US20230143050A1 - Imidazopyridazine il-17 inhibitor compounds - Google Patents
Imidazopyridazine il-17 inhibitor compounds Download PDFInfo
- Publication number
- US20230143050A1 US20230143050A1 US17/935,360 US202217935360A US2023143050A1 US 20230143050 A1 US20230143050 A1 US 20230143050A1 US 202217935360 A US202217935360 A US 202217935360A US 2023143050 A1 US2023143050 A1 US 2023143050A1
- Authority
- US
- United States
- Prior art keywords
- alkyl
- cycloalkyl
- compound
- pharmaceutically acceptable
- acceptable salt
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 150000001875 compounds Chemical class 0.000 title claims abstract description 637
- 239000003112 inhibitor Substances 0.000 title description 10
- MJQSRSOTRPMVKB-UHFFFAOYSA-N 5h-imidazo[4,5-c]pyridazine Chemical compound C1=NNC2=NC=NC2=C1 MJQSRSOTRPMVKB-UHFFFAOYSA-N 0.000 title 1
- 150000003839 salts Chemical class 0.000 claims abstract description 326
- 125000000217 alkyl group Chemical group 0.000 claims description 364
- 125000000753 cycloalkyl group Chemical group 0.000 claims description 287
- 125000001153 fluoro group Chemical group F* 0.000 claims description 157
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 claims description 130
- 125000002023 trifluoromethyl group Chemical group FC(F)(F)* 0.000 claims description 72
- 125000004432 carbon atom Chemical group C* 0.000 claims description 42
- 229910052731 fluorine Inorganic materials 0.000 claims description 33
- 239000011737 fluorine Substances 0.000 claims description 33
- 125000005843 halogen group Chemical group 0.000 claims description 31
- PXGOKWXKJXAPGV-UHFFFAOYSA-N Fluorine Chemical compound FF PXGOKWXKJXAPGV-UHFFFAOYSA-N 0.000 claims description 26
- 125000001424 substituent group Chemical group 0.000 claims description 24
- 229910052799 carbon Inorganic materials 0.000 claims description 23
- 125000006163 5-membered heteroaryl group Chemical group 0.000 claims description 21
- 125000000623 heterocyclic group Chemical group 0.000 claims description 14
- 125000003003 spiro group Chemical group 0.000 claims description 7
- 125000001412 tetrahydropyranyl group Chemical group 0.000 claims description 6
- 102000013691 Interleukin-17 Human genes 0.000 abstract description 134
- 108050003558 Interleukin-17 Proteins 0.000 abstract description 134
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 133
- 201000010099 disease Diseases 0.000 abstract description 70
- 208000035475 disorder Diseases 0.000 abstract description 63
- 208000011580 syndromic disease Diseases 0.000 abstract description 63
- 230000001404 mediated effect Effects 0.000 abstract description 52
- 238000000034 method Methods 0.000 abstract description 49
- -1 small molecule compounds Chemical class 0.000 description 491
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 294
- 239000000543 intermediate Substances 0.000 description 262
- 239000000203 mixture Substances 0.000 description 176
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 160
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical class CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 145
- 235000019439 ethyl acetate Nutrition 0.000 description 141
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 120
- 239000000243 solution Substances 0.000 description 116
- 239000011541 reaction mixture Substances 0.000 description 103
- 238000000746 purification Methods 0.000 description 91
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 88
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 87
- 239000010410 layer Substances 0.000 description 83
- 239000012044 organic layer Substances 0.000 description 82
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 79
- 238000010898 silica gel chromatography Methods 0.000 description 70
- HPALAKNZSZLMCH-UHFFFAOYSA-M sodium;chloride;hydrate Chemical compound O.[Na+].[Cl-] HPALAKNZSZLMCH-UHFFFAOYSA-M 0.000 description 68
- 239000012267 brine Substances 0.000 description 65
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 64
- 238000006243 chemical reaction Methods 0.000 description 64
- 239000007832 Na2SO4 Substances 0.000 description 60
- PMZURENOXWZQFD-UHFFFAOYSA-L Sodium Sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O PMZURENOXWZQFD-UHFFFAOYSA-L 0.000 description 60
- 229910052938 sodium sulfate Inorganic materials 0.000 description 60
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 56
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 55
- 230000002757 inflammatory effect Effects 0.000 description 53
- KXDHJXZQYSOELW-UHFFFAOYSA-M Carbamate Chemical compound NC([O-])=O KXDHJXZQYSOELW-UHFFFAOYSA-M 0.000 description 52
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 52
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 50
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 46
- 230000002829 reductive effect Effects 0.000 description 45
- 239000007787 solid Substances 0.000 description 44
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 39
- 229920006395 saturated elastomer Polymers 0.000 description 39
- 230000015572 biosynthetic process Effects 0.000 description 37
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 35
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 33
- 239000003921 oil Substances 0.000 description 33
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 32
- 238000003786 synthesis reaction Methods 0.000 description 32
- 239000000706 filtrate Substances 0.000 description 29
- IXCSERBJSXMMFS-UHFFFAOYSA-N hydrogen chloride Substances Cl.Cl IXCSERBJSXMMFS-UHFFFAOYSA-N 0.000 description 29
- 229910000041 hydrogen chloride Inorganic materials 0.000 description 29
- PFKFTWBEEFSNDU-UHFFFAOYSA-N carbonyldiimidazole Chemical compound C1=CN=CN1C(=O)N1C=CN=C1 PFKFTWBEEFSNDU-UHFFFAOYSA-N 0.000 description 28
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 28
- PCBZRNYXXCIELG-WYFCWLEVSA-N COC1=CC=C(C[C@H](NC(=O)OC2CCCC3(C2)OOC2(O3)C3CC4CC(C3)CC2C4)C(=O)N[C@@H]2[C@@H](CO)O[C@H]([C@@H]2O)N2C=NC3=C2N=CN=C3N(C)C)C=C1 Chemical compound COC1=CC=C(C[C@H](NC(=O)OC2CCCC3(C2)OOC2(O3)C3CC4CC(C3)CC2C4)C(=O)N[C@@H]2[C@@H](CO)O[C@H]([C@@H]2O)N2C=NC3=C2N=CN=C3N(C)C)C=C1 PCBZRNYXXCIELG-WYFCWLEVSA-N 0.000 description 27
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 26
- 239000002904 solvent Substances 0.000 description 26
- 201000001263 Psoriatic Arthritis Diseases 0.000 description 25
- 208000036824 Psoriatic arthropathy Diseases 0.000 description 25
- 238000003756 stirring Methods 0.000 description 25
- RYHBNJHYFVUHQT-UHFFFAOYSA-N 1,4-Dioxane Chemical compound C1COCCO1 RYHBNJHYFVUHQT-UHFFFAOYSA-N 0.000 description 24
- 125000004526 pyridazin-2-yl group Chemical group N1N(C=CC=C1)* 0.000 description 24
- 201000004681 Psoriasis Diseases 0.000 description 23
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 21
- 208000006673 asthma Diseases 0.000 description 20
- 206010002556 Ankylosing Spondylitis Diseases 0.000 description 19
- YXFVVABEGXRONW-UHFFFAOYSA-N Toluene Chemical compound CC1=CC=CC=C1 YXFVVABEGXRONW-UHFFFAOYSA-N 0.000 description 18
- 239000003814 drug Substances 0.000 description 18
- KWGKDLIKAYFUFQ-UHFFFAOYSA-M lithium chloride Chemical compound [Li+].[Cl-] KWGKDLIKAYFUFQ-UHFFFAOYSA-M 0.000 description 18
- 206010012438 Dermatitis atopic Diseases 0.000 description 17
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 17
- 201000008937 atopic dermatitis Diseases 0.000 description 17
- 239000005909 Kieselgur Substances 0.000 description 16
- 150000001721 carbon Chemical group 0.000 description 16
- 208000002557 hidradenitis Diseases 0.000 description 16
- 201000007162 hidradenitis suppurativa Diseases 0.000 description 16
- 201000006417 multiple sclerosis Diseases 0.000 description 16
