (s, 1H), 10.72 (s, 1H), 8.15 (t, 1H), 3.94 (s, 2H), 3.33 (s, 2H), 3.31-3.25 (m, 2H), 3.25-3.20 (m, 2H), 3.18 (s, 2H).
-
- Steps 1-3 were similar to those used in the preparation of carboxylic acid I-301.
- Step 4: Benzyl (2-(3-methyl-2,4-dioxoimidazolidin-1-yl)ethyl)carbamate (I-305)
- To a solution of benzyl (2-(2,4-dioxoimidazolidin-1-yl)ethyl)carbamate, I-304 (600 mg, 2.17 mmol) in toluene (20 mL) was added N,N-dimethylacetamide dimethyl acetal (cas: 18871-66-4, 1.3 mL, 4.0 equiv.) in one portion at 25° C. The resulting mixture was heated to 130° C. for 2 hours. After cooling to ambient temperature, the reaction mixture was concentrated in vacuo. The residue was purified by preparative TLC to give 500 mg (79% yield) of carbamate I-305 as a pale yellow oil. MS (ESI, pos. ion) m/z: 292.1 (M+1).
- To a solution of benzyl (2-(3-methyl-2,4-dioxoimidazolidin-1-yl)ethyl)carbamate, I-305 (500 mg, 1.72 mmol) in 20 mL of THF was added 50 mg of 10% Pd/C. The reaction was stirred at 25° C. for 10 hours under H2. Upon completion of the reaction, the reaction mixture was filtered and the filtrate was concentrated in vacuo. The residue was used in next step directly without purification. MS (ESI, pos. ion) m/z: 158.1 (M+1).
- To a solution of tert-butyl 1-(((benzyloxy)carbonyl)amino)cyclopropane-1-carboxylate, I-306 (500 mg, 3.18 mmol) in DCM (20 mL) was added thiodiglycolic anhydride (630 mg, 1.5 equiv.). The reaction mixture was then stirred at 25° C. for 1 hour. Upon completion of the reaction, the solvent was removed in vacuo, and the crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA), gradient:1-3% MeCN) to give 250 mg (27% yield) of I-307 as a pale oil. MS (ESI, pos. ion) m/z: 290.1 (M+1). 1H NMR (400 MHz, DMSO) δ 8.15 (s, 1H), 3.98 (s, 2H), 3.34 (d, 2H), 3.33 (s, 2H), 3.25 (t, 2H), 3.17 (s, 2H), 2.83 (s, 3H).
-
- To a solution of benzyloxycarbonylglycine (3.1 g, 15 mmol, cas: 1138-80-3) in DMF (30 mL) and methyl (2-((tert-butoxycarbonyl)amino)ethyl)glycinate, I-297 (1.8 g, 7.8 mmol) was added TEA (2.4 g, 24 mmol), EDC (4.6 g, 24 mmol), and then the reaction mixture was stirred at 25° C. for 15 hours. The reaction mixture was then diluted with EtOAc (100 mL) and was sequentially washed with aqueous 5% NaHCO3(100 mL×3), aqueous 5% citric acid solution (100 mL×3) and brine (100 mL×3). The EtOAc extracts were dried over anhydrous magnesium sulfate and purified by silica gel column chromatography (3% MeOH/DCM) to give 2.1 g of I-308 as a pale oil. Yield: 64%. MS (ESI, pos. ion) m/z: 446.1 (M+23).
- To a solution of methyl N-(((benzyloxy)carbonyl)glycyl)-N-(2-((tert-butoxycarbonyl)amino)ethyl)glycinate, I-308 (2.1 g, 5 mmol) in 30 mL of MeOH was added 500 mg of 10% Pd/C. The reaction mixture was stirred at ambient temperature for 10 hours under H2 (1 atm). Upon completion of the reaction, Pd/C was filtered and the filtrate was concentrated in vacuo. The residue was purified by silica gel column chromatography (3% MeOH/DCM) to give 800 mg of I-309 as a pale oil. Yield: 64%. MS (ESI, pos. ion) m/z: 280.1 (M+23).
- To a solution of tert-butyl (2-(2,5-dioxopiperazin-1-yl)ethyl)carbamate, I-309 (400 mg, 1.6 mmol) in 15 mL of DCM was added 15 mL of 4 M HCl in dioxane. The reaction mixture was stirred at 25° C. for 1 hour. Upon completion of the reaction, the mixture was concentrated under reduced pressure to give 360 mg of crude amine I-310 as a white solid, which was used in next step. MS (ESI, pos. ion) m/z: 158.1 (M+1).
- To a solution of benzyl (2-(3-methyl-2,4-dioxoimidazolidin-1-yl)ethyl)carbamate (300 mg, 1.91 mmol) in THF/H2O (10 mL/1 mL) was added TEA (200 mg, 2 mmol) and thiodiglycolic anhydride (504 mg, 3.82 mmol). The reaction mixture was stirred at 25° C. for 1 hour. Upon completion of the reaction, the solvent was removed under reduced pressure and the resulting residue was purified by preparative HPLC (Mobile Phase:MeCN/H2O (with 0.1% formic acid) Gradient:2-8% MeCN) to give 65 mg of carboxylic acid I-311 as a pale oil. Yield: 12%. MS (ESI, pos. ion) m/z: 290.1 (M+1). 1H NMR (400 MHz, DMSO) δ 8.12 (dd, J=12.1, 6.1 Hz, 2H), 3.92 (s, 2H), 3.76 (s, 1H), 3.38-3.31 (m, 4H), 3.23 (dd, J=11.8, 5.9 Hz, 1H).
-
- To a solution of 2-aminoethan-1-ol (1.2 g, 20 mmol), DMAP (220 mg, 1.8 mmol) and imidazole (2.7 g, 40 mmol) in 30 ml of DCM was added TBSCl (3.1 g, 21 mmol). The resulting mixture was stirred at ambient temperature for 16 hours. Upon completion of the reaction, 50 mL of water was added to the reaction mixture, which was then extracted with DCM (30 mL×3). The combined organic extracts were dried over Na2SO4, then concentrated in vacuo to give 3.1 g of I-312 as a pale oil. Yield: 89%. MS (ESI, pos. ion) m/z: 176.1 (M+1).
- To a solution of 2-((tert-butyldimethylsilyl)oxy)ethan-1-amine, I-312 (1.75 g, 10 mmol) in 30 mL of DCM was added methyl 2-bromoacetate (1.6 g, 1.1 equiv., cas #: 96-32-2) and TEA (2.0 g, 2.0 equiv.). The reaction mixture was stirred at ambient temperature for 10 hours under N2. Upon completion of the reaction, the solvent was removed in vacuo and the mixture was purified by column chromatography (5-10% MeOH in DCM) to give 2 g of I-313 as a yellow oil. Yield: 62%. MS (ESI, pos. ion) m/z: 248.1 (M+1).
- To a solution of benzyloxycarbonylglycine (3.1 g, 15 mmol, cas #: 1138-80-3) and amine I-313 (1.8 g, 7.28 mmol) in 30 mL of DMF was added TEA (2.4 g, 24 mmol) and the reaction mixture was stirred at 0° C. To this reaction mixture was added EDC (3.5 g, 18 mmol) and stirring continued at 0° C. for 2 hours, after which the reaction mixture was allowed to warm to ambient temperature and stirred for 15 hours. The reaction mixture was diluted with EtOAc (100 mL) and sequentially washed with aqueous 5% sodium bicarbonate solution (100 mL×3), aqueous 5% citric acid solution (100 mL×3), aqueous saturated sodium chloride solution (100 mL×3). The EtOAc extracts were dried over Na2SO4 and purified by silica gel column chromatography (3.8% MeOH/DCM) to give 3 g of amide I-314 as a yellow oil. Yield: 43%. MS (ESI, pos. ion) m/z: 461.1 (M+23).
- To a solution of methyl N-(((benzyloxy)carbonyl)glycyl)-N-(2-((tert-butoxycarbonyl) amino)ethyl)glycinate, I-314 (2.1 g, 4.8 mmol) in 30 mL of MeOH was added 500 mg of 10% Pd/C, The reaction mixture was stirred at ambient temperature for 10 hours under H2 (1 atm). Upon completion of the reaction, Pd/C was filtered and the filtrate was concentrated under reduced pressure. The residue was purified by silica gel column chromatography (3% MeOH/DCM) to give 720 mg of diketopiperazine I-315 as a pale oil. Yield: 55%. MS (ESI, pos. ion) m/z: 273.1 (M+1).
- To a solution of 1-(2-((tert-butyldimethylsilyl)oxy)ethyl)piperazine-2,5-dione, I-315 (720 mg, 2.64 mmol) and NaH (500 mg, 8.3 equiv., 60% dispersion in mineral oil) in 20 mL of THF at 0° C. was added Mel (1.1 g, 3.0 equiv.). The reaction mixture was stirred at ambient temperature for 1 hour. Upon completion of the reaction, the solvent was removed in vacuo, and the residue obtained was purified by column chromatography (DCM) to give 680 mg of diketopiperazine I-316 as a yellow oil, yield: 90%. MS (ESI, pos. ion) m/z: 287.1 (M+1).
- To a solution of 1-(2-((tert-butyldimethylsilyl)oxy)ethyl)-4-methylpiperazine-2,5-dione, I-316 (800 mg, 2.8 mmol) in DCM (8 mL) cooled in an ice-water bath was added HCl in Dioxane (30% v/v, 8 mL) under N2. The reaction mixture was stirred for 0.5 hours. Upon completion of the reaction, the reaction mixture was concentrated under reduced pressure to give 608 mg of I-317 as a pale oil, which was used directly for next step. MS (ESI, pos. ion) m/z: 173.1 (M+1).
- To a solution of 1-(2-hydroxyethyl)-4-methylpiperazine-2,5-dione, I-317 (600 mg, 3.8 mmol) in THE (20 mL) was added phthalimide (cas: 85-41-6, 592 mg, 1.05 equiv.) and PPh3 (1.5 g, 1.5 equiv.). The reaction mixture was stirred for 0.5 h in ice bath under N2. DIAD (2.3 g, 3.0 equiv.) was the added dropwise to the solution. The reaction mixture was allowed to warm to ambient temperature and stirred for 6 hours. Upon completion of the reaction, the reaction mixture was quenched with water (5 mL) and extracted with DCM (3×20 mL). The combined organic extracts were washed with water (20 mL), brine (20 mL), and dried over Na2SO4, then concentrated and the residue obtained was purified by column chromatography (50-100% EtOAc) to give 480 mg of I-318 as a yellow solid, yield: 42%. MS (ESI, pos. ion) m/z: 302.1 (M+1).
- To a solution of 2-(2-(4-methyl-2,5-dioxopiperazin-1-yl)ethyl)isoindoline-1,3-dione, I-318 (300 mg, 1 mmol) in MeOH (5 mL) that had been cooled in an ice-water bath was added NH2NH2 (85% in H2O, 300 mg, 5.5 equiv.). The reaction mixture was allowed to warm to ambient temperature and stirred for 12 hours. Upon completion of the reaction, the slurry was filtered and the filtrate was concentrated to afford crude amine I-319, which was used directly for the next step (pale oil, 280 mg). MS (ESI, pos. ion) m/z: 172.1 (M+1).
- A solution of 1-(2-aminoethyl)-4-methylpiperazine-2,5-dione, I-319 (280 mg, 1.27 mmol) and thiodiglycolic anhydride (300 mg, 1.8 equiv.) in 5 mL of DCM was stirred for 2 hours, and then was concentrated in vacuo to give the crude product as a pale oil. The crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% formic acid) Gradient: 5-15% MeCN) to give 50 mg of carboxylic acid I-320 as a white solid, yield: 13%. 1H NMR (400 MHz, CDCl3) δ 7.34 (s, 1H), 4.14 (s, 2H), 4.06 (s, 2H), 3.64 (dd, 2H), 3.55 (dd, 2H), 3.36 (s, 2H), 3.25 (s, 2H), 3.00 (s, 3H).
-
- To a solution of tert-butyl 3-oxopiperazine-1-carboxylate (cas: 76003-29-7, 2 g, 10 mmol) in DMF (20 mL) that had been pre-cooled in an ice-water bath was added NaH (800 mg, 2.0 equiv.) in portions under N2. The mixture was stirred for 0.5 hours. (2-bromoethoxy)(tert-butyl)dimethylsilane (cas: 86864-60-0, 5.3 mL, 2.5 equiv.) was added to the solution at 0° C. The reaction mixture was stirred at 25° C. for 12 hours. The reaction mixture was then diluted with water (50 mL) and extracted with EtOAc (3×80 mL). The combined organic extracts was then washed with water (50 mL), brine (50 mL), and dried over Na2SO4, then concentrated under reduced pressure to a residue. The residue was purified by silica gel chromatography to afford ketopiperazine I-321 as a pale oil (1.8 g, 50% yield, pale oil). MS (ESI, pos. ion) m/z: 381 (M+23).
- A solution of tert-butyl 4-(2-((tert-butyldimethylsilyl)oxy)ethyl)-3-oxopiperazine-1-carboxylate, I-321 (1.8 g, 5 mmol) in AcOH/THF/H2O (40 mL/13 mL/13 mL) was stirred at 40° C. for 2 hours. Upon completion of the reaction, the solvent was removed under reduced pressure. The crude product was purified by silica gel chromatography to give the alcohol I-322 (0.95 g, 78%, pale oil). MS (ESI, pos. ion) m/z: 267 (M+23).
- To a solution of tert-butyl 4-(2-hydroxyethyl)-3-oxopiperazine-1-carboxylate, I-322 (0.82 g, 3.4 mmol) in THF (8 mL) was added phthalimide (cas: 85-41-6, 0.75 g, 1.5 equiv.), PPh3 (1.6 g, 1.8 equiv.) in sequence at 0° C. under N2. Then DIAD (1.4 mL, 2.0 equiv.) was added dropwise. The mixture was then stirred at 25° C. for 1.5 hours. After LC-MS showed the reaction went to completion, the mixture solution was filtered. The filtrate was concentrated under reduced pressure to afford the crude product. The crude product was purified by silica gel chromatography to give phthalimide I-323 as a white solid (purity: 40%, 2.8 g, 88% yield). MS (ESI, pos. ion) m/z: 396 (M+23).
- To a solution of tert-butyl 4-(2-(1,3-dioxoisoindolin-2-yl)ethyl)-3-oxopiperazine-1-carboxylate, I-323 (0.58 g, ca. 0.77 mmol) in MeOH (8 mL) that had been pre-cooled in an ice-water bath was added NH2NH2 (85% in H2O, 0.1 mL, 2 equiv.). The reaction mixture was allowed to warm to ambient temperature and then stirred for 18 hours. Upon completion of the reaction, the slurry was filtered and the filtrate was concentrated to afford a pale oil. The crude product, I-324 was used directly for next step. MS (ESI, pos. ion) m/z: 266 (M+23).
- A solution of tert-butyl 4-(2-aminoethyl)-3-oxopiperazine-1-carboxylate, I-324 (crude product, ca. 0.77 mmol) and 1,4-thiodiglycolic anhydride (100 mg, 1.0 equiv.) in THF (5 mL) was stirred for 5 min and concentrated under reduced pressure. The crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% formic acid), Gradient:20-30% MeCN) to afford carboxylic acid I-325 as a white solid (54 mg, 19% yield). MS (ESI, pos. ion) m/z: 398.2 (M+23). 1H NMR (400 MHz, CDCl3) δ 4.14 (s, 2H), 3.67 (dd, 4H), 3.59-3.50 (m, 2H), 3.44 (d, 2H), 3.35 (s, 2H), 3.27 (s, 2H), 1.47 (s, 9H).
-
- The chemical structure of the target compound was confirmed by 1H NMR and LC-MS with the purity >95% (
HPLC 214 & 254 nm). - To a solution of tert-butyl (2-((2-aminoethyl)amino)ethyl)carbamate (cas: 193206-49-4, 1 g, 5 mmol) in EtOH (50 mL) was added diethyl oxalate (cas: 95-92-1, 0.73 g, 1.0 equiv.). The reaction mixture was heated to reflux for 18 hours, then concentrated under reduced pressure. The residue obtained was purified by silica gel chromatography to provide carbamate I-326 as a colorless foam. (330 mg, 26% yield). MS (ESI, pos. ion) m/z: 28 0 (M+23).
- To a solution of tert-butyl (2-(2,3-dioxopiperazin-1-yl)ethyl)carbamate, I-326 (280 mg, 1.1 mmol) in DCM (20 ml) was added HCl/MeOH (5 mL). The reaction mixture was then stirred at ambient temperature for 1 hour, then concentrated under reduced pressure to afford 210 mg of the crude product I-327, which was directly used without further purification. MS (ESI, pos. ion) m/z: 158 (M+1).
- To a solution of 1-(2-aminoethyl)piperazine-2,3-dione hydrochloride, I-327 (210 mg, 1.1 mmol) and thiodiglycolic anhydride (cas: 3261-87-8, 144 mg, 1.1 equiv.) in DMF (10 mL) was added TEA (222 mg, 2.2 equiv.). The reaction mixture was stirred at ambient temperature for 2 hours and then was concentrated under reduced pressure to afford the crude product. The crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O (with 0.1% TFA)) to give afford acid I-328 (56 mg, 18% yield) as a white solid). MS (ESI, pos. ion) m/z: 290 (M+1). 1H NMR (400 MHz, DMSO) δ 8.54 (s, 1H), 8.18 (t, 1H), 3.55-3.45 (m, 2H), 3.41 (t, 2H), 3.32 (d, 2H), 3.25 (dd, 2H), 3.18 (s, 2H).
-
- The chemical structure of the target compound was confirmed by 1H NMR and LC-MS with the purity >95% (
HPLC 214 & 254 nm). - To a solution of N-methylethylene-1,2-diamine (cas: 109-81-9, 1 g, 13.5 mmol) in EtOH (80 mL) was added diethyl oxalate (cas: 95-92-1, 2 g, 5 mmol). The reaction was heated to reflux for 18 hours, then concentrated under reduced pressure. The residue obtained was purified by silica gel chromatography to provide (1.4 g, 80% yield) of I-329 as a colorless foam. MS ESI, pos. ion) m/z: 129 (M+1).
- To a slurry of 1-methylpiperazine-2,3-dione, I-329 (1 g, 7.8 mmol), Cs2CO3 (12.7 g, 5.0 equiv.) and TBAI (288 mg, 0.1 equiv.) in DMF (50 mL) was added tert-butyl (2-bromoethyl)carbamate (3.5 g, 2.0 equiv.). The reaction mixture was heated to 80° C. for 24 hours. The reaction mixture was then concentrated and the residue obtained was purified by silica gel chromatography to provide 1.4 g (67% yield) of carbamate I-330 as a colorless oil. MS (ESI, pos. ion) m/z: 294 (M+23).
- To a solution of tert-butyl (2-(4-methyl-2,3-dioxopiperazin-1-yl)ethyl)carbamate, I-330 (100 mg, 0.37 mmol) in DCM (12 mL) was added HCl/MeOH (2 mL). The reaction was then stirred at ambient temperature for 1 hour. The reaction mixture was then concentrated and the crude product (77 mg, colorless oil) obtained was directly used without purification. MS (ESI, pos. ion) m/z: 172 (M+1).
- To a solution of 1-(2-aminoethyl)-4-methylpiperazine-2,3-dione hydrochloride, I-331 (77 mg, 0.37 mmol) and thiodiglycolic anhydride (49 mg, 1.0 equiv.) in DCM (10 mL) was added TEA (75 mg, 0.74 mmol). The reaction mixture was stirred at ambient temperature for 1 hour and then was concentrated under reduced pressure to give the crude product. The crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% TFA)) to afford acid I-332 (40 mg, 37% yield). MS (ESI, pos. ion) m/z: 304 (M+1). 1H NMR (400 MHz, DMSO) δ 8.21 (s, 1H), 3.52 (d, J=4.9 Hz, 4H), 3.39 (t, J=5.5 Hz, 2H), 3.31 (s, 2H), 3.26 (d, J=5.5 Hz, 2H), 3.17 (s, 2H), 2.91 (s, 3H).
-
- The chemical structure of the target compound was confirmed by 1H NMR and LC-MS with the purity >95% (
HPLC 214 & 254 nm). - A solution of 1-methylpiperazin-2-one (cas: 5625-67-2, 1 g, 9.99 mmol), tert-butyl (2-bromoethyl)carbamate (cas: 39684-80-5, 2 g, 0.9 equiv.) in anhydrous DMF (15 mL) was added K2CO3 (8.28 g, 6.0 equiv.). The reaction mixture was stirred for 8 hours at ambient temperature. Once LC-MS analysis indicated reaction completion, the reaction was quenched with H2O (20 mL) and the aqueous phase was extracted with EtOAc (20 mL×3). The combined organic extracts was concentrated under reduced pressure to give the crude product. The crude product was purified by silica gel chromatography (Petroleum ether:EtOAc=1:10) to provide carbamate I-333 as a pale oil (0.65 g, 22%). MS (ESI, pos. ion) m/z: 258 (M+1).
- A solution of tert-butyl (2-(4-methyl-3-oxopiperazin-1-yl)ethyl)carbamate, I-333 (0.25 g, 0.97 mmol) in DCM (2 mL) that had been pre-cooled in an ice-water bath was added a solution of TFA/DCM (1:1 v/v, 2 mL). The reaction mixture was then stirred at ambient temperature for 2 hours. When the LC-MS showed the reaction went to completion, the reaction mixture was concentrated in vacuo to afford the crude amine, I-334 (pale oil, 200 mg). The crude product was used directly for next step. MS (ESI, pos. ion) m/z: 158 (M+1).
- A solution of 4-(2-aminoethyl)-1-methylpiperazin-2-one, I-334 (0.2 g, 1.27 mmol) and thiodiglycolic anhydride (0.185 g, 1.1 equiv.) in THE (5 mL) was stirred at ambient temperature for 4 hours, and then the reaction mixture was concentrated to give the crude product. The crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% TFA)) to afford the acid I-335 as a pale oil (50 mg, 2% yield). MS (ESI, pos. ion) m/z: 290.1 (M+1). 1H NMR (400 MHz, DMSO) δ 8.26 (s, 1H), 3.75 (s, 2H), 3.48 (s, 3H), 3.44-3.36 (m, 5H), 3.26 (s, 2H), 3.12 (m, 2H), 2.87 (s, 3H).
-
- The synthetic route for I-338 was similar to that of I-335 and commenced with piperazin-2-one (cas:5625-67-2). 2-((2-oxo-2-((2-(3-oxopiperazin-1-yl)ethyl)amino)ethyl)thio)acetic acid (pale oil, 50 mg, 15% yield) was isolated by preparative HPLC (Mobile Phase: MeCN/H2O (with 0.1% TFA)). MS (ESI, pos. ion) m/z: 276.1 (M+1). 1H NMR (400 MHz, MeOD) δ 3.82 (s, 2H), 3.60-3.53 (m, 4H), 3.47 (m, 2H), 3.38 (s, 2H), 3.35 (s, 2H), 3.23 (m, 2H).
-
- The chemical structure of the target compound was confirmed by 1H NMR and LC-MS with the purity >95% (
HPLC 214 & 254 nm). - To a solution of morpholin-3-one (cas: 109-11-5, 2 g, 19.8 mmol) in anhydrous DMF (25 mL) was added NaH (60% dispersion in mineral oil, 1.98 g, 2.5 equiv.) at 0° C. under N2. The reaction mixture was stirred for 30 minutes and then ((2-bromoethoxy)methyl)benzene (cas: 1462-37-9, 1.98 g, 2.5 equiv.) was added to the reaction mixture, which was then allowed to warm to ambient temperature. After 12 hours, analysis by LC-MS indicated completion of the reaction. The reaction mixture was quenched with H2O (20 mL) and extracted with EtOAc (20 mL×3). The combined organic extracts were concentrated under reduced pressure to give the crude product, which was purified by silica gel chromatography (Petroleum ether:EtOAc=1:4) to provide morpholinone I-339 as a pale oil (2.3 g, 49% yield). MS (ESI, pos. ion) m/z: 236 (M+1).
- To a solution of 4-(2-(benzyloxy)ethyl)morpholin-3-one, I-339 (2.35 g, 9.79 mmol) in MeOH (10 mL) was added Pd/C (230 mg) quickly under H2 (1 atm). The reaction mixture was then stirred at ambient temperature for 48 hours, when analysis by LC-MS showed the reaction was complete. The reaction mixture was filtered and the filtrate was concentrated under reduced pressure to afford the crude product, I-340 (pale oil, 1.35 g, 93% yield). The crude product was used directly in next step. MS (ESI, pos. ion) m/z: 146 (M+1).
- A solution of 4-(2-hydroxyethyl)morpholin-3-one, I-340 (1.37 g, 9.45 mmol), phthalimide (cas: 85-41-6, 1.53 g, 1.1 equiv.) and PPh3(3.72 g, 1.5 equiv.) in anhydrous THF (30 mL) was stirred at 0° C. for 0.5 hours. Then DIAD (5.73 g, 3.0 equiv.) was added and the reaction mixture was allowed to warm to ambient temperature and stirred for 7 hours. The reaction mixture was concentrated and the residue obtained was purified by silica gel chromatography (Petroleum ether:EtOAc=1:5) to provide I-341 as a pale oil (2.5 g, 50% purity, 50% yield). MS (ESI, pos. ion) m/z: 275 (M+1).
- A solution of 2-(2-(3-oxomorpholino)ethyl)isoindoline-1,3-dione, I-341 (1.25 g, 4.56 mmol) in MeOH (10 mL) was added hydrazine hydrate (80% aqueous solution, 0.291 g, 1.5 equiv.). The reaction mixture was stirred for 12 hours at ambient temperature, then filtered and the filtrate was then concentrated to give the crude product, I-342 (1 g), which was taken forward to the next step without further purification. MS (ESI, pos. ion) m/z: 145 (M+1).
- A solution of 4-(2-aminoethyl)morpholin-3-one, I-342 (1 g, 6.94 mmol) and thiodiglycolic anhydride (cas: 3261-87-8, 1.09 g, 1.2 equiv.) in 10 mL of DCM was stirred for 2 hours, and then concentrated under reduced pressure to afford a residue, which was purified by preparative HPLC (Mobile Phase:MeCN/H2O (with 0.1% Formic Acid), Gradient:5-15% MeCN) to obtain I-343 (50 mg, 3% yield) as a pale oil. MS (ESI, pos. ion) m/z: 277 (M+1). 1H NMR (400 MHz, DMSO) δ 12.65 (s, 1H), 8.14 (m, 1H), 4.00 (s, 2H), 3.82-3.75 (m, 2H), 3.40-3.34 (m, 6H), 3.24 (m, 2H), 3.18 (s, 2H).
-
- To a solution of thiomorpholin-3-one (cas: 20196-21-8, 1.17 g, 10 mmol) in anhydrous DMF (10 mL) was added sodium hydride (cas: 7646-69-7, 1.20 g, 30 mmol, 3.0 equiv.) in ice bath under N2. After 30 minutes, (2-bromoethoxy)(tert-butyl)dimethylsilane (cas: 86864-60-0, 3.59 g, 1.5 equiv.) was added to the solution at 0° C. The reaction mixture was allowed to warm to ambient temperature and stirred for 5 hours. Once complete, the reaction was quenched with water (5 mL), extracted with EtOAc (3×500 mL). The combined organic extracts were then washed with water (50 mL), brine (50 mL), and dried with Na2SO4, then concentrated under reduced pressure to a residue, which was purified by silica gel chromatography to afford I-344 (1.40 g, 54% yield) as a pale yellow oil. MS (ESI, pos. ion) m/z: 276.1 (M+1).
- To a solution of 4-(2-((tert-butyldimethylsilyl)oxy)ethyl)thiomorpholin-3-one, I-344 (1.40 g, 5.09 mmol) in DCM (15 mL) that had been pre-cooled in an ice-water bath was added HCl in MeOH (30% v/v, 10 mL) under N2. The reaction mixture was stirred for 3 hours. Upon completion of the reaction, the resulting solution was concentrated under reduced pressure to a residue. The residue was purified by silica gel chromatography to afford I-345 (0.71 g, 87% yield) as a pale yellow oil. MS (ESI, pos. ion) m/z: 162.1 (M+1).
- To a solution of 4-(2-hydroxyethyl)thiomorpholin-3-one, I-345 (0.71 g, 4.41 mmol) in anhydrous THF (10 mL) at 0-5° C. was added phthalimide (cas: 85-41-6, 0.72 g, 1.1 equiv.) and PPh3 (1.74 g, 1.5 equiv.) under N2. After 30 minutes, DIAD (2.67 g, 3.0 equiv.) was added. The reaction mixture was allowed to warm to ambient temperature and stirred for 12 hours. Upon completion of the reaction, the reaction mixture was concentrated under reduced pressure to a residue, which was purified by silica gel chromatography to afford imide I-346 (0.90 g, 70% yield, about 50% purity, contaminated with PPh3O) as a white solid. MS (ESI, pos. ion) m/z: 291.1 (M+1).
- To a solution of 2-(2-(3-oxothiomorpholino)ethyl)isoindoline-1,3-dione, I-346 (0.9 g, 1.24 mmol) in MeOH (10 mL) at 0-5° C. was added NH2NH2 (85% in H2O, 0.14 g, 1.2 equiv.). The reaction mixture was allowed to warm to ambient temperature and stirred for 12 hours. Upon completion of the reaction, the reaction mixture was concentrated under reduced pressure. The residue obtained was purified by reversed-phase chromatography to afford the amine I-347 as a pale oil (0.41 g, 82% yield, about 40% purity). MS (ESI, pos. ion) m/z: 162.1 (M+1).
- A solution of 4-(2-aminoethyl)thiomorpholin-3-one, I-347 (0.41 g, 2.56 mmol) and thiodiglycolic anhydride (cas: 3261-87-8, 0.405 g, 3.07 mmol, 1.2 equiv.) in DCM (5 ml) and DMF (2.0 ml) was stirred for 16 hours at 25° C. Upon completion of the reaction, the mixture was concentrated by vacuum to afford a residue, which was purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% TFA), Gradient: 20-30% MeCN) to obtain 22.8 mg (3% yield) of I-348 as a pale oil. MS (ESI, pos. ion) m/z: 293.1 (M+1). 1H NMR (400 MHz, CDCl3): 1H NMR (400 MHz, CDCl3): 7.41 (s, 1H), 3.70 (ddd, 4H), 3.55 (d, 2H), 3.39 (d, 4H), 3.28 (s, 2H), 2.93-2.89 (m, 2H).
- The Synthesis of I-351 Involved 3 Steps from the Previously Described Intermediate I-346 as Depicted in the Following
Scheme 121 - To a solution of 2-(2-(3-oxothiomorpholino)ethyl)isoindoline-1,3-dione, I-346 (2.3 g,
purity 50%, 7.9 mmol) in DCM (10 mL) at 0-5° C. was added m-chloroperbenzoic acid (4.08 g, 3.0 equiv.). The mixture was allowed to warm to ambient temperature and stirred for 12 hours. Upon completion of the reaction, the reaction mixture was washed with saturated aqueous Na2SO3 (10 ml), saturated aqueous NaHCO3(10 ml), brine (10 ml), dried, and concentrated under reduced pressure. The residue was purified by silica gel chromatography to afford sulfone I-349 as a white solid (0.3 g, 23% yield, about 80% purity). MS (ESI, pos. ion) m/z: 323.1 (M+1). - To a solution of 2-(2-(1,1-dioxido-3-oxothiomorpholino)ethyl)isoindoline-1,3-dione, I-349 (0.3 g, 0.93 mmol) in MeOH (10 mL) was added hydrazine (85% solution in H2O, 0.042 g, 1.2 equiv.). The reaction mixture was stirred for 12 hours. Upon completion of the reaction, the reaction mixture was concentrated under reduced pressure to a residue, which was purified by reversed-phase chromatography to afford amine I-350 (0.1 g, 56% yield, about 80% purity) as a pale oil. MS (ESI, pos. ion) m/z: 193.1 (M+1).
- A solution of 4-(2-aminoethyl)thiomorpholin-3-
one 1,1-dioxide, I-350 (0.1 g, 0.52 mmol) and thiodiglycolic anhydride (cas: 3261-87-8, 0.082 g, 0.62 mmol, 1.2 equiv.) in DMF (4 mL) was stirred for 3 hours at 25° C. The reaction mixture was then concentrated under reduced pressure to afford a pale oil. The crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% TFA), Gradient:1-3% MeCN) to afford 63.4 mg (38% yield) of acid I-351 as a pale oil. MS (ESI, pos. ion) m/z: 325.1 (M+1). 1H NMR (400 MHz, D2O) δ 4.19 (s, 1H), 3.87 (dd, 1H), 3.59-3.53 (m, 2H), 3.41-3.37 (m, 1H), 3.32 (s, 2H), 3.25 (s, 2H). -
- To a solution of 3-bromopropan-1-ol (cas: 627-18-9, 600 mg, 4.3 mmol) in 15 mL of THF that had been pre-cooled to 0° C. was added TEA (0.9 mL) and a solution of triphosgene (600 mg, 0.5 equiv.) in 5 mL of THF under N2. The reaction mixture was monitored by LC-MS (the reaction aliquot was treated with BnNH2 prior to analysis). After 30 minutes, the reaction mixture was used directly in next step. MS (ESI, pos. ion) m/z: 272.2 (M+1).
- To the reaction mixture from previous step, was added tert-butyl (2-aminoethyl)carbamate (1 g, 1.5 equiv.) in one portion. The reaction mixture was stirred at 25° C. for 15 hours. Upon completion of the reaction, the reaction was quenched with water (50 mL), and extracted with EtOAc (3×50 mL). The combined organic extracts were concentrated to a residue, which was purified by silica gel chromatography (Petroleum ether:EtOAc=1:1) to afford 1.2 g (86% yield, 2 steps) of carbamate I-353 as a white solid. MS (ESI, pos. ion) m/z: 347.2 (M+23).