- 239000012299 nitrogen atmosphere Substances 0.000 description 16
- KDLHZDBZIXYQEI-UHFFFAOYSA-N palladium Substances [Pd] KDLHZDBZIXYQEI-UHFFFAOYSA-N 0.000 description 16
- 206010039073 rheumatoid arthritis Diseases 0.000 description 16
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 16
- 238000011282 treatment Methods 0.000 description 16
- 206010034277 Pemphigoid Diseases 0.000 description 15
- 206010046851 Uveitis Diseases 0.000 description 15
- 208000000594 bullous pemphigoid Diseases 0.000 description 15
- 239000003153 chemical reaction reagent Substances 0.000 description 15
- 239000003208 petroleum Substances 0.000 description 15
- 206010035226 Plasma cell myeloma Diseases 0.000 description 14
- 206010047642 Vitiligo Diseases 0.000 description 13
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 13
- 150000001412 amines Chemical class 0.000 description 12
- 125000001559 cyclopropyl group Chemical group [H]C1([H])C([H])([H])C1([H])* 0.000 description 12
- 239000008194 pharmaceutical composition Substances 0.000 description 12
- WYURNTSHIVDZCO-UHFFFAOYSA-N tetrahydrofuran Substances C1CCOC1 WYURNTSHIVDZCO-UHFFFAOYSA-N 0.000 description 12
- MFYSUUPKMDJYPF-UHFFFAOYSA-N 2-[(4-methyl-2-nitrophenyl)diazenyl]-3-oxo-n-phenylbutanamide Chemical compound C=1C=CC=CC=1NC(=O)C(C(=O)C)N=NC1=CC=C(C)C=C1[N+]([O-])=O MFYSUUPKMDJYPF-UHFFFAOYSA-N 0.000 description 11
- HBAQYPYDRFILMT-UHFFFAOYSA-N 8-[3-(1-cyclopropylpyrazol-4-yl)-1H-pyrazolo[4,3-d]pyrimidin-5-yl]-3-methyl-3,8-diazabicyclo[3.2.1]octan-2-one Chemical class C1(CC1)N1N=CC(=C1)C1=NNC2=C1N=C(N=C2)N1C2C(N(CC1CC2)C)=O HBAQYPYDRFILMT-UHFFFAOYSA-N 0.000 description 11
- 208000034578 Multiple myelomas Diseases 0.000 description 11
- XKWYEAUUECRUAE-UHFFFAOYSA-N [3-(1,3-dioxoisoindol-2-yl)-2,2-difluoropropyl] trifluoromethanesulfonate Chemical compound C1=CC=C2C(=O)N(CC(F)(COS(=O)(=O)C(F)(F)F)F)C(=O)C2=C1 XKWYEAUUECRUAE-UHFFFAOYSA-N 0.000 description 11
- 125000000113 cyclohexyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 11
- FSKGUQBJHKBPLI-UHFFFAOYSA-N 2,2-difluoropropane-1,3-diamine;dihydrochloride Chemical compound Cl.Cl.NCC(F)(F)CN FSKGUQBJHKBPLI-UHFFFAOYSA-N 0.000 description 10
- VHYFNPMBLIVWCW-UHFFFAOYSA-N 4-Dimethylaminopyridine Chemical compound CN(C)C1=CC=NC=C1 VHYFNPMBLIVWCW-UHFFFAOYSA-N 0.000 description 10
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 10
- JUJWROOIHBZHMG-UHFFFAOYSA-N Pyridine Chemical compound C1=CC=NC=C1 JUJWROOIHBZHMG-UHFFFAOYSA-N 0.000 description 10
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 10
- 230000001684 chronic effect Effects 0.000 description 10
- 230000014509 gene expression Effects 0.000 description 10
- 229960004540 secukinumab Drugs 0.000 description 10
- 238000004808 supercritical fluid chromatography Methods 0.000 description 10
- MSXVEPNJUHWQHW-UHFFFAOYSA-N 2-methylbutan-2-ol Chemical compound CCC(C)(C)O MSXVEPNJUHWQHW-UHFFFAOYSA-N 0.000 description 9
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 9
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 9
- 238000011161 development Methods 0.000 description 9
- 230000018109 developmental process Effects 0.000 description 9
- 239000000284 extract Substances 0.000 description 9
- 239000006260 foam Substances 0.000 description 9
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 9
- NLXLAEXVIDQMFP-UHFFFAOYSA-N Ammonia chloride Chemical compound [NH4+].[Cl-] NLXLAEXVIDQMFP-UHFFFAOYSA-N 0.000 description 8
- 208000019693 Lung disease Diseases 0.000 description 8
- 210000004027 cell Anatomy 0.000 description 8
- IKDUDTNKRLTJSI-UHFFFAOYSA-N hydrazine hydrate Chemical compound O.NN IKDUDTNKRLTJSI-UHFFFAOYSA-N 0.000 description 8
- 239000000463 material Substances 0.000 description 8
- 230000000414 obstructive effect Effects 0.000 description 8
- 239000012071 phase Substances 0.000 description 8
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 8
- 150000003384 small molecules Chemical class 0.000 description 8
- WJKHJLXJJJATHN-UHFFFAOYSA-N triflic anhydride Chemical compound FC(F)(F)S(=O)(=O)OS(=O)(=O)C(F)(F)F WJKHJLXJJJATHN-UHFFFAOYSA-N 0.000 description 8
- FFGKTZVBNAQUPY-MOPGFXCFSA-N CC(C)(C)OC(N[C@@H](C(CC1)CCC1(F)F)C1=CN2N=CC([C@@H](C3CC3)N)=CC2=N1)=O Chemical compound CC(C)(C)OC(N[C@@H](C(CC1)CCC1(F)F)C1=CN2N=CC([C@@H](C3CC3)N)=CC2=N1)=O FFGKTZVBNAQUPY-MOPGFXCFSA-N 0.000 description 7
- MZRVEZGGRBJDDB-UHFFFAOYSA-N N-Butyllithium Chemical compound [Li]CCCC MZRVEZGGRBJDDB-UHFFFAOYSA-N 0.000 description 7
- 210000000068 Th17 cell Anatomy 0.000 description 7
- 239000000654 additive Substances 0.000 description 7
- 239000002585 base Substances 0.000 description 7
- 239000003937 drug carrier Substances 0.000 description 7
- 230000037361 pathway Effects 0.000 description 7
- 125000003538 pentan-3-yl group Chemical group [H]C([H])([H])C([H])([H])C([H])(*)C([H])([H])C([H])([H])[H] 0.000 description 7
- 230000008569 process Effects 0.000 description 7
- 239000000047 product Substances 0.000 description 7
- 125000003226 pyrazolyl group Chemical group 0.000 description 7
- 239000000126 substance Substances 0.000 description 7
- LIGKNABBWOIHDF-QMMMGPOBSA-N CC(C)(C)OC(N[C@@H](CC(C)(C)C(F)(F)F)C(CI)=O)=O Chemical compound CC(C)(C)OC(N[C@@H](CC(C)(C)C(F)(F)F)C(CI)=O)=O LIGKNABBWOIHDF-QMMMGPOBSA-N 0.000 description 6
- 208000006545 Chronic Obstructive Pulmonary Disease Diseases 0.000 description 6
- QOSSAOTZNIDXMA-UHFFFAOYSA-N Dicylcohexylcarbodiimide Chemical compound C1CCCCC1N=C=NC1CCCCC1 QOSSAOTZNIDXMA-UHFFFAOYSA-N 0.000 description 6
- WTDHULULXKLSOZ-UHFFFAOYSA-N Hydroxylamine hydrochloride Chemical compound Cl.ON WTDHULULXKLSOZ-UHFFFAOYSA-N 0.000 description 6
- 210000001744 T-lymphocyte Anatomy 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- 239000007864 aqueous solution Substances 0.000 description 6
- FJDQFPXHSGXQBY-UHFFFAOYSA-L caesium carbonate Chemical compound [Cs+].[Cs+].[O-]C([O-])=O FJDQFPXHSGXQBY-UHFFFAOYSA-L 0.000 description 6
- 239000003795 chemical substances by application Substances 0.000 description 6
- 239000012230 colorless oil Substances 0.000 description 6
- LJXTYJXBORAIHX-UHFFFAOYSA-N diethyl 2,6-dimethyl-1,4-dihydropyridine-3,5-dicarboxylate Chemical compound CCOC(=O)C1=C(C)NC(C)=C(C(=O)OCC)C1 LJXTYJXBORAIHX-UHFFFAOYSA-N 0.000 description 6
- 238000001914 filtration Methods 0.000 description 6
- BWHMMNNQKKPAPP-UHFFFAOYSA-L potassium carbonate Chemical compound [K+].[K+].[O-]C([O-])=O BWHMMNNQKKPAPP-UHFFFAOYSA-L 0.000 description 6
- 229960000549 4-dimethylaminophenol Drugs 0.000 description 5
- 102000004127 Cytokines Human genes 0.000 description 5
- 108090000695 Cytokines Proteins 0.000 description 5
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 5
- FXHOOIRPVKKKFG-UHFFFAOYSA-N N,N-Dimethylacetamide Chemical compound CN(C)C(C)=O FXHOOIRPVKKKFG-UHFFFAOYSA-N 0.000 description 5
- SECXISVLQFMRJM-UHFFFAOYSA-N N-Methylpyrrolidone Chemical compound CN1CCCC1=O SECXISVLQFMRJM-UHFFFAOYSA-N 0.000 description 5
- 125000004429 atom Chemical group 0.000 description 5
- ARUVKPQLZAKDPS-UHFFFAOYSA-L copper(II) sulfate Chemical compound [Cu+2].[O-][S+2]([O-])([O-])[O-] ARUVKPQLZAKDPS-UHFFFAOYSA-L 0.000 description 5
- 229910000366 copper(II) sulfate Inorganic materials 0.000 description 5
- 230000000875 corresponding effect Effects 0.000 description 5
- 150000004985 diamines Chemical class 0.000 description 5
- MXFYYFVVIIWKFE-UHFFFAOYSA-N dicyclohexyl-[2-[2,6-di(propan-2-yloxy)phenyl]phenyl]phosphane Chemical compound CC(C)OC1=CC=CC(OC(C)C)=C1C1=CC=CC=C1P(C1CCCCC1)C1CCCCC1 MXFYYFVVIIWKFE-UHFFFAOYSA-N 0.000 description 5
- 125000000842 isoxazolyl group Chemical group 0.000 description 5
- 229960005435 ixekizumab Drugs 0.000 description 5
- 230000003902 lesion Effects 0.000 description 5
- 125000004123 n-propyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])* 0.000 description 5
- 229910052757 nitrogen Inorganic materials 0.000 description 5
- 229910000069 nitrogen hydride Inorganic materials 0.000 description 5
- 229910052760 oxygen Inorganic materials 0.000 description 5
- VZOPRCCTKLAGPN-ZFJVMAEJSA-L potassium;sodium;(2r,3r)-2,3-dihydroxybutanedioate;tetrahydrate Chemical compound O.O.O.O.[Na+].[K+].[O-]C(=O)[C@H](O)[C@@H](O)C([O-])=O VZOPRCCTKLAGPN-ZFJVMAEJSA-L 0.000 description 5
- 108090000623 proteins and genes Proteins 0.000 description 5
- UMJSCPRVCHMLSP-UHFFFAOYSA-N pyridine Natural products COC1=CC=CN=C1 UMJSCPRVCHMLSP-UHFFFAOYSA-N 0.000 description 5
- ZDYVRSLAEXCVBX-UHFFFAOYSA-N pyridinium p-toluenesulfonate Chemical compound C1=CC=[NH+]C=C1.CC1=CC=C(S([O-])(=O)=O)C=C1 ZDYVRSLAEXCVBX-UHFFFAOYSA-N 0.000 description 5
- 230000004044 response Effects 0.000 description 5
- 239000000725 suspension Substances 0.000 description 5
- 229940124597 therapeutic agent Drugs 0.000 description 5
- 230000001225 therapeutic effect Effects 0.000 description 5
- LMDZBCPBFSXMTL-UHFFFAOYSA-N 1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide Substances CCN=C=NCCCN(C)C LMDZBCPBFSXMTL-UHFFFAOYSA-N 0.000 description 4
- CFMZSMGAMPBRBE-UHFFFAOYSA-N 2-hydroxyisoindole-1,3-dione Chemical compound C1=CC=C2C(=O)N(O)C(=O)C2=C1 CFMZSMGAMPBRBE-UHFFFAOYSA-N 0.000 description 4
- CESUXLKAADQNTB-ZETCQYMHSA-N 2-methylpropane-2-sulfinamide Chemical compound CC(C)(C)[S@@](N)=O CESUXLKAADQNTB-ZETCQYMHSA-N 0.000 description 4
- FPQQSJJWHUJYPU-UHFFFAOYSA-N 3-(dimethylamino)propyliminomethylidene-ethylazanium;chloride Chemical compound Cl.CCN=C=NCCCN(C)C FPQQSJJWHUJYPU-UHFFFAOYSA-N 0.000 description 4
- MJZJYWCQPMNPRM-UHFFFAOYSA-N 6,6-dimethyl-1-[3-(2,4,5-trichlorophenoxy)propoxy]-1,6-dihydro-1,3,5-triazine-2,4-diamine Chemical compound CC1(C)N=C(N)N=C(N)N1OCCCOC1=CC(Cl)=C(Cl)C=C1Cl MJZJYWCQPMNPRM-UHFFFAOYSA-N 0.000 description 4
- VHUUQVKOLVNVRT-UHFFFAOYSA-N Ammonium hydroxide Chemical compound [NH4+].[OH-] VHUUQVKOLVNVRT-UHFFFAOYSA-N 0.000 description 4
- IRDIIEYHXIHAQC-DXFMSXTPSA-N CC(C)(C)OC(N[C@@H](C(CC1)CCC1(F)F)C1=CN2N=CC(/C=N/[S@@](C(C)(C)C)=O)=CC2=N1)=O Chemical compound CC(C)(C)OC(N[C@@H](C(CC1)CCC1(F)F)C1=CN2N=CC(/C=N/[S@@](C(C)(C)C)=O)=CC2=N1)=O IRDIIEYHXIHAQC-DXFMSXTPSA-N 0.000 description 4
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical group [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 4
- OAKJQQAXSVQMHS-UHFFFAOYSA-N Hydrazine Chemical compound NN OAKJQQAXSVQMHS-UHFFFAOYSA-N 0.000 description 4
- 206010020751 Hypersensitivity Diseases 0.000 description 4
- BZLVMXJERCGZMT-UHFFFAOYSA-N Methyl tert-butyl ether Chemical compound COC(C)(C)C BZLVMXJERCGZMT-UHFFFAOYSA-N 0.000 description 4
- 241000699670 Mus sp. Species 0.000 description 4
- 238000005481 NMR spectroscopy Methods 0.000 description 4
- 101100272976 Panax ginseng CYP716A53v2 gene Proteins 0.000 description 4
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 4
- RHQDFWAXVIIEBN-UHFFFAOYSA-N Trifluoroethanol Chemical compound OCC(F)(F)F RHQDFWAXVIIEBN-UHFFFAOYSA-N 0.000 description 4
- 208000026935 allergic disease Diseases 0.000 description 4
- 230000007815 allergy Effects 0.000 description 4
- 206010003246 arthritis Diseases 0.000 description 4
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 4
- 230000008499 blood brain barrier function Effects 0.000 description 4
- 210000001218 blood-brain barrier Anatomy 0.000 description 4
- 235000013877 carbamide Nutrition 0.000 description 4
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 4
- 238000002648 combination therapy Methods 0.000 description 4
- 238000010511 deprotection reaction Methods 0.000 description 4
- XBDQKXXYIPTUBI-UHFFFAOYSA-N dimethylselenoniopropionate Natural products CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 4
- 150000002148 esters Chemical class 0.000 description 4
- 239000012065 filter cake Substances 0.000 description 4
- 238000004128 high performance liquid chromatography Methods 0.000 description 4
- 239000003018 immunosuppressive agent Substances 0.000 description 4
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 4
- 238000002156 mixing Methods 0.000 description 4
- ZZJOBCNIMHAKDP-UHFFFAOYSA-N n-(6-chloropyridazin-3-yl)-2,2-dimethylpropanamide Chemical compound CC(C)(C)C(=O)NC1=CC=C(Cl)N=N1 ZZJOBCNIMHAKDP-UHFFFAOYSA-N 0.000 description 4
- 125000004108 n-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 4
- 230000003472 neutralizing effect Effects 0.000 description 4
- SNCDZWDDKDMUES-UHFFFAOYSA-N octan-4-one Chemical compound [CH2]CCCC(=O)CCC SNCDZWDDKDMUES-UHFFFAOYSA-N 0.000 description 4
- 125000001715 oxadiazolyl group Chemical group 0.000 description 4
- CTSLXHKWHWQRSH-UHFFFAOYSA-N oxalyl chloride Chemical compound ClC(=O)C(Cl)=O CTSLXHKWHWQRSH-UHFFFAOYSA-N 0.000 description 4
- 239000001301 oxygen Substances 0.000 description 4
- LPNYRYFBWFDTMA-UHFFFAOYSA-N potassium tert-butoxide Chemical compound [K+].CC(C)(C)[O-] LPNYRYFBWFDTMA-UHFFFAOYSA-N 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 125000006239 protecting group Chemical group 0.000 description 4
- 230000002285 radioactive effect Effects 0.000 description 4
- JQWHASGSAFIOCM-UHFFFAOYSA-M sodium periodate Chemical compound [Na+].[O-]I(=O)(=O)=O JQWHASGSAFIOCM-UHFFFAOYSA-M 0.000 description 4
- 235000011006 sodium potassium tartrate Nutrition 0.000 description 4
- UCPYLLCMEDAXFR-UHFFFAOYSA-N triphosgene Chemical compound ClC(Cl)(Cl)OC(=O)OC(Cl)(Cl)Cl UCPYLLCMEDAXFR-UHFFFAOYSA-N 0.000 description 4
- 229960003824 ustekinumab Drugs 0.000 description 4
- GILIYJDBJZWGBG-UWTATZPHSA-N (2r)-1,1,1-trifluoropropan-2-ol Chemical compound C[C@@H](O)C(F)(F)F GILIYJDBJZWGBG-UWTATZPHSA-N 0.000 description 3
- 125000004506 1,2,5-oxadiazolyl group Chemical group 0.000 description 3
- RKMGAJGJIURJSJ-UHFFFAOYSA-N 2,2,6,6-Tetramethylpiperidine Substances CC1(C)CCCC(C)(C)N1 RKMGAJGJIURJSJ-UHFFFAOYSA-N 0.000 description 3
- IFPLUAFUEGQSTL-UHFFFAOYSA-N 2-cyclopropyloxypropanoic acid Chemical compound OC(=O)C(C)OC1CC1 IFPLUAFUEGQSTL-UHFFFAOYSA-N 0.000 description 3
- NQEIWNPZGSWKBL-UHFFFAOYSA-N 2-fluoro-2-methylpropanediamide Chemical compound NC(=O)C(F)(C)C(N)=O NQEIWNPZGSWKBL-UHFFFAOYSA-N 0.000 description 3
- CESUXLKAADQNTB-SSDOTTSWSA-N 2-methylpropane-2-sulfinamide Chemical compound CC(C)(C)[S@](N)=O CESUXLKAADQNTB-SSDOTTSWSA-N 0.000 description 3
- NPSOXVXMGJYKJB-UHFFFAOYSA-N 3-[1-(trifluoromethyl)cyclopropyl]propanoic acid Chemical compound OC(=O)CCC1(C(F)(F)F)CC1 NPSOXVXMGJYKJB-UHFFFAOYSA-N 0.000 description 3
- KQGOSWYOPLIKSK-NSHDSACASA-N CC(C)(C)OC(N[C@@H](C(CC1)CCC1(F)F)C(CI)=O)=O Chemical compound CC(C)(C)OC(N[C@@H](C(CC1)CCC1(F)F)C(CI)=O)=O KQGOSWYOPLIKSK-NSHDSACASA-N 0.000 description 3
- VGGQIPXMGMOHNQ-INIZCTEOSA-N CC(C)(C)OC(N[C@@H](C(CC1)CCC1(F)F)C1=CN2N=CC(C=O)=CC2=N1)=O Chemical compound CC(C)(C)OC(N[C@@H](C(CC1)CCC1(F)F)C1=CN2N=CC(C=O)=CC2=N1)=O VGGQIPXMGMOHNQ-INIZCTEOSA-N 0.000 description 3
- 206010061218 Inflammation Diseases 0.000 description 3
- 108090001005 Interleukin-6 Proteins 0.000 description 3
- 102000004889 Interleukin-6 Human genes 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- BAVYZALUXZFZLV-UHFFFAOYSA-O Methylammonium ion Chemical compound [NH3+]C BAVYZALUXZFZLV-UHFFFAOYSA-O 0.000 description 3
- KWYUFKZDYYNOTN-UHFFFAOYSA-M Potassium hydroxide Chemical compound [OH-].[K+] KWYUFKZDYYNOTN-UHFFFAOYSA-M 0.000 description 3
- 208000007400 Relapsing-Remitting Multiple Sclerosis Diseases 0.000 description 3
- 241000219061 Rheum Species 0.000 description 3
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 3
- DTQVDTLACAAQTR-UHFFFAOYSA-M Trifluoroacetate Chemical compound [O-]C(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-M 0.000 description 3