- A solution of 3-bromopropyl tert-butyl ethane-1,2-diyldicarbamate, I-353(1.1 g, 3.4 mmol), NaH (360 mg, 2.5 equiv., 60% dispersion in mineral oil), NaI (350 mg, 1 equiv.) in DMF (60 mL) was heated to 80° C. for 2 hours. On completion, the reaction mixture was quenched with water (30 mL) and extracted with EtOAc (3×30 mL). The combined organic extracts were concentrated to a residue, which was purified by silica gel chromatography (EtOAc), to afford oxazinone I-354 (100 mg, 12%) as a pale oil. MS (ESI, pos. ion) m/z: 267.2 (M+23).
- A solution of tert-butyl (2-(2-oxo-1,3-oxazinan-3-yl)ethyl)carbamate (100 mg, 0.4 mmol) in HCl (2 M in EtOAc, 3 mL) was stirred at 25° C. for 2 hours. Upon completion of the reaction, the reaction mixture was concentrated and purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% TFA) to afford amine I-355 (30 mg, 50% yield) as a pale oil. MS (ESI, pos. ion) m/z: 145.2 (M+1).
- To a stirred solution of 3-(2-aminoethyl)-1,3-oxazinan-2-one, I-355 (30 mg, 0.2 mmol) in DCM (2 mL), was added thiodiglycolic anhydride (cas:3261-87-8, 27 mg, 1 equiv.), TEA (4 drops) at 25° C. The reaction mixture was stirred for 2 hours, and then concentrated and purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% TFA), gradient:2-8% MeCN) to afford acid I-356 (15 mg, 27%) as a pale oil. MS (ESI, pos. ion) m/z: 277.2 (M+1). 1H NMR (400 MHz, CDCl3) δ 7.38 (s, 1H), 4.33-4.28 (m, 2H), 3.63-3.58 (m, 2H), 3.57-3.52 (m, 2H), 3.45 (t, 2H), 3.37 (s, 2H), 3.27 (s, 2H), 2.11-2.07 (m, 2H).
-
- 2-((3-aminopropyl)amino)ethan-1-ol (5.9 g, 50 mmol, cas #:4461-39-6) and urea (4.5 g, 1.5 equiv., cas #: 57-13-6) in a sealed tube was heated at 130° C. for 10 hours. After reaction completion, the residue was purified by silica gel column chromatography (20% MeOH in dichloromethane) to afford alcohol I-357 (1 g, 14% yield) as a white solid. MS (ESI, pos. ion) m/z: 145.1 (M+1).
- To a solution of 1-(2-hydroxyethyl)tetrahydropyrimidin-2(1H)-one, I-357 (2.6 g, 18 mmol), DMAP (220 mg, 0.1 equiv.) and imidazole (2.5 g, 2.0 equiv.) in 30 mL of DCM was added TBSCl (2.7 g, 1.0 equiv.). The reaction mixture was stirred at ambient temperature for 16 hours, then diluted with 50 mL of water and extracted with DCM (30 mL×3). The combined organic extracts were dried over Na2SO4 and concentrated in vacuo to afford 3.1 g (67% yield) of silyl ether I-358 as a pale oil. MS (ESI, pos. ion) m/z: 259.1 (M+1).
- To a solution of 1-(2-((tert-butyldimethylsilyl)oxy)ethyl)tetrahydropyrimidin-2(1H)-one, I-358 (2.1 g, 8 mmol) and NaH (960 mg, 5.0 equiv.) in THE (30 mL) at 0° C. was added Mel (3.4 g, 3.0 equiv.). The reaction mixture was stirred at ambient temperature for 1 hour, then the solvent was removed in vacuo, and the residue obtained was purified by column chromatography (DCM) to afford silyl ether I-359 (1.1 g, 50% yield) as a white solid. MS (ESI, pos. ion) m/z: 273.1 (M+1).
- To a solution of 1-(2-((tert-butyldimethylsilyl)oxy)ethyl)-3-methyltetrahydropyrimidin-2(1H)-one, I-359 (1.1 g, 4 mmol) in MeOH (10 mL) at 0-5° C. was added HCl in MeOH (30% v/v, 10 mL) under N2. The reaction mixture was stirred for 0.5 hours, then concentrated under reduced pressure to afford alcohol I-360 (600 mg, 95% yield) as a pale oil, which was used directly for next step. MS (ESI, pos. ion) m/z: 159.1 (M+1).
- To a solution of 1-(2-((tert-butyldimethylsilyl)oxy)ethyl)-3-methyltetrahydropyrimidin-2(1H)-one, I-360 (600 mg, 3.8 mmol) in THE (20 mL) at 0-5° C. was added phthalimide (cas: 85-41-6, 592 mg, 1.05 equiv.), PPh3 (1.5 g, 1.5 equiv) under N2. After 30 minutes, DIAD (2.3 g, 3.0 equiv.) was added and the reaction mixture was allowed to warm to ambient temperature and stirred for 6 hours. The reaction was then quenched with water (5 mL), and extracted with DCM (3×20 mL). The combined organic extracts were washed with water (20 mL), brine (20 mL), and dried with Na2SO4, then concentrated under reduced pressure. The residue obtained was purified by column chromatography (50% EtOAc in Petroleum Ether) to afford phthalimide I-361 (280 mg, 26% yield) as a yellow solid. MS (ESI, pos. ion) m/z: 288.1 (M+1).
- To a solution of 2-(2-(3-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)isoindoline-1,3-dione, I-361 (280 mg, 0.98 mmol) in MeOH (5 mL) at 0-5° C. was added NH2NH2 (85% solution in H2O, 200 mg, 5.6 equiv.). The reaction mixture was allowed to warm to ambient temperature and stirred for 12 hours. The slurry was then filtered, and the filtrate was concentrated to afford the crude amine I-362 (0.2 g) as a pale oil, which was taken forward to the next step. MS (ESI, pos. ion) m/z: 158.1 (M+1).
- A solution of 1-(2-aminoethyl)-3-methyltetrahydropyrimidin-2(1H)-one, I-362 (200 mg, 1.27 mmol) and thiodiglycolic anhydride (cas: 3261-87-8, 300 mg, 1.8 equiv.) in 5 mL DCM was stirred for 2 hours, and then concentrated in vacuo to afford the crude product as a pale oil. Purification by preparative HPLC (Mobile Phase: MeCN/H2O (with 0.1% Formic Acid) Gradient:5-15% MeCN) afforded I-363 (50 mg, 14% yield) as a white solid. MS (ESI, pos. ion) m/z: 290.1 (M+1). 1H NMR (400 MHz, CDCl3) δ 7.47 (s, 1H), 3.59-3.56 (m, 2H), 3.5-3.42 (m, 2H), 3.36 (s, 2H), 3.36-3.31 (m, 2H), 3.31-3.26 (m, 2H), 3.20 (s, 2H), 2.94 (s, 3H), 2.01-1.96 (m, 2H).
- The Synthesis of I-366 Involved 3 Steps from Previously Described Intermediate I-357 as Depicted in the Following
Scheme 124 - To a solution of 1-(2-hydroxyethyl)tetrahydropyrimidin-2(1H)-one, I-357 (1 g, 6.9 mmol) in THE (30 mL) at 0-5° C. was added phthalimide (cas: 85-41-6, 1 g, 1.05 equiv.) and PPh3 (2.7 g, 1.5 equiv.). After 30 minutes, DIAD (4.2 g, 3.0 equiv.) was added and the reaction mixture was allowed to warm to ambient temperature and stirred for 6 hours. The reaction was then quenched with water (5 mL), extracted with DCM (3×20 mL). The combined organic extracts were washed with water (20 mL), brine (20 mL), and dried with Na2SO4, then concentrated under reduced pressure. The residue obtained was purified by silica gel column chromatography (50% EtOAc in Petroleum Ether) to afford 800 mg (43% yield) of phthalimide I-364 as a yellow solid. MS (ESI, pos. ion) m/z: 274.1 (M+1).
- To a solution of 2-(2-(2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)isoindoline-1,3-dione, I-364 (0.2 g, 0.7 mmol) in MeOH (5 mL) at 0-5° C. was added NH2NH2 (85% in H2O, 200 mg, 5.5 mmol). The reaction mixture was allowed to warm to ambient temperature and stirred for 7 hours, then filtered, and the filtrate was concentrated to afford crude amine I-365 (0.12 g) as a pale oil. The crude product was used directly for the next step. MS (ESI, pos. ion) m/z: 145.1 (M+1).
- A solution of 1-(2-aminoethyl)-3-methylpyrrolidin-2-one, I-365 (120 mg, 0.83 mmol) and thiodiglycolic anhydride (cas: 3261-87-8, 167 mg, 1.5 equiv.) in 5 mL of DCM was stirred for 2 hours, and then concentrated in vacuo to give the crude product as a pale oil. The crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% TFA), gradient:5-15% MeCN) to afford 80 mg (35% yield) of I-366 as a white solid. MS (ESI, pos. ion) m/z: 276.2 (M+1). 1H NMR (400 MHz, CDCl3) δ 7.54 (s, 1H), 6.71 (s, 1H), 3.59-3.52 (m, 2H), 3.51 (d, J=5.1 Hz, 2H), 3.42-3.36 (m, 3H), 3.34-3.29 (m, 3H), 1.99 (s, 2H), 1.25 (s, 2H).
-
- The chemical structure of the target compound was confirmed by 1H NMR and LC-MS with the purity >95% (
HPLC 214 & 254 nm). - To a solution of (R)-3-((tert-butyldimethylsilyl)oxy)pyrrolidin-2-one, I-251 (8 g, 37.2 mmol) in anhydrous DMF (80 mL) at 0-5° C. was added NaH (60% dispersion in mineral oil, 3.72 g, 2.5 equiv.) under N2. The reaction mixture was stirred for 30 minutes at 0-5° C. and ((2-bromoethoxy)methyl)benzene (cas: 1462-37-9, 11.9 g, 1.5 equiv.) was added. The reaction mixture was allowed to warm to ambient temperature. After 12 hours, LC-MS indicated that the reaction was complete. H2O (20 mL) was added and the reaction mixture was extracted with EtOAc (20 mL×3). The combined organic extracts were concentrated under reduced pressure and the crude product was purified by silica gel chromatography (Petroleum ether:EtOAc=1:1) to provide I-367 (5 g, 39% yield) as a pale oil. MS (ESI, pos. ion) m/z: 350 (M+1).
- To a solution of (R)-1-(2-(benzyloxy)ethyl)-3-((tert-butyldimethylsilyl)oxy)pyrrolidin-2-one, I-367 (5 g, 14.32 mmol) was added HCl in MeOH (30% v/v, 30 mL) and the reaction mixture was stirred at 0-5° C. for 0.5 hours. Once LC-MS analysis indicated reaction completion, the reaction mixture was concentrated and the crude product was purified by silica gel chromatography (Petroleum ether:EtOAc=1:10) to afford I-368 (2.36 g, 70% yield) as a pale oil. MS (ESI, pos. ion) m/z: 236 (M+1).
- To a solution of (R)-1-(2-(benzyloxy)ethyl)-3-hydroxypyrrolidin-2-one, I-368 (2.36 g, 10.0 mmol) in anhydrous MeCN (30 ml) at 0-5° C. was added Ag2O (4.65 g, 2.0 equiv.) under N2. The reaction mixture was then stirred for 5 minutes and CH3I (1.28 g, 0.9 equiv.) was added. The reaction mixture was allowed to warm to ambient temperature and stirred for 10 hours. When LC-MS analysis indicated that the reaction was complete, the reaction mixture was filtered and the filtrate was concentrated under reduced pressure to afford the crude product, which was purified by silica gel chromatography (Petroleum ether:EtOAc=1:1) to provide I-369 (1.7 g, 68%) as a pale oil. MS (ESI, pos. ion) m/z: 250 (M+1).
- To a solution of (R)-1-(2-(benzyloxy)ethyl)-3-methoxypyrrolidin-2-one, I-369 (1.7 g, 6.82 mmol) in MeOH (10 mL) was added Pd/C (170 mg) quickly under H2 (1 atm). The reaction mixture was then stirred at ambient temperature for 48 hours. When LC-MS analysis indicated that the reaction was complete, the reaction mixture was filtered, and the filtrate was concentrated under reduced pressure to a residue. The crude product was purified by silica gel chromatography (Petroleum ether:EtOAc=1:10) to provide I-370 (0.15 g, 14% yield) as a pale oil. MS (ESI, pos. ion) m/z: 160 (M+1).
- A solution of (R)-1-(2-hydroxyethyl)-3-methoxypyrrolidin-2-one, I-370 (0.15 g, 0.94 mmol), phthalimide (cas: 85-41-6, 0.148 g, 1.1 equiv.) and PPh3(0.369 g, 1.5 equiv.) in anhydrous THF (3 mL) was stirred at 0-5° C. for 0.5 hours. Then DIAD (0.569 g, 3.0 equiv.) was added and the reaction mixture was allowed to warm to ambient temperature and stirred for 7 hours. The reaction mixture was then concentrated to afford the crude product, which was purified by silica gel chromatography (Petroleum ether:EtOAc=1:10) to provide I-371 (0.5 g, 50% purity, 50% yield) as a pale oil. MS (ESI, pos. ion) m/z: 275 (M+1).
- To a solution of (R)-2-(2-(3-methoxy-2-oxopyrrolidin-1-yl)ethyl)isoindoline-1,3-dione, I-371 (0.5 g, 1.74 mmol) in MeOH (5 mL) was added hydrazine hydrate (80% solution, 0.130 g, 1.5 equiv.). The reaction mixture was stirred for 12 hours at ambient temperature, then filtered. The filtrate was concentrated and the crude product, I-372 (0.5 g) was used directly in the next step. MS (ESI, pos. ion) m/z: 159 (M+1).
- To a solution of (R)-1-(2-aminoethyl)-3-methoxypyrrolidin-2-one, I-372 (0.5 g, 3.3 mmol) and thiodiglycolic anhydride (cas: 3261-87-8, 0.653 g, 1.5 equiv.) in 5 mL of DCM was added TEA (0.066 g, 0.2 equiv.). The reaction mixture was stirred for 2 hours, and then concentrated under reduced pressure to give the crude product, which was purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% TFA), Gradient:5-15% MeCN) to afford I-373 (50 mg, 5% yield) as a pale oil. MS (ESI, pos. ion) m/z: 291.1 (M+1). 1H NMR (400 MHz, DMSO) δ 12.68 (s, 1H), 8.10 (s, 1H), 3.88 (s, 1H), 3.38 (s, 3H), 3.35 (s, 2H), 3.33-3.26 (m, 3H), 3.19 (m, 5H), 2.32-2.20 (m, 1H), 1.76 (m, 1H).
-
- The synthetic route for I-380 is similar to that of I-373 and commenced with (S)-3-hydroxypyrrolidin-2-one (cas: 34368-52-0). Carboxylic acid I-380 (pale oil, 50 mg, 3% yield) was isolated by preparative HPLC (Mobile Phase:MeCN/H2O (with 0.1% TFA), Gradient:5-15% MeCN). MS (ESI, pos. ion) m/z: 291.1 (M+1). 1H NMR (400 MHz, DMSO) δ 8.11 (s, 1H), 3.89 (m, 1H), 3.38 (s, 3H), 3.35 (s, 2H), 3.33-3.25 (m, 3H), 3.25-3.14 (m, 5H), 2.31-2.21 (m, 1H), 1.82-1.70 (m, 1H).
- The Synthesis of I-386 Involved 6 Steps from Previously Described Intermediate I-259 as Depicted in the Following
Scheme 127 - To a solution of methyl (S)-2-(4-((tert-butyldimethylsilyl)oxy)-2-oxopyrrolidin-1-yl)acetate, I-259 (2.1 g, 7.32 mmol) in MeOH (15 mL) at 0-5° C. was added HCl in EtOAc (2 M, 15 mL) under N2. The reaction mixture was allowed to warm to ambient temperature and stirred for 4 hours. After reaction completion, ammonium hydroxide (ca. 0.2 mL) was added to adjust the pH to 7, and then the reaction mixture was concentrated under reduced pressure. The residue obtained was purified by silica gel chromatography to afford ester I-381 (1.3 g, 102% yield) as a pale oil. MS (ESI, pos. ion) m/z: 174.1 (M+1).
- To a solution of methyl (S)-2-(4-hydroxy-2-oxopyrrolidin-1-yl)acetate, I-381 (1.3 g, 7.51 mmol) in acetonitrile (15 ml) at 0-5° C. was added silver oxide (cas:260667-12-3, 2.62 g, 1.5 equiv.) and iodomethane (0.96 g, 0.9 equiv.) under N2. The reaction mixture was allowed to warm to ambient temperature and stirred for 12 hours. Upon completion of the reaction, the reaction mixture was filtered through celite. The filtrate was concentrated under reduced pressure and the residue obtained was purified by silica gel chromatography to afford ester I-382 (0.48 g, 35% yield) as a pale oil. MS (ESI, pos. ion) m/z: 184.1 (M+1).
- To a solution of methyl (S)-2-(4-methoxy-2-oxopyrrolidin-1-yl)acetate, I-382 (0.25 g, 1.50 mmol) in t-BuOH (10 mL) was added sodium borohydride (0.228 g, 4.0 equiv.) in MeOH (0.5 mL) under N2. The reaction mixture was stirred for 0.5 hours at 85° C. Upon completion of the reaction, the reaction mixture was concentrated under reduced pressure. The residue afforded was quenched with water (2 mL), and extracted with DCM (3×20 mL). The combined organic extracts were then washed with water (20 mL), brine (20 mL), and dried with Na2SO4, then concentrated and the residue obtained was purified by silica gel chromatography to afford alcohol I-383 (0.11 g, 46% yield) as a pale oil. MS (ESI, pos. ion) m/z: 160.1 (M+1).
- To a solution of (S)-1-(2-hydroxyethyl)-4-methoxypyrrolidin-2-one, I-383 (0.31 g, 1.95 mmol) in THE (5 mL) was added phthalimide (0.32 g, 1.1 equiv.), and PPh3 (0.77 g, 1.5 equiv.). The reaction mixture was stirred for 0.5 h at 05° C. under N2 and DIAD (1.18 g, 3.0 equiv.) was added. The reaction mixture was allowed to warm to ambient temperature and stirred at ambient temperature for 12 hours, then concentrated under reduced pressure. The residue obtained was purified by silica gel chromatography to afford phthalimide I-384 as a yellow oil (0.40 g, 71% yield). MS (ESI, pos. ion) m/z: 289.1 (M+1).
- To a solution of (S)-2-(2-(4-methoxy-2-oxopyrrolidin-1-yl)ethyl)isoindoline-1,3-dione, I-384 (0.40 g, 1.39 mmol) in MeOH (10 mL) at 0-5° C. was added hydrazine (85% in H2O, 0.06 g, 1.2 equiv.). The reaction mixture was allowed to warm to ambient temperature and stirred for 12 hours, then concentrated under reduced pressure. DCM (10 ml) was added to the residue and the slurry was filtered. The filtrate was concentrated to afford the crude amine I-385 as a pale oil, 0.18 g, 82% yield), which was used directly in the next step. MS (ESI, pos. ion) m/z: 159.1 (M+1).
- A solution of (S)-1-(2-aminoethyl)-4-methoxypyrrolidin-2-one, I-385 (0.18 g, 1.13 mmol) and thiodiglycolic anhydride (0.19 g, 1.3 equiv.) in DMF (5 mL) was stirred for 2 hours at 25° C., then concentrated under reduced pressure to give the crude product as a pale oil. The crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% TFA), Gradient:1-3% MeCN) to afford 137 mg (42% yield) of I-386 as a pale oil. MS (ESI, pos. ion) m/z: 291.1 (M+1). 1H NMR (400 MHz, CDCl3) δ 7.56 (s, 1H), 4.06 (t, 1H), 3.82 (dd, 1H), 3.68-3.59 (m, 2H), 3.46-3.36 (m, 5H), 3.32 (s, 3H), 3.27 (s, 2H), 2.72 (dd, 6.7 Hz, 1H), 2.53 (dd, 1.6 Hz, 1H).
- The Synthesis of I-392 Involved 6 Steps from Previously Described Intermediate I-252 as Depicted in the Following
Scheme 128 - To a solution of methyl (R)-2-(4-((tert-butyldimethylsilyl)oxy)-2-oxopyrrolidin-1-yl)acetate, I-252 (3.7 g, 12.89 mmol) in MeOH (20 mL) at 0-5° C. was added HCl in EtOAc (2 M, 20 mL) under N2. The reaction mixture was stirred for 4 hours. Upon completion of the reaction, ammonium hydroxide (about 0.4 ml) was added to adjust
pH 7, and then the reaction mixture was concentrated under reduced pressure. The residue obtained was purified by silica gel chromatography to afford alcohol I-387 as a pale oil (2.1 g, 94% yield). MS (ESI, pos. ion) m/z: 174.1 (M+1). - To a solution of methyl (R)-2-(4-hydroxy-2-oxopyrrolidin-1-yl)acetate, I-387 (2.1 g, 12.14 mmol) in acetonitrile (20 ml) at 0-5° C. was added silver oxide (4.22 g, 1.5 equiv.) and iodomethane (1.55 g, 0.9 equiv.) under N2. The reaction mixture was allowed to warm to ambient temperature and stirred for 12 hours, then filtered through celite. The filtrate was concentrated under reduced pressure. The residue obtained was purified by silica gel chromatography to afford ester I-388 as a pale oil (0.83 g, 37% yield). MS (ESI, pos. ion) m/z: 184.1 (M+1).
- To a solution of methyl (R)-2-(4-methoxy-2-oxopyrrolidin-1-yl)acetate, I-388 (1.2 g, 6.42 mmol) in t-BuOH (10 mL) was added sodium borohydride (0.73 g, 3.0 equiv.) under N2. The reaction mixture was stirred for 0.5 hours at 80° C., then cooled and concentrated under reduced pressure. The residue was quenched with water (2 mL) and extracted with DCM (3×20 mL). The combined organic extracts were then washed with water (20 mL), brine (20 mL), and dried with Na2SO4, then concentrated and the residue obtained was purified by silica gel chromatography to afford alcohol I-389 as a pale oil (0.52 g, 51% yield). MS (ESI, pos. ion) m/z: 160.1 (M+1).
- To a solution of (R)-1-(2-hydroxyethyl)-4-methoxypyrrolidin-2-one, I-389 (0.58 g, 3.64 mmol) in THE (6 mL) was added phthalimide (0.59 g, 1.1 equiv.) and PPh3 (1.43 g, 1.5 equiv.). The reaction mixture was stirred for 0.5 hours in an ice-water bath under N2. Then DIAD (2.21 g, 3.0 equiv.) was added and the reaction mixture was allowed to warm to ambient temperature and stirred for 12 hours, then concentrated under reduced pressure. The residue obtained was purified by silica gel chromatography to afford phthalimide I-390 as a yellow oil (0.45 g, 43% yield). MS (ESI, pos. ion) m/z: 289.1 (M+1).
- To a solution of (S)-2-(2-(4-methoxy-2-oxopyrrolidin-1-yl)ethyl)isoindoline-1,3-dione, I-390 (0.45 g, 1.56 mmol) in MeOH (10 mL) at 0-5° C. was added hydrazine (85% in H2O, 0.07 g, 1.87 mmol, 1.2 equiv.). The reaction mixture was allowed to warm to ambient temperature and stirred for 12 hours, then concentrated. The residue was diluted in DCM (10 mL) and the slurry was filtered. The filtrate was concentrated to afford the crude amine I-391 as a pale oil (0.21 g, 85% yield, 85% purity), which was used directly in the next step. MS (ESI, pos. ion) m/z: 159.1 (M+1).
- A solution of (R)-1-(2-aminoethyl)-4-methoxypyrrolidin-2-one, I-391 (0.21 g, 1.33 mmol) and thiodiglycolic anhydride (0.23 g, 1.3 equiv.) in DMF (5 mL) was stirred for 2 hours at 25° C., then the reaction mixture was concentrated under reduced pressure and the crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% TFA), Gradient: 1-3% MeCN) to give 117.5 mg (41% yield) of acid I-392 as a pale oil. MS (ESI, pos. ion) m/z: 291.1 (M+1). 1H NMR (400 MHz, CDCl3) δ 7.52 (s, 1H), 4.04 (t, 1H), 3.78 (dd, 1H), 3.63-3.55 (m, 2H), 3.42-3.32 (m, 5H), 3.30 (s, 3H), 3.27 (s, 2H), 2.67 (dd, 1H), 2.47 (dd, 1H).
-
- The chemical structure of the target compound was confirmed by 1H NMR and LC-MS with the purity >95% (
HPLC 214 & 254 nm). - A solution of 2-ethylsuccinic acid (cas: 636-48-6, 0.2 g, 1.37 mmol) and tert-butyl (2-aminoethyl)carbamate (0.26 g, 1.2 equiv.) in 5 mL of PhCH3 was heated to reflux for 7 hours. After LC-MS analysis indicated that the reaction was complete, the reaction mixture was concentrated under reduced pressure to give the crude product, which was purified by preparative TLC (EtOAc:Petroleum ether=2:1) to afford imide I-393 (0.15 g, 41% yield) a pale oil. MS (ESI, pos. ion) m/z: 293 (M+Na).
- A solution of tert-butyl (2-(3-ethyl-2,5-dioxopyrrolidin-1-yl)ethyl)carbamate, I-393 (250 mg, 0.93 mmol) in TFA/DCM (1:3 v/v, 8 mL) was stirred at 25° C. for 1 hour. When LC-MS analysis indicated that the reaction was complete, the reaction mixture was concentrated under reduced pressure to give 1-(2-aminoethyl)-3-ethylpyrrolidine-2,5-dione, I-394 (500 mg) as a pale oil, which was used directly for next step. MS (ESI, pos. ion) m/z: 171 (M+1).
- To a solution of (S)-1-(2-aminoethyl)-3-hydroxypyrrolidine-2,5-dione, I-394 (500 mg, 1.77 mmol) and thiodiglycolic anhydride (257 mg, 1.1 equiv.) in 5 mL DCM was added TEA (257 mg, 1.1 equiv.). The reaction mixture was stirred for 2 hours and was concentrated in vacuo to give the crude product. The crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% formic acid)) to afford the racemic carboxylic acid I-395 as a pale oil (220 mg, 41% yield). MS (ESI, pos. ion) m/z: 303.1 (M+1).
- (S*)-I-395 (pale oil, 80 mg, 36% yield) was isolated by chiral separation (Superchiral S-AD (Chiralway), 2 cm I.D.*25 cm Length, 5 um, CO2/EtOH=70/30 (v/v)) from racemic acid I-395. MS (ESI, pos. ion) m/z: 303.1 (M+1). 1H NMR (400 MHz, CDCl3) δ 7.22 (s, 1H), 3.74-3.61 (m, 2H), 3.58-3.45 (m, 2H), 3.33 (m, 4H), 2.93-2.72 (m, 2H), 2.40 (m, 1H), 1.99-1.86 (m, 1H), 1.65-1.53 (m, 1H), 0.99 (m, 3H).
- (R*)-I-395 (pale oil, 80 mg, 36% yield) is isolated by chiral separation (Superchiral S-AD (Chiralway), 2 cm I.D.*25 cm Length, 5 um, CO2/EtOH=70/30 (v/v)) from racemic acid I-395. MS (ESI, pos. ion) m/z: 303.1 (M+1). 1H NMR (400 MHz, CDCl3) δ 7.48 (s, 1H), 3.66 (m, 2H), 3.47 (m, 2H), 3.31 (s, 4H), 2.94-2.67 (m, 2H), 2.37 (m, 1H), 1.88 (m, 1H), 1.56 (m, 1H), 0.95 (m 3H).
-
- A solution of (S)-2-hydroxysuccinic acid (cas: 97-67-6, 2 g, 14.9 mmol) and tert-butyl (2-aminoethyl)carbamate (2.88 g, 1.2 equiv.) in 10 mL of toluene was heated to reflux for 7 hours. When LC-MS analysis indicated that the reaction was complete, the reaction mixture was concentrated under reduced pressure to give the crude product, which was purified by silica gel chromatography (EtOAc:Petroleum ether=2:1) to afford 1.9 g (49% yield) of intermediate tert-butyl (S)-(2-(3-hydroxy-2,5-dioxopyrrolidin-1-yl)ethyl)carbamate I-396 as a pale oil. MS (ESI, pos. ion) m/z: 281 (M+Na).
- A solution of tert-butyl (S)-(2-(3-hydroxy-2,5-dioxopyrrolidin-1-yl)ethyl)carbamate, I-396 (300 mg, 1.06 mmol) in TFA/DCM (1:3 v/v, 8 mL) was stirred at 25° C. for 1 hour. When LC-MS analysis indicated that the reaction was complete, the reaction mixture was concentrated under reduced pressure to afford (S)-1-(2-aminoethyl)-3-hydroxypyrrolidine-2,5-dione, I-397 (400 mg) as a pale oil, which was used directly for next step. MS (ESI, pos. ion) m/z: 159 (M+1).
- A solution of (S)-1-(2-aminoethyl)-3-hydroxypyrrolidine-2,5-dione, I-397 (200 mg, 1.3 mmol) and thiodiglycolic anhydride (167 mg, 1.3 mmol) in 5 mL of DCM was added TEA (157 mg, 1.2 equiv.). The reaction mixture was stirred for 2 hours, then concentrated under reduced pressure to give the crude product. The crude product was purified by preparative HPLC to give the carboxylic acid I-398 (83 mg, 22% yield) as a pale oil. MS (ESI, pos. ion) m/z: 291.2 (M+1). 1H NMR (400 MHz, DMSO-d6): δ 8.16-8.13 (m, 1H), 4.48-4.45 (m, 1H), 3.45-3.42 (m, 2H), 3.35 (s, 2H), 3.26-3.17 (m, 2H), 3.14 (s, 2H), 2.98-2.91 (m, 1H), 2.55 (s, 1H), 2.44-2.39 (m, 1H).
- I-399 was prepared from (2R)-malic acid as a pale oil in 79% yield. MS (ESI, pos. ion) m/z: 291.2 (M+1). 1H NMR (400 MHz, DMSO-d6): δ 8.15-8.12 (m, 1H), 4.47-4.44 (m, 1H), 3.45-3.42 (m, 2H), 3.34 (s, 2H), 3.26-3.16 (m, 2H), 3.14 (s, 2H), 2.97-2.91 (m, 1H), 2.54 (s, 1H), 2.44-2.36 (m, 1H).
-
- The synthetic route for I-404 was similar to that of I-398 and commenced with (±)-(2R*,3R*)-2,3-dimethylsuccinic acid, (±)-I-400 (cas: 13545-04-5). I-404 (pale oil, 30 mg, 15% yield) was isolated by chiral separation (Superchiral S-AD (Chiralway), 2 cm I.D.* 25 cm Length, 5 um, Hexane/EtOH=60/40 (v/v)) from racemic acid I-403. MS (ESI, pos. ion) m/z: 303.1 (M+1). 1H NMR (400 MHz, CDCl3): δ 7.34 (s, 1H), 5.6 (s, 1H), 3.67 (m, 2H), 3.5 (s, 2H), 3.31 (m, 4H), 2.4 (m, 2H), 1.3 (m, 6H).
-
- To a solution of 3-methylpyrrolidin-2-one (cas: 2555-05-7, 0.3 g, 3 mmol) in THE (10 mL) at 0-5° C. was added NaH (0.242 g, 2 equiv.) under N2. The reaction mixture was stirred for 0.5 hours, then (2-bromoethoxy)(tert-butyl)dimethylsilane (cas: 86864-60-0, 0.86 g, 1.2 equiv.) was added. The reaction mixture was allowed to warm to ambient temperature and stirred for 5 hours. The reaction was then quenched with water (5 mL), and extracted with DCM (3×20 mL). The combined organic extracts were then washed with water (20 mL), brine (20 mL), dried with Na2SO4 and concentrated under reduced pressure. The residue obtained was purified by silica gel chromatography to afford I-405 (0.25 g, 32% yield) as a pale oil. MS (ESI, pos. ion) m/z: 258 (M+1).
- To a solution of 1-(2-((tert-butyldimethylsilyl)oxy)ethyl)-3-methylpyrrolidin-2-one, I-405 (0.3 g, 3 mmol) in MeOH (10 mL) at 0-5° C. was added HCl in MeOH (30%, 3 mL) under N2. The mixture was stirred for 0.5 hours. The reaction mixture was then concentrated under reduced pressure to afford the crude alcohol I-406 as a pale oil (0.25 g), which was used directly in the next step. MS (ESI, pos. ion) m/z: 144 (M+1).
- To a solution of 1-(2-hydroxyethyl)-3-methylpyrrolidin-2-one, I-406 (0.25 g, 1.75 mmol) in THE (5 mL) was added phthalimide (cas: 85-41-6, 0.25 g, 1.5 equiv.) and PPh3 (0.68 g, 1.5 equiv.). The reaction mixture was cooled to 0-5° C. and DIAD (1.059 g, 3.0 equiv.) was added. The reaction mixture was allowed to warm to ambient temperature and stirred for 6 hours, then quenched with water (5 mL), and extracted with DCM (3×20 mL). The combined organic extracts were then washed with water (20 mL), brine (20 mL), dried with Na2SO4 and concentrated under reduced pressure to afford the crude product, I-407 (purity: 67%, 0.3 g, 48% yield), which was taken to the next step without further purification. MS (ESI, pos. ion) m/z: 273 (M+1).
- To a solution of 2-(2-(3-methyl-2-oxopyrrolidin-1-yl)ethyl)isoindoline-1,3-dione, I-407 (0.3 g, 3 mmol) in MeOH (10 mL) at 0-5° C. was added NH2NH2 (85% in H2O, 1.03 mL, 1.2 equiv.). The reaction mixture was allowed to warm to ambient temperature, stirred for 7 hours, and then filtered. The filtrate was concentrated to afford a pale oil. The crude product, I-408 (0.35 g) was used directly in the next step. MS (ESI, pos. ion) m/z: 143 (M+1).