- AXWGMBADANAYSD-UHFFFAOYSA-M [Br-].[Mg+]C1CCOCC1 Chemical compound [Br-].[Mg+]C1CCOCC1 AXWGMBADANAYSD-UHFFFAOYSA-M 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 230000002378 acidificating effect Effects 0.000 description 3
- 230000000996 additive effect Effects 0.000 description 3
- 150000001299 aldehydes Chemical class 0.000 description 3
- 238000010976 amide bond formation reaction Methods 0.000 description 3
- VZTDIZULWFCMLS-UHFFFAOYSA-N ammonium formate Chemical compound [NH4+].[O-]C=O VZTDIZULWFCMLS-UHFFFAOYSA-N 0.000 description 3
- 239000002260 anti-inflammatory agent Substances 0.000 description 3
- 229940121363 anti-inflammatory agent Drugs 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 229960000074 biopharmaceutical Drugs 0.000 description 3
- SIPUZPBQZHNSDW-UHFFFAOYSA-N bis(2-methylpropyl)aluminum Chemical compound CC(C)C[Al]CC(C)C SIPUZPBQZHNSDW-UHFFFAOYSA-N 0.000 description 3
- 210000000988 bone and bone Anatomy 0.000 description 3
- 229910000024 caesium carbonate Inorganic materials 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 230000002596 correlated effect Effects 0.000 description 3
- NKLCNNUWBJBICK-UHFFFAOYSA-N dess–martin periodinane Chemical compound C1=CC=C2I(OC(=O)C)(OC(C)=O)(OC(C)=O)OC(=O)C2=C1 NKLCNNUWBJBICK-UHFFFAOYSA-N 0.000 description 3
- 125000004431 deuterium atom Chemical group 0.000 description 3
- UAOMVDZJSHZZME-UHFFFAOYSA-N diisopropylamine Chemical compound CC(C)NC(C)C UAOMVDZJSHZZME-UHFFFAOYSA-N 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 125000002883 imidazolyl group Chemical group 0.000 description 3
- 229940125721 immunosuppressive agent Drugs 0.000 description 3
- 230000004054 inflammatory process Effects 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 3
- 239000002480 mineral oil Substances 0.000 description 3
- 235000010446 mineral oil Nutrition 0.000 description 3
- 239000002808 molecular sieve Substances 0.000 description 3
- 201000000050 myeloid neoplasm Diseases 0.000 description 3
- DUWWHGPELOTTOE-UHFFFAOYSA-N n-(5-chloro-2,4-dimethoxyphenyl)-3-oxobutanamide Chemical compound COC1=CC(OC)=C(NC(=O)CC(C)=O)C=C1Cl DUWWHGPELOTTOE-UHFFFAOYSA-N 0.000 description 3
- RJWKIBPXFVCJQH-NSHDSACASA-N n-(cyclopropylmethylidene)-2-methylpropane-2-sulfinamide Chemical compound CC(C)(C)[S@](=O)N=CC1CC1 RJWKIBPXFVCJQH-NSHDSACASA-N 0.000 description 3
- 125000000740 n-pentyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 3
- 125000002971 oxazolyl group Chemical group 0.000 description 3
- 230000008506 pathogenesis Effects 0.000 description 3
- XKJCHHZQLQNZHY-UHFFFAOYSA-N phthalimide Chemical group C1=CC=C2C(=O)NC(=O)C2=C1 XKJCHHZQLQNZHY-UHFFFAOYSA-N 0.000 description 3
- UVSMNLNDYGZFPF-UHFFFAOYSA-N pomalidomide Chemical compound O=C1C=2C(N)=CC=CC=2C(=O)N1C1CCC(=O)NC1=O UVSMNLNDYGZFPF-UHFFFAOYSA-N 0.000 description 3
- 229910000343 potassium bisulfate Inorganic materials 0.000 description 3
- 229910000027 potassium carbonate Inorganic materials 0.000 description 3
- 239000002243 precursor Substances 0.000 description 3
- 230000000770 proinflammatory effect Effects 0.000 description 3
- 235000019260 propionic acid Nutrition 0.000 description 3
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 3
- 150000003254 radicals Chemical class 0.000 description 3
- 125000002914 sec-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 210000003491 skin Anatomy 0.000 description 3
- 239000002002 slurry Substances 0.000 description 3
- 239000011734 sodium Substances 0.000 description 3
- URGAHOPLAPQHLN-UHFFFAOYSA-N sodium aluminosilicate Chemical compound [Na+].[Al+3].[O-][Si]([O-])=O.[O-][Si]([O-])=O URGAHOPLAPQHLN-UHFFFAOYSA-N 0.000 description 3
- 235000017557 sodium bicarbonate Nutrition 0.000 description 3
- 229910000104 sodium hydride Inorganic materials 0.000 description 3
- 229910052717 sulfur Inorganic materials 0.000 description 3
- 239000011593 sulfur Substances 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 3
- 125000001425 triazolyl group Chemical group 0.000 description 3
- UOHDZXTWPSGQLO-UHFFFAOYSA-N tributyl(methoxymethyl)stannane Chemical compound CCCC[Sn](CCCC)(CCCC)COC UOHDZXTWPSGQLO-UHFFFAOYSA-N 0.000 description 3
- LWIHDJKSTIGBAC-UHFFFAOYSA-K tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 3
- RNGJIGOJNRFXEB-UHFFFAOYSA-N (1-cyclopropyl-2-methoxyethenyl)cyclopropane Chemical compound COC=C(C1CC1)C1CC1 RNGJIGOJNRFXEB-UHFFFAOYSA-N 0.000 description 2
- MONMFXREYOKQTI-REOHCLBHSA-N (2s)-2-bromopropanoic acid Chemical compound C[C@H](Br)C(O)=O MONMFXREYOKQTI-REOHCLBHSA-N 0.000 description 2
- SFPPCFXOSJAOKL-FNORWQNLSA-N (ne)-n-ethylidene-2-methylpropane-2-sulfinamide Chemical compound C\C=N\S(=O)C(C)(C)C SFPPCFXOSJAOKL-FNORWQNLSA-N 0.000 description 2
- APQIUTYORBAGEZ-UHFFFAOYSA-N 1,1-dibromoethane Chemical compound CC(Br)Br APQIUTYORBAGEZ-UHFFFAOYSA-N 0.000 description 2
- 125000001399 1,2,3-triazolyl group Chemical group N1N=NC(=C1)* 0.000 description 2
- 125000001376 1,2,4-triazolyl group Chemical group N1N=C(N=C1)* 0.000 description 2
- VJDWLGLJZNWMFB-UHFFFAOYSA-N 2,2-dicyclopropylacetaldehyde Chemical compound C1CC1C(C=O)C1CC1 VJDWLGLJZNWMFB-UHFFFAOYSA-N 0.000 description 2
- MONMFXREYOKQTI-UHFFFAOYSA-N 2-bromopropanoic acid Chemical compound CC(Br)C(O)=O MONMFXREYOKQTI-UHFFFAOYSA-N 0.000 description 2
- IKHGUXGNUITLKF-UHFFFAOYSA-N Acetaldehyde Chemical compound CC=O IKHGUXGNUITLKF-UHFFFAOYSA-N 0.000 description 2
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 2
- NONMTHKENNGEOA-SHZVTRLKSA-N CC(C)(C)C(NC(N=N1)=CC([C@@H](C2CC2)N[S@](C(C)(C)C)=O)=C1Cl)=O Chemical compound CC(C)(C)C(NC(N=N1)=CC([C@@H](C2CC2)N[S@](C(C)(C)C)=O)=C1Cl)=O NONMTHKENNGEOA-SHZVTRLKSA-N 0.000 description 2
- IRDIIEYHXIHAQC-GXFVLUQESA-N CC(C)(C)OC(N[C@@H](C(CC1)CCC1(F)F)C1=CN2N=CC(/C=N/[S@](C(C)(C)C)=O)=CC2=N1)=O Chemical compound CC(C)(C)OC(N[C@@H](C(CC1)CCC1(F)F)C1=CN2N=CC(/C=N/[S@](C(C)(C)C)=O)=CC2=N1)=O IRDIIEYHXIHAQC-GXFVLUQESA-N 0.000 description 2
- FAJYDXZMVNOSQJ-PMACEKPBSA-N CC(C)(C)OC(N[C@@H](C(CC1)CCC1(F)F)C1=CN2N=CC([C@@H](C3(CCC3)C#N)N)=CC2=N1)=O Chemical compound CC(C)(C)OC(N[C@@H](C(CC1)CCC1(F)F)C1=CN2N=CC([C@@H](C3(CCC3)C#N)N)=CC2=N1)=O FAJYDXZMVNOSQJ-PMACEKPBSA-N 0.000 description 2
- WMJNEGOAFTVFIY-UHFFFAOYSA-N CCOC(C1=NON=C1C(F)F)=O Chemical compound CCOC(C1=NON=C1C(F)F)=O WMJNEGOAFTVFIY-UHFFFAOYSA-N 0.000 description 2
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 2
- 102100032373 Coiled-coil domain-containing protein 85B Human genes 0.000 description 2
- YZCKVEUIGOORGS-OUBTZVSYSA-N Deuterium Chemical compound [2H] YZCKVEUIGOORGS-OUBTZVSYSA-N 0.000 description 2
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 2
- 108010008165 Etanercept Proteins 0.000 description 2
- 239000007821 HATU Substances 0.000 description 2
- DIIWSYPKAJVXBV-UHFFFAOYSA-N Hantzch dihydropyridine Natural products CCOC(=O)C1=CC(C(=O)OCC)=C(C)N=C1C DIIWSYPKAJVXBV-UHFFFAOYSA-N 0.000 description 2
- 101000868814 Homo sapiens Coiled-coil domain-containing protein 85B Proteins 0.000 description 2
- 101000998146 Homo sapiens Interleukin-17A Proteins 0.000 description 2
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical compound Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- 102100035018 Interleukin-17 receptor A Human genes 0.000 description 2
- 101710186083 Interleukin-17 receptor A Proteins 0.000 description 2
- 102100035012 Interleukin-17 receptor C Human genes 0.000 description 2
- 101710186068 Interleukin-17 receptor C Proteins 0.000 description 2
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 2
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 2
- WMFOQBRAJBCJND-UHFFFAOYSA-M Lithium hydroxide Chemical compound [Li+].[OH-] WMFOQBRAJBCJND-UHFFFAOYSA-M 0.000 description 2
- 208000005777 Lupus Nephritis Diseases 0.000 description 2
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- VQBLHCUWNFFUGD-UHFFFAOYSA-N N-(6-chloro-5-formylpyridazin-3-yl)-2,2-dimethylpropanamide Chemical compound C1(=CC(C=O)=C(Cl)N=N1)NC(=O)C(C)(C)C VQBLHCUWNFFUGD-UHFFFAOYSA-N 0.000 description 2
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 2
- MBBZMMPHUWSWHV-BDVNFPICSA-N N-methylglucamine Chemical compound CNC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO MBBZMMPHUWSWHV-BDVNFPICSA-N 0.000 description 2
- 229910002651 NO3 Inorganic materials 0.000 description 2
- NHNBFGGVMKEFGY-UHFFFAOYSA-N Nitrate Chemical compound [O-][N+]([O-])=O NHNBFGGVMKEFGY-UHFFFAOYSA-N 0.000 description 2
- OFBQJSOFQDEBGM-UHFFFAOYSA-N Pentane Chemical compound CCCCC OFBQJSOFQDEBGM-UHFFFAOYSA-N 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 2
- LOUPRKONTZGTKE-WZBLMQSHSA-N Quinine Chemical compound C([C@H]([C@H](C1)C=C)C2)C[N@@]1[C@@H]2[C@H](O)C1=CC=NC2=CC=C(OC)C=C21 LOUPRKONTZGTKE-WZBLMQSHSA-N 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 2
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- 230000001154 acute effect Effects 0.000 description 2
- 229960002964 adalimumab Drugs 0.000 description 2
- 201000009961 allergic asthma Diseases 0.000 description 2
- 150000001413 amino acids Chemical group 0.000 description 2
- 229910021529 ammonia Inorganic materials 0.000 description 2
- 239000008346 aqueous phase Substances 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 229940077388 benzenesulfonate Drugs 0.000 description 2
- SRSXLGNVWSONIS-UHFFFAOYSA-M benzenesulfonate Chemical compound [O-]S(=O)(=O)C1=CC=CC=C1 SRSXLGNVWSONIS-UHFFFAOYSA-M 0.000 description 2
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 2
- 125000002619 bicyclic group Chemical group 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 125000001246 bromo group Chemical group Br* 0.000 description 2
- JAMFGQBENKSWOF-UHFFFAOYSA-N bromo(methoxy)methane Chemical compound COCBr JAMFGQBENKSWOF-UHFFFAOYSA-N 0.000 description 2
- GZUXJHMPEANEGY-UHFFFAOYSA-N bromomethane Chemical compound BrC GZUXJHMPEANEGY-UHFFFAOYSA-N 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- 229910052791 calcium Inorganic materials 0.000 description 2
- 229960005069 calcium Drugs 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 125000001309 chloro group Chemical group Cl* 0.000 description 2
- 125000004122 cyclic group Chemical group 0.000 description 2
- 125000000582 cycloheptyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 2
- PAFZNILMFXTMIY-UHFFFAOYSA-N cyclohexylamine Chemical compound NC1CCCCC1 PAFZNILMFXTMIY-UHFFFAOYSA-N 0.000 description 2
- 125000000640 cyclooctyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C([H])([H])C1([H])[H] 0.000 description 2
- JMYVMOUINOAAPA-UHFFFAOYSA-N cyclopropanecarbaldehyde Chemical compound O=CC1CC1 JMYVMOUINOAAPA-UHFFFAOYSA-N 0.000 description 2
- YOXHCYXIAVIFCZ-UHFFFAOYSA-N cyclopropanol Chemical compound OC1CC1 YOXHCYXIAVIFCZ-UHFFFAOYSA-N 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 229910052805 deuterium Inorganic materials 0.000 description 2
- LVTYICIALWPMFW-UHFFFAOYSA-N diisopropanolamine Chemical compound CC(O)CNCC(C)O LVTYICIALWPMFW-UHFFFAOYSA-N 0.000 description 2
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 2
- 229910000397 disodium phosphate Inorganic materials 0.000 description 2
- 235000019800 disodium phosphate Nutrition 0.000 description 2
- 239000006185 dispersion Substances 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 125000005745 ethoxymethyl group Chemical group [H]C([H])([H])C([H])([H])OC([H])([H])* 0.000 description 2
- VRHAQNTWKSVEEC-UHFFFAOYSA-N ethyl 1,3-dioxoisoindole-2-carboxylate Chemical compound C1=CC=C2C(=O)N(C(=O)OCC)C(=O)C2=C1 VRHAQNTWKSVEEC-UHFFFAOYSA-N 0.000 description 2
- OGFGNEHBFPNDDB-UHFFFAOYSA-N ethyl 4-(trifluoromethyl)-1,2,5-oxadiazole-3-carboxylate Chemical compound O1N=C(C(F)(F)F)C(=N1)C(=O)OCC OGFGNEHBFPNDDB-UHFFFAOYSA-N 0.000 description 2
- 210000002950 fibroblast Anatomy 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 239000007789 gas Substances 0.000 description 2
- 229950010864 guselkumab Drugs 0.000 description 2
- 210000004524 haematopoietic cell Anatomy 0.000 description 2
- 238000010438 heat treatment Methods 0.000 description 2
- XLYOFNOQVPJJNP-ZSJDYOACSA-N heavy water Substances [2H]O[2H] XLYOFNOQVPJJNP-ZSJDYOACSA-N 0.000 description 2
- 125000001072 heteroaryl group Chemical group 0.000 description 2
- 125000005842 heteroatom Chemical group 0.000 description 2
- 230000002519 immonomodulatory effect Effects 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 210000004964 innate lymphoid cell Anatomy 0.000 description 2
- 102000053460 interleukin-17 receptor activity proteins Human genes 0.000 description 2
- 108040001304 interleukin-17 receptor activity proteins Proteins 0.000 description 2
- UEXQBEVWFZKHNB-UHFFFAOYSA-N intermediate 29 Natural products C1=CC(N)=CC=C1NC1=NC=CC=N1 UEXQBEVWFZKHNB-UHFFFAOYSA-N 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 210000001503 joint Anatomy 0.000 description 2
- GOTYRUGSSMKFNF-UHFFFAOYSA-N lenalidomide Chemical compound C1C=2C(N)=CC=CC=2C(=O)N1C1CCC(=O)NC1=O GOTYRUGSSMKFNF-UHFFFAOYSA-N 0.000 description 2
- 239000011777 magnesium Substances 0.000 description 2
- 229910052749 magnesium Inorganic materials 0.000 description 2
- ULKSWZAXQDJMJT-UHFFFAOYSA-M magnesium;2,2,6,6-tetramethylpiperidin-1-ide;chloride Chemical compound [Cl-].CC1(C)CCCC(C)(C)N1[Mg+] ULKSWZAXQDJMJT-UHFFFAOYSA-M 0.000 description 2
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 108020004999 messenger RNA Proteins 0.000 description 2
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 2
- OIRDBPQYVWXNSJ-UHFFFAOYSA-N methyl trifluoromethansulfonate Chemical compound COS(=O)(=O)C(F)(F)F OIRDBPQYVWXNSJ-UHFFFAOYSA-N 0.000 description 2
- 150000007522 mineralic acids Chemical class 0.000 description 2
- 125000001280 n-hexyl group Chemical group C(CCCCC)* 0.000 description 2
- 150000007524 organic acids Chemical class 0.000 description 2
- 210000002997 osteoclast Anatomy 0.000 description 2
- 229910052763 palladium Inorganic materials 0.000 description 2
- 210000005259 peripheral blood Anatomy 0.000 description 2
- 239000011886 peripheral blood Substances 0.000 description 2
- XIPFMBOWZXULIA-UHFFFAOYSA-N pivalamide Chemical compound CC(C)(C)C(N)=O XIPFMBOWZXULIA-UHFFFAOYSA-N 0.000 description 2
- 229910052700 potassium Inorganic materials 0.000 description 2
- 239000011591 potassium Substances 0.000 description 2
- CHKVPAROMQMJNQ-UHFFFAOYSA-M potassium bisulfate Chemical compound [K+].OS([O-])(=O)=O CHKVPAROMQMJNQ-UHFFFAOYSA-M 0.000 description 2
- NROKBHXJSPEDAR-UHFFFAOYSA-M potassium fluoride Chemical compound [F-].[K+] NROKBHXJSPEDAR-UHFFFAOYSA-M 0.000 description 2
- ZRLVQFQTCMUIRM-UHFFFAOYSA-N potassium;2-methylbutan-2-olate Chemical compound [K+].CCC(C)(C)[O-] ZRLVQFQTCMUIRM-UHFFFAOYSA-N 0.000 description 2
- 239000002244 precipitate Substances 0.000 description 2
- KIDHWZJUCRJVML-UHFFFAOYSA-N putrescine Chemical compound NCCCCN KIDHWZJUCRJVML-UHFFFAOYSA-N 0.000 description 2
- 125000000714 pyrimidinyl group Chemical group 0.000 description 2
- 125000000168 pyrrolyl group Chemical group 0.000 description 2
- 238000010992 reflux Methods 0.000 description 2
- 210000003583 retinal pigment epithelium Anatomy 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 229950007943 risankizumab Drugs 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 230000011664 signaling Effects 0.000 description 2
- 206010040882 skin lesion Diseases 0.000 description 2
- 231100000444 skin lesion Toxicity 0.000 description 2
- 229910052708 sodium Inorganic materials 0.000 description 2