- To a solution of 1-(2-aminoethyl)-3-methylpyrrolidin-2-one, I-408 (350 mg, 1.3 mmol) and thiodiglycolic anhydride (167 mg, 1.0 equiv.) in 5 mL of DCM was added TEA (157 mg, 1.56 mmol). The reaction mixture was stirred for 2 hours and was concentrated in vacuo to give the crude acid, which was purified by preparative HPLC to afford racemic acid I-409. (R*)-I-409 (30 mg, 5%, absolute configuration not known) was isolated by chiral separation (CHIRALPAK AD-H column, Mobile phase:Hexane/EtOH/AcOH=80/20/0.1 (v/v/v)) from racemic I-409. MS (ESI, pos. ion) m/z: 275.2 (M+1). 1H NMR (400 MHz, CDCl3): δ 7.38 (s, 1H), 3.5 (m, 6H), 3.4 (s, 2H), 3.2 (s, 2H), 2.6 (m, 1H), 2.3 (m, 1H), 1.6 (m, 1H), 1.1 (m, 3H).
- Isolated as a pale oil in 5% yield by chiral separation (CHIRALPAK AD-H column, Mobile phase:Hexane/EtOH/HOAc=80/20/0.1 (v/v/v)) from racemic I-409. The absolute configuration at the stereocenter was not established. MS (ESI, pos. ion) m/z: 275.2 (M+1). 1H NMR (400 MHz, CDCl3): δ 7.4 (s, 1H), 3.5 (m, 6H), 3.4 (s, 2H), 3.2 (s, 2H), 2.58 (m, 1H), 2.28 (m, 1H), 1.7 (m, 1H), 1.1 (m, 3H).
-
- A solution of 3,4-dimethylfuran-2,5-dione (cas: 766-39-2, 600 mg, 4.76 mmol) and tert-butyl (2-aminoethyl)carbamate (cas: 57260-73-8, 1.1 g, 1.5 equiv.) in toluene (30 mL) was heated to reflux for 2 hours. The reaction mixture was then concentrated and purified by silica gel chromatography (Hexane:EtOAc=5:1) to afford tert-butyl (2-(3,4-dimethyl-2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)ethyl)carbamate, I-410 as a yellow solid (700 mg, 55%). MS (ESI, pos. ion) m/z: 291.1 (M+23).
- To a solution tert-butyl (2-(3,4-dimethyl-2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)ethyl)carbamate (700 mg, 2.61 mmol) in DCM (10 mL) was added TFA (2 mL). The reaction mixture was stirred at ambient temperature for 1 hour, then concentrated to afford the crude 1-(2-aminoethyl)-3,4-dimethyl-1H-pyrrole-2,5-dione TFA salt, I-411 as a brown oil (500 mg, 108%). MS (ESI, pos. ion) m/z: 169.1 (M+1).
- A solution of 1-(2-aminoethyl)-3,4-dimethyl-1H-pyrrole-2,5-dione (0.4 g, 2.38 mmol) and thiodiglycolic anhydride (1.2 g, 4 equiv.) in DCM (5 mL) was stirred at ambient temperature overnight. The reaction was monitored by LC-MS. Upon completion of the reaction, the reaction mixture was concentrated and purified by preparative TLC to afford acid I-412 (100 mg, 14%) as a white solid. MS (ESI, pos. ion) m/z: 301.1 (M+1). 1H NMR (400 MHz, CDCl3): δ 8.28 (s, 1H), 3.70 (m, 2H), 3.50 (m, 2H), 3.39 (s, 2H), 3.36 (s, 1H), 3.32 (s, 2H), 1.96 (s, 6H).
- The synthetic route for (S*)-I-413 and (R*)-I-413 was similar to the route for (R*)- and (S*)-I-234. The synthesis started with 5-methylpyrrolidin-2-one. The final target compounds were purified by preparative HPLC to afford 200 mg (55%) of racemic I-413 as a pale oil. Preparative chiral separation (CHIRALPAK AD column (Hexane/EtOH/AcOH=70/30/0.1)) of the racemate afforded the two enantiomers.
- After chiral HPLC purification, 30 mg of (S*)-I-413 (absolute configuration not determined) was obtained as a yellow oil. MS (ESI, pos. ion) m/z: 275.1 (M+1). 1H NMR (400 MHz, CDCl3): δ 7.50 (s, 1H), 6.81 (s, 1H), 3.96-3.84 (m, 1H), 3.77-3.67 (m, 1H), 3.71-3.58 (m, 1H), 3.36 (s, 2H), 3.29-3.19 (m, 2H), 3.28-3.23 (m, 1H), 3.18-3.08 (m, 1H), 2.51-2.37 (m, 2H), 2.26-2.16 (m, 1H), 1.72-1.53 (m, 1H), 1.26-1.22 (m, 3H).
- After chiral HPLC purification, 41 mg of (R*)-I-413 (absolute configuration not determined) was obtained as a yellow oil. MS (ESI, pos. ion) m/z: 275.1 (M+1). 1H NMR (400 MHz, CDCl3): δ 7.39 (s, 1H), 3.96-3.88 (m, 1H), 3.88-3.79 (m, 1H), 3.73 (s, 1H), 3.36 (s, 2H), 3.29-3.19 (m, 3H), 3.15-3.07 (m, 1H), 2.47-2.37 (m, 2H), 2.27-2.19 (m, 1H), 1.67-1.56 (m, 1H), 1.26-1.24 (m, 3H).
-
- The chemical structure of the target compound was confirmed by H NMR and LC-MS with the purity >95% (
HPLC 214 & 254 nm). - To a stirred solution of (tert-butoxycarbonyl)-D-asparagine (cas: 75647-01-7, 1.0 g, 4.3 mmol) in DMF (7 mL) was added DCC (0.8 g, 1.0 equiv.) and HOSu (0.5 g, 1.0 equiv.). The reaction mixture was heated to 80° C. for 6 hours and then concentrated under reduced pressure. The residue was dissolved in EtOAc (10 mL) and filtered. The filtrate was washed with water, brine, dried with Na2SO4, and then concentrated under reduced pressure. The resulting residue was purified by column chromatography (EtOAc:Petroleum ether=1:1) to afford imide I-414 as a pale yellow solid (0.5 g, 53% yield). MS (ESI, pos. ion) m/z: 237.1 (M+23).
- To a solution of tert-butyl(2,5-dioxopyrrolidin-3-yl)carbamate, I-414 (0.5 g, 2.3 mmol) and benzyl (2-bromoethyl)carbamate (cas: 53844-02-3, 890 mg, 1.5 equiv.) in DMF (5 mL) was added potassium carbonate (800 mg, 2.5 equiv.). The reaction mixture was heated to 90° C. for 12 hours. The reaction was then quenched with water (5 mL), and extracted with EtOAc (3×20 mL). The combined organic extracts were then washed with water (20 mL), brine (20 mL), dried with Na2SO4 and concentrated under reduced pressure. The residue was purified by column chromatography (EtOAc:Petroleum ether=1:1) to provide carbamate I-415 as a pale yellow oil (0.9 g, 100%). MS (ESI, pos. ion) m/z: 414.1 (M+23).
- To a solution of tert-butyl (1-(2-(((benzyloxy)carbonyl)amino)ethyl)-2,5-dioxopyrrolidin-3-yl)carbamate, I-415 (0.9 g, 2.3 mmol) in EtOAc (15 ml), was added 100 mg of Pd/C under H2 (14 Psi). The reaction mixture was stirred at ambient temperature overnight then filtered, and the filtrate was concentrated to afford the crude tert-butyl-(1-(2-aminoethyl)-2,5-dioxopyrrolidin-3-yl)carbamate I-416 as brown oil (0.5 g, 84%). MS (ESI, pos. ion) m/z: 280.1 (M+23).
- A solution of tert-butyl-(1-(2-aminoethyl)-2,5-dioxopyrrolidin-3-yl)carbamate, I-416 (0.1 g, 0.4 mmol) and thiodiglycolic anhydride (211 mg, 4 equiv.) in DCM (5 mL) was stirred at ambient temperature for 4 hours. The reaction was monitored by LC-MS. Upon completion of the reaction, the reaction mixture was concentrated, and the resulting residue was purified by preparative HPLC to afford I-417 (racemic) (39 mg, 25% yield). MS (ESI, pos. ion) m/z: 412.2 (M+23). 1H NMR (400 MHz, CDCl3): δ 7.34 (s, 1H), 5.62 (m, 1H), 4.36 (s, 1H), 3.72 (m, 1H), 3.57 (m, 1H), 3.45 (m, 3H), 3.31 (1H), 3.05 (m, 1H), 2.80 (s, 2H), 2.01 (s, 2H), 1.44 (s, 9H).
-
- The chemical structure of the target compound was confirmed by 1H NMR and LC-MS with the purity >95% (
HPLC 214 & 254 nm). - A solution of 3-chloropropane-1-sulfonyl chloride (cas: 1633-82-5, 1.22 g, 6.9 mmol) in anhydrous THF (5 mL) was added to a solution of tert-butyl (2-aminoethyl)carbamate (1 g, 6.25 mmol) and DIPEA (1.30 mL) in anhydrous THF (62 mL) at 0-5° C. The reaction mixture was allowed to warm to ambient temperature and stirred for 8 hours. When LC-MS analysis indicated that the reaction was complete, H2O (20 mL) was added, and the reaction mixture was extracted with EtOAc (20 mL×3). The combined organic extracts were concentrated under reduced pressure to give the crude product. The crude product was purified by silica gel chromatography (Petroleum ether:EtOAc=1:2) to provide I-418 (2.0 g, 96%) as a pale oil. MS (ESI, pos. ion) m/z: 323 (M+Na).
- To a solution of tert-butyl (2-aminoethyl)carbamate, I-418 (2 g, 6.67 mmol) in anhydrous THF (70 mL) at 0-5° C. was added NaH (60% dispersion in mineral oil, 0.4 g, 1.5 equiv.) in portions. The reaction was allowed to warm to ambient temperature and stirred for 8 hours. When LC-MS analysis indicated that the reaction was complete, H2O (20 mL) was added and the reaction mixture was extracted with EtOAc (20 mL×3). The combined organic extracts were concentrated in vacuo to provide the crude product. The crude product was purified by silica gel chromatography (Petroleum Ether:EtOAc=2:1) to provide I-419 (0.15 g, 9% yield) as a pale oil. MS (ESI, pos. ion) m/z: 287 (M+Na).
- A solution of tert-butyl (2-(1,1-dioxidoisothiazolidin-2-yl)ethyl)carbamate, I-419 (150 mg, 0.57 mmol) in TFA/DCM (1:3 v/v, 4 mL) was stirred at 25° C. for 2 hours. When LC-MS analysis indicated that the reaction was complete, the reaction mixture was concentrated in vacuo to give the crude amine TFA salt, I-420 as a pale oil (337 mg), which was used directly in the next step. MS (ESI, pos. ion) m/z: 165 (M+1).
- To a solution of 2-(2-aminoethyl)isothiazolidine-1,1-dioxide (337 mg, 1.22 mmol) and thiodiglycolic anhydride (193 mg, 1.2 equiv.) in 5 mL of DCM was added TEA (24 mg, 0.244 mmol). The reaction mixture was stirred for 2 hours and then concentrated under reduced pressure to give the crude product. The crude product was purified by preparative HPLC (Mobile Phase: MeCN/H2O (0.1% TFA), Gradient: 1-5% MeCN) to afford I-421 as a pale oil (50 mg, 14% yield). MS (ESI, pos. ion) m/z: 297.1 (M+1). 1H NMR (400 MHz, DMSO) δ 12.60 (s, 1H), 8.11 (m, 1H), 3.36 (s, 2H), 3.27-3.19 (m, 6H), 3.19-3.12 (m, 2H), 2.95 (m, 2H), 2.25-2.15 (m, 2H).
-
- The synthetic route for I-425 was similar to that used for the synthesis of I-421 and commenced with 4-chlorobutane-1-sulfonyl chloride (cas: 1633-84-7). 2-((2-((2-(1,1-dioxido-1,2-thiazinan-2-yl)ethyl)amino)-2-oxoethyl)thio)acetic acid, I-425 (pale oil, 50 mg, 15% yield) was isolated by preparative HPLC (Mobile Phase: MeCN/H2O (with 0.1% TFA), Gradient:10-20% MeCN). MS (ESI, pos. ion) m/z: 311.1 (M+1). 1H NMR (400 MHz, DMSO) δ 12.57 (s, 1H), 8.13 (m, 1H), 3.37 (s, 2H), 3.34-3.30 (m, 2H), 3.21 (s, 2H), 3.18 (m, 2H), 3.11 (m, 2H), 3.08-3.03 (m, 2H), 2.06-1.95 (m, 2H), 1.54 (m, 3.7 Hz, 2H).
-
- To a solution of amine salt I-14 (44.5 mg, 0.226 mmol), 2,2-dimethylmalonic acid (59.8 mg, 2.0 equiv.) and DIPEA (118 μL, 3.0 equiv.) in DMF (1 mL) was added HATU (129.1 mg, 1.5 equiv.). The reaction mixture was maintained at ambient temperature for 2 hours and was then purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA) to afford I-426 (8.6 mg, 14% yield).
-
- E-1 was synthesized as depicted in
Scheme 138. - To Rink-amide resin R-1 (0.125 mmol/g, 140.5 mg, 17.6 μmol) in a 6 mL polypropylene tube with an end-cap was added 20% v/v piperidine/DMF (2 mL). The tube was capped and agitated at ambient temperature for 30 minutes, then drained. The resin was washed with DMF (5×3 mL). A solution of carboxylic acid building block I-1 (36.6 mg, 8.0 equiv.) in DMF (2.8 mL) was added to the resin, followed by DIPEA (61 μL, 20 equiv.). HATU (80 mg, 12.0 equiv.) was then added and the reaction mixture was agitated at ambient temperature for 18 hours. The reaction mixture was drained and the resin washed with DMF (5×3 mL), DCM (5×3 mL) and dried in vacuo for 30 minutes.
- The resin was transferred to a 15 mL Falcon tube and 3 mL of cleavage reagent (95:2.5:2.5 v/v/v TFA/TIS/H2O) was added. The reaction mixture was agitated at ambient temperature for 1 hour. The resin was filtered and washed with TFA (2×3 mL). The combined filtrate and washes were concentrated under reduced pressure to afford a residue, which was triturated with Et2O (3 mL) to precipitate the peptide. The peptide was re-dissolved in glacial AcOH (2 mL) and purified by preparative HPLC (
Phenomenex Jupiter 10μM Proteo 90 Å LC column, 250×21.2 mm, with flow rate—15 mL/min, gradient of 0-100% acetonitrile in 25 mM aqueous ammonium acetate over 30 minutes) to afford 25.8 mg of E-1 as a white solid. ESI-MS (positive ionization) found 1149.7, [C213H325N47O64S]4+ calculated 1149.3. -
- E-2 was synthesized as depicted in
Scheme 139. - To Rink-amide resin (0.125 mmol/g, 107.8 mg, 13.5 μmol) in a 6 mL polypropylene tube with an end-cap was added 20% v/v piperidine/DMF (2 mL). The tube was capped, agitated at ambient temperature for 30 minutes, and then drained. The resin was washed with DMF (5×3 mL). A solution of pentafluorophenyl ester I-2 (32.9 mg, 5.0 equiv.) in DMF (1 mL) was added to the resin, followed by DIPEA (24 μL, 10 equiv.) and the reaction mixture was agitated at ambient temperature for 24 hours. The reaction mixture was drained. The resin was washed with DMF (5×3 mL), DCM (5×3 mL), and dried in vacuo for 30 minutes.
- The resin was transferred to a 15 mL falcon tube and 3 mL of cleavage reagent (95:2.5:2.5 v/v/v TFA/TIS/H2O) was added. The reaction mixture was agitated at ambient temperature for 3 hours. The resin was filtered and washed with TFA (2×0.5 mL). The combined filtrate and washes were concentrated under reduced pressure to afford a residue, which was triturated with Et2O (2 mL) to precipitate the peptide. The peptide was re-dissolved in glacial AcOH (1.2 mL) and purified by preparative HPLC (
Phenomenex Jupiter 10μM Proteo 90 Å LC column, 250×21.2 mm, with flow rate—15 mL/min, gradient of 0-100% acetonitrile in 25 mM aqueous ammonium acetate over 30 minutes) to afford 9.4 mg of E-2 as a white solid. ESI-MS (positive ionization) found 1165.3, [C217H323N47O65S]4+ calculated 1164.8. -
- E-3 was synthesized as depicted in
Scheme 140. - To peptide I-4 (0.25 mL of a 5 mM stock solution in DMSO, 1.2 μmol) was added I-3 (50 μL of a 50 mM stock solution in DMSO, 2.0 equiv.), followed by 300 mM sodium phosphate buffer, pH 11.5 (50 μL). The reaction mixture was agitated at ambient temperature for 16 hours and then purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford E-3 (4.3 mg) as a white solid. ESI-MS found 1374.3, C186H269N46O59S (M−3H) requires 1374.3.
-
- E-4 was synthesized as depicted in
Scheme 141. - To peptide I-4 (0.25 mL of a 5 mM stock solution in DMSO, 1.2 μmol) was added I-5 (50 μL of a 50 mM stock solution in DMSO, 2.0 equiv.), followed by 500 mM borate buffer, pH 9.5 (25 μL). The reaction mixture was agitated at ambient temperature for 16 hours and then purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford E-4 (1.8 mg) as a white solid. ESI-MS found 1395.0, C190H267N46O60S (M−3H) requires 1395.0.
-
- E-5 was prepared according to GP4 using 24 mg of resin (estimated loading 0.18 mmol/g) and I-6 to afford 2.3 mg of E-5 as a white solid. ESI-MS found 1058.5, C193H278N46O60S (M−4H+) requires 1058.0.
-
- E-6 was prepared according to GP4 using 30.9 mg of resin (estimated loading 0.15 mmol/g) and I-6 to afford 0.9 mg of E-6 as a white solid. ESI-MS found 1063.5, C194H288N46O60S (M+4H+) requires 1063.5.
-
- E-7 was prepared according to GP4 using 43.3 mg of resin (estimated loading 0.125 mmol/g) and I-6 to afford 2.5 mg of E-7 as a white solid. ESI-MS found 1152.3, C214H323N47O64S (M+4H+) requires 1151.8.
-
- E-8 was prepared according to GP4 using 30.8 mg of resin (estimated loading 0.18 mmol/g) and I-7 to afford 2.4 mg of E-8 as a white solid. ESI-MS found 1077.6, C194H285FN46O60S (M+4H+) requires 1077.0.
-
- E-9 was prepared according to GP4 using 30.3 mg of resin (estimated loading 0.18 mmol/g) and I-8 to afford 3.1 mg of E-9 as a white solid. ESI-MS found 1061.0, C192H286N46O61S (M+4H+) requires 1061.0.
-
- E-10 was prepared according to GP4 using 40.1 mg of resin (estimated loading 0.125 mmol/g) and I-8 to afford 1.5 mg of E-10 as a white solid. ESI-MS found 1152.8, C213H323N47O65S (M+4H+) requires 1152.8.
-
- E-11 was prepared according to GP4 using 67 mg of resin (estimated loading 0.08 mmol/g) and I-9 to afford 2.5 mg of E-11 as a white solid. ESI-MS found 1157.9, C212H321N47O65S2 (M+4H+) requires 1157.3.
-
- E-12 was prepared according to GP4 using 55.6 mg of resin (estimated loading 0.15 mmol/g) and I-9 to afford 1.7 mg of E-12 as a white solid. ESI-MS found 1125.8, C207H313N45O63S2 (M+4H+) requires 1125.3.
-
- E-13 was prepared according to GP4 using 53.3 mg of resin (estimated loading 0.18 mmol/g) and I-9 to afford 5.0 mg of E-13 as a white solid. ESI-MS found 1125.4, C207H314N46O62S2 (M+4H+) requires 1125.1.
-
- E-14 was prepared according to GP4 using 41.3 mg of resin (estimated loading 0.11 mmol/g) and I-9 to afford 0.5 mg of E-14 as a white solid. ESI-MS found 1238.2, C222H348N56O66S3 (M+4H+) requires 1237.6.
-
- E-15 was prepared according to GP4 using 40.4 mg of resin (estimated loading 0.06 mmol/g) and I-9 to afford 0.8 mg of E-15 as a white solid. ESI-MS found 1135.3, C206H319N47O64S2 (M+4H+) requires 1134.8.
-
- E-16 was prepared according to GP4 using 56.5 mg of resin (estimated loading 0.18 mmol/g) and I-9 to afford 1.1 mg of E-16 as a white solid. ESI-MS found 1161.2, C213H323N47O65S2 (M+4H+) requires 1160.8.
-
- E-17 was prepared according to GP4 using 68 mg of resin (estimated loading 0.16 mmol/g) and I-9 to afford 3.3 mg of E-17 as a white solid. ESI-MS found 1139.3, C205H315N47O64S3 (M+4H+) requires 1138.8.
-
- E-18 was prepared according to GP4 using 56.9 mg of resin (estimated loading 0.17 mmol/g) and I-9 to afford 0.7 mg of E-18 as a white solid. ESI-MS found 1153.4, C207H318N48O65S3 (M+4H+) requires 1153.1.
-
- E-19 was prepared according to GP4 using 27.3 mg of resin (estimated loading 0.18 mmol/g) and I-10 to afford 0.7 mg of E-19 as a white solid. ESI-MS found 1065.8, C194H281N47O60S (M−4H)− requires 1065.3.
-
- E-20 was prepared according to GP4 using 29 mg of resin (estimated loading 0.18 mmol/g) and I-11 to afford 3.0 mg of E-20 as a white solid. ESI-MS found 1063.0, C193H280N46O61S (M−4H)− requires 1062.5.
-
- E-21 was prepared according to GP4 using 108.5 mg of resin (estimated loading 0.125 mmol/g) and I-11 to afford 9.7 mg of E-21 as a white solid. ESI-MS found 1156.8, C214H325N47O65S (M+4H+) requires 1156.3.
-
- E-22 was prepared according to GP4 using 31.5 mg of resin (estimated loading 0.18 mmol/g) and I-12 to afford 1.8 mg of E-22 as a white solid. ESI-MS found 1065.1, C193H288N46O61S (M+4H+) requires 1064.5.
-
- E-23 was prepared according to GP4 using 29.4 mg of resin (estimated loading 0.18 mmol/g) and I-13 to afford 4.2 mg of E-23 as a white solid. ESI-MS found 1068.6, C194H290N46O61S (M+4H+) requires 1068.0.
-
- E-24 was prepared according to GP4 using 26.9 mg of resin (estimated loading 0.15 mmol/g) and I-15 to afford 3.3 mg of E-24 as a white solid. ESI-MS found 1068.0, C191H276N46O62S2 (M−4H)− requires 1067.5.
-
- E-25 was prepared according to GP3 using 29.1 mg of resin (estimated loading 0.18 mmol/g) and diester I-16 to afford 2.1 mg of E-25 as a white solid. ESI-MS found 1024.0, C187H272N44O60 (M−4H)− requires 1023.5.
-
- E-26 was prepared according to GP5 using 28.7 mg of resin (estimated loading 0.18 mmol/g) and I-21 to afford 3.4 mg of E-26 as a white solid. ESI-MS found 1070.5, C198H282N46O61 (M−4H)− requires 1070.0.
-
- E-27 was prepared according to GP5 using 24.7 mg of resin (estimated loading 0.18 mmol/g) and I-22 to afford 2.5 mg of E-27 as a white solid. ESI-MS found 1027.3, C188H275N45O59 (M−4H)− requires 1026.8.
-
- E-28 was prepared according to GP5 using 26.1 mg of resin (estimated loading 0.18 mmol/g) and I-23 to afford 1.8 mg of E-28 as a white solid. ESI-MS found 1074.0, C199H284N46O61 (M−4H)− requires 1073.5.
-
- E-29 was prepared according to GP5 using 23.5 mg of resin (estimated loading 0.18 mmol/g) and I-24 to afford 0.5 mg of E-29 as a white solid. ESI-MS found 1067.0, C197H280N46O61 (M−4H)− requires 1066.5.
-
- E-30 was prepared according to GP5 using 24.9 mg of resin (estimated loading 0.18 mmol/g) and I-25 to afford 1.4 mg of E-30 as a white solid. ESI-MS found 1068.7, C197H289N47O60 (M+4H+) requires 1068.3.
-
- E-31 was prepared according to GP5 using 28.4 mg of resin (estimated loading 0.18 mmol/g) and I-26 to afford 2.4 mg of E-31 as a white solid. ESI-MS found 1070.5, C198H282N46O61 (M−4H)− requires 1070.0.
-
- E-32 was prepared according to GP5 using 26.4 mg of resin (estimated loading 0.18 mmol/g) and I-27 to afford 5.5 mg of E-32 as a white solid. ESI-MS found 1074.0, C199H284N46O61 (M−4H)− requires 1073.5.
-
- E-33 was prepared according to GP5 using 27.1 mg of resin (estimated loading 0.2 mmol/g) and I-28 to afford 3.1 mg of E-33 as a white solid. ESI-MS found 1070.0, C195H284N46O61S (M−4H)− requires 1069.5.
-
- E-34 was prepared according to GP5 using 28 mg of resin (estimated loading 0.18 mmol/g) and I-29 to afford 3.0 mg of E-34 as a white solid. ESI-MS found 1062.5, C193H278N46O61S (M−4H)− requires 1149.8.
-
- E-35 was prepared according to GP5 using 25.8 mg of resin (estimated loading 0.18 mmol/g) and I-30 to afford 2.4 mg of E-35 as a white solid. ESI-MS found 1059.0, C192H276N46O61S (M−4H)− requires 1058.5.
-
- E-36 was prepared according to GP5 using 39.7 mg of resin (estimated loading 0.125 mmol/g) and I-31 to afford 5.9 mg of E-36 as a white solid. ESI-MS found 1148.9, C215H329N47O64 (M+4H+) requires 1148.3.
-
- E-37 was prepared according to GP5 using 34 mg of resin (estimated loading 0.18 mmol/g) and I-32 to afford 5.2 mg of E-37 as a white solid. ESI-MS found 1071.6, C195H290N46O61S (M+4H+) requires 1071.0.
-
- E-38 was prepared according to GP5 using 21.6 mg of resin (estimated loading 0.18 mmol/g) and I-33 to afford 3.5 mg of E-38 as a white solid. ESI-MS found 1080.0, C198H288N46O61S (M+4H+) requires 1079.5.
-
- E-39 was prepared according to GP5 using 51.5 mg of resin (estimated loading 0.14 mmol/g) and I-9 to afford 0.8 mg of E-39 as a white solid. ESI-MS found 1164.9, C214H325N47O65S2 (M+4H+) requires 1164.3.
-
- E-40 was prepared according to GP5 using 26.2 mg of resin (estimated loading 0.38 mmol/g) and I-34 to afford 3.3 mg of E-40 as a white solid. ESI-MS found 1064.0, C191H276N46O61S2 (M−4H)− requires 1063.5.
-
- E-41 was prepared according to GP5 using 109.9 mg of resin (estimated loading 0.125 mmol/g) and I-34 to afford 7.3 mg of E-41 as a white solid. ESI-MS found 1156.1, C212H313N47O65S2 (M−4H)− requires 1155.3.
-
- Peptide E-42 was prepared from 39 mg of resin (approximate loading 0.18 mmol/g) using I-35 and GP5 to afford E-42 as a white solid. ESI-MS found 1078.5, C198H282N46O61S (M−4H)− requires 1078.0.
-
- Peptide E-43 was prepared from 36 mg of resin (approximate loading 0.18 mmol/g) using I-35 and GP5 to afford E-43 as a white solid. ESI-MS found 1067.5, C197H282N46O59S (M−4H)− requires 1067.0.
-
- Peptide E-44 was prepared from 36 mg of resin (approximate loading 0.18 mmol/g) using I-35 and GP5 to afford E-44 as a white solid. ESI-MS found 1075.0, C197H280N46O61S (M−4H)− requires 1074.5.
-
- Peptide E-45 was prepared from 27.9 mg of resin (approximate loading 0.2 mmol/g) using I-35 and GP5 to afford 2.3 mg of E-45 as a white solid. ESI-MS found 1082.0, C199H284N46O61S (M−4H)− requires 1081.5.
-
- Peptide E-46 was prepared from 32 mg of resin (approximate loading 0.17 mmol/g) using I-35 and GP5 to afford 4.7 mg of E-46 as a white solid. ESI-MS found 1075.3, C197H279N45O62S (M−4H)− requires 1074.8.
-
- Peptide E-47 was prepared from 32.6 mg of resin (approximate loading 0.17 mmol/g) using I-35 and GP5 to afford 4.8 mg of E-47 as a white solid. ESI-MS found 1071.7, C195H273N45O63S (M−4H)− requires 1071.2.
-
- Peptide E-48 was prepared from 30.2 mg of resin (approximate loading 0.19 mmol/g) using I-35 and GP5 to afford 5.4 mg of E-48 as a white solid. ESI-MS found 1059.0, C193H280N46O60S (M−4H)− requires 1058.5.
-
- E-49 was prepared according to GP5 using 50 mg of resin (estimated loading 0.18 mmol/g) and I-36 to afford 7.7 mg of E-49 as a white solid. ESI-MS found 1059.5, C192H278N46O61S (M−4H)− requires 1059.0.
-
- E-50 was prepared according to GP5 using 52.9 mg of resin (estimated loading 0.15 mmol/g) and I-36 to afford E-50 as a white solid. ESI-MS found 1151.3, C212H323N47O64S (M−4H)− requires 1150.8.
-
- E-51 was prepared according to GP5 using 50 mg of resin (estimated loading 0.18 mmol/g) and I-37 to afford 5.9 mg of E-51 as a white solid. ESI-MS found 1056.0, C191H276N46O61S (M−4H)− requires 1055.5.
-
- E-52 was prepared according to GP5 using 50 mg of resin (estimated loading 0.18 mmol/g) and I-38 to afford 3.1 mg of E-52 as a white solid. ESI-MS found 1060.0, C191H276N46O62S (M−4H)− requires 1059.5.
-
- E-53 was prepared according to GP5 using 50 mg of resin (estimated loading 0.18 mmol/g) and I-39 to afford 7.8 mg of E-53 as a white solid. ESI-MS found 1063.0, C193H280N46O61S (M−4H)− requires 1062.5.
-
- E-54 was prepared according to GP5 using 22 mg of resin (estimated loading 0.5 mmol/g) and I-40 to afford 1.8 mg of E-54 as a white solid. ESI-MS found 1063.5, C196H278N46O61 (M−4H)− requires 1063.0.
-
- E-55 was prepared according to GP5 using 21.3 mg of resin (estimated loading 0.5 mmol/g) and I-41 to afford 1.0 mg of E-55 as a white solid. ESI-MS found 1067.0, C197H280N46O61 (M−4H)− requires 1066.5.
-
- E-56 was prepared according to GP5 using 13.6 mg of resin (estimated loading 0.5 mmol/g) and I-42 to afford 0.8 mg of E-56 as a white solid. ESI-MS found 1071.0, C193H280N46O61S2 (M−4H)− requires 1070.5.
-
- E-57 was prepared according to GP5 using 16.1 mg of resin (estimated loading 0.5 mmol/g) and I-44 to afford 0.4 mg of E-57 as a white solid. ESI-MS found 1068.0, C195H276N46O61S (M−4H)− requires 1067.5.
-
- E-58 was prepared according to GP5 using 20.7 mg of resin (estimated loading 0.5 mmol/g) and I-48 to afford 0.3 mg of E-58 as a white solid. ESI-MS found 1070.5, C198H282N46O61 (M−4H)− requires 1070.0.
-
- E-59 was prepared according to GP5 using 13.6 mg of resin (estimated loading 0.5 mmol/g) and I-51 to afford 0.6 mg of E-59 as a white solid. ESI-MS found 1075.0, C197H280N46O61S (M−4H)− requires 1074.5.
-
- E-60 was prepared according to GP5 using 30.5 mg of resin (estimated loading 0.15 mmol/g) and I-53 to afford 3.6 mg of E-60 as a white solid. ESI-MS found 1068.5, C196H282N46O60S (M−4H)− requires 1068.0.
-
- E-61 was prepared according to GP4 using 36.9 mg of resin (estimated loading 0.125 mmol/g) and I-55 to afford 5.1 mg of E-61 as a white solid. ESI-MS found 1163.8, C216H329N47O65S (M+4H+) requires 1163.3.
-
- E-62 was prepared according to GP4 using 22 mg of resin (estimated loading 0.5 mmol/g) and commercially available 2-(2,4-dioxothiazolidin-3-yl)acetic acid to afford 0.8 mg of E-62 as a white solid. ESI-MS found 1034.7, C187H269N45O60S (M−4H)− requires 1034.2.
-
- E-63 was synthesized as depicted in
Scheme 142. - Resin R-2 (29.2 mg, approximate loading 0.39 mmol/g, 11.3 μmol) was treated with 20% piperidine/DMF (3×5 min×1 mL) for Fmoc deprotection. The resin was drained and washed with DMF (5×1 mL). A solution of ester I-56 (23.9 mg, 5.0 equiv.) in DMF (0.6 mL) was added, followed by DIPEA (19.7 μL, 10.0 equiv.) and the reaction mixture was agitated at ambient temperature for 16 hours. The resin was then drained and washed with DMF (5×) and DCM (5×) and then dried in vacuo. The resin was treated with 20% piperidine/DMF (3×5 min×1 mL) for Fmoc deprotection. The resin was drained and washed with DMF (5×1 mL). A solution of 2-(2,4-dioxothiazolidin-3-yl)acetic acid (9.9 mg, 5.0 equiv.) in DMF (0.6 mL) was added, followed by DIPEA (23.6 μL, 12.0 equiv.) and HATU (34.4 mg, 8.0 equiv.) and the reaction mixture was agitated at ambient temperature for 16 hours. The resin was then drained and washed with DMF (5×) and DCM (5×) and then dried in vacuo. Resin cleavage was performed with TFA/TIPS/H2O (95:2.5:2.5 v/v/v, 1 mL) at ambient temperature for 1 hour. The reaction mixture was filtered and the resin was washed with TFA (2×1 mL). The combined filtrate and washes were concentrated. The residue was triturated with Et2O (2 mL) and the supernatant was discarded. The residue was dissolved in AcOH (1 mL) and purified by preparative HPLC (25 mM NH4OAc/MeCN, 0-100% gradient over 30 minutes) to afford 1.6 mg of peptide E-63 as a white solid. ESI-MS found 1056.0, C191H276N46O61S (M−4H)− requires 1055.5.
-
- E-64 was synthesized as depicted in
Scheme 143. - Resin R-2 (36.1 mg, approximate loading 0.39 mmol/g, 14.1 μmol) was treated with 20% piperidine/DMF (3×5 min×1 mL) for Fmoc deprotection. The resin was drained and washed with DMF (5×1 mL). A solution of ester I-57 (30.7 mg, 5.0 equiv.) in DMF (0.6 mL) was added, followed by DIPEA (24.5 μL, 10.0 equiv.) and the reaction mixture was agitated at ambient temperature for 16 hours. The resin was then drained and washed with DMF (5×) and DCM (5×) and then dried in vacuo. The resin was treated with 20% piperidine/DMF (3×5 min×1 mL) for Fmoc deprotection. The resin was drained and washed with DMF (5×1 mL). A solution of 2-(2,4-dioxothiazolidin-3-yl)acetic acid (12.3 mg, 5.0 equiv.) in DMF (0.6 mL) was added, followed by DIPEA (29.4 μL, 12.0 equiv.) and HATU (42.8 mg, 8.0 equiv.) and the reaction mixture was agitated at ambient temperature for 16 hours. The resin was then drained and washed with DMF (5×) and DCM (5×) and then dried in vacuo. Resin cleavage was performed with TFA/TIPS/H2O (95:2.5:2.5 v/v/v, 1 mL) at ambient temperature for 1 hour. The reaction mixture was filtered and the resin was washed with TFA (2×1 mL). The combined filtrate and washes were concentrated. The residue was triturated with Et2O (2 mL) and the supernatant was discarded. The residue was dissolved in AcOH (1 mL) and purified by preparative HPLC (25 mM NH4OAc/MeCN, 0-100% gradient over 30 minutes) to afford 1.2 mg of peptide E-64 as a white solid. ESI-MS found 1059.5, C192H278N46O61S (M−4H)− requires 1059.0.
-
- E-65 was prepared according to GP4 using 49.4 mg of resin (estimated loading 0.125 mmol/g) and I-60 to afford 5.8 mg of E-65 as a white solid. ESI-MS found 1161.4, C213H323N47O65S2 (M+4H+) requires 1160.8.
-
- E-66 was prepared according to GP4 using 28.6 mg of resin (estimated loading 0.18 mmol/g) and I-61 to afford 2.4 mg of E-66 as a white solid. ESI-MS found 1059.8, C191H277N47O61S (M−4H)− requires 1059.3.
-
- E-67 was prepared according to GP4 using 26.5 mg of resin (estimated loading 0.18 mmol/g) and I-62 to afford E-67 as a white solid. ESI-MS found 1068.0, C196H280N46O60S (M−4H)− requires 1067.5.
-
- E-68 was prepared according to GP4 using 30.2 mg of resin (estimated loading 0.18 mmol/g) and I-64 to afford 4.6 mg of E-68 as a white solid. ESI-MS found 1064.0, C193H286N46O61S (M+4H+) requires 1064.0.
-
- E-69 was prepared according to GP4 using 27.8 mg of resin (estimated loading 0.18 mmol/g) and I-66 to afford 2.9 mg of E-69 as a white solid. ESI-MS found 1067.9, C194H290N46O61S (M+4H+) requires 1068.0.
-
- Peptide E-70 was prepared from 35 mg of resin (approximate loading 0.18 mmol/g) using I-67 and GP4 to afford 2.4 mg of E-70 as a white solid. ESI-MS found 1080.0, C198H290N46O61S (M+4H+) requires 1080.0.
-
- Peptide E-71 was prepared from 35 mg of resin (approximate loading 0.125 mmol/g) using I-67 and GP4 to afford 1.5 mg of E-71 as a white solid. ESI-MS found 1171.9, C219H327N47O65S (M+4H+) requires 1171.8.
-
- E-72 was prepared according to GP4 using 24.4 mg of resin (estimated loading 0.18 mmol/g) and I-68 to afford 2.5 mg of E-72 as a white solid. ESI-MS found 1071.3, C196H279N47O60S (M−4H)− requires 1070.8.
- E-73
- E-73 was prepared according to GP4 using 46.2 mg of resin (estimated loading 0.125 mmol/g) and I-69 to afford 6.6 mg of E-73 as a white solid. ESI-MS found 1156.8, C215H329N47O64S (M+4H+) requires 1156.3.
-
- Peptide E-74 was prepared from 30 mg of resin (approximate loading 0.125 mmol/g) using I-70 and GP4 to afford 2.2 mg of E-74 as a white solid. ESI-MS found 1165.6, C218H327N47O64S (M+4H+) requires 1164.8.
-
- E-75 was prepared according to GP4 using 35.8 mg of resin (estimated loading 0.125 mmol/g) and I-71 to afford 3.2 mg of E-75 as a white solid. ESI-MS found 1153.5, C212H323N48O65S (M+4H+) requires 1153.1.
-
- E-76 was prepared according to GP4 using 34.9 mg of resin (estimated loading 0.125 mmol/g) and I-72 to afford 3.5 mg of E-76 as a white solid. ESI-MS found 1160.5, C214H326N48O65S (M+4H+) requires 1160.1.
-
- Peptide E-77 was prepared from 37 mg of resin (approximate loading 0.125 mmol/g) using I-74 and GP1 to afford 3.1 mg of E-77 as a white solid. ESI-MS found 1161.4, C213H323N47O65S2 (M+4H+) requires 1160.8.
-
- Peptide E-78 was prepared from 30 mg of resin (approximate loading 0.125 mmol/g) using I-76 and GP4 to afford 2.2 mg of E-78 as a white solid. ESI-MS found 1164.9, C214H325N47O65S2 (M+4H+) requires 1164.3.
-
- E-79 was prepared according to GP4 using 38.4 mg of resin (estimated loading 0.125 mmol/g) and I-79 to afford 4.2 mg of E-79 as a white solid. ESI-MS found 1153.8, C213H325N47O65S (M+4H+) requires 1153.3.
-
- E-80 was prepared according to GP4 using 39.8 mg of resin (estimated loading 0.125 mmol/g) and I-80 to afford 2.5 mg of E-80 as a white solid. ESI-MS found 1153.8, C213H325N47O65S (M+4H+) requires 1153.3.
-
- E-81 was prepared according to GP4 using 37.6 mg of resin (estimated loading 0.125 mmol/g) and I-82 to afford 2.1 mg of E-81 as a white solid. ESI-MS found 1163.8, C216H329N47O65S (M+4H+) requires 1163.3.
-
- E-82 was prepared according to GP4 using 49.9 mg of resin (estimated loading 0.125 mmol/g) and I-85 to afford 6.5 mg of E-82 as a white solid. ESI-MS found 1156.9, C215H329N47O64S (M+4H+) requires 1156.3.
-
- E-83 was prepared according to GP4 using 50.8 mg of resin (estimated loading 0.125 mmol/g) and I-87 to afford 6.0 mg of E-83 as a white solid. ESI-MS found 1157.0, C215H329N47O64S (M+4H+) requires 1156.3.
-
- E-84 was prepared according to GP4 using 39.3 mg of resin (estimated loading 0.125 mmol/g) and I-89 to afford 2.9 mg of E-84 as a white solid. ESI-MS found 1160.4, C215H327N47O65S (M+4H+) requires 1159.8.
-
- E-85 was prepared according to GP4 using 41.1 mg of resin (estimated loading 0.125 mmol/g) and I-90 to afford 3.7 mg of E-85 as a white solid. ESI-MS found 1160.4, C215H327N47O65S (M+4H+) requires 1159.8.
-
- E-86 was prepared according to GP4 using 30.9 mg of resin (estimated loading 0.125 mmol/g) and I-92 to afford 3.1 mg of E-86 as a white solid. ESI-MS found 1159.7, C215H325N47O65S (M+4H+) requires 1159.3.
-
- E-87 was prepared according to GP4 using 21.9 mg of resin (estimated loading 0.18 mmol/g) and I-94 to afford 2.2 mg of E-87 as a white solid. ESI-MS found 1063.5, C196H278N46O61 (M−4H)− requires 1063.0.
-
- E-88 was prepared according to GP4 using 31 mg of resin (estimated loading 0.18 mmol/g) and I-96 to afford 3.4 mg of E-88 as a white solid. ESI-MS found 1067.0, C197H280N46O61 (M−4H)− requires 1066.5.
-
- E-89 was prepared according to GP4 using 28.1 mg of resin (estimated loading 0.18 mmol/g) and I-98 to afford 2.5 mg of E-89 as a white solid. ESI-MS found 1063.5, C196H278N46O61 (M−4H)− requires 1063.0.
-
- E-90 was prepared according to GP4 using 35.5 mg of resin (estimated loading 0.125 mmol/g) and I-101 to afford 4.8 mg of E-90 as a white solid. ESI-MS found 1156.8, C214H325N47O65S (M+4H+) requires 1156.3.
-
- E-91 was prepared according to GP4 using 35.3 mg of resin (estimated loading 0.125 mmol/g) and I-100 to afford 3.2 mg of E-91 as a white solid. ESI-MS found 1156.8, C214H325N47O65S (M+4H+) requires 1156.3.
-
- Peptide E-92 was prepared from 35 mg of resin (approximate loading 0.125 mmol/g) using I-104 and GP4 to afford 3.7 mg of E-92 as a white solid. ESI-MS found 1139.3, C210H319N47O64S (M+4H+) requires 1138.8.
-
- Peptide E-93 was prepared from 38 mg of resin (approximate loading 0.125 mmol/g) using I-106 and GP4 to afford 2.0 mg of E-93 as a white solid. ESI-MS found 1162.8, C216H327N47O65S (M+4H+) requires 1162.8.
-
- Peptide E-94 was prepared from 44 mg of resin (approximate loading 0.18 mmol/g) using I-109 and GP5 to afford 4.1 mg of E-94 as a white solid. ESI-MS found 1073.3, C196H289N47O60S (M+4H+) requires 1073.2.
-
- Peptide E-95 was prepared from 34 mg of resin (approximate loading 0.18 mmol/g) using I-111 and GP5 to afford 4.9 mg of E-95 as a white solid. ESI-MS found 1084.2, C196H285N47O63S (M+4H+) requires 1084.2.
-
- Peptide E-96 was prepared from 34 mg of resin (approximate loading 0.18 mmol/g) using I-113 and GP5 to afford 4.4 mg of E-96 as a white solid. ESI-MS found 1084.2, C196H285N47O63S (M+4H+) requires 1084.2.
-
- Peptide E-97 was prepared from 35 mg of resin (approximate loading 0.125 mmol/g) using I-115 and GP4 to afford 2.5 mg of E-97 as a white solid. ESI-MS found 1154.4, C212H323N47O64S2 (M+4H+) requires 1153.8.
-
- Peptide E-98 was prepared from 26 mg of resin (approximate loading 0.18 mmol/g) using I-118 and GP4 to afford E-98 as a white solid. ESI-MS found 1167.0, C197H282N46O59S (M−4H)− requires 1167.0.
-
- Peptide E-99 was prepared from 108 mg of resin (approximate loading 0.18 mmol/g) using I-118 and GP4 to afford 1.0 mg of E-99 as a white solid. ESI-MS found 1160.3, C218H325N47O65 (M+4H+) requires 1160.3.
-
- To 26 mg of resin (approximate loading 0.18 mmol/g, 4.68 μmol) in a 3 mL polypropylene tube with an end-cap was added 20% v/v piperidine/DMF (2 mL). The tube was capped, agitated at ambient temperature for 30 minutes, and then drained. The resin was washed with DMF (5×3 mL). A solution of carboxylic acid building block I-120 (8 mg, 5.6 equiv.) in DMF (2.8 mL) was added to the resin, followed by EDC (27.4 mg, 30.5 equiv.) and 1-hydroxybenzotriazole hydrate (34 mg, 43.1 equiv.). The reaction mixture was agitated at ambient temperature for 18 hours. The reaction mixture was drained; the resin was washed with DMF (5×3 mL), DCM (5×3 mL), and dried in vacuo for 30 minutes.
- The resin was transferred to a 15 mL Falcon tube and 3 mL of cleavage reagent (95:2.5:2.5 v/v/v TFA/TIS/H2O) was added. The reaction mixture was agitated at ambient temperature for 1 hour. The resin was filtered and washed with TFA (2×3 mL). The combined filtrate and washes were concentrated under reduced pressure to afford a residue, which was triturated with Et2O (3 mL) to precipitate the peptide. The peptide was re-dissolved in glacial AcOH (2 mL) and purified by preparative HPLC (
Phenomenex Jupiter 10μM Proteo 90 Å LC column, 250×21.2 mm, with flow rate—15 mL/min, gradient of 0-100% acetonitrile in 25 mM aqueous ammonium acetate over 30 minutes) to afford E-100 as a white solid. ESI-MS found 1169.0, C197H288N46O61 (M+4H+) requires 1168.5. -
- Peptide E-101 was prepared from 25 mg of resin (approximate loading 0.18 mmol/g) using I-122 and GP5 to afford E-101 as a white solid.
-
- Peptide E-102 was prepared from 25 mg of resin (approximate loading 0.18 mmol/g) using I-124 and GP5 to afford E-102 as a white solid. ESI-MS found 1073.8, C195H285N47O61S (M+4H+) requires 1073.3.
-
- Peptide E-103 was prepared from 25 mg of resin (approximate loading 0.18 mmol/g) using I-126 and GP5 to afford E-103 as a white solid. ESI-MS found 1083.5, C200H280N46O61S (M−4H)− requires 1084.0.
-
- Peptide E-104 was prepared from 25 mg of resin (approximate loading 0.18 mmol/g) using I-129 and GP5 to afford E-104 as a white solid. ESI-MS found 1073.0, C196H284N46O61S (M−4H)− requires 1072.5.
-
- Peptide E-105 was prepared from 25 mg of resin (approximate loading 0.18 mmol/g) using I-131 and GP5 to afford E-105 as a white solid. ESI-MS found 1071.8, C195H277N47O61S (M−4H)− requires 1071.3.
-
- Peptide E-106 was prepared from 25 mg of resin (approximate loading 0.18 mmol/g) using I-133 and GP5 to afford E-106 as a white solid. ESI-MS found 1080.2, C196H277N46O61SCl (M−4H)− requires 1079.5.
-
- Peptide E-107 was prepared from 25 mg of resin (approximate loading 0.18 mmol/g) using I-135 and GP5 to afford E-107 as a white solid. ESI-MS found 1080.2, C196H277N46O61SCl (M−4H)− requires 1079.5.
-
- Peptide E-108 was prepared from 25 mg of resin (approximate loading 0.18 mmol/g) using I-137 and GP5 to afford E-108 as a white solid. ESI-MS found 1084.0, C200H290N46O61S (M−4H)− requires 1083.5.
-
- Peptide E-109 was prepared from 25 mg of resin (approximate loading 0.18 mmol/g) using I-139 and GP5 to afford E-109 as a white solid. ESI-MS found 1085.5, C200H290N46O61S (M−4H)− requires 1085.0.
-
- E-110 was prepared according to GP4 using 21.8 mg of resin (estimated loading 0.15 mmol/g) and I-141 to afford 2.0 mg of E-110 as a white solid. ESI-MS found 1072.0, C191H276N46O63S2 (M−4H)− requires 1071.5.
-
- Peptide E-111 was prepared from 30 mg of resin (approximate loading 0.125 mmol/g) using I-145 and GP4 to afford 2.2 mg of E-111 as a white solid. ESI-MS found 1160.3, C216H331N47O64S (M+4H+) requires 1159.8.
-
- Peptide E-112 was prepared from 33 mg of resin (approximate loading 0.125 mmol/g) using I-146 and GP4 to afford 3.7 mg of E-112 as a white solid. ESI-MS found 1145.3, C215H329N47O64 (M+4H+) requires 1144.8.
-
- Peptide E-113 was prepared from 33 mg of resin (approximate loading 0.125 mmol/g) using I-147 and GP4 to afford 3.4 mg of E-113 as a white solid. ESI-MS found 1148.8, C215H329N47O64 (M+4H+) requires 1148.3.
-
- Peptide E-114 was prepared from 45 mg of resin (approximate loading 0.125 mmol/g) using I-148 and GP4 to afford 5.8 mg of E-114 as a white solid. ESI-MS found 1152.3, C216H331N47O64 (M+4H+) requires 1151.8.
-
- E-115 was prepared according to GP4 using 45.9 mg of resin (estimated loading 0.125 mmol/g) and I-150 to afford 6.0 mg of E-115 as a white solid. ESI-MS found 1163.9, C216H329N47O65S (M+4H+) requires 1163.3.
-
- E-116 was prepared according to GP4 using 30.5 mg of resin (estimated loading 0.125 mmol/g) and I-152 to afford 2.4 mg of E-116 as a white solid. ESI-MS found 1175.9, C220H329N47O65S (M+4H+) requires 1175.3.
-
- E-117 was prepared according to GP4 using 34.2 mg of resin (estimated loading 0.125 mmol/g) and I-155 to afford 2.1 mg of E-117 as a white solid. ESI-MS found 1160.3, C215H327N47O65S (M+4H+) requires 1159.8.
-
- E-118 was prepared according to GP4 using 28 mg of resin (estimated loading 0.125 mmol/g) and I-157 to afford E-118 as a white solid. ESI-MS found 1166.4, C217H327N47O65S (M+4H+) requires 1165.8.
-
- E-119 was prepared according to GP4 using 29.8 mg of resin (estimated loading 0.125 mmol/g) and I-159 to afford 3.6 mg of E-119 as a white solid. ESI-MS found 1167.1, C217H331N47O65S (M+4H+) requires 1166.8.
-
- E-120 was prepared according to GP4 using 29.3 mg of resin (estimated loading 0.125 mmol/g) and I-161 to afford 4.4 mg of E-120 as a white solid. ESI-MS found 1166.8, C217H329N47O65S (M+4H+) requires 1166.3.
-
- E-121 was prepared according to GP4 using 26.2 mg of resin (estimated loading 0.125 mmol/g) and I-163 to afford 3.2 mg of E-121 as a white solid. ESI-MS found 1160.3, C215H327N47O65S (M+4H+) requires 1159.8.
-
- E-122 was prepared according to GP4 using 29.3 mg of resin (estimated loading 0.18 mmol/g) and I-165 to afford 0.6 mg of E-122 as a white solid. ESI-MS found 1070.9, C195H290N46O61S (M+4H+) requires 1071.0.
-
- E-123 was prepared according to GP4 using 28.9 mg of resin (estimated loading 0.18 mmol/g) and I-167 to afford 4.1 mg of E-123 as a white solid. ESI-MS found 1067.1, C195H290N46O60S (M+4H+) requires 1067.0.
-
- E-124 was prepared according to GP4 using 42.9 mg of resin (estimated loading 0.125 mmol/g) and I-168 to afford 18.6 mg of E-124 as a white solid. ESI-MS found 1145.4, C214H327N47O64 (M+4H+) requires 1144.8.
-
- E-125 was prepared according to GP4 using 45.8 mg of resin (estimated loading 0.125 mmol/g) and I-169 to afford 5.4 mg of I-169 as a white solid. ESI-MS found 1148.9, C215H329N47O64 (M+4H+) requires 1148.3.
-
- E-126 was prepared according to GP4 using 45.5 mg of resin (estimated loading 0.125 mmol/g) and I-170 to afford 4.7 mg of E-126 as a white solid. ESI-MS found 1152.3, C216H331N47O64 (M+4H+) requires 1151.8.
-
- E-127 was prepared according to GP4 using 36.2 mg of resin (estimated loading 0.18 mmol/g) and I-172 to afford 2.1 mg of E-127 as a white solid. ESI-MS found 1064.8, C192H287N47O61S (M+4H+) requires 1064.8.
-
- E-128 was prepared according to GP4 using 38.3 mg of resin (estimated loading 0.125 mmol/g) and I-174 to afford 3.1 mg of E-128 as a white solid. ESI-MS found 1145.4, C214H327N47O64 (M+4H+) requires 1144.8.
-
- E-129 was prepared according to GP4 using 40.1 mg of resin (estimated loading 0.125 mmol/g) and I-176 to afford 5.2 mg of E-129 as a white solid. ESI-MS found 1141.8, C213H325N47O64 (M+4H+) requires 1141.3.
-
- E-130 was prepared according to GP4 using 40 mg of resin (estimated loading 0.125 mmol/g) and I-180 to afford 5.2 mg of E-130 as a white solid. ESI-MS found 1152.4, C216H331N47O64 (M+4H+) requires 1151.8.
-
- E-131 was prepared according to GP4 using 39.3 mg of resin (estimated loading 0.125 mmol/g) and I-183 to afford 3.0 mg of E-131 as a white solid. ESI-MS found 1152.3, C216H331N47O64 (M+4H+) requires 1151.8.
-
- E-132 was prepared according to GP4 using 39.8 mg of resin (estimated loading 0.125 mmol/g) and I-184 to afford 5.7 mg of E-132 as a white solid. ESI-MS found 1138.3, C212H323N47O64 (M+4H+) requires 1141.3.
-
- E-133 was prepared according to GP4 using 38.5 mg of resin (estimated loading 0.125 mmol/g) and I-185 to afford 4.3 mg of E-133 as a white solid. ESI-MS found 1141.8, C213H325N47O64 (M+4H+) requires 1141.3.
-
- E-134 was prepared according to GP4 using 27 mg of resin (estimated loading 0.18 mmol/g) and I-187 to afford 1.6 mg of E-134 as a white solid. ESI-MS found 1059.5, C192H278N46O61S (M−4H)− requires 1059.0.
-
- E-135 was prepared according to GP4 using 25.1 mg of resin (estimated loading 0.15 mmol/g) and I-188 to afford 3.7 mg of E-135 as a white solid. ESI-MS found 1055.5, C191H274N46O61S (M−4H)− requires 1055.0.
-
- E-136 was prepared according to GP5 using 20.9 mg of resin (estimated loading 0.15 mmol/g) and I-191 to afford 1.6 mg of E-136 as a white solid. ESI-MS found 1065.5, C194H278N46O61S (M−4H)− requires 1065.0.
-
- E-137 was prepared according to GP5 using 16.6 mg of resin (estimated loading 0.5 mmol/g) and I-194 to afford 1.3 mg of E-137 as a white solid. ESI-MS found 1069.5, C195H282N46O61S (M−4H)− requires 1069.0.
-
- E-138 was prepared according to GP5 using 16.9 mg of resin (estimated loading 0.5 mmol/g) and I-197 to afford 1.0 mg of E-138 as a white solid. ESI-MS found 1069.5, C195H282N46O61S (M−4H)− requires 1069.0.
-
- E-139 was prepared according to GP4 using 22.2 mg of resin (estimated loading 0.15 mmol/g) and I-200 to afford 0.9 mg of E-139 as a white solid. ESI-MS found 1052.3, C192H279N45O60S (M−4H)− requires 1051.8.
-
- E-140 was prepared according to GP4 using 31 mg of resin (estimated loading 0.15 mmol/g) and I-202 to afford 2.7 mg of E-140 as a white solid. ESI-MS found 1055.8, C193H281N45O60S (M−4H)− requires 1055.3.
-
- E-141 was prepared according to GP4 using 24.7 mg of resin (estimated loading 0.15 mmol/g) and I-204 to afford 1.6 mg of E-141 as a white solid. ESI-MS found 1059.3, C194H283N45O60S (M−4H)− requires 1058.8.
-
- E-142 was prepared according to GP4 using 20.7 mg of resin (estimated loading 0.15 mmol/g) and I-209 to afford 2.4 mg of E-142 as a white solid. ESI-MS found 1056.0, C191H274N46O61S (M−4H)− requires 1055.5.
-
- E-143 was prepared according to GP4 using 21 mg of resin (estimated loading 0.15 mmol/g) and I-213 to afford 2.1 mg of E-143 as a white solid. ESI-MS found 1059.5, C192H278N46O61S (M−4H)− requires 1059.0.
-
- E-144 was prepared according to GP4 using 45.5 mg of resin (estimated loading 0.125 mmol/g) and I-213 to afford 4.8 mg of E-144 as a white solid. ESI-MS found 1153.1, C213H323N47O65S (M+4H+) requires 1152.8.
-
- E-145 was prepared according to GP4 using 23 mg of resin (estimated loading 0.15 mmol/g) and I-217 to afford 3.0 mg of E-145 as a white solid. ESI-MS found 1059.5, C192H278N46O61S (M−4H)− requires 1059.0.
-
- E-146 was prepared according to GP4 using 24.1 mg of resin (estimated loading 0.15 mmol/g) and I-221 to afford 2.5 mg of E-146 as a white solid. ESI-MS found 1059.5, C192H278N46O61S (M−4H)− requires 1059.0.
-
- E-147 was prepared according to GP4 using 42.5 mg of resin (estimated loading 0.125 mmol/g) and I-225 to afford 1.7 mg of E-147 as a white solid. ESI-MS found 1160.8, C214H325N47O66S (M+4H+) requires 1160.3.
-
- E-148 was prepared according to GP4 using 44.5 mg of resin (estimated loading 0.125 mmol/g) and I-229 to afford 2.8 mg of E-148 as a white solid. ESI-MS found 1160.7, C214H325N47O66S (M+4H+) requires 1160.3.
-
- E-149 was prepared according to GP4 using 38.9 mg of resin (estimated loading 0.125 mmol/g) and (R*)-I-234 to afford 5.7 mg of E-149 as a white solid. ESI-MS found 1153.3, C214H327N47O64S (M+4H+) requires 1152.8.
-
- E-150 was prepared according to GP4 using 39 mg of resin (estimated loading 0.125 mmol/g) and (S*)-I-234 to afford 4.2 mg of E-190 as a white solid. ESI-MS found 1153.3, C214H327N47O64S (M+4H+) requires 1152.8.
-
- E-151 was prepared according to GP4 using 43.4 mg of resin (estimated loading 0.125 mmol/g) and I-240 to afford 6.0 mg of E-151 as a white solid. ESI-MS found 1153.6, C213H326N48O64S (M+4H+) requires 1153.1.
-
- E-152 was prepared according to GP4 using 37.7 mg of resin (estimated loading 0.125 mmol/g) and I-243 to afford 1.8 mg of E-152 as a white solid. ESI-MS found 1150.0, C212H324N48O64S (M+4H+) requires 1149.6.
-
- E-153 was prepared according to GP4 using 41 mg of resin (estimated loading 0.125 mmol/g) and I-248 to afford 4.1 mg of E-153 as a white solid. ESI-MS found 1153.3, C214H327N47O64S (M+4H+) requires 1152.8.
-
- E-154 was prepared according to GP4 using 41.1 mg of resin (estimated loading 0.125 mmol/g) and I-249 to afford 6.5 mg of E-154 as a white solid. ESI-MS found 1146.1, C214H328N46O63S (M+4H+) requires 1145.6.
-
- E-155 was prepared according to GP4 using 39.8 mg of resin (estimated loading 0.125 mmol/g) and I-250 to afford 4.7 mg of E-155 as a white solid. ESI-MS found 1145.6, C214H326N46O63S (M+4H+) requires 1145.
-
- E-156 was prepared according to GP4 using 46.9 mg of resin (estimated loading 0.125 mmol/g) and I-257 to afford 2.7 mg of E-156 as a white solid. ESI-MS found 1153.8, C213H325N47O65S (M+4H+) requires 1153.3.
-
- E-157 was prepared according to GP4 using 45.5 mg of resin (estimated loading 0.125 mmol/g) and I-264 to afford 7.0 mg of E-157 as a white solid. ESI-MS found 1153.7, C213H325N47O65S (M+4H+) requires 1153.3.
-
- E-158 was prepared according to GP4 using 44.5 mg of resin (estimated loading 0.125 mmol/g) and I-271 to afford 2.7 mg of E-158 as a white solid. ESI-MS found 1157.2, C214H327N47O65S (M+4H+) requires 1156.8.
-
- E-159 was prepared according to GP4 using 39.9 mg of resin (estimated loading 0.125 mmol/g) and I-278 to afford 2.6 mg of E-159 as a white solid. ESI-MS found 1157.3, C214H327N47O65S (M+4H+) requires 1156.8.
-
- E-160 was prepared according to GP4 using 43.8 mg of resin (estimated loading 0.125 mmol/g) and I-279 to afford 5.5 mg of E-160 as a white solid. ESI-MS found 1150.3, C212H323N47O64S (M+4H+) requires 1149.8.
-
- E-161 was prepared according to GP4 using 39.7 mg of resin (estimated loading 0.125 mmol/g) and I-282 to afford 4.8 mg of E-161 as a white solid. ESI-MS found 1153.9, C212H321N47O66S (M+4H+) requires 1153.3.
-
- E-162 was prepared according to GP4 using 40.4 mg of resin (estimated loading 0.125 mmol/g) and I-289 to afford 5.3 mg of E-162 as a white solid. ESI-MS found 1157.3, C214H327N47O65S (M+4H+) requires 1156.8.
-
- E-163 was prepared according to GP4 using 36.6 mg of resin (estimated loading 0.125 mmol/g) and I-296 to afford 2.9 mg of E-163 as a white solid. ESI-MS found 1157.4, C214H327N47O65S (M+4H+) requires 1156.8.
-
- E-164 was prepared according to GP4 using 41.3 mg of resin (estimated loading 0.125 mmol/g) and I-301 to afford 2.0 mg of E-164 as a white solid. ESI-MS found 1153.7, C212H322N48O65S (M+4H+) requires 1153.1.
-
- E-165 was prepared according to GP4 using 38.4 mg of resin (estimated loading 0.125 mmol/g) and I-307 to afford 5.3 mg of E-165 as a white solid. ESI-MS found 1157.1, C213H324N48O65S (M+4H+) requires 1156.6.
-
- E-166 was prepared according to GP4 using 34.3 mg of resin (estimated loading 0.125 mmol/g) and I-311 to afford 3.3 mg of E-166 as a white solid. ESI-MS found 1157.1, C213H324N48O65S (M+4H+) requires 1156.6.
-
- E-167 was prepared according to GP4 using 30 mg of resin (estimated loading 0.125 mmol/g) and I-320 to afford 4.0 mg of E-167 as a white solid. ESI-MS found 1160.6, C214H326N48O65S (M+4H+) requires 1160.1.
-
- E-168 was prepared according to GP4 using 39.6 mg of resin (estimated loading 0.125 mmol/g) and I-325 to afford 4.9 mg of E-168 as a white solid. ESI-MS found 1153.7, C213H326N48O64S (M+4H+) requires 1153.1.
-
- E-169 was prepared according to GP4 using 39.5 mg of resin (estimated loading 0.125 mmol/g) and I-328 to afford 5.8 mg of E-169 as a white solid. ESI-MS found 1157.1, C213H324N48O65S (M+4H+) requires 1156.6.
-
- E-170 was prepared according to GP4 using 36.3 mg of resin (estimated loading 0.125 mmol/g) and I-332 to afford 4.4 mg of E-170 as a white solid. ESI-MS found 1160.7, C214H326N48O65S (M+4H+) requires 1160.1.
-
- E-171 was prepared according to GP4 using 43.4 mg of resin (estimated loading 0.125 mmol/g) and I-335 to afford 4.3 mg of E-171 as a white solid. ESI-MS found 1157.2, C214H328N48O64S (M+4H+) requires 1156.6.
-
- E-172 was prepared according to GP4 using 42.5 mg of resin (estimated loading 0.125 mmol/g) and I-338 to afford 4.5 mg of E-172 as a white solid. ESI-MS found 1153.5, C213H326N48O64S (M+4H+) requires 1153.1.
-
- E-173 was prepared according to GP4 using 38.5 mg of resin (estimated loading 0.125 mmol/g) and I-343 to afford 4.5 mg of E-172 as a white solid. ESI-MS found 1153.9, C213H325N47O65S (M+4H+) requires 1153.3.
-
- E-174 was prepared according to GP4 using 42.4 mg of resin (estimated loading 0.125 mmol/g) and I-348 to afford 4.5 mg of E-174 as a white solid. ESI-MS found 1157.9, C213H325N47O64S2 (M+4H+) requires 1157.3.
-
- E-175 was prepared according to GP4 using 45 mg of resin (estimated loading 0.125 mmol/g) and I-351 to afford 6.5 mg of E-175 as a white solid. ESI-MS found 1165.8, C213H325N47O66S2 (M+4H+) requires 1165.3.
-
- E-176 was prepared according to GP4 using 38.5 mg of resin (estimated loading 0.125 mmol/g) and I-356 to afford 5.1 mg of E-176 as a white solid. ESI-MS found 1153.9, C213H325N47O65S (M+4H+) requires 1153.3.
-
- E-177 was prepared according to GP4 using 39 mg of resin (estimated loading 0.125 mmol/g) and I-363 to afford 5.2 mg of E-177 as a white solid. ESI-MS found 1157.2, C214H328N48O64S (M+4H+) requires 1156.6.
-
- E-178 was prepared according to GP4 using 38.5 mg of resin (estimated loading 0.125 mmol/g) and I-366 to afford 4.8 mg of E-178 as a white solid. ESI-MS found 1153.7, C213H326N48O64S (M+4H+) requires 1153.1.
-
- E-179 was prepared according to GP4 using 30 mg of resin (estimated loading 0.125 mmol/g) and I-373 to afford 4.1 mg of E-179 as a white solid. ESI-MS found 1157.3, C214H327N47O65S (M+4H+) requires 1156.8.