- 229910000029 sodium carbonate Inorganic materials 0.000 description 2
- BEOOHQFXGBMRKU-UHFFFAOYSA-N sodium cyanoborohydride Chemical compound [Na+].[B-]C#N BEOOHQFXGBMRKU-UHFFFAOYSA-N 0.000 description 2
- LPXPTNMVRIOKMN-UHFFFAOYSA-M sodium nitrite Chemical compound [Na+].[O-]N=O LPXPTNMVRIOKMN-UHFFFAOYSA-M 0.000 description 2
- 230000006641 stabilisation Effects 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 239000007858 starting material Substances 0.000 description 2
- 150000003431 steroids Chemical class 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 2
- 125000001010 sulfinic acid amide group Chemical group 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 229940095064 tartrate Drugs 0.000 description 2
- DYHSDKLCOJIUFX-UHFFFAOYSA-N tert-butoxycarbonyl anhydride Chemical compound CC(C)(C)OC(=O)OC(=O)OC(C)(C)C DYHSDKLCOJIUFX-UHFFFAOYSA-N 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 238000004809 thin layer chromatography Methods 0.000 description 2
- 229950005515 tildrakizumab Drugs 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- AJMCPPHFXMZWCK-UHFFFAOYSA-N tributyl(cyclobutyloxymethyl)stannane Chemical compound CCCC[Sn](CCCC)(CCCC)COC1CCC1 AJMCPPHFXMZWCK-UHFFFAOYSA-N 0.000 description 2
- XEKIDGIZQAEOKB-UHFFFAOYSA-N tributyl(iodomethyl)stannane Chemical compound CCCC[Sn](CI)(CCCC)CCCC XEKIDGIZQAEOKB-UHFFFAOYSA-N 0.000 description 2
- XFNJVJPLKCPIBV-UHFFFAOYSA-N trimethylenediamine Chemical compound NCCCN XFNJVJPLKCPIBV-UHFFFAOYSA-N 0.000 description 2
- 229910000404 tripotassium phosphate Inorganic materials 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- 150000003672 ureas Chemical class 0.000 description 2
- LSPHULWDVZXLIL-UHFFFAOYSA-N (+/-)-Camphoric acid Chemical compound CC1(C)C(C(O)=O)CCC1(C)C(O)=O LSPHULWDVZXLIL-UHFFFAOYSA-N 0.000 description 1
- VRJSPHBNIYAYAY-NSHDSACASA-N (2S)-3,3-dicyclopropyl-2-[(2-methylpropan-2-yl)oxycarbonylamino]propanoic acid Chemical compound C(C)(C)(C)OC(=O)N[C@H](C(=O)O)C(C1CC1)C1CC1 VRJSPHBNIYAYAY-NSHDSACASA-N 0.000 description 1
- FCFWEOGTZZPCTO-MRVPVSSYSA-N (2r)-3,6-dimethoxy-2-propan-2-yl-2,5-dihydropyrazine Chemical compound COC1=N[C@H](C(C)C)C(OC)=NC1 FCFWEOGTZZPCTO-MRVPVSSYSA-N 0.000 description 1
- CMIBUZBMZCBCAT-HZPDHXFCSA-N (2r,3r)-2,3-bis[(4-methylbenzoyl)oxy]butanedioic acid Chemical compound C1=CC(C)=CC=C1C(=O)O[C@@H](C(O)=O)[C@H](C(O)=O)OC(=O)C1=CC=C(C)C=C1 CMIBUZBMZCBCAT-HZPDHXFCSA-N 0.000 description 1
- SPFMQWBKVUQXJV-BTVCFUMJSA-N (2r,3s,4r,5r)-2,3,4,5,6-pentahydroxyhexanal;hydrate Chemical compound O.OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C=O SPFMQWBKVUQXJV-BTVCFUMJSA-N 0.000 description 1
- GILIYJDBJZWGBG-REOHCLBHSA-N (2s)-1,1,1-trifluoropropan-2-ol Chemical compound C[C@H](O)C(F)(F)F GILIYJDBJZWGBG-REOHCLBHSA-N 0.000 description 1
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- 125000004400 (C1-C12) alkyl group Chemical group 0.000 description 1
- 125000004169 (C1-C6) alkyl group Chemical group 0.000 description 1
- GHOKWGTUZJEAQD-ZETCQYMHSA-N (D)-(+)-Pantothenic acid Chemical compound OCC(C)(C)[C@@H](O)C(=O)NCCC(O)=O GHOKWGTUZJEAQD-ZETCQYMHSA-N 0.000 description 1
- OCGWWLDZAFOHGD-UHFFFAOYSA-N 1,1,1-trifluoro-2-methylpropan-2-ol Chemical compound CC(C)(O)C(F)(F)F OCGWWLDZAFOHGD-UHFFFAOYSA-N 0.000 description 1
- SCYULBFZEHDVBN-UHFFFAOYSA-N 1,1-Dichloroethane Chemical compound CC(Cl)Cl SCYULBFZEHDVBN-UHFFFAOYSA-N 0.000 description 1
- 125000004502 1,2,3-oxadiazolyl group Chemical group 0.000 description 1
- 125000004504 1,2,4-oxadiazolyl group Chemical group 0.000 description 1
- 125000001781 1,3,4-oxadiazolyl group Chemical group 0.000 description 1
- DFPYXQYWILNVAU-UHFFFAOYSA-N 1-hydroxybenzotriazole Chemical compound C1=CC=C2N(O)N=NC2=C1.C1=CC=C2N(O)N=NC2=C1 DFPYXQYWILNVAU-UHFFFAOYSA-N 0.000 description 1
- 238000005160 1H NMR spectroscopy Methods 0.000 description 1
- AOBBDXYJJKBZJY-UHFFFAOYSA-N 2,2,3,3-tetrafluorobutane-1,4-diamine Chemical compound NCC(F)(F)C(F)(F)CN AOBBDXYJJKBZJY-UHFFFAOYSA-N 0.000 description 1
- CDZXJJOGDCLNKX-UHFFFAOYSA-N 2,2,3,3-tetrafluorobutane-1,4-diol Chemical compound OCC(F)(F)C(F)(F)CO CDZXJJOGDCLNKX-UHFFFAOYSA-N 0.000 description 1
- DDHUNHGZUHZNKB-UHFFFAOYSA-N 2,2-dimethylpropane-1,3-diamine Chemical compound NCC(C)(C)CN DDHUNHGZUHZNKB-UHFFFAOYSA-N 0.000 description 1
- JVSFQJZRHXAUGT-UHFFFAOYSA-N 2,2-dimethylpropanoyl chloride Chemical compound CC(C)(C)C(Cl)=O JVSFQJZRHXAUGT-UHFFFAOYSA-N 0.000 description 1
- TYGCVPMEMBXPSM-LBPRGKRZSA-N 2,4,6-trimethylbenzenesulfinamide Chemical compound CC1=CC(C)=C([S@@](N)=O)C(C)=C1 TYGCVPMEMBXPSM-LBPRGKRZSA-N 0.000 description 1
- UEJJHQNACJXSKW-UHFFFAOYSA-N 2-(2,6-dioxopiperidin-3-yl)-1H-isoindole-1,3(2H)-dione Chemical compound O=C1C2=CC=CC=C2C(=O)N1C1CCC(=O)NC1=O UEJJHQNACJXSKW-UHFFFAOYSA-N 0.000 description 1
- NXFFJDQHYLNEJK-UHFFFAOYSA-N 2-[4-[(4-chlorophenyl)methyl]-7-fluoro-5-methylsulfonyl-2,3-dihydro-1h-cyclopenta[b]indol-3-yl]acetic acid Chemical compound C1=2C(S(=O)(=O)C)=CC(F)=CC=2C=2CCC(CC(O)=O)C=2N1CC1=CC=C(Cl)C=C1 NXFFJDQHYLNEJK-UHFFFAOYSA-N 0.000 description 1
- ABFPKTQEQNICFT-UHFFFAOYSA-M 2-chloro-1-methylpyridin-1-ium;iodide Chemical compound [I-].C[N+]1=CC=CC=C1Cl ABFPKTQEQNICFT-UHFFFAOYSA-M 0.000 description 1
- 239000001763 2-hydroxyethyl(trimethyl)azanium Substances 0.000 description 1
- JTNCEQNHURODLX-UHFFFAOYSA-N 2-phenylethanimidamide Chemical compound NC(=N)CC1=CC=CC=C1 JTNCEQNHURODLX-UHFFFAOYSA-N 0.000 description 1
- OABCLADGVBHOPC-UHFFFAOYSA-N 2-propan-2-ylpyrazole-3-carbonyl chloride Chemical compound CC(C)N1N=CC=C1C(Cl)=O OABCLADGVBHOPC-UHFFFAOYSA-N 0.000 description 1
- DTXVKPOKPFWSFF-UHFFFAOYSA-N 3(S)-hydroxy-13-cis-eicosenoyl-CoA Chemical compound NC1=CC=C(Cl)N=N1 DTXVKPOKPFWSFF-UHFFFAOYSA-N 0.000 description 1
- AHLQCSUZPCONHF-UHFFFAOYSA-N 3,3-difluorocyclopentane-1-carbaldehyde Chemical compound FC1(F)CCC(C=O)C1 AHLQCSUZPCONHF-UHFFFAOYSA-N 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-M 3-carboxy-2,3-dihydroxypropanoate Chemical compound OC(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-M 0.000 description 1
- ALKYHXVLJMQRLQ-UHFFFAOYSA-M 3-carboxynaphthalen-2-olate Chemical compound C1=CC=C2C=C(C([O-])=O)C(O)=CC2=C1 ALKYHXVLJMQRLQ-UHFFFAOYSA-M 0.000 description 1
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 1
- KPIPMSGECJHLNB-UHFFFAOYSA-N 4-(difluoromethyl)-1,2,5-oxadiazole-3-carboxylic acid Chemical compound N=1ON=C(C(F)F)C=1C(=O)O KPIPMSGECJHLNB-UHFFFAOYSA-N 0.000 description 1
- PNTOGNKUHMFXAH-UHFFFAOYSA-N 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid Chemical compound OC(=O)C1=NON=C1C1CC1 PNTOGNKUHMFXAH-UHFFFAOYSA-N 0.000 description 1
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical compound [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 229910015844 BCl3 Inorganic materials 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-M Bicarbonate Chemical compound OC([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-M 0.000 description 1
- 208000006386 Bone Resorption Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-M Bromide Chemical compound [Br-] CPELXLSAUQHCOX-UHFFFAOYSA-M 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- IDCYDLXMOTVYHZ-QMMMGPOBSA-N CC(C)(C)OC(N[C@@H](COC(C)(C)C(F)(F)F)C(CI)=O)=O Chemical compound CC(C)(C)OC(N[C@@H](COC(C)(C)C(F)(F)F)C(CI)=O)=O IDCYDLXMOTVYHZ-QMMMGPOBSA-N 0.000 description 1
- 101710186200 CCAAT/enhancer-binding protein Proteins 0.000 description 1
- RDBIPHCCWOQYSP-VIFPVBQESA-N COC([C@H](C(C1CC1)C1CC1)N)=O Chemical compound COC([C@H](C(C1CC1)C1CC1)N)=O RDBIPHCCWOQYSP-VIFPVBQESA-N 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 206010051290 Central nervous system lesion Diseases 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- 235000019743 Choline chloride Nutrition 0.000 description 1