-
- Peptide E-180 was prepared from 30 mg of resin (approximate loading 0.125 mmol/g) using I-380 and GP4 to afford 2.3 mg of E-180 as a white solid. ESI-MS found 1157.4, C214H327N47O65S (M+4H+) requires 1156.8.
-
- E-181 was prepared according to GP4 using 40.3 mg of resin (estimated loading 0.125 mmol/g) and I-386 to afford 5.5 mg of E-181 as a white solid. ESI-MS found 1157.3, C214H327N47O65S (M+4H+) requires 1156.8.
-
- E-182 was prepared according to GP4 using 41 mg of resin (estimated loading 0.125 mmol/g) and I-392 to afford 5.1 mg of E-182 as a white solid. ESI-MS found 1157.3, C214H327N47O65S (M+4H+) requires 1156.8.
-
- E-183 was prepared according to GP4 using 40.8 mg of resin (estimated loading 0.125 mmol/g) and (S*)-I-395 to afford 4.5 mg of E-183 as a white solid. ESI-MS found 1160.3, C215H327N47O65S (M+4H+) requires 1159.8.
-
- E-184 was prepared according to GP4 using 38 mg of resin (estimated loading 0.125 mmol/g) and (R*)-I-395 to afford 3.0 mg of E-184 as a white solid. ESI-MS found 1160.3, C215H327N47O65S (M+4H+) requires 1159.8.
-
- E-185 was prepared according to GP4 using 34 mg of resin (estimated loading 0.125 mmol/g) and I-398 to afford 2.5 mg of E-185 as a white solid. ESI-MS found 1157.2, C213H323N47O66S (M+4H+) requires 1156.8.
-
- E-186 was prepared according to GP4 using 35.3 mg of resin (estimated loading 0.125 mmol/g) and I-399 to afford 1.3 mg of E-186 as a white solid. ESI-MS found 1157.3, C213H323N47O66S (M+4H+) requires 1156.8.
-
- E-187 was prepared according to GP4 using 39 mg of resin (estimated loading 0.125 mmol/g) and I-404 to afford 3.0 mg of E-187 as a white solid. ESI-MS found 1160.3, C215H327N47O65S (M+4H+) requires 1159.8.
- E-188 was prepared according to GP4 using 45.9 mg of resin (estimated loading 0.125 mmol/g) and (R*)-I-409 to afford 4 mg of E-188 as a white solid. ESI-MS found 1153.3, C214H327N47O64S (M+4H+) requires 1152.8.
- E-189 was prepared according to GP4 using 43.8 mg of resin (estimated loading 0.125 mmol/g) and (S*)-I-409 to afford 4.3 mg of E-189 as a white solid. ESI-MS found 1153.3, C214H327N47O64S (M+4H+) requires 1152.8.
-
- E-190 was prepared according to GP4 using 36.6 mg of resin (estimated loading 0.125 mmol/g) and I-412 to afford 0.5 mg of E-190 as a white solid. ESI-MS found 1159.7, C215H325N47O65S (M+4H+) requires 1159.3.
- E-191 was prepared according to GP4 using 30.2 mg of resin (estimated loading 0.125 mmol/g) and (S*)-I-413 to afford 2.9 mg of E-191 as a white solid. ESI-MS found 1153.4, C214H327N47O64S (M+4H+) requires 1152.8.
- E-192 was prepared according to GP4 using 31.1 mg of resin (estimated loading 0.125 mmol/g) and (R*)-I-413 to afford 3.3 mg of E-192 as a white solid. ESI-MS found 1153.4, C214H327N47O64S (M+4H+) requires 1152.8.
-
- E-193 was prepared according to GP4 using 41.4 mg of resin (estimated loading 0.125 mmol/g) and I-417 to afford 4.1 mg of E-193 as a white solid. ESI-MS found 1157.1, C213H324N48O65S (M+4H+) requires 1156.6.
-
- E-194 was prepared according to GP4 using 42.1 mg of resin (estimated loading 0.125 mmol/g) and I-421 to afford 5.4 mg of E-194 as a white solid. ESI-MS found 1158.8, C212H325N47O65S2 (M+4H+) requires 1158.3.
-
- E-195 was prepared according to GP4 using 50.9 mg of resin (estimated loading 0.125 mmol/g) and I-425 to afford 5.8 mg of E-195 as a white solid. ESI-MS found 1162.3, C213H327N47O65S2 (M+4H+) requires 1161.8.
-
- Peptide E-196 was prepared from 24.9 mg of resin (approximate loading 0.18 mmol/g) using I-426 and GP4 to afford 2.7 mg of E-196 as a white solid. ESI-MS found 1059.4989, C192H278SN46O61 (M−4H)− requires 1059.0.
- The synthesis of carboxylic acid I-430 is depicted in Scheme 138:
- To a solution of amine salt I-427 (165.8 mg, 0.743 mmol), carboxylic acid I-428 (119 mg, 1.0 equiv.) and DIPEA (388 μL, 3.0 equiv.) in DMF (2 mL) at ambient temperature was added HATU (423.8 mg, 1.5 equiv.). The reaction mixture was maintained at ambient temperature for 23 hours and was then purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA) to afford ester I-429 as a colorless oil (180.7 mg, 86% yield).
- To a solution of ester I-429 (90.3 mg, 0.318 mmol) in MeOH (3 mL) and H2O (1 mL) was added lithium hydroxide (15.2 mg, 2.0 equiv.). The reaction mixture was heated to 60° C. for 23 hours, acidified with 6N HCl to pH<2, and then purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA) to afford acid I-430 as a white solid (26.1 mg, 30% yield). ESI-MS found 271.3, C13H23N2O4 (M+4H)4+ requires 271.3.
- The syntheses of compounds I-439 & I-443 involved 8 steps as depicted in the following
Scheme 139. -
- A solution of 4-((tert-butyldimethylsilyl)oxy)dihydro-2H-pyran-2,6(3H)-dione I-431 (cas: 91424-40-7, 5.0 g, 20.5 mmol), benzyl (2-aminoethyl)carbamate (cas: 72080-83-2, 3.97 g, 20.5 mmol) and TEA (6.2 g, 61.5 mmol) in anhydrous THF (150 mL) was stirred at 25° C. for 16 hours. The reaction mixture was concentrated to afford the crude 5-((2-(((benzyloxy)carbonyl)amino)ethyl)amino)-3-((tert-butyldimethylsilyl)oxy)-5-oxopentanoic acid I-432 (8.9 g), which was taken on to the next reaction without further purification. MS (ESI, positive ion) m/z: 439.2 (M+1).
-
- To a mixture of acid I-432 (5 g, 11.4 mmol) and K2CO3 (2.4 g, 17.1 mmol) in anhydrous DMF (30 mL) was added Mel (1.95 g, 13.7 mmol) at 25° C. under N2. The reaction mixture was heated to 50° C. for 5 hours, then concentrated and dissolved in EtOAc (150 mL). The organic phase was washed with water (50 mL×3), dried and concentrated to afford the crude product, which was purified by silica gel chromatography (Petroleum ether:EtOAc=3:1 to 1:1) to provide a pale oil (4.5 g, 87% yield). MS (ESI, positive ion) m/z: 453.2 (M+1).
-
- To a solution of ester I-433 (2 g, 4.4 mmol) in anhydrous THF (200 mL) was added BH3-THF (1 M, 22 mL, 22 mmol) at 0° C. The reaction mixture was heated to 80° C. for 2 hours and cooled to 0° C., then quenched by adding 1 mL of concentrated HCl. The reaction mixture was concentrated and dissolved in EtOAc (150 mL). The organic phase was washed with water (50 mL×3), dried and concentrated to afford the crude amine I-434 (2.5 g), which was taken to the next reaction without further purification. MS (ESI, positive ion) m/z: 439.2 (M+1).
-
- A solution of amine I-434 (2.5 g, 5.7 mmol) and TEA (2.89 g, 28.5 mmol) in anhydrous toluene (150 ml) was heated to 50° C. for 16 hours. The reaction mixture was concentrated and purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA) to afford a brown oil (430 mg, 19% yield). MS (ESI, positive ion) m/z: 407.2 (M+1).
- [5.0 cm I.D.×25 cm L CHIRALCEL OZ column at 35° C.,
flow rate 60 mL/min with Hexane/IPA=80/20 (V/V)] afforded enantiomers I-436 and I-440. -
- To a solution of benzyl (R or S)-(2-(4-((tert-butyldimethylsilyl)oxy)-2-oxopiperidin-1-yl)ethyl)carbamate I-436 (150 mg, 6.82 mmol) in THE (10 ml) was added Pd/C (170 mg) quickly under H2. The reaction was then stirred at ambient temperature for 16 hours, when analysis by LC-MS indicated reaction completion. The reaction mixture was filtered, and the filtrate was concentrated under reduced pressure to afford crude amine I-437 (105 mg), which was taken to the next reaction without further purification. MS (ESI, positive ion) m/z: 273.2 (M+1).
-
- A solution of (R or S)-1-(2-hydroxyethyl)-3-methoxypyrrolidin-2-one (I-437) (100 mg, 0.94 mmol) and thiodiglycolic anhydride (cas: 3261-87-8, 240 mg, 1.84 mmol) in anhydrous THF (5 mL) was stirred at 25° C. for 16 hours. The reaction mixture was concentrated to afford crude acid I-438 (340 mg), which was taken to the next reaction without further purification. MS (ESI, positive ion) m/z: 405.1 (M+1).
-
- To a solution of crude acid I-438 (340 mg) in THF (10 mL) was added HCl/EtOAc (5 M, 2 mL) at 0° C. The reaction mixture was stirred for 12 hours at ambient temperature, then concentrated to afford a residue, which was purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA) to afford acid I-439 as a pale oil (22 mg, 9% yield). MS (ESI, positive ion) m/z: 291.2 (M+1)). 1H NMR (400 MHz, D2O) δ 4.05-4.03 (m, 1H), 3.44-3.24 (m, 6H), 3.22 (s, 2H), 3.17 (s, 2H), 2.55-2.50 (m, 1H), 2.20-2.15 (m, 1H), 1.91-1.87 (m, 1H), 1.73-1.68 (m, 1H).
- A similar sequence of steps with carbamate I-441 afforded acid I-443 (40 mg, 16% yield) as a pale oil.
- The syntheses of intermediates I-451 and I-454 involved 8 steps as depicted in the following
Scheme 140. -
- A mixture of ((2-bromoethoxy)methyl)benzene (cas: 1462-37-9, 10 g, 46.7 mmol) and sodium iodide (10.5 g, 1.5 equiv.) in acetone (250 mL) was heated to reflux for 16 hours. The reaction mixture was concentrated, and the residue was dissolved into EtOAc (200 mL) and diluted with water (100 mL). The organic layer was washed with brine (50 mL×3), dried over anhydrous Na2SO4 and concentrated to afford the crude product, which was purified by silica gel chromatography (Petroleum ether:EtOAc=20:1) to afford iodide I-444 as a brown liquid (7 g, yield: 600%).
-
- A solution of 2-piperidone (cas: 675-20-7, 2 g, 20.2 mmol) in anhydrous THF (50 mL) was added NaH (60% in mineral oil, 1.2 g, 30.3 mmol) at 0° C., then iodide I-444 (10.6 g, 40.4 mmol). The reaction mixture was heated at 80° C. for 16 hours, then quenched by adding 100 mL of saturated aqueous NH4Cl at 0° C. The aqueous phase was extracted with EtOAc (50 mL×3). The organic extracts were combined, dried and concentrated afford the crude product, which was purified by silica gel chromatography (DCM:MeOH=20:1) to afford amide I-445 (1.2 g, yield: 25%) as a pale oil. MS (ESI, positive ion) m/z: 234.2 (M+1).
-
- To a solution of amide I-445 (500 mg, 2.14 mmol) in anhydrous THF (20 mL) was added LDA (2 M, 1.6 mL, 3.2 mmol) at −78° C. under N2. The reaction mixture was stirred for 30 minutes at the same temperature and Mel (914 mg, 6.44 mmol) was added. After 1 hour, LC-MS analysis indicated reaction completion. The reaction mixture was quenched with H2O (20 mL) and extracted with EtOAc (20 mL×3). The combined organic extracts was concentrated to obtain crude product, which was purified by silica gel chromatography (DCM:MeOH=20:1) to provide lactam I-446 as a brown oil (380 mg, 72% yield). MS (ESI, positive ion) m/z: 248.2 (M+1).
-
- To a solution of lactam I-446 (5 g, 20.24 mmol) and acetic acid (0.5 mL) in MeOH (150 mL) was added 10% Pd(OH)2 (300 mg) under H2. The reaction mixture was heated to 50° C. under H2 (3 atm) for 2 days. The reaction mixture was filtered, and the filtrate was concentrated to afford the crude product (3.2 g), which was taken to the next reaction without further purification. MS (ESI, positive ion) m/z: 158.2 (M+1).
-
- A solution of lactam I-447 (200 mg, 1.27 mmol), phthalimide (374 mg, 2.54 mmol) and P(n-Bu)3 (514 mg, 2.54 mmol) in anhydrous THF (10 mL) was stirred at 0° C. for 0.5 hours. Then DIAD (514 mg, 2.54 mmol) was added to the reaction dropwise and the reaction mixture was stirred for 18 hours at ambient temperature. The reaction mixture was concentrated to get crude product, which was purified by silica gel chromatography (Petroleum ether:EtOAc=1:1) to provide imide I-448 as a pale oil (180 mg, 49% yield). MS (ESI, positive ion) m/z: 287.2 (M+1).
-
Step 6. Phthalimide I-448 was subjected to chiral SFC to separate the racemate into its constituent enantiomers. Separation was accomplished using a Superchiral S-AD (Chiralway) column (2.1 cm I.D.×25 cm L, 5 μm at 35° C.,flow rate 10 mL/min with Hexane/EtOH=55/45 (v/v), 30 mg injection) affording 137 mg of each enantiomer (I-449 and I-452) from 400 mg of racemate. -
- To a solution of I-449 (150 mg, 0.52 mmol) in MeOH (10 mL) was added Hydrazine hydrate (cas: 7803-57-8, 80%, 0.3 mL) at 0° C. The reaction mixture was stirred for 12 hours at ambient temperature, then filtered and the filtrate was concentrated. The residue afforded (210 mg) was used directly in the next step. MS (ESI, positive ion) m/z: 157.2 (M+1).
-
- A solution of (R or S)-1-(2-aminoethyl)-3-methylpiperidin-2-one, I-450 (210 mg, 1.36 mmol) and thiodiglycolic anhydride (533 mg, 4.08 mmol) in 5 mL of DCM was stirred at 25° C. for 16 hours. The reaction mixture was concentrated to afford the crude product, which was purified by preparative HPLC (Mobile Phase: MeCN/H2O (with 0.1% TFA)) to afford acid I-451 (40 mg, 11% yield) as a pale oil. MS (ESI, positive ion) m/z: 289.2 (M+1). 1H NMR (400 MHz, D2O) δ 3.43-3.39 (m, 2H), 3.36-3.28 (m, 6H), 3.24 (s, 2H), 2.36-2.31 (m, 1H), 1.80-1.70 (m, 2H), 1.66-1.58 (m, 1H), 1.46-1.39 (m, 1H), 1.08-1.06 (d, 3H).
- A similar sequence of steps from phthalimide I-452 afforded acid I-454 (43 mg, 12% yield) as a pale oil.
- The synthesis of intermediate I-458 is depicted in Scheme 141:
- To a solution of amine salt I-456 (57.3 mg, 0.315 mmol), carboxylic acid I-455 (49.5 mg, 1.0 equiv.) and DIPEA (165 μL, 3.0 equiv.) in DMF (1 mL) at ambient temperature was added HATU (179.7 mg, 1.5 equiv.). The reaction mixture was maintained at ambient temperature for 2 hours and was then purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% AcOH) to afford ester I-457 as a colorless oil (75.3 mg, 84% yield).
- To ester I-457 (75.3 mg, 0.265 mmol) was added TFA (4 mL). The reaction mixture was maintained at ambient temperature for 4 hours, then concentrated. The residue afforded was purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA) to afford acid I-458 as a white solid (42.3 mg, 70% yield). ESI-MS found 227.1. C10H15N2O4 (M−H)− requires 227.1.
- The synthesis of intermediate I-461 is depicted in Scheme 142:
- To a solution of amine salt I-456 (57.1 mg, 0.314 mmol), carboxylic acid I-455 (53.8 mg, 1.0 equiv.) and DIPEA (164 μL, 3.0 equiv.) in DMF (1 mL) at ambient temperature was added HATU (179.3 mg, 1.5 equiv.). The reaction mixture was maintained at ambient temperature for 3 hours and was then purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% AcOH) to afford ester I-460 as a colorless oil (81.1 mg, 87% yield).
- To ester I-460 (81.1 mg, 0.272 mmol) was added TFA (4 mL). The reaction mixture was maintained at ambient temperature for 4 hours, then concentrated. The residue afforded was purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA) to afford acid I-461 as a white solid (73.8 mg, quantitative yield). ESI-MS found 243.3. C11H19N2O4 (M+H)+ requires 243.1.
- The synthesis of intermediate I-464 is depicted in Scheme 143:
- To a solution of amine salt I-462 (96.6 mg, 0.493 mmol), carboxylic acid I-455 (77.5 mg, 1.0 equiv.) and DIPEA (258 μL, 3.0 equiv.) in DMF (1 mL) at ambient temperature was added HATU (281.4 mg, 1.5 equiv.). The reaction mixture was maintained at ambient temperature for 16 hours and was then purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% AcOH) to afford ester I-463 as a white solid (127.6 mg, 87% yield). To ester I-463 (127.6 mg, 0.428 mmol) was added TFA (4 mL). The reaction mixture was maintained at ambient temperature for 4 hours, then concentrated. The residue afforded was purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA) to afford acid I-464 as a white solid (115.7 mg, quantitative yield). ESI-MS found 243.3. C11H19N2O4 (M+H)+ requires 243.1.
- The synthesis of intermediate I-466 is depicted in
Scheme 144 - To a solution of amine salt I-462 (93.1 mg, 0.476 mmol), carboxylic acid I-459 (81.4 mg, 1.0 equiv.) and DIPEA (249 μL, 3.0 equiv.) in DMF (2 mL) at ambient temperature was added HATU (271.2 mg, 1.5 equiv.). The reaction mixture was maintained at ambient temperature for 3 hours and was then purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% AcOH) to afford ester I-465 as a colorless oil (133 mg, 90% yield).
- To ester I-465 (133 mg, 0.426 mmol) was added TFA (4 mL). The reaction mixture was maintained at ambient temperature for 4 hours, then concentrated. The residue afforded was purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA) to afford acid I-466 as a white solid (108.4 mg, >99% yield). ESI-MS found 257.3. C12H21N2O4 (M+H)+ requires 257.1.
- The synthesis of intermediate I-469 is depicted in Scheme 145:
- To a solution of amine salt I-467 (80.1 mg, 0.441 mmol), carboxylic acid I-455 (69.3 mg, 1.0 equiv.) and DIPEA (231 μL, 3.0 equiv.) in DMF (2 mL) at ambient temperature was added HATU (251.6 mg, 1.5 equiv.). The reaction mixture was maintained at ambient temperature for 16 hours and was then purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% AcOH) to afford ester I-468 as a colorless oil (112.4 mg, 90% yield).
- To ester I-468 (112.4 mg, 0.395 mmol) was added TFA (4 mL). The reaction mixture was maintained at ambient temperature for 4 hours, then concentrated. The residue afforded was purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA) to afford acid I-469 as a white solid (79.1 mg, 88% yield). ESI-MS found 229.2. C10H17N2O4 (M+H)+ requires 229.1.
- The synthesis of intermediate I-471 is depicted in Scheme 146:
- To a solution of amine salt I-467 (87.9 mg, 0.484 mmol), carboxylic acid I-459 (82.8 mg, 1.0 equiv.) and DIPEA (253 μL, 3.0 equiv.) in DMF (2 mL) at ambient temperature was added HATU (275.8 mg, 1.5 equiv.). The reaction mixture was maintained at ambient temperature for 16 hours and was then purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% AcOH) to afford ester I-470 as a colorless oil (131.9 mg, 91% yield).
- To ester I-470 (131.9 mg, 0.442 mmol) was added TFA (4 mL). The reaction mixture was maintained at ambient temperature for 4 hours, then concentrated. The residue afforded was purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA) to afford acid I-471 as a white solid (102.2 mg, 95% yield). ESI-MS found 243.3. C11H19N2O4 (M+H)+ requires 243.1.
- The synthesis of intermediate I-474 is depicted in Scheme 147:
- To a solution of amine salt I-472 (79.1 mg, 0.436 mmol), carboxylic acid I-455 (68.4 mg, 1.0 equiv.) and DIPEA (228 μL, 3.0 equiv.) in DMF (2 mL) at ambient temperature was added HATU (248.4 mg, 1.5 equiv.). The reaction mixture was maintained at ambient temperature for 16 hours and was then purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% AcOH) to afford ester I-473 as a colorless oil (105.9 mg, 86% yield).
- To ester I-473 (105.9 mg, 0.372 mmol) was added TFA (4 mL). The reaction mixture was maintained at ambient temperature for 4 hours, then concentrated. The residue afforded was purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA) to afford acid I-474 as a white solid (100.5 mg, quantitative yield). ESI-MS found 229.2. C10H17N2O4 (M+H)+ requires 229.1.
- The synthesis of intermediate I-476 is depicted in Scheme 148:
- To a solution of amine salt I-472 (74.4 mg, 0.41 mmol), carboxylic acid I-459 (70.1 mg, 1.0 equiv.) and DIPEA (214 μL, 3.0 equiv.) in DMF (2 mL) at ambient temperature was added HATU (233.6 mg, 1.5 equiv.). The reaction mixture was maintained at ambient temperature for 16 hours and was then purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% AcOH) to afford ester I-475 as a colorless oil (104.3 mg, 85% yield).
- To ester I-475 (104.3 mg, 0.35 mmol) was added TFA (4 mL). The reaction mixture was maintained at ambient temperature for 4 hours, then concentrated. The residue afforded was purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA) to afford acid I-476 as a white solid (96.6 mg, quantitative yield). ESI-MS found 243.2. C11H19N2O4 (M+H)+ requires 243.1.
- The synthesis of intermediate I-478 is depicted in Scheme 149:
- To a solution of 2,5-dioxopyrrolidin-1-yl(tert-butoxycarbonyl)glycinate (50 mg, 0.183 mmol) in 1 mL of anhydrous DCM was added piperidine (0.2 mL, 5 equiv.). The reaction mixture was stirred at room temperature for 18 hours, then diluted with 5 mL of DCM, washed with 1N HCl (5 mL), saturated aqueous NaHCO3(5 mL) and brine (5 mL). The organic extracts were dried (Na2SO4) and concentrated to afford a residue, which was purified by silica gel chromatography to afford the amide I-477 (35 mg, 81% yield).
- Amide I-477 (35 mg, 0.15 mmol) was dissolved in 1:1 DCM/TFA (3 mL). After 1 hour at room temperature, the reaction mixture was concentrated and held under high vacuum for 1 hour. The resulting oil and thiodiglycolic anhydride (21.5 mg, 1.1 equiv.) were dissolved in DCM (3 mL), and TEA (65 μL, 2.5 equiv.) was added. After 25 minutes, the reaction mixture was concentrated and purified by preparative HPLC (H2O/MeCN with 0.1% TFA) to afford 14.6 mg (5% yield) of acid I-478. ESI-MS found 275.1, C11H19N2O4S (MH+) requires 275.1.
- The synthesis of intermediate I-486 is depicted in Scheme 150:
-
- A solution of 3-methylpyridin-2(1H)-one, I-483 (cas: 1003-56-1, 3.0 g, 27.52 mmol, 1.0 equiv.), KI (0.913 g, 5.50 mmol, 0.2 equiv.), NaH (60%, 1.321 g, 33.02 mmol, 1.2 equiv.), in DMF (20 mL) was stirred under nitrogen at 0° C. for 1 hour. Then the reaction mixture was added to a solution of tert-butyl (2-bromoethyl)carbamate (cas: 39684-80-5, 9.205 g, 41.28 mmol, 1.5 equiv.) in DMF (20 mL) dropwise. The reaction mixture was stirred at 0° C. for other 1 hour and then 25° C. for another 48 hours. LCMS analysis showed ˜50% conversion. Then H2O (50 mL) was added and the mixture was extracted with EtOAc (100 mL×3). The organic phase was dried and purified by silica gel chromatography (20%-50% EtOAc with Petroleum ether) to afford the product tert-butyl (2-(3-methyl-2-oxopyridin-1(2H)-yl)ethyl)carbamate I-484 (1.2 g, 17% yield, 95% purity) as white solid, MS (ESI, positive ion) m/z: 253 (M+1) and byproduct: tert-butyl (2-((3-methylpyridin-2-yl)oxy)ethyl)carbamate (0.2 g, 3% yield, 95% purity), MS (ESI, positive ion) m/z: 253.1 (M+1).
-
- To the solution of tert-butyl (2-(3-methyl-2-oxopyridin-1(2H)-yl)ethyl)carbamate I-484 (1.2 g, 4.76 mmol, 1.0 equiv.) in DCM (20 mL) was added TFA (10 mL). The solution was stirred for 2 h at 25° C. After completion, the mixture was concentrated and the remained TFA was removed by centrifugation to give light yellow oil (0.7 g, TFA salt, 97% yield, 60% purity by LCMS). MS (ESI, positive ion) m/z: 153.1 (M+1).
-
- A solution of 1-(2-aminoethyl)-3-methylpyridin-2(1H)-one (0.7 g, 4.61 mmol, 1.0 equiv.), TEA (1.397 g, 13.83 mmol, 3.0 equiv.), thiodiglycolic anhydride (0.913 g, 6.92 mmol, 1.5 equiv.) in DCM (10 mL) was stirred for 36 hours at 25° C. After completion, the reaction mixture was concentrated. The residue was purified by Preparative HPLC (Mobile Phase: ACN-H2O) to afford I-486 (119.7 mg, 9% yield, 99.2% purity) as a white solid. MS (ESI, positive ion) m/z: 285.1 (M+1). 1H NMR (400 MHz, D2O) δ 7.41-7.36 (m, 1H), 7.32 (dd, 1H), 6.31 (t, 1H), 4.07-4.01 (m, 2H), 3.54-3.48 (m, 2H), 3.17 (d, 4H), 1.99 (s, 3H).
- The synthesis of intermediate I-490 is depicted in Scheme 151:
-
- To a solution of 6-methylpyridin-2(1H)-one I-487 (cas: 3279-76-3, 5.0 g, 45.87 mmol, 1.0 equiv.), Cs2CO3 (29.91 g, 91.74 mmol, 2.0 equiv.) in anhydrous DMF (40 mL) was added tert-butyl (2-bromoethyl)carbamate (cas: 39684-80-5, 15.34 g, 68.81 mmol, 1.5 equiv.). The reaction mixture was stirred at 90° C. for 4 hours. After completion, the reaction mixture was purified by reversed flash column (Mobile Phase: MeCN—H2O, Gradient: 20-30% H2O) to afford tert-butyl (2-(6-methyl-2-oxopyridin-1(2H)-yl)ethyl)carbamate, I-488 (3.0 g, 26% yield, 95% purity) as a white solid, MS (ESI, positive ion) m/z: 253.1 (M+1) and byproduct: tert-butyl (2-((6-methylpyridin-2-yl)oxy)ethyl)carbamate (7.0 g, 61% yield, 95% purity) as a white solid, MS (ESI, positive ion) m/z: 253.1 (M+1).
-
- To a solution of tert-butyl (2-(6-methyl-2-oxopyridin-1(2H)-yl)ethyl)carbamate, I-488 (1.5 g, 5.95 mmol, 1.0 equiv.) in DCM (20 mL) was added TFA (10 mL). The reaction mixture was stirred for 2 hours at 25° C. After completion, the reaction mixture was concentrated and the remained TFA was removed by centrifugation to give amine I-489 as a light yellow oil (0.9 g, TFA salt, 101% yield, 90% purity). MS (ESI, positive ion) m/z: 153.1 (M+1).
-
- The solution of 1-(2-aminoethyl)-6-methylpyridin-2(1H)-one, I-489 (0.9 g, 5.92 mmol, 1.0 equiv.), TEA (1.79 g, 17.76 mmol, 3.0 equiv.), thiodiglycolic anhydride (1.172 g, 8.88 mmol, 1.5 equiv.) in DCM (10 mL) was stirred for 24 hours at 25° C. After completion, the reaction mixture was concentrated. The residue was purified by preparative HPLC (Mobile Phase: ACN-H2O, Gradient: 5-10% MeCN) to afford carboxylic acid I-490 (119 mg, 7% yield, 99.6% purity) as a light yellow solid. MS (ESI, positive ion) m/z: 285.1 (M+1). 1H NMR (400 MHz, D2O) δ 7.39 (dd, 1H), 6.34 (dd, 2H), 4.13 (t, 2H), 3.50 (t, 2H), 3.20 (s, 2H), 3.17 (s, 2H), 2.35 (s, 3H).
- The synthesis of carboxylic acid I-494 involved 3 steps as depicted in the following Scheme 152:
-
- A solution of 4-methylpyridin-2(1H)-one, I-491 (cas: 13466-41-6, 5.0 g, 45.87 mmol, 1.0 equiv.), KI (1.522 g, 9.17 mmol, 0.2 equiv.), NaH (60%, 2.20 g, 55.04 mmol, 1.2 equiv.) in DMF (20 ml) was stirred under nitrogen at 0° C. for 1 hour. Then the mixture was added to a solution of tert-butyl (2-bromoethyl)carbamate (cas: 39684-80-5, 15.34 g, 68.80 mmol, 1.5 equiv.) in DMF (30 mL) dropwise. The reaction mixture was stirred at 0° C. for 1 hour and then 25° C. for other 12 hours. LCMS showed ˜50% conversion, at which point H2O (50 mL) was added and the reaction mixture was extracted with EtOAc (100 mL×3). The organic phase was dried and purified by flash (20%-50% EtOAc with Petroleum ether) to afford tert-butyl (2-(4-methyl-2-oxopyridin-1(2H)-yl)ethyl)carbamate, I-492 (1.3 g, 11% yield, 95% purity) as a white solid, MS (ESI, positive ion) m/z: 253 (M+1) and by product: tert-butyl (2-((4-methylpyridin-2-yl)oxy)ethyl)carbamate (0.2 g, 2% yield, 95% purity), MS (ESI, positive ion) m/z: 253 (M+1).
-
- To a solution of tert-butyl (2-(4-methyl-2-oxopyridin-1(2H)-yl)ethyl)carbamate, I-492 (1.3 g, 5.16 mmol, 1.0 equiv.) in DCM (20 mL) was added TFA (10 ml). The solution was stirred for 2 hours at 25° C. After completion, the reaction mixture was concentrated and the remained TFA was removed by centrifugation to afford amine I-493 as a light yellow oil (0.8 g, TFA salt, 102% yield, 90% purity by LCMS). MS (ESI, positive ion) m/z: 153.1 (M+1).
-
- The solution of 1-(2-aminoethyl)-4-methylpyridin-2(1H)-one, I-493 (0.8 g, 5.26 mmol, 1.0 equiv.), TEA (1.593 g, 15.78 mmol, 3.0 equiv.), thiodiglycolic anhydride (1.041 g, 7.89 mmol, 1.5 equiv.) in DCM (10 mL) was stirred for 12 hours at 40° C. After completion, the reaction mixture was concentrated. The residue was purified by preparative HPLC (Mobile Phase: ACN-H2O, Gradient: 5-10% MeCN) to afford I-494 (114.2 mg, 8% yield, 99.6% purity) as a white solid. MS (ESI, positive ion) m/z: 285.1 (M+1). 1H NMR (400 MHz, D2O) δ 7.36 (d, 1H), 6.36 (s, 1H), 6.31 (dd, 1H), 4.03-3.97 (m, 2H), 3.52-3.47 (m, 2H), 3.20 (s, 2H), 3.16 (s, 2H), 2.14 (s, 3H).
- The synthesis of carboxylic acid I-498 involved 3 steps as depicted in the following
Scheme 153. -
- A solution of 5-methylpyridin-2(1H)-one, I-495 (cas: 1003-68-5, 5.0 g, 45.87 mmol, 1.0 equiv.), KI (1.522 g, 9.17 mmol, 0.2 equiv.), and NaH (60%, 2.20 g, 55.04 mmol, 1.2 equiv.) in DMF (20 ml) was stirred under nitrogen at 0° C. for 1 hour. Then the reaction mixture was added to a solution of tert-butyl (2-bromoethyl)carbamate (cas: 39684-80-5, 15.34 g, 68.80 mmol, 1.5 equiv.) in DMF (30 mL) dropwise. The reaction mixture was stirred at 0° C. for 1 hour and then 25° C. for 12 hours. LCMS analysis showed ˜50% conversion, at which point H2O (50 mL) was added and the reaction mixture was extracted with EtOAc (100 mL×3). The organic phase was dried and purified by silica gel chromatography (20%-50% EtOAc with Petroleum ether) to give the product tert-butyl (2-(5-methyl-2-oxopyridin-1(2H)-yl)ethyl)carbamate, I-496 (1.7 g, 15% yield, 95% purity) as a white solid, MS (ESI, positive ion) m/z: 253 (M+1) and byproduct: tert-butyl (2-((5-methylpyridin-2-yl)oxy)ethyl)carbamate (0.4 g, 3% yield, 95% purity), MS (ESI, positive ion) m/z: 253 (M+1).
-
- To a solution of tert-butyl (2-(4-methyl-2-oxopyridin-1(2H)-yl)ethyl)carbamate, I-496 (1.7 g, 6.74 mmol, 1.0 equiv.) in DCM (20 mL) was added TFA (10 mL) and the reaction mixture was stirred for 2 hours at 25° C. After completion, the reaction mixture was concentrated and the remaining TFA was removed by centrifugation to give the amine I-497 as a light yellow oil (1.0 g, TFA salt, 103% yield, 90% purity by LCMS). MS (ESI, positive ion) m/z: 153.1 (M+1).
-
- A solution of 1-(2-aminoethyl)-5-methylpyridin-2(1H)-one, I-497 (1.0 g, 6.58 mmol, 1.0 equiv.), TEA (1.994 g, 19.74 mmol, 3.0 equiv.), and thiodiglycolic anhydride (1.303 g, 9.87 mmol, 1.5 equiv.) was stirred in DCM (10 mL) for 12 hours at 40° C. After completion, the reaction mixture was concentrated. The residue was purified by preparative HPLC (Mobile Phase: ACN-H2O, Gradient: 5-10% MeCN) to give I-498 (106 mg, 7% yield) as a white solid. MS (ESI, positive ion) m/z: 285.1 (M+1). 1H NMR (400 MHz, D2O) δ 7.44 (dd, 1H), 7.30 (s, 1H), 6.47 (d, 1H), 4.05-3.98 (m, 2H), 3.56-3.49 (m, 2H), 3.21 (s, 2H), 3.17 (s, 2H), 2.01 (s, 3H).
- The synthesis of intermediate I-505 is depicted in Scheme 155:
- To a solution of amine hydrochloride I-427 (144 mg, 0.645 mmol) and DIPEA (225 μL, 2.0 equiv.) in DCM (5 mL) that had been cooled in an ice-water bath was added acid chloride I-503 (88.1 mg, 1.0 equiv.). The reaction mixture was gradually allowed to warm to ambient temperature and after 3 hours was concentrated to a residue that was purified by preparative HPLC (MeCN/H2O with 0.1% TFA) to afford ester I-504 (163.8 mg, >99% yield) as a colorless oil.
- To a solution of ester I-504 (78 mg, 0.322 mmol) in MeOH (3 mL) and H2O (1 mL) was added lithium hydroxide (23.1 mg, 3.0 equiv.). The reaction mixture was stirred for 2 hours at ambient temperature at which point analysis by LC-MS indicated that the reaction was complete. The reaction mixture was concentrated and diluted with H2O (1 mL), then acidified to pH-1 with 2N HCl. The solution was subjected to purification by preparative HPLC (MeCN/H2O with 0.1% TFA) to afford carboxylic acid I-505 (56.5 mg, 82% yield) as a white solid. ESI-MS found 215.3, C9H15N2O4 (MH+) requires 215.1.
- The synthesis of intermediate I-507 is depicted in Scheme 156:
- Amine I-506 (84.2 mg, 0.584 mmol) was treated with Glutaric anhydride (66.6 mg, 1.0 equiv.) in DMF (1.1 mL). After 1.5 hours the reaction mixture was subjected to purification by preparative HPLC (MeCN/H2O with 0.1% TFA) to afford carboxylic acid I-507 (40 mg, 27% yield) as a colorless oil. ESI-MS found 259.2, C11H19N2O5 (MH+) requires 259.1.
- The synthesis of intermediate I-508 is depicted in Scheme 157:
- Amine I-506 (96 mg, 0.666 mmol) was treated with 2,2-dimethylsuccinic anhydride (96 mg, 1.1 equiv.) in DMF (1 mL). After 16 hours the reaction mixture was subjected to purification by preparative HPLC (MeCN/H2O with 0.1% TFA) to afford carboxylic acid I-508 (24.8 mg, 14% yield) as a colorless oil.
- The synthesis of intermediate I-510 is depicted in Scheme 158:
- To a solution of amine I-506 (169.5 mg, 1.174 mmol) and DIPEA (614 μL, 3.0 equiv.) in DCM (5 mL) that had been cooled in an ice-water bath was added acid chloride I-500 (209.3 mg, 1.0 equiv.). The reaction mixture was allowed to warm to ambient temperature and after 1.5 hours was concentrated to a residue to afford crude ester I-509 as a colorless oil, which was redissolved in MeOH (3 mL). A solution of lithium hydroxide (84.4 mg, 3.0 equiv.) in H2O (1 mL) was added. The reaction mixture was stirred for 17 hours at ambient temperature. The reaction mixture was concentrated and 1 M NaHSO4 and 6N HCl was added to afford a solution of pH˜1.5. Purification by preparative HPLC (MeCN/H2O with 0.1% TFA) afforded carboxylic acid I-510 (125.3 mg, 41% yield) as a colorless oil. ESI-MS found 259.2, C11H19N2O5 (MH+) requires 259.1.
- The synthesis of intermediate I-513 is depicted in Scheme 159:
- To a solution of amine dihydrochloride I-511 (138.5 mg, 0.656 mmol) and DIPEA (343 μL, 3.0 equiv.) in DCM (4 mL) that had been cooled in an ice-water bath was added acid chloride I-500 (117.2 mg, 1.0 equiv.). The reaction mixture was allowed to warm to ambient temperature and after 1.5 hours was deemed complete by LC-MS analysis. The reaction mixture was concentrated to a residue to afford crude ester I-512 as a colorless oil, which was redissolved in MeOH (2 mL). A solution of lithium hydroxide (47.2 mg, 3.0 equiv.) in H2O (1 mL) was added. The reaction mixture was stirred for 17 hours at ambient temperature. Additional LiOH (47.2 mg, 3.0 equiv.) in H2O (1 mL) was added and stirring was continued for 2 more hours. The reaction mixture was concentrated and 6N HCl was added to afford a solution of pH˜1.5. Purification by preparative HPLC (MeCN/H2O with 0.1% TFA) afforded carboxylic acid I-513 (136 mg, 82% yield). ESI-MS found 253.2, C12H17N2O4 (MH+) requires 253.1.
- The synthesis of intermediate I-516 is depicted in Scheme 160:
- To a solution of amine salt I-427 (62.8 mg, 0.281 mmol), carboxylic acid I-514 (52.4 mg, 1.0 equiv.) and DIPEA (147 μL, 3.0 equiv.) in DMF (1 mL) at ambient temperature was added PyAOP (190.7 mg, 1.3 equiv.). The reaction mixture was maintained at ambient temperature for 17 hours and was then purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA) to afford ester I-515 as a colorless oil (68.7 mg, 79% yield).
- To a solution of ester I-515 (68.7 mg, 0.221 mmol) in MeOH (2 mL) and H2O (1 mL) was added lithium hydroxide (15.9 mg, 3.0 equiv.). The reaction mixture was stirred at ambient temperature for 3 hours, then acidified with 6N HCl to pH<2, then purified by preparative HPLC (Mobile Phase: MeCN/H2O with 0.1% TFA) to afford acid I-516 as a white solid (33.9 mg, 54% yield). ESI-MS found 283.3, C14H23N2O4 (M+4H)4+ requires 283.2.
-
- Prepared according to GP1. Yield: 32.5 mg (74%). ESI-MS found 323.1, C15H19N2O4S (MH+) requires 323.1.
-
- Prepared according to GP1. Yield: 18 mg (39%). ESI-MS found 323.3, C15H19N2O4S (MH+) requires 323.1.
- The synthesis of I-552 involved 5 steps as depicted in the following
Scheme 161. - The chemical structure of the target compound was confirmed by 1H NMR and LC-MS with the purity >90% (
HPLC 214 & 254 nm). -
- To a solution of (1S,4R)-2-azabicyclo[2.2.1]hept-5-en-3-one, I-547 (2.18 g, 20.0 mmol, CAS:13031-83-8) in anhydrous THF (30 mL) was added LDA (10 mL, 2 M in THF, 1.0 equiv.) at 0° C. The mixture was stirred at 0° C. for 0.5 hours and oxirane (20 mL, 20.0 equiv.) was added. The reaction mixture was allowed to warm to 20° C. and maintained at that temperature for another 16 hours. After the reaction was deemed complete, the pH of the reaction mixture was adjusted to 6 with 1N HCl. The reaction mixture was concentrated to a volume of approximately 5 mL and purified by reversed phase column chromatography (Cis column, 20-35 μm, 100 Å, 80 g, 0.1% v/v Formic acid in MeCN/H2O) to afford the alcohol I-548 (1.3 g, 43% yield). MS (ESI, pos. ion) m/z: 154.1, (MH+).
-
- To a solution of methyl (1S,4R)-2-(2-hydroxyethyl)-2-azabicyclo[2.2.1]hept-5-en-3-one, I-548 (1.3 g, 8.50 mmol) and TEA (2.5 g, 3.0 equiv.) in anhydrous THF (20 mL) was added MsCl (1.46 g, 1.5 equiv.). The reaction mixture was stirred at 20° C. for 16 hours, then diluted with water (50 mL), and extracted with EtOAc (50 mL). The organic extract was dried over sodium sulfate, and concentrated to afford the crude mesylate I-549 as a yellow oil (1.8 g, 92% yield), which was used for the next step. MS (ESI, pos. ion) m/z: 232.0, (MH+).
-
- To a solution of crude 2-((1S,4R)-3-oxo-2-azabicyclo[2.2.1]hept-5-en-2-yl)ethyl methanesulfonate, I-549 (1.8 g, 7.79 mmol) in EtOH (20 mL) was added concentrated aqueous NH3 (25-28% solution, 5 mL). The mixture was stirred at 100° C. for 0.5 hours. After completion, the reaction mixture was concentrated to ca. 5 mL and purified by reversed phase column chromatography (0.1% Formic acid in MeCN/H2O) to afford the desired amine I-550 as a colorless syrup (550 mg, 47% yield). MS (ESI, pos. ion) m/z: 153.1, (MH+).
-
- A slurry of (1S,4R)-2-(2-aminoethyl)-2-azabicyclo[2.2.1]hept-5-en-3-one, I-550 (200 mg, 1.32 mmol) and Pd/C (10%, 100 mg) in EtOH (6 mL) was stirred under H2 (1 atm) at 20° C. for 16 hours. The reaction mixture was then filtered, and the filtrate was concentrated to afford the desired amine I-551 as a colorless syrup (200 mg, 98% yield). MS (ESI, pos. ion) m/z: 155.1, (MH+).
-
- To a solution of (1R,4S)-2-(2-aminoethyl)-2-azabicyclo[2.2.1]heptan-3-one (200 mg, 1.30 mmol) in DMF (3 mL) was added thiodiglycolic anhydride (343 mg, 2.0 equiv.), and the reaction mixture was stirred at 40° C. for 16 hours, then purified by reversed phase column chromatography (0.1% Formic acid in MeCN/H2O) to afford acid I-552 as a colorless syrup (160 mg, 42% yield). MS (ESI, pos. ion) m/z: 287.1, (MH+). 1H NMR (400 MHz, D2O) δ 4.04 (s, 1H), 3.42-3.54 (m, 2H), 3.31-3.38 (m, 5H), 3.03-3.09 (m, 1H), 2.80-2.81 (m, 1H), 1.90-1.98 (m, 1H), 1.80-1.86 (m, 2H), 1.59-1.65 (m, 1H), 1.39-1.46 (m, 2H).
- The synthesis of intermediate I-557 involved 4 steps as described in the following
Scheme 162. - The chemical structure of the target compound was confirmed by 1H NMR and LC-MS with the purity >95% (
HPLC 214 & 254 nm). -
- To a solution of (1R,4S)-2-azabicyclo[2.2.1]hept-5-en-3-one (3 g, CAS: 79200-56-9, 27.5 mmol) in THF (50 mL) was added LDA (2 M in THF, 13.8 mL, 1.0 equiv.) at 25° C. The reaction mixture was stirred for 1 h at 25° C. and then oxirane (cas: 75-21-8, 20 mL, 17.6 g, 0.4 mol, 14.5 equiv.) was added. The reaction mixture was stirred at 25° C. for 48 hours. When the reaction was deemed complete by LC-MS analysis, the pH of the reaction mixture was adjusted to 6-7 with HCl (1 M). The reaction mixture was concentrated to a residue, which was purified by reversed phase column chromatography (0.1% Formic acid in MeCN/H2O) to afford (1R,4S)-2-(2-hydroxyethyl)-2-azabicyclo [2.2.1]hept-5-en-3-one, I-554(2.8 g, 67% yield) as a yellow oil. MS (ESI, pos. ion) found m/z: 154.1 (MH+).
-
- To a solution of (1R,4S)-2-(2-hydroxyethyl)-2-azabicyclo[2.2.1]hept-5-en-3-one (2.8 g, 18.3 mmol) in THE (50 mL) was added TEA (5.5 g, 3.0 equiv.) and MsCl (2.08 g, 1.0 equiv.) at 25° C. The reaction mixture was stirred at 25° C. for 2 hours. When the reaction was deemed complete by LC-MS analysis, the reaction mixture diluted with water (50 mL), and extracted with EtOAc (50 mL). The organic extract was washed with water (2×40 mL), brine (2×30 mL) and dried over anhydrous Na2SO4, then concentrated to afford the crude mesylate I-555 (3.0 g, 71% yield) as a yellow solid, which was used for next step without further purification. MS (ESI, neg. ion) m/z: 232.0 (M+1).
-
- To a solution of crude mesylate I-555 (3.0 g, 12.9 mmol) in EtOH (20 mL) was added concentrated aqueous ammonia (25-28% solution, 5 mL), and the reaction mixture was stirred at 100° C. for 1 hour, then concentrated to ca. 5 mL and purified by reversed phase column chromatography (0.1% Formic acid in MeCN/H2O) to afford the desired amine I-556(1.8 g, 95% yield) as a colorless syrup. MS (ESI, pos. ion) m/z: 153.1, (MH+).
-
- To a solution of (1R,4S)-2-(2-aminoethyl)-2-azabicyclo[2.2.1]hept-5-en-3-one (1.4 g, 9.1 mmol) in DMF (3 mL) was added thiodiglycolic anhydride (2.4 g, 2.0 equiv.), and the reaction mixture was stirred at 40° C. for 12 hours. The reaction mixture was purified by Preparatory HPLC (0.1% Formic acid in MeCN/H2O) to afford carboxylic acid I-557 (33.1 mg, 1% yield) a white solid. MS (ESI, pos. ion) m/z: 285.1, (MH+). 1H NMR (400 MHz, D2O) δ 6.18-6.24 (m, 1H), 6.01-6.05 (m, 1H), 5.59-5.61 (m, 0.5H), 5.25-5.27 (m, 0.5H), 4.17-4.24 (m, 0.5H), 3.89-3.95 (m, 0.5H), 3.56-3.82 (m, 4H), 3.37-3.54 (m, 4H), 2.44-2.61 (m, 2H).
- The synthesis of intermediate I-559 from previously described intermediate I-556 involved 2 steps as depicted in the following
Scheme 163. - The chemical structure of the target compound was confirmed by 1H NMR and LC-MS with the purity >90% (
HPLC 214 & 254 nm). -
- A solution of amine I-556 (1.0 g, 6.6 mmol) and 10% Pd/C (300 mg) in EtOH (10 mL) was stirred under H2 (1 atm) at 20° C. for 16 hours. The reaction mixture was then filtered, and the filtrate was concentrated to afford the amine I-558 (1.0 g, 98% yield) as a colorless syrup. MS (ESI, pos. ion) m/z: 155.1 (M+1).
-
- To a solution of amine I-558 (1.0 g, 6.6 mmol) in DMF (10 mL) was added thiodiglycolic anhydride (1.7 g, 2.0 equiv.). The reaction mixture was stirred at 40° C. for 36 hours, then purified directly by Preparative HPLC (0.1% TFA in MeCN/H2O) to afford carboxylic acid I-559 (46.1 mg, 3% yield) as a colorless syrup. MS (ESI, pos. ion) m/z: 287.1, (MH+). 1H NMR (400 MHz, D2O) δ 4.06 (s, 1H), 3.46-3.54 (m, 2H), 3.31-3.38 (m, 5H), 3.05-3.11 (m, 1H), 2.82 (s, 1H), 1.94-1.99 (m, 1H), 1.81-1.88 (m, 2H), 1.59-1.65 (m, 1H), 1.34-1.48 (m, 2H).
- The synthesis of I-571 involved 9 steps as described in the following
Scheme 164. - The chemical structure of the target compound was confirmed by 1H NMR and LC-MS with the purity >95% (
HPLC 214 & 254 nm). -
- To a solution of (2,4-dimethoxyphenyl)methanol, I-560 (10 g, 59.5 mmol) in Et2O (100 mL) was added pyridine (4.65 g, 1.0 equiv.), and SOCl2 (7.02 g, 1.0 equiv.) at 0° C. The reaction mixture was stirred at 0° C. for 2 hours, then poured into ice water (120 mL) and the layers were separated. The aqueous layer was extracted with diethyl ether (2×60 mL) and the combined organic extracts were washed with ice water (60 mL) and a solution of 5:1 saturated aqueous sodium chloride:saturated aqueous sodium bicarbonate (2×60 mL), dried over anhydrous sodium sulfate, filtered, and concentrated to ˜50 mL of solution. The crude solution was used directly in next step.
-
- To a solution of 1-(chloromethyl)-2,4-dimethoxybenzene, I-561 (20 g, 107 mmol, 5.0 equiv.) in acetone (200 mL) was added methyl 3-hydroxyisoxazole-5-carboxylate, I-562 (3 g, 21.5 mmol) and K2CO3 (8.9 g, 3.0 equiv.). The reaction mixture was stirred at 70° C. for 19 hours. When the reaction was deemed complete by LC-MS analysis, the reaction mixture was concentrated under reduced pressure. The crude product was purified by column chromatography (silica gel, Petroleum/EtOAc=1:1) to afford methyl 3-((3,4-dimethylbenzyl)oxy)isoxazole-5-carboxylate, I-563 (2.0 g, 32% yield, as a yellow oil).
-
- To a solution of methyl 3-[(3,4-dimethylphenyl)methoxy]-1,2-oxazole-5-carboxylate, I-563 (1.1 g, 4.2 mmol) in EtOH (10 mL) was added NaBH4 (245 mg, 1.5 equiv.) at 0° C. The reaction mixture was allowed to warm to 25° C. and stirred for 2 hours. After completion, the reaction mixture was quenched with H2O (5 mL), and extracted with DCM (20 mL). The organic extract was dried (Na2SO4), concentrated under reduced pressure and the residue obtained was purified by silica gel chromatography (Petroleum ether:EtOAc=1:1) to afford (3-((3,4-dimethylbenzyl)oxy)isoxazol-5-yl)methanol, I-564 (0.9 g, quantitative yield) as a yellow oil. MS (ESI, pos. ion) m/z: 288.1 (M+Na).
-
- To a solution of {3-[(3,4-dimethylphenyl)methoxy]-1,2-oxazol-5-yl}methanol, I-564 (300 mg, 1.287 mmol) in DCM (5 mL) was added MsCl (440 mg, 3.0 equiv.) and TEA (258 mg, 2.0 equiv.) at 0° C. The reaction mixture was allowed to warm to 25° C. and stirred for 2 hours. After completion, the reaction mixture was quenched with H2O (15 mL), and extracted with DCM (50 mL). The organic extract was dried (Na2SO4), concentrated under reduced pressure and the residue obtained was purified by silica gel chromatography (Petroleum ether:EtOAc=2:1) to afford (3-((3,4-dimethylbenzyl)oxy)isoxazol-5-yl)methyl methane sulfonate, I-565 (300 mg, 77% yield) as a yellow oil. MS (ESI, pos.ion) m/z: 366.0 (M+Na).
-
- To a solution of {3-[(3,4-dimethylphenyl)methoxy]-1,2-oxazol-5-yl}methyl methane sulfonate, I-565 (2.9 g, 9.3 mmol) in acetone (50 mL) was added LiBr (2.4 g, 3.0 equiv.). The reaction mixture was stirred at 60° C. for 3 hours. When the reaction was deemed complete by LC-MS analysis, the reaction mixture was concentrated under reduced pressure to a residue, which was purified by silica gel column chromatography (DCM:MeOH=20:1) to afford 5-(bromomethyl)-3-((3,4-dimethylbenzyl)oxy)isoxazole, I-566 (2.5 g, 90% yield) as a yellow oil. MS (ESI, pos. ion) m/z: 350.0 (M+Na).
-
- To a solution of (3R)-3-isopropyl-2,5-dimethoxy-3,6-dihydropyrazine, I-567 (46 mg, CAS:109838-95-9, 0.25 mmol) in THE (5 mL) was added n-BuLi (2.5 M in hexane, 0.1 ml, 1.0 equiv.) at −78° C. under N2. After 30 minutes, 5-(bromomethyl)-3-[(3,4-dimethylphenyl)methoxy]-1,2-oxazole, I-566 (50 mg, 0.7 equiv.) was added. The flask was evacuated and purged again with nitrogen. The resulting mixture was slowly warmed to room temperature over 18 hours. When the reaction was deemed complete by LC-MS analysis, the reaction mixture was quenched with water (2 mL) and extracted with EtOAc (2×10 mL). The combined organic extracts were washed with brine, dried over Na2SO4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Petroleum:EtOAc=2:1) to afford 3-((3,4-dimethylbenzyl)oxy)-5-(((2S,5R)-5-isopropyl-3,6-dimethoxy-2,5-dihydropyrazin-2-yl)methyl)isoxazole, I-568 (20 mg, 30% yield) as a yellow oil. MS (ESI, pos. ion) m/z: 432.2 (MH+).
-
- A mixture of (2S,5R)-2-({3-[(3,4-dimethylphenyl)methoxy]-1,2-oxazol-5-yl}methyl)-5-isopropyl-3,6-dimethoxy-2,5-dihydropyrazine, I-568 (30 mg, 0.05 mmol) in 1N HCl (1 mL) and MeCN (5 ML) was stirred under 30° C. for 3 hours. The solvent was then removed under reduced pressure to afford the crude methyl (S)-2-amino-3-(3-((2,4-dimethoxybenzyl)oxy) isoxazol-5-yl)propanoate, I-569 (20 mg, 86% yield) as a yellow oil, which was used in the next step without any purification. MS (ESI, pos. ion) m/z: 337.1(MH+).
-
- To a stirred solution of methyl (S)-2-amino-3-{3-[(2,4-dimethoxyphenyl)methoxy]-1,2-oxazol-5-yl}propanoate, I-569 (1.2 g, 3.57 mmol) in MeOH (20 mL) was added LiOH (246 mg, 3.0 equiv.) in H2O (20 mL) at 0° C. The reaction mixture was allowed to warm to room temperature over 2 hours. The reaction mixture was then concentrated to a residue, which was purified by reverse phase HPLC (MeCN/H2O with 0.5% formic acid) to afford (S)-2-amino-3-(3-((2,4-dimethoxybenzyl)oxy)isoxazol-5-yl)propanoic acid, I-570 (300 mg, 25% yield) as a yellow solid. MS (ESI, pos. ion) m/z: 323.1 (MH+).
-
- To a solution of (S)-2-amino-3-{3-[(2,4-dimethoxyphenyl)methoxy]-1,2-oxazol-5-yl}propanoic acid, I-570 (300 mg, 0.93 mmol) in dioxane (10 mL) and H2O (10 mL) was added Fmoc-OSu (340 mg, 1.3 equiv.) and Na2CO3 (197 mg, 2.0 equiv.). The mixture was stirred for 2 hours at 20° C. When the reaction was deemed complete by LC-MS analysis, the pH of the reaction mixture was adjusted to 2 using 1N HCl. The reaction mixture was then extracted with DCM (30 mL), and the organic extract was dried (Na2SO4) and concentrated under reduced pressure. The residue obtained was purified by preparatory TLC (DCM:MeOH=10:1) to afford the desired carboxylic acid, I-571 (200 mg, 40% yield) as a white solid. MS (ESI, pos. ion) m/z: 545.2 (MH+). 1H NMR (400 MHz, DMSO-d6) δ=7.89 (d, J=7.5, 2H), 7.65 (d, J=4.5, 2H), 7.41 (t, J=7.4, 2H), 7.37-7.23 (m, 2H), 6.97 (d, J=8.4, 1H), 6.53 (d, J=2.1, 1H), 6.41 (dd, J=8.3, 2.3, 1H), 5.56 (s, 1H), 4.76 (s, 2H), 4.21 (dd, J=15.1, 8.1, 3H), 3.86 (s, 1H), 3.74 (s, 3H), 3.69 (s, 3H), 2.96 (d, J=11.9, 1H), 2.84 (d, J=6.9, 1H).
-
- Peptide E-197 was prepared from 31.7 mg of the corresponding sequence immobilized on Rink amide resin (estimated loading 0.19 mmol/g) using I-34 and GP5 to afford 1.0 mg of E-197 as a white solid. ESI-MS found 1160.8, C214H327S2N47O64 (M+4H)4+ requires 1160.8.
-
- Peptide E-198 was prepared from 64.4 mg of the corresponding sequence immobilized on Rink amide resin (estimated loading 0.11 mmol/g) using I-9 and GP4 to afford 3.2 mg of E-198 as a white solid. ESI-MS found 1613.4, C220H335S2N52O67 (M+3H)3+ requires 1613.8.
-
- Peptide E-199 was prepared from 138.8 mg of the corresponding sequence immobilized on chlorotrityl resin (estimated loading 0.18 mmol/g) using I-9 and GP4 to afford 6.5 mg of E-199 as a white solid. ESI-MS found 1542.9, C212H319S2N46066 (M+3H)3+ requires 1543.1.
-
- Peptide E-200 was prepared from 158 mg of the corresponding sequence immobilized on Rink amide resin (estimated loading 0.16 mmol/g) using I-9 and GP4 to afford 12 mg of E-200 as a white solid. ESI-MS found 1556.2, C214H325S2N48O65 (M+3H)3+ requires 1557.1.
-
- Peptide E-201 was prepared from 184 mg of the corresponding sequence immobilized on Rink amide resin (estimated loading 0.16 mmol/g) using I-9 and GP4 to afford 14 mg of E-201 as a white solid. ESI-MS found 1532.4, C209H323S2N48O64 (M+3H)3+ requires 1531.1.
-
- Peptide E-202 was prepared from 30 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-443 (*absolute configuration arbitrarily assigned) and GP4 to afford 1.9 mg of E-202 as a white solid. ESI-MS found 1157.3, C214H327SN47O65 (M+4H)4+ requires 1156.8.
-
- Peptide E-203 was prepared from 30 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-439 (*absolute configuration arbitrarily assigned) and GP4 to afford 1.2 mg of E-203 as a white solid. ESI-MS found 1157.2, C214H327SN47O65 (M+4H)4+ requires 1156.8.
-
- Peptide E-204 was prepared from 39.6 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-430 and GP4 to afford 3.2 mg of E-204 as a white solid. ESI-MS found 1152.3, C216H331N47O64 (M+4H)4+ requires 1151.8.
-
- Peptide E-205 was prepared from 46.6 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-451 and GP4 to afford 6.4 mg of E-205 as a white solid. ESI-MS found 1156.9, C215H329SN47O64 (M+4H)4+ requires 1156.3.
-
- Peptide E-206 was prepared from 44.4 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-454 and GP4 to afford 5.9 mg of E-206 as a white solid. ESI-MS found 1156.9, C215H329SN47O64 (M+4H)4+ requires 1156.3.
-
- Peptide E-207 was prepared from 37 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-458 and GP4 to afford 4.8 mg of E-207 as a white solid. ESI-MS found 1141.8, C213H325N47O64 (M+4H)4+ requires 1141.3.
-
- Peptide E-208 was prepared from 40.4 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-461 and GP4 to afford 7 mg of E-208 as a white solid. ESI-MS found 1145.3, C214H327N47O64 (M+4H)4+ requires 1144.8.
-
- Peptide E-209 was prepared from 44.2 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-464 and GP4 to afford 2.2 mg of E-209 as a white solid. ESI-MS found 1145.3, C214H327N47O64 (M+4H)4+ requires 1144.8.
-
- Peptide E-210 was prepared from 43.2 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-466 and GP4 to afford 1.5 mg of E-210 as a white solid. ESI-MS found 1148.9, C215H329N47O64 (M+4H)4+ requires 1148.3.
-
- Peptide E-211 was prepared from 48.2 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-469 and GP4 to afford 1.5 mg of E-211 as a white solid. ESI-MS found 1141.8, C213H325N47O64 (M+4H)4+ requires 1141.3.
-
- Peptide E-212 was prepared from 44.2 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-471 and GP4 to afford 3.8 mg of E-212 as a white solid. ESI-MS found 1145.3, C214H327N47O64 (M+4H)4+ requires 1144.8.
-
- Peptide E-213 was prepared from 44.1 mg of resin R-1 (estimated loading 0.18 mmol/g) using I-474 and GP4 to afford 4.3 mg of E-213 as a white solid. ESI-MS found 1141.9, C213H325N47O64 (M+4H)4+ requires 1141.3.
-
- Peptide E-214 was prepared from 45.9 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-476 and GP4 to afford 3.0 mg of E-214 as a white solid. ESI-MS found 1145.4, C214H327N47O64 (M+4H)4+ requires 1144.8.
- The synthesis of example E-215 is depicted in Scheme 167:
- To Rink amide resin R-3 (0.17 mmol/g, 60 mg, 0.01 mmol) in a 3 mL polypropylene tube with an end-cap was added 20% v/v piperidine/DMF (2 mL). The tube was capped, agitated at ambient temperature for 20 minutes, and then drained. The resin was washed with DMF (5×3 mL). A solution of carboxylic acid I-519 (25.2 mg, 6.0 equiv.) in DMF (1.2 mL) was added, followed by DIPEA (27 μL, 15.0 equiv.) and HATU (34.9 mg, 9.0 equiv.). The reaction mixture was agitated at ambient temperature for 5 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL). 20% v/v piperidine/DMF (2 mL) was added to the resin. The tube was capped, agitated at ambient temperature for 20 minutes, and then drained. The resin was washed with DMF (5×3 mL). A solution of carboxylic acid I-248 (16.7 mg, 6.0 equiv.) in DMF (1.2 mL) was added, followed by DIPEA (27 μL, 15.0 equiv.) and HATU (34.9 mg, 9.0 equiv.). The reaction mixture was agitated at ambient temperature for 16 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL). The peptide was cleaved from the resin using 1 mL of cleavage reagent (88:2:5:5 v/v/v/v TFA/TIS/PhOH/H2O) for 1 hour. The resin was filtered and washed with TFA (2×0.5 mL). The combined filtrate and washes were concentrated under reduced pressure to afford a residue, which was triturated with Et2O (2 mL) to precipitate the peptide. The peptide was re-dissolved in glacial AcOH (1.2 mL) and purified by preparative HPLC (
Phenomenex Jupiter 10μM Proteo 90 Å LC column, 250×21.2 mm, with flow rate—15 mL/min, gradient of 0100% acetonitrile in 25 mM aqueous ammonium acetate over 30 minutes) to afford 2.7 mg of E-215 as a white solid. ESI-MS found 1149.8, C213H325SN47O64 (M+4H)4+ requires 1149.3. -
- Peptide E-216 was prepared from 50 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-478 and GP4 to afford 4.2 mg of E-216 as a white solid. ESI-MS found 1153.4, C214H327SN47O64 (M+4H)4+ requires 1152.8.
- The synthesis of example E-217 is depicted in Scheme 168:
- To Rink amide resin R-3 (0.17 mmol/g, 62.5 mg, 0.011 mmol) in a 3 mL polypropylene tube with an end-cap was added 20% v/v piperidine/DMF (2 mL). The tube was capped, agitated at ambient temperature for 20 minutes, and then drained. The resin was washed with DMF (5×3 mL). A solution of carboxylic acid I-520 (28 mg, 6.0 equiv.) in DMF (1.2 mL) was added, followed by DIPEA (28 μL, 15.0 equiv.) and HATU (36.3 mg, 9.0 equiv.). The reaction mixture was agitated at ambient temperature for 4 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL). 20% v/v piperidine/DMF (2 mL) was added to the resin. The tube was capped, agitated at ambient temperature for 20 minutes, and then drained. The resin was washed with DMF (5×3 mL). A solution of carboxylic acid I-248 (17.5 mg, 6.0 equiv.) in DMF (1.2 mL) was added, followed by DIPEA (28 μL, 15.0 equiv.) and HATU (36.3 mg, 9.0 equiv.). The reaction mixture was agitated at ambient temperature for 5 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL). The peptide was cleaved from the resin using 1 mL of cleavage reagent (88:2:5:5 v/v/v/v TFA/TIS/PhOH/H2O) for 1 hour. The resin was filtered and washed with TFA (2×0.5 mL). The combined filtrate and washes were concentrated under reduced pressure to afford a residue, which was triturated with Et2O (2 mL) to precipitate the peptide. The peptide was re-dissolved in glacial AcOH (1.2 mL) and purified by preparative HPLC (
Phenomenex Jupiter 10μM Proteo 90 Å LC column, 250×21.2 mm, with flow rate—15 mL/min, gradient of 0100% acetonitrile in 25 mM aqueous ammonium acetate over 30 minutes) to afford 2.5 mg of E-217 as a white solid. ESI-MS found 1156.8, C215H329SN47O64 (M+4H)4+ requires 1156.3. - The synthesis of example E-218 is depicted in Scheme 169:
- To Rink amide resin R-3 (0.17 mmol/g, 61.4 mg, 0.01 mmol) in a 3 mL polypropylene tube with an end-cap was added 20% v/v piperidine/DMF (2 mL). The tube was capped, agitated at ambient temperature for 20 minutes, and then drained. The resin was washed with DMF (5×3 mL). A solution of carboxylic acid I-521 (23.8 mg, 6.0 equiv.) in DMF (1.2 mL) was added, followed by DIPEA (27 μL, 15.0 equiv.) and HATU (35.6 mg, 9.0 equiv.). The reaction mixture was agitated at ambient temperature for 4 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL). 20% v/v piperidine/DMF (2 mL) was added to the resin. The tube was capped, agitated at ambient temperature for 20 minutes, and then drained. The resin was washed with DMF (5×3 mL). A solution of carboxylic acid I-248 (17.2 mg, 6.0 equiv.) in DMF (1.2 mL) was added, followed by DIPEA (27 μL, 15.0 equiv.) and HATU (35.6 mg, 9.0 equiv.). The reaction mixture was agitated at ambient temperature for 5 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL). The peptide was cleaved from the resin using 1 mL of cleavage reagent (88:2:5:5 v/v/v/v TFA/TIS/PhOH/H2O) for 1 hour. The resin was filtered and washed with TFA (2×0.5 mL). The combined filtrate and washes were concentrated under reduced pressure to afford a residue, which was triturated with Et2O (2 mL) to precipitate the peptide. The peptide was re-dissolved in glacial AcOH (1.2 mL) and purified by preparative HPLC (
Phenomenex Jupiter 10μM Proteo 90 Å LC column, 250×21.2 mm, with flow rate—15 mL/min, gradient of 0-100% acetonitrile in 25 mM aqueous ammonium acetate over 30 minutes) to afford 1.7 mg of E-218 as a white solid. ESI-MS found 1155.8, C213H325SN51O62 (M+4H)4+ requires 1155.3. - The synthesis of example E-219 is depicted in Scheme 170:
- Fmoc cleavage from Rink amide resin R-3 (0.17 mmol/g, 66.7 mg, 0.011 mmol) was performed as described in example 218. A solution of Fmoc-D-Asp(OtBu)-OH (28 mg, 6.0 equiv.) in DMF (1.2 mL) was added, followed by DIPEA (30 μL, 15.0 equiv.) and HATU (38.8 mg, 9.0 equiv.). The reaction mixture was agitated at ambient temperature for 4 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL). After further Fmoc cleavage, A solution of carboxylic acid I-248 (18.7 mg, 6.0 equiv.) in DMF (1.2 mL) was added, followed by DIPEA (28 μL, 15.0 equiv.) and HATU (38.8 mg, 9.0 equiv.). The reaction mixture was agitated at ambient temperature for 5 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL). The peptide was cleaved from the resin and purified as described in example 218 to afford 4.3 mg of E-219 as a white solid. ESI-MS found 1149.8, C213H325SN47O64 (M+4H)4+ requires 1149.3.