- 235000001258 Cinchona calisaya Nutrition 0.000 description 1
- 229920000858 Cyclodextrin Polymers 0.000 description 1
- RGHNJXZEOKUKBD-SQOUGZDYSA-M D-gluconate Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O RGHNJXZEOKUKBD-SQOUGZDYSA-M 0.000 description 1
- 229940123907 Disease modifying antirheumatic drug Drugs 0.000 description 1
- SNRUBQQJIBEYMU-UHFFFAOYSA-N Dodecane Natural products CCCCCCCCCCCC SNRUBQQJIBEYMU-UHFFFAOYSA-N 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 1
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039619 Granulocyte colony-stimulating factor Human genes 0.000 description 1
- 241001272567 Hominoidea Species 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101100384805 Homo sapiens ARCN1 gene Proteins 0.000 description 1
- 101001055222 Homo sapiens Interleukin-8 Proteins 0.000 description 1
- 101000990915 Homo sapiens Stromelysin-1 Proteins 0.000 description 1
- 101000713585 Homo sapiens Tubulin beta-4A chain Proteins 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-O Htris Chemical compound OCC([NH3+])(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-O 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- 229940126060 IL-17A antagonist Drugs 0.000 description 1
- 102000004554 Interleukin-17 Receptors Human genes 0.000 description 1
- 108010017525 Interleukin-17 Receptors Proteins 0.000 description 1
- 102100033461 Interleukin-17A Human genes 0.000 description 1
- 108090001007 Interleukin-8 Proteins 0.000 description 1
- 102000004890 Interleukin-8 Human genes 0.000 description 1
- 102100026236 Interleukin-8 Human genes 0.000 description 1
- 206010023203 Joint destruction Diseases 0.000 description 1
- 208000012659 Joint disease Diseases 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- WHXSMMKQMYFTQS-UHFFFAOYSA-N Lithium Chemical compound [Li] WHXSMMKQMYFTQS-UHFFFAOYSA-N 0.000 description 1
- 239000012448 Lithium borohydride Substances 0.000 description 1
- 108091054455 MAP kinase family Proteins 0.000 description 1
- 102000043136 MAP kinase family Human genes 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 108010057466 NF-kappa B Proteins 0.000 description 1
- 102000003945 NF-kappa B Human genes 0.000 description 1
- 229910020889 NaBH3 Inorganic materials 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 206010036790 Productive cough Diseases 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-M Propionate Chemical compound CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 1
- 239000005700 Putrescine Substances 0.000 description 1
- 235000014443 Pyrus communis Nutrition 0.000 description 1
- 208000002200 Respiratory Hypersensitivity Diseases 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- KEAYESYHFKHZAL-UHFFFAOYSA-N Sodium Chemical compound [Na] KEAYESYHFKHZAL-UHFFFAOYSA-N 0.000 description 1
- 102100030416 Stromelysin-1 Human genes 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 210000000662 T-lymphocyte subset Anatomy 0.000 description 1
- 229920002253 Tannate Polymers 0.000 description 1
- 239000004809 Teflon Substances 0.000 description 1
- 229920006362 Teflon® Polymers 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 102000000591 Tight Junction Proteins Human genes 0.000 description 1
- 108010002321 Tight Junction Proteins Proteins 0.000 description 1
- GSEJCLTVZPLZKY-UHFFFAOYSA-N Triethanolamine Chemical compound OCCN(CCO)CCO GSEJCLTVZPLZKY-UHFFFAOYSA-N 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- YZCKVEUIGOORGS-NJFSPNSNSA-N Tritium Chemical compound [3H] YZCKVEUIGOORGS-NJFSPNSNSA-N 0.000 description 1
- 102100036788 Tubulin beta-4A chain Human genes 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 1
- 239000003929 acidic solution Substances 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- WNLRTRBMVRJNCN-UHFFFAOYSA-L adipate(2-) Chemical compound [O-]C(=O)CCCCC([O-])=O WNLRTRBMVRJNCN-UHFFFAOYSA-L 0.000 description 1
- 230000010085 airway hyperresponsiveness Effects 0.000 description 1
- 229910052783 alkali metal Inorganic materials 0.000 description 1
- 229910052784 alkaline earth metal Inorganic materials 0.000 description 1
- 239000012670 alkaline solution Substances 0.000 description 1
- 150000001336 alkenes Chemical class 0.000 description 1
- 125000003342 alkenyl group Chemical group 0.000 description 1
- 125000003545 alkoxy group Chemical group 0.000 description 1
- 150000001350 alkyl halides Chemical class 0.000 description 1
- 125000000304 alkynyl group Chemical group 0.000 description 1
- VREFGVBLTWBCJP-UHFFFAOYSA-N alprazolam Chemical compound C12=CC(Cl)=CC=C2N2C(C)=NN=C2CN=C1C1=CC=CC=C1 VREFGVBLTWBCJP-UHFFFAOYSA-N 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 229940024606 amino acid Drugs 0.000 description 1
- 235000001014 amino acid Nutrition 0.000 description 1
- 150000001414 amino alcohols Chemical class 0.000 description 1
- 150000003863 ammonium salts Chemical class 0.000 description 1
- 150000008064 anhydrides Chemical class 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 210000001742 aqueous humor Anatomy 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 239000012298 atmosphere Substances 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 201000004982 autoimmune uveitis Diseases 0.000 description 1
- 125000002393 azetidinyl group Chemical group 0.000 description 1
- 125000004069 aziridinyl group Chemical group 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- JUHORIMYRDESRB-UHFFFAOYSA-N benzathine Chemical compound C=1C=CC=CC=1CNCCNCC1=CC=CC=C1 JUHORIMYRDESRB-UHFFFAOYSA-N 0.000 description 1
- AGEZXYOZHKGVCM-UHFFFAOYSA-N benzyl bromide Chemical compound BrCC1=CC=CC=C1 AGEZXYOZHKGVCM-UHFFFAOYSA-N 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- 238000001574 biopsy Methods 0.000 description 1
- 239000012455 biphasic mixture Substances 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 230000024279 bone resorption Effects 0.000 description 1
- UWTDFICHZKXYAC-UHFFFAOYSA-N boron;oxolane Chemical compound [B].C1CCOC1 UWTDFICHZKXYAC-UHFFFAOYSA-N 0.000 description 1
- 229960003735 brodalumab Drugs 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- AXCZMVOFGPJBDE-UHFFFAOYSA-L calcium dihydroxide Chemical compound [OH-].[OH-].[Ca+2] AXCZMVOFGPJBDE-UHFFFAOYSA-L 0.000 description 1
- 239000004227 calcium gluconate Substances 0.000 description 1
- 235000013927 calcium gluconate Nutrition 0.000 description 1
- 229960004494 calcium gluconate Drugs 0.000 description 1
- 239000000920 calcium hydroxide Substances 0.000 description 1
- 229910001861 calcium hydroxide Inorganic materials 0.000 description 1
- 229940095643 calcium hydroxide Drugs 0.000 description 1
- NEEHYRZPVYRGPP-UHFFFAOYSA-L calcium;2,3,4,5,6-pentahydroxyhexanoate Chemical compound [Ca+2].OCC(O)C(O)C(O)C(O)C([O-])=O.OCC(O)C(O)C(O)C(O)C([O-])=O NEEHYRZPVYRGPP-UHFFFAOYSA-L 0.000 description 1
- MIOPJNTWMNEORI-UHFFFAOYSA-N camphorsulfonic acid Chemical compound C1CC2(CS(O)(=O)=O)C(=O)CC1C2(C)C MIOPJNTWMNEORI-UHFFFAOYSA-N 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 1
- 150000001735 carboxylic acids Chemical class 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 239000003054 catalyst Substances 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 229960003115 certolizumab pegol Drugs 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 150000001793 charged compounds Chemical class 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- VDANGULDQQJODZ-UHFFFAOYSA-N chloroprocaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1Cl VDANGULDQQJODZ-UHFFFAOYSA-N 0.000 description 1
- 229960002023 chloroprocaine Drugs 0.000 description 1
- OEYIOHPDSNJKLS-UHFFFAOYSA-N choline Chemical compound C[N+](C)(C)CCO OEYIOHPDSNJKLS-UHFFFAOYSA-N 0.000 description 1
- 229960001231 choline Drugs 0.000 description 1
- SGMZJAMFUVOLNK-UHFFFAOYSA-M choline chloride Chemical compound [Cl-].C[N+](C)(C)CCO SGMZJAMFUVOLNK-UHFFFAOYSA-M 0.000 description 1
- 229960003178 choline chloride Drugs 0.000 description 1
- 238000013375 chromatographic separation Methods 0.000 description 1
- 229940090100 cimzia Drugs 0.000 description 1
- LOUPRKONTZGTKE-UHFFFAOYSA-N cinchonine Natural products C1C(C(C2)C=C)CCN2C1C(O)C1=CC=NC2=CC=C(OC)C=C21 LOUPRKONTZGTKE-UHFFFAOYSA-N 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 239000003246 corticosteroid Substances 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 239000007822 coupling agent Substances 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- KTHXBEHDVMTNOH-UHFFFAOYSA-N cyclobutanol Chemical compound OC1CCC1 KTHXBEHDVMTNOH-UHFFFAOYSA-N 0.000 description 1
- 125000001995 cyclobutyl group Chemical group [H]C1([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- HCAJEUSONLESMK-UHFFFAOYSA-N cyclohexylsulfamic acid Chemical compound OS(=O)(=O)NC1CCCCC1 HCAJEUSONLESMK-UHFFFAOYSA-N 0.000 description 1
- 125000000058 cyclopentadienyl group Chemical group C1(=CC=CC1)* 0.000 description 1
- YUYGUQQDGRTJMA-UHFFFAOYSA-M cyclopentane;ruthenium(1+);triphenylphosphane;chloride Chemical compound [Ru]Cl.[CH]1[CH][CH][CH][CH]1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1 YUYGUQQDGRTJMA-UHFFFAOYSA-M 0.000 description 1
- 125000001511 cyclopentyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- DEZRYPDIMOWBDS-UHFFFAOYSA-N dcm dichloromethane Chemical compound ClCCl.ClCCl DEZRYPDIMOWBDS-UHFFFAOYSA-N 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 125000002704 decyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 230000035614 depigmentation Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- ACYGYJFTZSAZKR-UHFFFAOYSA-J dicalcium;2-[2-[bis(carboxylatomethyl)amino]ethyl-(carboxylatomethyl)amino]acetate Chemical compound [Ca+2].[Ca+2].[O-]C(=O)CN(CC([O-])=O)CCN(CC([O-])=O)CC([O-])=O ACYGYJFTZSAZKR-UHFFFAOYSA-J 0.000 description 1
- BIPUHAHGLJKIPK-UHFFFAOYSA-N dicyclopropylmethanone Chemical compound C1CC1C(=O)C1CC1 BIPUHAHGLJKIPK-UHFFFAOYSA-N 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- ZBCBWPMODOFKDW-UHFFFAOYSA-N diethanolamine Chemical compound OCCNCCO ZBCBWPMODOFKDW-UHFFFAOYSA-N 0.000 description 1
- GOWQBFVDZPZZFA-UHFFFAOYSA-N diethyl 2-fluoropropanedioate Chemical compound CCOC(=O)C(F)C(=O)OCC GOWQBFVDZPZZFA-UHFFFAOYSA-N 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- OOKFLLNDYNWCHK-UHFFFAOYSA-N difluoromethyl(trimethyl)silane Chemical compound C[Si](C)(C)C(F)F OOKFLLNDYNWCHK-UHFFFAOYSA-N 0.000 description 1
- 229940043279 diisopropylamine Drugs 0.000 description 1
- 229940113088 dimethylacetamide Drugs 0.000 description 1
- 229910001873 dinitrogen Inorganic materials 0.000 description 1
- 239000001177 diphosphate Substances 0.000 description 1
- XPPKVPWEQAFLFU-UHFFFAOYSA-J diphosphate(4-) Chemical compound [O-]P([O-])(=O)OP([O-])([O-])=O XPPKVPWEQAFLFU-UHFFFAOYSA-J 0.000 description 1
- 235000011180 diphosphates Nutrition 0.000 description 1
- DGODWNOPHMXOTR-UHFFFAOYSA-N dipotassium;dioxido(dioxo)osmium;dihydrate Chemical compound O.O.[K+].[K+].[O-][Os]([O-])(=O)=O DGODWNOPHMXOTR-UHFFFAOYSA-N 0.000 description 1
- 230000009266 disease activity Effects 0.000 description 1
- 239000002988 disease modifying antirheumatic drug Substances 0.000 description 1
- 239000002612 dispersion medium Substances 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- CETRZFQIITUQQL-UHFFFAOYSA-N dmso dimethylsulfoxide Chemical compound CS(C)=O.CS(C)=O CETRZFQIITUQQL-UHFFFAOYSA-N 0.000 description 1
- 125000003438 dodecyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- MOTZDAYCYVMXPC-UHFFFAOYSA-N dodecyl hydrogen sulfate Chemical compound CCCCCCCCCCCCOS(O)(=O)=O MOTZDAYCYVMXPC-UHFFFAOYSA-N 0.000 description 1
- 229940043264 dodecyl sulfate Drugs 0.000 description 1
- 230000004064 dysfunction Effects 0.000 description 1
- 229940009662 edetate Drugs 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 238000000132 electrospray ionisation Methods 0.000 description 1
- 229940073621 enbrel Drugs 0.000 description 1
- ZSWFCLXCOIISFI-UHFFFAOYSA-N endo-cyclopentadiene Natural products C1C=CC=C1 ZSWFCLXCOIISFI-UHFFFAOYSA-N 0.000 description 1
- 229950000206 estolate Drugs 0.000 description 1
- 229960000403 etanercept Drugs 0.000 description 1
- CCIVGXIOQKPBKL-UHFFFAOYSA-M ethanesulfonate Chemical compound CCS([O-])(=O)=O CCIVGXIOQKPBKL-UHFFFAOYSA-M 0.000 description 1
- VICYTAYPKBLQFB-UHFFFAOYSA-N ethyl 3-bromo-2-oxopropanoate Chemical compound CCOC(=O)C(=O)CBr VICYTAYPKBLQFB-UHFFFAOYSA-N 0.000 description 1
- OCJKUQIPRNZDTK-UHFFFAOYSA-N ethyl 4,4,4-trifluoro-3-oxobutanoate Chemical compound CCOC(=O)CC(=O)C(F)(F)F OCJKUQIPRNZDTK-UHFFFAOYSA-N 0.000 description 1
- CBDPWKVOPADMJC-UHFFFAOYSA-N ethyl 4,4-difluoro-3-oxobutanoate Chemical compound CCOC(=O)CC(=O)C(F)F CBDPWKVOPADMJC-UHFFFAOYSA-N 0.000 description 1
- OJCSPXHYDFONPU-UHFFFAOYSA-N etoac etoac Chemical compound CCOC(C)=O.CCOC(C)=O OJCSPXHYDFONPU-UHFFFAOYSA-N 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 238000003818 flash chromatography Methods 0.000 description 1
- 235000019253 formic acid Nutrition 0.000 description 1
- 238000001640 fractional crystallisation Methods 0.000 description 1
- 239000012458 free base Substances 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 125000002541 furyl group Chemical group 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 229940050410 gluconate Drugs 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 229960001743 golimumab Drugs 0.000 description 1
- 229910052736 halogen Inorganic materials 0.000 description 1
- 150000002367 halogens Chemical class 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- 125000003187 heptyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 239000000710 homodimer Substances 0.000 description 1
- 229940048921 humira Drugs 0.000 description 1
- XGIHQYAWBCFNPY-AZOCGYLKSA-N hydrabamine Chemical compound C([C@@H]12)CC3=CC(C(C)C)=CC=C3[C@@]2(C)CCC[C@@]1(C)CNCCNC[C@@]1(C)[C@@H]2CCC3=CC(C(C)C)=CC=C3[C@@]2(C)CCC1 XGIHQYAWBCFNPY-AZOCGYLKSA-N 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- XMBWDFGMSWQBCA-UHFFFAOYSA-N hydrogen iodide Chemical compound I XMBWDFGMSWQBCA-UHFFFAOYSA-N 0.000 description 1
- DQKGOGJIOHUEGK-UHFFFAOYSA-M hydron;2-hydroxyethyl(trimethyl)azanium;carbonate Chemical compound OC([O-])=O.C[N+](C)(C)CCO DQKGOGJIOHUEGK-UHFFFAOYSA-M 0.000 description 1
- USZLCYNVCCDPLQ-UHFFFAOYSA-N hydron;n-methoxymethanamine;chloride Chemical compound Cl.CNOC USZLCYNVCCDPLQ-UHFFFAOYSA-N 0.000 description 1
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 description 1
- 150000005233 imidazopyridazines Chemical class 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000001506 immunosuppresive effect Effects 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000010249 in-situ analysis Methods 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 229960000598 infliximab Drugs 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 229910052740 iodine Inorganic materials 0.000 description 1
- 239000011630 iodine Substances 0.000 description 1
- 125000002346 iodo group Chemical group I* 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- SYJRVVFAAIUVDH-UHFFFAOYSA-N ipa isopropanol Chemical compound CC(C)O.CC(C)O SYJRVVFAAIUVDH-UHFFFAOYSA-N 0.000 description 1
- SUMDYPCJJOFFON-UHFFFAOYSA-N isethionic acid Chemical compound OCCS(O)(=O)=O SUMDYPCJJOFFON-UHFFFAOYSA-N 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- YWXYYJSYQOXTPL-SLPGGIOYSA-N isosorbide mononitrate Chemical compound [O-][N+](=O)O[C@@H]