- The synthesis of example E-220 is depicted in Scheme 171:
- Fmoc cleavage from Rink amide resin R-3 (0.17 mmol/g, 65.5 mg, 0.011 mmol) was performed as described in example 218. A solution of carboxylic acid I-522 (42.5 mg, 6.0 equiv.) in DMF (1.2 mL) was added, followed by DIPEA (29 μL, 15.0 equiv.) and HATU (38 mg, 9.0 equiv.). The reaction mixture was agitated at ambient temperature for 4 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL). After further Fmoc cleavage, a solution of carboxylic acid I-248 (18.3 mg, 6.0 equiv.) in DMF (1.2 mL) was added, followed by DIPEA (29 μL, 15.0 equiv.) and HATU (38 mg, 9.0 equiv.). The reaction mixture was agitated at ambient temperature for 5 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL). The peptide was cleaved from the resin and purified as described in example 218 to afford 2.0 mg of E-220 as a white solid. ESI-MS found 1159.3, C214H327SN51O62 (M+4H)4+ requires 1158.8.
- The synthesis of example E-221 is depicted in Scheme 172:
- Fmoc cleavage from Rink amide resin R-3 (0.17 mmol/g, 64.8 mg, 0.011 mmol) was performed as described in example 218. A solution of carboxylic acid I-523 (26 mg, 6.0 equiv.) in DMF (1.2 mL) was added, followed by DIPEA (29 μL, 15.0 equiv.) and HATU (37.6 mg, 9.0 equiv.). The reaction mixture was agitated at ambient temperature for 4 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL). After further Fmoc cleavage, a solution of carboxylic acid I-248 (18.1 mg, 6.0 equiv.) in DMF (1.2 mL) was added, followed by DIPEA (29 μL, 15.0 equiv.) and HATU (37.6 mg, 9.0 equiv.). The reaction mixture was agitated at ambient temperature for 5 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL). The peptide was cleaved from the resin and purified as described in example 218 to afford 1.4 mg of E-221 as a white solid. ESI-MS found 1159.4, C214H327SN51O62 (M+4H)4+ requires 1158.8.
- The synthesis of example E-222 is depicted in Scheme 173:
- Fmoc cleavage from Rink amide resin R-3 (0.17 mmol/g, 62.8 mg, 0.011 mmol) was performed as described in example 218. A solution of carboxylic acid I-524 (24.3 mg, 6.0 equiv.) in DMF (1.2 mL) was added, followed by DIPEA (29 μL, 15.0 equiv.) and HATU (36.6 mg, 9.0 equiv.). The reaction mixture was agitated at ambient temperature for 4 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL). After further Fmoc cleavage, a solution of carboxylic acid I-248 (17.6 mg, 6.0 equiv.) in DMF (1.2 mL) was added, followed by DIPEA (29 μL, 15.0 equiv.) and HATU (36.6 mg, 9.0 equiv.). The reaction mixture was agitated at ambient temperature for 5 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL). The peptide was cleaved from the resin and purified as described in example 218 to afford 2.5 mg of E-222 as a white solid. ESI-MS found 1155.9, C213H325SN51O62 (M+4H)4+ requires 1155.3.
-
- Peptide E-228 was prepared from 44.5 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-486 and GP4 to afford 4.8 mg of E-228 as a white solid. ESI-MS found 1155.8, C215H325SN47O64 (M+4H)4+ requires 1155.3.
- The synthesis of example E-229 is depicted in Scheme 179:
- Fmoc cleavage from Rink amide resin R-1 (estimated loading 0.125 mmol/g, 121.6 mg, 0.015 mmol) was performed as described in example 218. A solution of Fmoc-P-Ala-OH (28.4 mg, 6.0 equiv.) in DMF (3 mL) was added, followed by DIPEA (40 μL, 15.0 equiv.) and HATU (52 mg, 9.0 equiv.). The reaction mixture was agitated at ambient temperature for 2 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL) and dried in vacuo to afford resin R-4.
- Resin R-4 (49.3 mg, estimated loading 0.125 mmol/g, 6.2 μmol) was subjected to Fmoc cleavage as described above, and a solution of carboxylic acid I-528 (6 mg, 6.0 equiv.) in DMF (1.2 mL) was added, followed by DIPEA (16 μL, 15.0 equiv.) and HATU (21 mg, 9.0 equiv.). The reaction mixture was agitated at ambient temperature for 16 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL) and dried in vacuo. The peptide was cleaved from the resin and purified as described in example 218 to afford 5.6 mg of Peptide E-229 as a white solid. ESI-MS found 1142.3, C212H323N47O65 (M+4H)4+ requires 1141.8.
- The synthesis of example E-230 is depicted in Scheme 180:
- Resin R-4 (52.2 mg, estimated loading 0.125 mmol/g, 6.5 μmol) was subjected to Fmoc cleavage as described in example 218, and a solution of carboxylic acid I-529 (6 mg, 6.0 equiv.) in DMF (1.2 mL) was added, followed by DIPEA (17 μL, 15.0 equiv.) and HATU (22 mg, 9.0 equiv.). The reaction mixture was agitated at ambient temperature for 16 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL) and dried in vacuo. The peptide was cleaved from the resin and purified as described in example 218 to afford 4.3 mg of E-230 as a white solid. ESI-MS found 1140.8, C213H321N47O64 (M+4H)4+ requires 1140.3.
-
- Peptide E-234 was prepared from 46.2 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-498 and GP4 to afford 6.1 mg of E-234 as a white solid. ESI-MS found 1155.8, C215H325SN47O64 (M+4H)4+ requires 1155.3.
- The synthesis of example E-235 is depicted in Scheme 184:
- Fmoc deprotection of resin R-1 (111.9 mg, estimated loading 0.125 mmol/g, 0.014 mmol) was carried out as described in example 218, then a solution of thiodiglycolic anhydride (14.8 mg, 8.0 equiv.) in DMF (1.2 mL) was added and the reaction mixture was agitated for 6 hours at ambient temperature. The solution was drained and the resin was washed with DMF (5×) and DCM (5×) and dried in vacuo to afford resin R-5.
- To resin R-5 (40.5 mg, estimated loading 0.125 mmol/g, 5.1 μmol) was added a solution of amine hydrochloride I-532 (7.8 mg, 8.0 equiv.) and DIPEA (18 μL, 20.0 equiv.) in DMF (1.2 mL), followed by HATU (15.4 mg, 8.0 equiv.). The reaction mixture was agitated at ambient temperature for 5 hours, then the solution was drained and the resin was washed with DMF (5×) and DCM (5×) and dried in vacuo. The peptide was cleaved from resin and purified as described in example 218 to afford 1.7 mg of peptide E-235 as a white solid. ESI-MS found 1156.0, C213H322SN48O65 (M+4H)4+ requires 1156.1.
-
- Peptide E-236 was prepared from 42.2 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-490 and GP4 to afford 2.7 mg of E-236 as a white solid. ESI-MS found 1155.3, C215H325SN47O64 (M+4H)4+ requires 1155.3.
- The synthesis of example E-237 is depicted in Scheme 185:
- To resin R-5 (41.3 mg, estimated loading 0.125 mmol/g, 5.2 μmol) was added a solution of amine hydrochloride I-533 (7.9 mg, 8.0 equiv.) and DIPEA (18 μL, 20.0 equiv.) in DMF (1.2 mL), followed by HATU (15.7 mg, 8.0 equiv.). The reaction mixture was agitated at ambient temperature for 3.5 hours, then the solution was drained and the resin was washed with DMF (5×) and DCM (5×) and dried in vacuo. The peptide was cleaved from resin and purified as described in example 218 to afford 2.3 mg of peptide E-237 as a white solid. ESI-MS found 1156.0, C213H322SN48O65 (M+4H)4+ requires 1156.1.
-
- Peptide E-239 was prepared from 49.5 mg of resin (estimated loading 0.125 mmol/g) using I-505 and GP4 to afford 5.3 mg of E-239 as a white solid. ESI-MS found 1137.7, C212H323N47O64 (M+4H)4+ requires 1137.8.
-
- Peptide E-240 was prepared from 47.1 mg of resin (estimated loading 0.125 mmol/g) using I-507 and GP4 to afford 5.0 mg of E-240 as a white solid. ESI-MS found 1148.7, C214H327N47O65 (M+4H)4+ requires 1148.8.
-
- Peptide E-241 was prepared from 53.3 mg of resin (estimated loading 0.125 mmol/g) using I-508 and GP4 to afford 3.7 mg of E-241 as a white solid. ESI-MS found 1152.3, C215H329N47O65 (M+4H)4+ requires 1152.3.
-
- Peptide E-244 was prepared from 47.8 mg of resin (estimated loading 0.125 mmol/g) using I-122 and GP5 to afford 7.0 mg of E-244 as a white solid. ESI-MS found 1168.2, C218H325SN47O65 (M+4H)4+ requires 1168.3
-
- Peptide E-245 was prepared from 44.3 mg of resin (estimated loading 0.125 mmol/g) using I-126 and GP5 to afford 3.3 mg of E-245 as a white solid. ESI-MS found 1177.3, C221H325SN47O65 (M+4H)4+ requires 1177.3.
-
- Peptide E-246 was prepared from 21.2 mg of resin (estimated loading 0.125 mmol/g) using I-137 and GP5 to afford 1.5 mg of E-246 as a white solid. ESI-MS found 1177.3, C221H325SN47O65 (M+4H)4+ requires 1177.3.
- The synthesis of example E-251 is depicted in Scheme 190:
- Fmoc cleavage from Rink amide resin R-3 (0.18 mmol/g, 51.5 mg, 0.009 mmol) was performed as described in example 218. A solution of carboxylic acid I-538 (24.4 mg, 6.0 equiv., *absolute configuration not established) in 20% Collidine/DMF (1.5 mL) was added, followed by HATU (19.4 mg, 5.5 equiv.). The reaction mixture was agitated at ambient temperature for 16 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL). After further Fmoc cleavage, a solution of carboxylic acid I-248 (15.3 mg, 6.0 equiv.) in 20% Collidine/DMF (1.5 mL) was added, followed by HATU (19.4 mg, 5.5 equiv.). The reaction mixture was agitated at ambient temperature for 16 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL). The peptide was cleaved from the resin and purified as described in example 218 to afford 3.6 mg of E-251 as a white solid. ESI-MS found 1156.8, C215H329SN47O64 (M+4H)4+ requires 1156.3.
- The synthesis of example E-252 is depicted in Scheme 191:
- Fmoc cleavage from resin R-1 (estimated loading 0.125 mmol/g, 42 mg, 5.3 μmol) was performed as described in example 218. A solution of carboxylic acid I-513 (8 mg, 6.0 equiv.) in DMF (1.3 mL) was then added to the resin, followed by DIPEA (14 μL, 15.0 equiv.) and PyAOP (19.2 mg, 7.0 equiv.). The reaction mixture was agitated at ambient temperature for 20 hours and then the resin was drained and washed with DMF (5×), DCM (5×) and dried in vacuo. Cleavage of the peptide from resin and purification was performed as described for example 218 to afford 4.0 mg of E-252 as a white solid. ESI-MS found 1147.8, C215H325N47O64 (M+4H)4+ requires 1147.3.
-
- Peptide E-255 was prepared from 49.7 mg of resin (estimated loading 0.125 mmol/g) using I-510 as described for example 252 (coupling time: 5 hours) to afford 5.7 mg of E-255 as a white solid. ESI-MS found 1149.4, C214H327N47O65 (M+4H)4+ requires 1148.8.
-
- Fmoc cleavage from resin R-1 (estimated loading 0.125 mmol/g, 46.2 mg, 5.8 μmol) was performed as described in example 218. A solution of carboxylic acid I-517 (11.2 mg, 6.0 equiv.) in DMF (1.3 mL) was then added to the resin, followed by DIPEA (15 μL, 15.0 equiv.) and HATU (12.1 mg, 5.5 equiv.). The reaction mixture was agitated at ambient temperature for 2 hours and then the resin was drained and washed with DMF (5×), DCM (5×) and dried in vacuo. Cleavage of the peptide from resin and purification was performed as described for example 218 to afford 3.9 mg of E-258 as a white solid. ESI-MS found 1165.4, C218H327SN47O64 (M+4H)4+ requires 1164.8.
-
- Resin R-4 (39.3 mg, estimated loading 0.125 mmol/g, 4.9 μmol) was subjected to Fmoc cleavage as described in example 218, and a solution of carboxylic acid I-541 (4.2 mg, 6.0 equiv.) in 20% Collidine/DMF (1.3 mL) was added, followed by HATU (10.3 mg, 5.5 equiv.). The reaction mixture was agitated at ambient temperature for 5 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL) and dried in vacuo. The peptide was cleaved from the resin and purified as described in example 218 to afford 6.5 mg of E-262 as a white solid. ESI-MS found 1138.4, C212H323N47O64 (M+4H)4+ requires 1137.8.
-
- Resin R-4 (40.7 mg, estimated loading 0.125 mmol/g, 5.1 μmol) was subjected to Fmoc cleavage as described in example 218, and a solution of carboxylic acid I-542 (9.2 mg, 11.5 equiv.) in 20% Collidine/DMF (1.3 mL) was added, followed by HATU (10.3 mg, 5.5 equiv.). The reaction mixture was agitated at ambient temperature for 19 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL) and dried in vacuo. The peptide was cleaved from the resin and purified as described in example 218 to afford 5.0 mg of E-263 as a white solid. ESI-MS found 1141.8, C213H325N47O64 (M+4H)4+ requires 1141.3.
-
- Resin R-4 (43 mg, estimated loading 0.125 mmol/g, 5.4 μmol) was subjected to Fmoc cleavage as described in example 218, and a solution of carboxylic acid I-543 (8.2 mg, 8.9 equiv.) in 20% Collidine/DMF (1.3 mL) was added, followed by HATU (11.2 mg, 5.5 equiv.). The reaction mixture was agitated at ambient temperature for 19 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL) and dried in vacuo. The peptide was cleaved from the resin and purified as described in example 218 to afford 4.3 mg of E-264 as a white solid. ESI-MS found 1145.3, C214H327N47O64 (M+4H)4+ requires 1144.8.
-
- Resin R-4 (36.6 mg, estimated loading 0.125 mmol/g, 4.6 μmol) was subjected to Fmoc cleavage as described in example 218, and a solution of carboxylic acid I-544 (7.3 mg, 8.6 equiv.) in 20% Collidine/DMF (1.3 mL) was added, followed by HATU (9.6 mg, 5.5 equiv.). The reaction mixture was agitated at ambient temperature for 19 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL) and dried in vacuo. The peptide was cleaved from the resin and purified as described in example 218 to afford 4.4 mg of E-265 as a white solid. ESI-MS found 1148.9, C215H329N47O64 (M+4H)4+ requires 1148.3.
-
- Peptide E-268 was prepared from 55.1 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-518 as described in example 252 to afford 5.7 mg of E-268 as a white solid. ESI-MS found 1165.4, C218H327SN47O64 (M+4H)4+ requires 1164.8.
-
- Peptide E-283 was prepared from 102 mg of the corresponding sequence immobilized on Rink amide resin (estimated loading 0.19 mmol/g) using I-248 and GP4 to afford 6.6 mg of E-283 as a white solid. ESI-MS found 1156.8, C215H329SN47O64 (M+4H)4+ requires 1156.3.
-
- Peptide E-284 was prepared from 50.2 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-494 and GP4 to afford 5.1 mg of E-284 as a white solid. ESI-MS found 1155.8, C215H325SN47O64 (M+4H)4+ requires 1155.3.
-
- Peptide E-288 was prepared from 72.4 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-552 as described in example 254 to afford 7.5 mg of E-288 as a white solid. ESI-MS found 1156.4, C215H327N47O64S (M+4H)4+ requires 1155.8.
-
- Peptide E-289 was prepared from 65.4 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-557 as described in example 254 to afford 9.3 mg of E-289 as a white solid. ESI-MS found 1155.8, C215H325N47O64S (M+4H)4+ requires 1155.3.
-
- Peptide E-290 was prepared from 70.7 mg of resin R-1 (estimated loading 0.125 mmol/g) using I-559 as described in example 254 to afford 4.8 mg of E-290 as a white solid. ESI-MS found 1156.4, C215H327N47O645 (M+4H)4+ requires 1155.8.
- The synthesis of example E-291 is depicted in Scheme 208:
- Fmoc cleavage from Rink amide resin R-3 (0.19 mmol/g, 79.1 mg, 0.015 mmol) was performed as described in example 218. A solution of carboxylic acid I-571 (49 mg, 6.0 equiv.) in 20% Collidine/DMF (1.5 mL) was added, followed by HATU (31.4 mg, 5.5 equiv.). The reaction mixture was agitated at ambient temperature for 14.5 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL). After further Fmoc cleavage, a solution of carboxylic acid I-248 (24.7 mg, 6.0 equiv.) in 20% Collidine/DMF (1.5 mL) was added, followed by HATU (31.4 mg, 5.5 equiv.). The reaction mixture was agitated at ambient temperature for 6.5 hours, then drained and the resin was washed with DMF (5×3 mL) and DCM (5×3 mL). The peptide was cleaved from the resin and purified as described in example 218 to afford 5.3 mg of E-291 as a white solid. ESI-MS found 1159.4, C215H326SN48O64 (M+4H)4+ requires 1159.1.
- Suspension cells were harvested and resuspended in 1×HBSS (+10 mM HEPES, 625 μM IBMX, 0.2% BSA) according to the following procedure: 5 uL of 2× cell suspension+1× antibody were added to each well, where the optimal cell density was 10,000 cells per well in a low volume 384-well plate. Agonist serial dilutions in a separate 384 well dilution plate in a 22-point series of 2× dilutions of agonist in DMSO were performed as follows. 80 μL of the highest concentration of Agonist/DMSO was added to well No. 1. 40 μL was removed from well No. 1 and added it to well No. 2, followed by gentle mixing. 40 μL was removed from well No. 2 and added it to well No. 3, followed by gentle mixing. This process was repeated until well No. 22. Additional serial dilutions for additional agonists were set up in a similar manner. 50 nL of each 2× agonist serial dilution was added in duplicate to the designated agonist rows of the assay plate using the Labcyte ECHO. Assay plate was incubated for 30 minutes at room temperature. Following agonist incubation, 5 μL of cAMP Antibody Reagent was added to all wells. A stock of cAMP Working Detection Solution in a separate 15 ml polypropylene tube was prepared by mixing 19 parts of cAMP Lysis Buffer, 5 parts of
Substrate Reagent part Substrate Reagent - Note:
-
- In table 3 “+++++” denotes EC50<0.1 nM; “++++” denotes 0.1 nM≤EC50<1 nM; “+++” denotes 1 nM≤EC50<10 nM; “++” denotes 10 nM≤EC50≤100 nM; “+” denotes 100 nM≤EC50≤1000 nM; and“−” denotes EC50>1000 nM.
- In table 3A, for GLP-1R data: “+++++” denotes EC50≤0.1 nM; “++++” denotes 0.1 nM≤EC50<1 nM; “+++” denotes 1 nM≤EC50<10 nM; “++” denotes 10 nM≤EC50<100 nM; “+” denotes 100 nM EC50≤1000 nM; and “−” denotes EC50>1000 nM.
- In table 3A, for GIP-R data: “+++++” denotes EC50<0.1 nM; “++++” denotes 0.1 nM≤EC50≤1 nM; “+++” denotes 1 nM EC50≤1 nM; “++” denotes 10 nM≤EC50<100 nM or Emax≤30%; “+” denotes 100 nM≤EC50≤1000 nM or Emax<20%; and “−” denotes EC50>1000 nM or Emax<1000.
-
TABLE 3 Compound EC50(Emax) EC50(Emax) # GLP-1R/nM GIP-R/nM 1 ++++ (97) +++ (23) 2 +++++ (99) +++ (46) 3 ++++ (96) − 4 +++++ (100) +++ (23) 5 +++++ (95) +++ (74) 6 ++++ (95) +++ (75) 7 +++++ (94) +++ (29) 8 +++++ (90) +++ (57) 9 +++++ (100) +++ (48) 10 ++++ (95) +++ (32) 11 ++++ (96) +++ (39) 12 +++ (91) ++++ (85) 13 +++ (69) +++ (25) 14 ++++ (81) ++ (<10) 15 ++++ (93) +++ (20) 16 +++++ (97) +++ (22) 17 ++++ (92) +++ (55) 18 +++++ (101) ++++ (80) 19 +++++ (93) ++++ (50) 20 ++++ (91) +++ (22) 21 +++++ (95) +++ (20) 22 ++++ (90) ++++ (46) 23 +++ (83) +++ (37) 24 ++++ (92) +++ (15) 25 +++ (86) +++ (43) 26 ++++ (95) +++ (64) 27 ++++ (95) +++ (45) 28 ++++ (101) +++ (57) 29 +++ (98) +++ (11) 30 ++++ (97) +++ (59) 31 +++ (102) ++ (37) 32 +++++ (103) +++ (65) 33 ++++ (100) ++ (43) 34 ++++ (107) +++ (20-38) 35 ++++ (110) +++ (20-37) 36 +++++/++++ (108) ++++/+++ (51-75) 37 +++++/++++ (110) +++ (10-21) 38 ++++ (97-104) +++ (18-43) 39 +++++/++++ (102-104) ++++/+++ (40-60) 40 ++++ (101-105) +++ (14-34) 41 ++++ (100-104) +++ (75) 42 +++++/++++ (102-109) ++++/+++ (28-46) 43 ++++ (93-97) +++ (60-73) 44 ++++ (97-99) +++ (54-67) 45 ++++ (100) +++ (42) 46 +++ (100) +++ (46) 47 +++++ (100) +++ (24) 48 ++++ (104) ++++ (65) 49 ++++ (101) ++++ (48) 50 ++++ (103) +++ (26) 51 ++++ (98) +++ (65) 52 +++++ (101) +++ (56-61) 53 +++ (99) +++ (62) 54 +++++ (107) (6 at 1 μM) 55 ++++ (104) +++ (47) 56 ++++ (110) +++ (60) 57 ++++ (109) (7 at 1 μM) 58 ++++ (108) +++ (26) 59 +++++ (108) +++ (31) 60 ++++ (98) +++ (37) 61 +++ (96) +++ (56) 62 +++ (101) +++ (48) 63 +++ (91) +++ (24) 64 +++++ (97) +++ (35) 65 ++++ (96) +++ (42) 66 +++++ (113) +++ (11) 67 ++++ (100) +++ (65) 68 ++++ (109) ++++ (87) 69 ++++ (104) +++ (75) 70 ++++ (102) +++ (86) 71 ++++/+++ (102) +++ (77-87) 72 ++++ (105) ++++ (87) 73 ++++ (93) ++ (78) 74 ++++ (92) +++ (47) 75 ++++ (99) +++ (39) 76 +++ (95) ++++ (89) 77 ++++ (90) ++++ (82) 78 ++++ (94) +++ (58) 79 ++++ (102) ++++ (77) 80 ++++ (92) +++ (73) 81 ++++ (96) ++++ (89) 82 +++ (95) +++ (82) 83 ++++ (106) +++ (73) 84 ++++ (107) +++ (53) 85 +++ (103) ++++ (83) 86 ++++ (110) +++ (61) 87 +++ (89) +++ (62) 88 +++ (108) +++ (102) 89 +++ (108) ++++ (81) 90 +++ (108) +++ (74) 91 +++ (98) +++ (85) 92 +++ (94-104) ++++ (85-88) 93 ++++ (99) +++ (73) 94 +++ (89) +++ (46) 95 ++ (84) +++ (20) 96 +++ (94) ++++ (90) 97 +++ (99) ++++ (93) 98 ++++ (96) − (<5 at 1 μM) 99 +++ (102) − (11 at 1 μM) 100 ++ (95) +++ (100) 101 ++ (92) − 102 +++ (104) ++ (34) 103 ++ (95) +++ (68) 104 +++ (104-106) +++ (43-47) 105 ++ (90) ++ (<10 at 1 μM) 106 ++ (95) ++ (37) 107 ++ (57) ++++ (124) 108 − (18 at 1 μM) ++ (69) 109 +++ (101) ++ (36) 110 ++ (88) ++ (33) 111 ++ (94) ++ (12 at 1 μM) 112 ++ (94) ++ (26 at 1 μM) 113 ++ (89) ++ (52) 114 ++++/+++ (94-103) +++ (42-63) 115 +++ (91) +++ (67) 116 +++++ (98) ++ (50) 117 +++ (92) ++ (70) 118 +++++ (95) +++ (35) 119 +++++ (97) ++ (41) 120 +++ (91) − (6 at 1 μM) 121 ++++ (90) ++ (27) 122 +++ (91) − (<1 at 1 μM) 123 +++ (104) ++++ (111) 124 ++ (73) − (10 at 1 μM) 125 ++ (94-100) +++ (54-60) 126 ++ (84) ++ (42-51) 127 +++ (95-107) +++ (98-102) 128 +++ (99) +++/++ (68) 129 +++/++ (91-95) ++++/+++ (102-109) 130 ++++ (114) +++ (64) 131 +++ (95) − (3.2) 132 +++++ (103-114) +++ (61-64) 133 +++ (98) ++++ (104) 134 +++++ (103-108) ++ (30) 135 +++++/++++ (106-111) ++ (15-22) 136 ++ (91-94) ++++ (105) 137 +++ (103) ++ (8) 138 +++ (87) +++ (81) 139 ++++ (102) +++ (79) 140 +++++ (107) +++ (63) 141 +++ (98-100) ++ (46-50) 142 +++++ (101-105) ++ (14.2-17) 143 ++++ (99-108) +++ (99-107) 144 +++ (93-119) +++++ (127-140) 145 +++ (100-104) +++++/++++ (125) 146 +++ (86-92) +++ (83-97) 147 +++ (87-97) +++++ (114-128) 148 ++++ (99) +++ (64-67) 149 +++ (86-92) +++++ (113) 150 +++ (95-113) +++++/++++ (118-130) 151 +++ (103-107) ++++ (117-119) 152 ++ (85) +++ (103) 153 +++++ (107) ++ (75-85) 154 +++ (80) +++ (78) 155 ++++ (102) +++ (80) 156 +++ (95-100) +++++ (116-118) 157 +++/++ (93-95) ++++/+++ (103-105) 158 ++ (31-38) ++++ (104-107) 159 ++ (87-91) +++ (89-92) 160 +++ (85-95) ++++ (109-113) 161 ++ (89-101) +++/++ (58-107) 162 ++ (42-46) ++++/+++ (103-107) 163 ++ (73) +++++ (106) 164 ++ (68) ++ (99-105) 165 ++++ (101-106) +++ (91-98) 166 +++++ (109) +++/++ (77-84) 167 ++++/+++ (94-99) − (<1 at 1 μM) 168 +++ (92) − (6-14 at 1 μM) 169 +++ (96) − (6-8 at 1 μM) 170 +++ (99) − (5-8 at 1 μM) 171 +++ (93-98) − (6.5 at 1 μM) 172 +++ (98-101) ++ (63-71) 173 +++ (90-105) ++++ (92-111) 174 ++/+ (17-73) + (30-66) 175 ++ (87-94) ++ (38) 176 ++ (92) − (1.8 at 1 μM) 177 +++ (96) − (9 at 1 μM) 178 +++ (97) + (38) 179 ++++ (103) − (2 at 1 μM) 180 ++ (94) ++ (84) 181 ++ (103) +++ (102) 182 ++++ (96) + (12 at 1 μM) 183 ++ (95) − (1.4 at 1 μM) 184 +++ (99) ++ (43) 185 ++++ (97) − (8.6 at 1 μM) 186 +++ (94) − (4 at 1 μM) 187 ++ (89) ++ (58) 188 ++ (101) +++ (107) 189 +++ (94) − (4.5 at 1 μM) 190 +++ (97-119) ++++/+++ (88-119) 191 +++ (97) ++ (68) 192 ++++ (111) ++ (63) 193 +++ (117) ++ (44) 194 +++ (98) − (12 at 1 μM) 195 ++++/+++ (93-113) ++++/+++ (46-87) 196 ++++/+++ (93-104) +++/++ (41-86) -
TABLE 3A Compound EC50(Emax) EC50(Emax) # GLP-1R/nM GIP-R/nM 1 ++++ (97) ++ (23) 2 +++++ (99) +++ (46) 3 ++++ (96) − 4 +++++ (100) ++ (23) 5 +++++ (95) +++ (74) 6 ++++ (95) +++ (75) 7 +++++ (94) ++ (29) 8 +++++ (90) +++ (57) 9 +++++ (100) +++ (48) 10 ++++ (95) +++ (32) 11 ++++ (96) +++ (39) 12 +++ (91) ++++ (85) 13 +++ (69) ++ (25) 14 ++++ (81) − 15 ++++ (93) ++ (20) 16 +++++ (97) ++ (22) 17 ++++ (92) +++ (55) 18 +++++ (101) ++++ (80) 19 +++++ (93) ++++ (50) 20 ++++ (91) ++ (22) 21 +++++ (95) ++ (20) 22 ++++ (90) ++++ (46) 23 +++ (83) +++ (37) 24 ++++ (92) + (15) 25 +++ (86) +++ (43) 26 ++++ (95) +++ (64) 27 ++++ (95) +++ (45) 28 ++++ (101) +++ (57) 29 +++ (98) + (11) 30 ++++ (97) +++ (59) 31 +++ (102) ++ (37) 32 +++++ (103) +++ (65) 33 ++++ (100) ++ (43) 34 ++++ (107) ++/+++ (20-38) 35 ++++ (110) ++/+++ (20-37) 36 +++++/++++ (108) ++++/+++ (51-75) 37 +++++/++++ (110) +/++ (10-21) 38 ++++ (97-104) +/+++ (18-43) 39 +++++/++++ (102-104) ++++/+++ (40-60) 40 ++++ (101-105) +/+++ (14-34) 41 ++++ (100-104) +++ (75) 42 +++++/++++ (102-109) ++++/++ (28-46) 43 ++++ (93-97) +++ (60-73) 44 ++++ (97-99) +++ (54-67) 45 ++++ (100) +++ (42) 46 +++ (100) +++ (46) 47 +++++ (100) ++ (24) 48 ++++ (104) ++++ (65) 49 ++++ (101) ++++ (48) 50 ++++ (103) ++ (26) 51 ++++ (98) +++ (65) 52 +++++ (101) +++ (56-61) 53 +++ (99) +++ (62) 54 +++++ (107) − 55 ++++ (104) +++ (47) 56 ++++ (110) +++ (60) 57 ++++ (109) − 58 ++++ (108) ++ (26) 59 +++++ (108) +++ (31) 60 ++++ (98) +++ (37) 61 +++ (96) +++ (56) 62 +++ (101) +++ (48) 63 +++ (91) ++ (24) 64 +++++ (97) +++ (35) 65 ++++ (96) +++ (42) 66 +++++ (113) + (11) 67 ++++ (100) +++ (65) 68 ++++ (109) ++++ (87) 69 ++++ (104) +++ (75) 70 ++++ (102) +++ (86) 71 ++++/+++ (102) +++ (77-87) 72 ++++ (105) ++++ (87) 73 ++++ (93) ++ (78) 74 ++++ (92) +++ (47) 75 ++++ (99) +++ (39) 76 +++ (95) ++++ (89) 77 ++++ (90) ++++ (82) 78 ++++ (94) +++ (58) 79 ++++ (102) ++++ (77) 80 ++++ (92) +++ (73) 81 ++++ (96) ++++ (89) 82 +++ (95) +++ (82) 83 ++++ (106) +++ (73) 84 ++++ (107) +++ (53) 85 +++ (103) ++++ (83) 86 ++++ (110) +++ (61) 87 +++ (89) +++ (62) 88 +++ (108) +++ (102) 89 +++ (108) ++++ (81) 90 +++ (108) +++ (74) 91 +++ (98) +++ (85) 92 +++ (94-104) ++++ (85-88) 93 ++++ (99) +++ (73) 94 +++ (89) +++ (46) 95 ++ (84) ++ (20) 96 +++ (94) ++++ (90) 97 +++ (99) ++++ (93) 98 ++++ (96) − 99 +++ (102) − 100 ++ (95) +++ (100) 101 ++ (92) − 102 +++ (104) ++ (34) 103 ++ (95) +++ (68) 104 +++ (104-106) +++ (43-47) 105 ++ (90) − 106 ++ (95) ++ (37) 107 ++ (57) ++++ (124) 108 − (18 at 1 μM) ++ (69) 109 +++ (101) ++ (36) 110 ++ (88) ++ (33) 111 ++ (94) + (12 at 1 μM) 112 ++ (94) ++ (26 at 1 μM) 113 ++ (89) ++ (52) 114 ++++/+++ (94-103) +++ (42-63) 115 +++ (91) +++ (67) 116 +++++ (98) ++ (50) 117 +++ (92) ++ (70) 118 +++++ (95) +++ (35) 119 +++++ (97) ++ (41) 120 +++ (91) − 121 ++++ (90) ++ (27) 122 +++ (91) − 123 +++ (104) ++++ (111) 124 ++ (73) − 125 ++ (94-100) +++ (54-60) 126 ++ (84) ++ (42-51) 127 +++ (95-107) +++ (98-102) 128 +++ (99) +++/++ (68) 129 +++/++ (91-95) ++++/+++ (102-109) 130 ++++ (114) +++ (64) 131 +++ (95) − 132 +++++ (103-114) +++ (61-64) 133 +++ (98) ++++ (104) 134 +++++ (103-108) ++ (30) 135 +++++/++++ (106-111) +/++ (15-22) 136 ++ (91-94) ++++ (105) 137 +++ (103) − 138 +++ (87) +++ (81) 139 ++++ (102) +++ (79) 140 +++++ (107) +++ (63) 141 +++ (98-100) ++ (46-50) 142 +++++ (101-105) + (14.2-17) 143 ++++ (99-108) +++ (99-107) 144 +++ (93-119) +++++ (127-140) 145 +++ (100-104) +++++/++++ (125) 146 +++ (86-92) +++ (83-97) 147 +++ (87-97) +++++ (114-128) 148 ++++ (99) +++ (64-67) 149 +++ (86-92) +++++ (113) 150 +++ (95-113) +++++/++++ (118-130) 151 +++ (103-107) ++++ (117-119) 152 ++ (85) +++ (103) 153 +++++ (107) ++ (75-85) 154 +++ (80) +++ (78) 155 ++++ (102) +++ (80) 156 +++ (95-100) +++++ (116-118) 157 +++++ (93-95) ++++/+++ (103-105) 158 ++ (31-38) ++++ (104-107) 159 ++ (87-91) +++ (89-92) 160 +++ (85-95) ++++ (109-113) 161 ++ (89-101) +++/++ (58-107) 162 ++ (42-46) ++++/+++ (103-107) 163 ++ (73) +++++ (106) 164 ++ (68) ++ (99-105) 165 ++++ (101-106) +++ (91-98) 166 +++++ (109) +++++ (77-84) 167 ++++/+++ (94-99) − 168 +++ (92) − 169 +++ (96) − 170 +++ (99) − 171 +++ (93-98) − 172 +++ (98-101) ++ (63-71) 173 +++ (90-105) ++++ (92-111) 174 ++/+ (17-73) + (30-66) 175 ++ (87-94) ++ (38) 176 ++ (92) − 177 +++ (96) − 178 +++ (97) + (38) 179 ++++ (103) − 180 ++ (94) ++ (84) 181 ++ (103) +++ (102) 182 ++++ (96) + (12 at 1 μM) 183 ++ (95) − 184 +++ (99) ++ (43) 185 ++++ (97) − 186 +++ (94) − 187 ++ (89) ++ (58) 188 ++ (101) +++ (107) 189 +++ (94) − 190 +++ (97-119) ++++/+++ (88-119) 191 +++ (97) ++ (68) 192 ++++ (111) ++ (63) 193 +++ (117) ++ (44) 194 +++ (98) − 195 ++++/+++ (93-113) ++++/+++ (46-87) 196 ++++/+++ (93-104) +++/++ (41-86) 197 ++ (95) + (20) 198 ++ (95) ++ (81) 199 ++++ (92) +++ (78) 200 ++ (89) + (66) 201 +++ (99) +++ (105) 202 +++++ ++++ (67) 203 ++++ +++ (44) 204 +++++ ++ (98) 205 +++++ +++ (61) 206 +++++ + (18) 207 ++++ +++ (68) 208 +++++ +++ (59) 209 +++++ (94) ++ (27) 210 +++++ (90) ++ (40) 211 +++++ (91) ++++ (50) 212 +++++ (90) +++ (50) 213 +++++ (90) ++++ (59) 214 +++++ (95) +++ (45) 215 +++ (103) − 217 +++++ (97) +++ (58) 218 ++++ (96) +/++ (19-23) 219 ++ (89) +++ (75) 220 +++ − 221 +++ (95) +++ (68) 222 +++ (99) >1 mM 223 +++++ (101) ++++ (91) 224 ++++ (98) ++ (76) 225 ++++ +++ (70-80) 226 +++ (89) + (17) 232 ++++ (95) +++ (78) 233 +++++ (96) +++ (77) 234 ++++ (97) +++ (76) 238 ++++ (95) +++ (82) 239 ++++ (100) ++ (46) 240 ++++ (97) +++ (60) 241 +++ (100) ++ (46) 243 +++++ (103) ++ (20) 244 +++++ (100) +++ (50) 247 ++++ (102) +++++ (110) 248 ++ (80) +++ (105) 249 ++ (101) +++ (105) 254 +++++ +++ (80) 257 +++++ ++ (40) 260 +++ + 264 +++++ (100) +++ (90) 265 +++++ (100) ++++ (80) 266 +++++ (100) +++ (70) 267 +++++ (100) +++ (40) 270 +++ (90) +++ (90) 285 +++++ (99) ++++ (97) 289 +++++ (100) ++ (20) 291 ++++ (100) +++ (60) 290 +++++ (100) ++ (10) 292 +++ (90) ++ (50) - b) Glucose Tolerance Test (GTT)
- Freestyle Lite glucometer and strips; compounds to be tested; sterilized
glucose solution 200 mg/mi. - Compounds were diluted in PBS from the 1 mM DMSO stocks right before injection. Body weight and baseline blood glucose level for each mouse were measured. Tails were snipped using sterile scissors; blood from tails was used to measure glucose. For 0.25 h GTT, mice were fasted for 5-6 h and injected with compound subcutaneously 15 mins before glucose injection. For 4 h GTT, mice were fasted O/N for 16 h and injected with compound subcutaneously 4 h before glucose injection. For 16 h GTT, mice were injected with compound subcutaneously 16 h before glucose injection; food was removed at the same time. For 24 h GTT, mice were injected with compound subcutaneously 24 h before glucose injection; food was removed 5-6 h before glucose injection. 20% glucose in water was prepared; the solution was sterilized by 0.2 m-filtration. An intraperitoneal injection of glucose (2 g/kg) was given to the mouse. Continued to take blood samples from the tail. Blood glucose was measured at 10, 20, 30, 40, 60, 90, and 120 minutes after glucose injection. Between each of these time points, the mouse was returned to its cage and monitored (at least 6 replicate mice were used for each time-point). The average glucose measurements were plotted as a function of time and the area under the curve (AUC) was determined. AUC results of the GTT test are presented in Table 4, below.
-
TABLE 4 24 h Glucose Tolerance Test (GTT) Dose range AUC Compound # (nmol/kg) score 1 2-5 3 2 2-5 2 5 2-5 2 16 2-5 2 18 2-5 2 32 2-5 2 41 2-5 4 59 2-5 3 64 2-5 3 65 2-5 2 66 2-5 2 68 2-5 2 69 2-5 2 77 5.1-15 2 79 5.1-15 2 81 2-5 3 83 2-5 2 91 2-5 3 96 5.1-15 4 98 5.1-15 2 114 2-5 3 195 2-5 2 233 2-5 2 234 2-5 3 264 2-5 3 266 2-5 2 Liraglutide 50 4 Liraglutide 200 2 Semaglutide 2.5 3 Note: AUC score is based on percent compared to vehicle which is set to 100%; AUC score 1 = 0-25%, AUC score 2 = 26-50%,AUC score 3 = 51-75%,AUC score 4 = 76-100%. - c) PathHunter β-Arrestin Assay
- 5,000 cells were seeded in appropriate cell culture media per well in a low volume 384-well tissue culture plate. The assay plate was incubated with cells overnight at 37° C. and 5% CO2. The media was removed, and 5 uL of appropriate cell culture media containing 0.2% BSA was added. Agonist serial dilutions in a separate 384 well dilution plate in a 22-point series of 2× dilutions of agonist in DMSO were performed as follows. 80 μL of the highest concentration of Agonist/DMSO was added to well No. 1. 40 μL was removed from well No. 1, and added to well No. 2, followed by gentle mixing. 40 μL was removed from well No. 2 and added to well No. 3, followed by gentle mixing. This process was repeated until well No. 22. Additional serial dilutions for additional agonists were set up in a similar manner. 100 nL of each 2× agonist serial dilution was added in duplicate to the designated agonist rows of the assay plate using the Labcyte ECHO. Assay plate was incubated for 90 minutes at 37° C. and 5% CO2. A stock of Working Detection Solution in a separate 15 ml polypropylene tube was prepared by mixing 19 parts of Cell Assay Buffer, 5 parts of
Substrate Reagent part Substrate Reagent 2. Following agonist incubation, 3 μL of Working Detection Solution was added to all wells of the assay plate [Note: Do not pipette up and down in the vial to mix or vortex plates]. Plates were spun down briefly. Assay plate was incubated for 3 hour at room temperature in the dark for the immunocompetition reaction to occur. Samples were read on Tecan i-control plate reader using luminescence mode with 100 ms integration time. Data analysis was performed using GraphPad Prism. EC50 values were only assigned to compounds with an Emax greater than 10% of positive controls (GLP-1 and liraglutide were used as positive controls for this assay). The results of the PathHunter β-arrestin assay was summarized in Table 5, below. -
TABLE 5 β-arrestin activity Compound # EC50 1 >1 μM 2 >1 μM 3 >1 μM 4 0.01-1 μM 5 0.01-1 μM 6 >1 μM 7 >1 μM 8 >1 μM 9 >1 μM 10 >1 μM 11 >1 μM 12 >1 μM 13 >1 μM 14 >1 μM 15 >1 μM 16 <0.01 μM 17 >1 μM 18 <0.01 μM 19 <0.01 μM 20 >1 μM 21 >1 μM 22 >1 μM 23 >1 μM 24 >1 μM 25 >1 μM 26 >1 μM 27 >1 μM 28 >1 μM 29 >1 μM 30 >1 μM 31 >1 μM 32 >1 μM 33 >1 μM 34 >1 μM 35 >1 μM 36 >1 μM 37 >1 μM 38 >1 μM 39 >1 μM 40 >1 μM 41 >1 μM 42 >1 μM 43 >1 μM 44 >1 μM 60 >1 μM 64 >1 μM 65 >1 μM 66 >1 μM 68 >1 μM 69 >1 μM 71 >1 μM 72 >1 μM 73 >1 μM 74 >1 μM 75 >1 μM 77 >1 μM 79 >1 μM 81 >1 μM 83 >1 μM 85 >1 μM 86 >1 μM 91 >1 μM 92 >1 μM 93 >1 μM 94 >1 μM 96 >1 μM 97 >1 μM 98 >1 μM 104 >1 μM 111 >1 μM GLP-1 <0.01 μM 114 >1 μM 116 >1 μM 118 >1 μM 119 <0.01 μM 121 >1 μM 123 >1 μM 128 >1 μM 129 >1 μM 130 >1 μM 132 0.01-1 μM 133 >1 μM 134 0.01-1 μM 135 >1 μM 136 >1 μM 137 >1 μM 138 >1 μM 139 >1 μM 140 >1 μM 141 >1 μM 142 0.01-1 μM 143 >1 μM 144 >1 μM 145 >1 μM 146 >1 μM 147 >1 μM 148 >1 μM 149 >1 μM 150 >1 μM 151 >1 μM 152 >1 μM 153 0.01-1 μM 154 >1 μM 155 >1 μM 156 >1 μM 157 >1 μM 158 >1 μM 159 >1 μM 160 >1 μM 161 >1 μM 162 >1 μM 163 >1 μM 164 >1 μM 165 >1 μM 166 >1 μM 167 >1 μM 170 >1 μM 171 >1 μM 172 >1 μM 173 >1 μM 176 >1 μM 177 >1 μM 178 >1 μM 179 0.01-1 μM 180 >1 μM 181 >1 μM 182 >1 μM 183 >1 μM 184 >1 μM 185 >1 μM 186 >1 μM 187 >1 μM 188 >1 μM 189 >1 μM 190 >1 μM 191 >1 μM 192 >1 μM 193 >1 μM 194 >1 μM 195 >1 μM 196 >1 μM liraglutide 0.01-1 μM 202 >1 μM 203 >1 μM 204 0.02-1 μM 208 >1 μM 207 >1 μM 205 >1 μM 206 >1 μM 209 0.01-1 μM 210 0.01-1 μM 211 0.01-1 μM 212 0.01-1 μM 213 0.01-1 μM 214 0.01-1 μM 217 >1 μM 226 >1 μM 223 0.01-1 μM 218 >1 μM 232 >1 μM 233 0.01-1 μM 234 >1 μM 238 >1 μM 239 >1 μM 240 >1 μM 241 >1 μM 243 >1 μM 244 0.01-1 μM 264 <0.01 μM 265 <0.01 μM 266 <0.01 μM 225 >1 μM 285 >1 μM - d) Conditioned Taste Aversion (CTA) in Mice
- One week before start of experiment (Day −7), animals were transferred to single house double grommet cages. A 50 ml water bottle was placed, and consistently replaced when refilled in the same grommet to habituate the animal to a “water” side. After 7 days of baseline water consumption, animals began the taste preference procedure. On
Day 1, the animals were weighed and deprived of water at 6 μm. On acquisition day (Day 2), mice had access to a single bottle containing 0.15% saccharin solution, on the opposite side to the “water” habituated side and allowed to consume for 3 h, from 6 μm until 9 μm. The saccharine bottles were then removed and weighed to record the 3 h consumption. The mice were assigned to form balanced groups based on saccharine consumption and animals that did not consume saccharine were removed from the study. After the groups were formed, the animals were either injected subcutaneously with test drug, vehicle (solvent) or positive aversive drug (200 nmol/kg liraglutide) based on weight fromDay 1 and returned to cages with weighed water bottles. OnDay 3, the water was removed and weighed at 6 μm. OnDay 4, both saccharine and water bottles were weighed and returned simultaneously to respective grommet at 6 μm. OnDay 5, the bottles were removed at 6 μm and weighed. Saccharine consumption was measured as a percent of the total amount of fluid consumed. The reduction of saccharin consumption during the retrieval was used as a measure of CTA strength. Liraglutide and semaglutide were used as positive controls. The results are summarized in Table 6. -
TABLE 6 Conditioned taste aversion (CTA) Compound # Dose (nmol/kg) CTA score 2 30 2 5 30 1 16 30 1 32 30 2 65 30 3 66 50 2 68 30 3 69 30 3/4 83 30 2 91 30 4 96 30 4 98 30 4 114 50 2 195 30 3 202 30 4 233 30 1 234 30 1 264 30 1 266 30 1 Liraglutide 50 2 Liraglutide 200 1 Semaglutide 10 2 Semaglutide 20 1 Note: Saccharine preference score is compared to vehicle (preferred saccharine solution) which is set to 100%; Score 1 = 0-25%,Score 2 = 26-50%,Score 3 = 51-75%,Score 4 = 76-100%. - A number of embodiments of the invention have been described. Nevertheless, it will be understood that various modifications may be made without departing from the spirit and scope of the invention. Accordingly, other embodiments are within the scope of the following claims.
Claims (24)
1. A compound having formula (IAA), or a pharmaceutically acceptable salt thereof:
wherein:
ring A is:
a saturated or unsaturated monocyclic ring that includes from 3-8 ring atoms (inclusive of G and the nitrogen atom labelled N*), wherein:
G is C(O); and
the dotted, circular line connecting G and N* is a divalent group that includes from 1-6 ring atoms; wherein:
(a) from 0-2 of the divalent group's ring atoms are ring heteroatoms, which are each independently selected from the group consisting of N, O, and S; and
(b) from 1-6 of the divalent group's ring atoms are ring carbon atoms, which are each independently selected from the group consisting of C, CH, CH2, CRb, C(Rb)2, and CHRb;
wherein:
each of the divalent group's 1-6 ring carbon atoms is independently selected from the group consisting of CH, CH2, CRb, C(Rb)2, and CHRb; and
L is:
(i) —(CH2)m—X1—(CH2)n—X2—(CH2)p— (formula VIII), wherein m is from 1-6; n is from 0-2;
and p is from 0-8; or
(ii) —(CH2)m—X1—(CH2)p— (formula VIII), wherein m is from 1-6; and p is from 0-8;
X1 is —N(R′)C(O)— or —C(O)N(R′)—; wherein each occurrence of R′ is H;
X2 is:
—S—;
each of R1, R2, and R4 is H;
R2′ is
wherein:
R3 is —C(O)OH;
a is 0-5;
a′ is 0 or 1; and
each of R3a and R3b is H;
each occurrence of Rb is independently selected from the group consisting of: C1-6 alkyl; C1-4 haloalkyl; —OH; oxo; —F; —N(Ra)(R″); C1-4 alkoxy; C1-4 haloalkoxy; —C(═O)(C1-4 alkyl); —C(═O)O(C1-6 alkyl); —C(═O)OH, —C(═O)N(R′″)(R″″), —S(O)1-2(C1-6 alkyl); and cyano; and
—N(R4)W is a peptide having formula (XIV):
wherein
R5 is a C-terminal amino acid or amino acid amide that is optionally substituted with from 1-2 modifying groups selected from an acyl group and a PEG group).
2-169. (canceled)
171-218. (canceled)
236. A method for treating type 2 diabetes mellitus in a human subject, the method comprising administering to the human subject in need thereof an effective amount of the compound or pharmaceutically acceptable salt thereof of claim 1 or 227 .
237. A method for treating obesity in a human subject, the method comprising administering to the human subject in need thereof an effective amount of the compound or pharmaceutically acceptable salt thereof of claim 1 or 227 , optionally wherein the method comprises administering the compound to the subject in combination with a diet therapy or an exercise therapy.
238. A pharmaceutical composition comprising the compound or pharmaceutically acceptable salt thereof of claim 1 or 227 and one or more pharmaceutically acceptable excipients.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US18/087,063 US20230357347A1 (en) | 2018-03-23 | 2022-12-22 | Modulators of g-protein coupled receptors |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201862647604P | 2018-03-23 | 2018-03-23 | |
PCT/US2019/023726 WO2019183577A1 (en) | 2018-03-23 | 2019-03-22 | Modulators of g-protein coupled receptors |
US202017040653A | 2020-09-23 | 2020-09-23 | |
US18/087,063 US20230357347A1 (en) | 2018-03-23 | 2022-12-22 | Modulators of g-protein coupled receptors |
Related Parent Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US17/040,653 Continuation US11535660B1 (en) | 2018-03-23 | 2019-03-22 | Modulators of G-protein coupled receptors |
PCT/US2019/023726 Continuation WO2019183577A1 (en) | 2018-03-23 | 2019-03-22 | Modulators of g-protein coupled receptors |
Publications (1)
Publication Number | Publication Date |
---|---|
US20230357347A1 true US20230357347A1 (en) | 2023-11-09 |
Family
ID=67986596
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US17/040,653 Active US11535660B1 (en) | 2018-03-23 | 2019-03-22 | Modulators of G-protein coupled receptors |
US18/087,063 Pending US20230357347A1 (en) | 2018-03-23 | 2022-12-22 | Modulators of g-protein coupled receptors |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US17/040,653 Active US11535660B1 (en) | 2018-03-23 | 2019-03-22 | Modulators of G-protein coupled receptors |
Country Status (15)
Country | Link |
---|---|
US (2) | US11535660B1 (en) |
EP (1) | EP3768294A4 (en) |
JP (1) | JP2021531259A (en) |
KR (1) | KR20210008834A (en) |
CN (1) | CN112236161A (en) |
AR (1) | AR115016A1 (en) |
AU (1) | AU2019237507A1 (en) |
BR (1) | BR112020019148A2 (en) |
CA (1) | CA3094820A1 (en) |
EA (1) | EA202092269A1 (en) |
IL (2) | IL277495B1 (en) |
MX (1) | MX2020009950A (en) |
PH (1) | PH12020551539A1 (en) |
SG (1) | SG11202009338SA (en) |
WO (1) | WO2019183577A1 (en) |
Families Citing this family (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP4337682A2 (en) * | 2021-05-13 | 2024-03-20 | Carmot Therapeutics Inc. | Modulators of g-protein coupled receptors |
KR20230062994A (en) | 2021-11-01 | 2023-05-09 | 국민대학교산학협력단 | Method for screening positive allosteric modulator of glucagon-like peptide-1 receptor and positive allosteric modulator of glucagon-like peptide-1 receptor prepared by the same |
WO2024033374A1 (en) | 2022-08-11 | 2024-02-15 | Syngenta Crop Protection Ag | Novel arylcarboxamide or arylthioamide compounds |
WO2024089216A1 (en) | 2022-10-27 | 2024-05-02 | Syngenta Crop Protection Ag | Novel sulfur-containing heteroaryl carboxamide compounds |
Family Cites Families (52)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1997010224A1 (en) | 1995-09-13 | 1997-03-20 | Takeda Chemical Industries, Ltd. | Benzoxazepine compounds, their production and use as lipid lowering agents |
US6432947B1 (en) | 1997-02-19 | 2002-08-13 | Berlex Laboratories, Inc. | N-heterocyclic derivatives as NOS inhibitors |
AU2610899A (en) | 1998-02-27 | 1999-09-15 | Novo Nordisk A/S | N-terminally modified glp-1 derivatives |
KR20050037004A (en) | 1998-12-07 | 2005-04-20 | 소시에떼 더 콘세이유 더 레세르세 에 다플리까띠옹 시엔띠피끄, 에스.아.에스. | Analogues of glp-1 |
KR20020015307A (en) | 1999-02-26 | 2002-02-27 | 리처드 피. 버군 쥬니어 | Small Molecule Modulators of G Protein-Coupled Receptor Six |
CA2383798A1 (en) | 1999-09-07 | 2001-03-15 | Conjuchem Inc. | Pulmonary delivery for bioconjugation |
CA2416384A1 (en) | 2000-07-17 | 2003-01-16 | Takeda Chemical Industries, Ltd. | Sulfone derivatives, their production and use |
NZ540381A (en) | 2002-11-01 | 2007-11-30 | Takeda Pharmaceutical | 5-membered aromatic heterocycle derivatives as prophylactic and therapeutic agents for treating neuropathy |
CA2505322A1 (en) | 2002-11-08 | 2004-05-21 | Takeda Pharmaceutical Company Limited | Receptor function regulator |
CA2507026A1 (en) | 2002-11-22 | 2004-06-10 | Takeda Pharmaceutical Company Limited | Imidazole derivatives, their production and use |
WO2004067548A2 (en) * | 2003-01-31 | 2004-08-12 | Theratechnologies Inc. | Chemically modified metabolites of regulatory peptides and methods of producing and using same |
WO2004106276A1 (en) | 2003-05-30 | 2004-12-09 | Takeda Pharmaceutical Company Limited | Condensed ring compound |
CA2539253A1 (en) | 2003-09-19 | 2005-03-31 | Novo Nordisk A/S | Albumin-binding derivatives of therapeutic peptides |
WO2005030740A1 (en) | 2003-09-30 | 2005-04-07 | Takeda Pharmaceutical Company Limited | Thiazoline derivative and use of the same |
CA2550012A1 (en) | 2003-12-17 | 2005-06-30 | Takeda Pharmaceutical Company Limited | Urea derivative, process for producing the same and use |
US7456218B2 (en) | 2003-12-25 | 2008-11-25 | Takeda Pharmaceutical Company Limited | 3-(4-benzyloxyphenyl) propanoic acid derivatives |
WO2005063725A1 (en) | 2003-12-26 | 2005-07-14 | Takeda Pharmaceutical Company Limited | Phenylpropanoic acid derivatives |
US7786165B2 (en) | 2004-03-15 | 2010-08-31 | Takeda Pharmaceutical Company Limited | Aminophenylpropanoic acid derivative |
JP4859665B2 (en) | 2004-03-30 | 2012-01-25 | 武田薬品工業株式会社 | Alkoxyphenylpropanoic acid derivatives |
TWI396686B (en) | 2004-05-21 | 2013-05-21 | Takeda Pharmaceutical | Cyclic amide derivative, and its production and use |
US20060275288A1 (en) | 2005-01-20 | 2006-12-07 | Grihalde Nelson D | GLP-1 receptor agonist and allosteric modulator monoclonal antibodies and uses thereof |
EP1873144B1 (en) | 2005-04-20 | 2014-07-23 | Takeda Pharmaceutical Company Limited | Fused heterocyclic compound |
WO2006121860A2 (en) | 2005-05-06 | 2006-11-16 | Bayer Pharmaceuticals Corporation | Glucagon-like peptide 1 (glp-1) receptor agonists and their pharmacological methods of use |
WO2007013694A1 (en) | 2005-07-29 | 2007-02-01 | Takeda Pharmaceutical Company Limited | Phenoxyalkanoic acid compound |
EP1916234B1 (en) | 2005-07-29 | 2014-11-12 | Takeda Pharmaceutical Company Limited | Cyclopropanecarboxylic acid compound |
BRPI0615150A2 (en) | 2005-08-10 | 2017-06-20 | Takeda Pharmaceuticals Co | agent for the prophylaxis or treatment of diabetes, insulin sensitizer, compound, prodrug, pharmaceutical agent, and use of the compound or a salt thereof or a prodrug thereof |
JP2007063225A (en) | 2005-09-01 | 2007-03-15 | Takeda Chem Ind Ltd | Imidazopyridine compound |
CN101420941A (en) * | 2006-04-11 | 2009-04-29 | 艾尼纳制药公司 | Use of gpr119 receptor agonists for increasing bone mass and for treating osteoporosis, and combination therapy relating thereto |
PE20080993A1 (en) | 2006-06-27 | 2008-10-06 | Takeda Pharmaceutical | CYCLICAL COMPOUNDS FUSED AS MODULATORS OF THE GPR40 RECEIVER |
WO2008021560A2 (en) * | 2006-08-17 | 2008-02-21 | Amylin Pharmaceuticals, Inc. | Dpp-iv resistant gip hybrid polypeptides with selectable properties |
EP2298772A1 (en) | 2006-10-18 | 2011-03-23 | Takeda Pharmaceutical Company Limited | Fused heterocyclic compounds |
US8410087B2 (en) | 2006-10-19 | 2013-04-02 | Takeda Pharmaceutical Company Limited | Indole compound |
US20100016396A1 (en) | 2007-01-29 | 2010-01-21 | Hiroshi Imoto | Pyrazole compound |
WO2008099794A1 (en) | 2007-02-09 | 2008-08-21 | Takeda Pharmaceutical Company Limited | Fused ring compounds as partial agonists of ppar-gamma |
JPWO2008136428A1 (en) | 2007-04-27 | 2010-07-29 | 武田薬品工業株式会社 | Nitrogen-containing 5-membered heterocyclic compound |
JP2011502958A (en) | 2007-06-19 | 2011-01-27 | 武田薬品工業株式会社 | Glucokinase activated indazole compound |
ES2650038T3 (en) * | 2008-06-17 | 2018-01-16 | Indiana University Research And Technology Corporation | Mixed agonists based on GIP for the treatment of metabolic disorders and obesity |
TW201006821A (en) * | 2008-07-16 | 2010-02-16 | Bristol Myers Squibb Co | Pyridone and pyridazone analogues as GPR119 modulators |
US20120148586A1 (en) | 2009-08-27 | 2012-06-14 | Joyce Ching Tsu Chou | Glucagon-like protein-1 receptor (glp-1r) agonists for treating autoimmune disorders |
US8426414B2 (en) | 2009-10-09 | 2013-04-23 | Bristol-Myers Squibb Company | Modulators of G protein-coupled receptor 88 |
RU2012136450A (en) * | 2010-01-27 | 2014-03-10 | Индиана Юниверсити Рисерч Энд Текнолоджи Корпорейшн | CONJUGATES GLUCAGON ANTAGONIST - GIP AGONIST AND COMPOSITIONS FOR TREATMENT OF METABOLIC DISORDERS AND OBESITY |
WO2011162989A2 (en) | 2010-06-24 | 2011-12-29 | Vanderbilt University | Glp-1 receptor modulation of addiction, neuropsychiatric disorders and erectile dysfunction |
WO2013148579A1 (en) | 2012-03-29 | 2013-10-03 | Cebix Inc. | Pegylated c-peptide |
KR20150083121A (en) * | 2012-11-12 | 2015-07-16 | 레드우드 바이오사이언스 인코포레이티드 | Compounds and methods for producing a conjugate |
AU2013356790B2 (en) | 2012-12-06 | 2018-03-08 | Victoria Link Limited | Conjugate compounds |
US9766239B2 (en) | 2013-03-13 | 2017-09-19 | Arizona Board Of Regents On Behalf Of Arizona State University | Synbodies for detection of human norovirus |
EP3604271A1 (en) | 2013-06-28 | 2020-02-05 | Auckland Uniservices Limited | Peptides for amino acid and peptide conjugates and conjugation process |
WO2015031268A1 (en) | 2013-08-26 | 2015-03-05 | Arizona Board Of Regents On Behalf Of Arizona State University | High affinity synbodies for influenza |
US20170326233A1 (en) | 2014-11-14 | 2017-11-16 | Angiochem Inc. | Conjugates including an antibody moiety, a polypeptide that traverses the blood-brain barrier, and a cytotoxin |
WO2016131893A1 (en) | 2015-02-18 | 2016-08-25 | Medimmune Limited | Incretin fusion polypeptides |
CN105219802A (en) * | 2015-10-10 | 2016-01-06 | 广西大学 | The specific expressed GIPR of islet tissue dnlentiviral vectors and application thereof |
GB2551945B (en) | 2015-12-18 | 2021-09-08 | Heptares Therapeutics Ltd | Novel GLP-1 receptor agonist peptides |
-
2019
- 2019-03-22 BR BR112020019148-5A patent/BR112020019148A2/en unknown
- 2019-03-22 EP EP19772275.4A patent/EP3768294A4/en active Pending
- 2019-03-22 JP JP2021500508A patent/JP2021531259A/en active Pending
- 2019-03-22 AU AU2019237507A patent/AU2019237507A1/en active Pending
- 2019-03-22 IL IL277495A patent/IL277495B1/en unknown
- 2019-03-22 CA CA3094820A patent/CA3094820A1/en active Pending
- 2019-03-22 SG SG11202009338SA patent/SG11202009338SA/en unknown
- 2019-03-22 MX MX2020009950A patent/MX2020009950A/en unknown
- 2019-03-22 US US17/040,653 patent/US11535660B1/en active Active
- 2019-03-22 CN CN201980032743.8A patent/CN112236161A/en active Pending
- 2019-03-22 IL IL311177A patent/IL311177A/en unknown
- 2019-03-22 WO PCT/US2019/023726 patent/WO2019183577A1/en unknown
- 2019-03-22 EA EA202092269A patent/EA202092269A1/en unknown
- 2019-03-22 KR KR1020207030531A patent/KR20210008834A/en unknown
- 2019-03-25 AR ARP190100749A patent/AR115016A1/en unknown
-
2020
- 2020-09-23 PH PH12020551539A patent/PH12020551539A1/en unknown
-
2022
- 2022-12-22 US US18/087,063 patent/US20230357347A1/en active Pending
Also Published As
Publication number | Publication date |
---|---|
AU2019237507A1 (en) | 2020-10-08 |
EA202092269A1 (en) | 2020-12-14 |
AR115016A1 (en) | 2020-11-18 |
MX2020009950A (en) | 2021-04-28 |
CA3094820A1 (en) | 2019-09-26 |
EP3768294A4 (en) | 2022-05-04 |
IL311177A (en) | 2024-04-01 |
JP2021531259A (en) | 2021-11-18 |
CN112236161A (en) | 2021-01-15 |
SG11202009338SA (en) | 2020-10-29 |
IL277495B1 (en) | 2024-04-01 |
KR20210008834A (en) | 2021-01-25 |
US11535660B1 (en) | 2022-12-27 |
IL277495A (en) | 2020-11-30 |
EP3768294A1 (en) | 2021-01-27 |
PH12020551539A1 (en) | 2021-06-07 |
BR112020019148A2 (en) | 2021-01-26 |
TW202012432A (en) | 2020-04-01 |
WO2019183577A1 (en) | 2019-09-26 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20230357347A1 (en) | Modulators of g-protein coupled receptors | |
US11207323B2 (en) | sGC stimulators | |
TWI773657B (en) | Substituted 4-phenyl pyridine compounds as non-systemic tgr5 agonists | |
US9382197B2 (en) | Substituted hydroxamic acids and uses thereof | |
US10640495B2 (en) | Heterocycle derivatives having TrkA inhibitory activity | |
US11555012B2 (en) | ACLY inhibitors and uses thereof | |
US20200268897A1 (en) | Phosphatase Binding Compounds and Methods of Using Same | |
US20220249475A1 (en) | Compounds and method for treating cytokine release syndrome | |
EP3192794A1 (en) | Sustained hiv protease inhibitor | |
TWI840348B (en) | Modulators of g-protein coupled receptors |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: CARMOT THERAPEUTICS, INC., CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:ENQUIST, JOHAN;KRISHNAN, SHYAM;ATWAL, SUMAN;AND OTHERS;SIGNING DATES FROM 20200914 TO 20200921;REEL/FRAME:064658/0835 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |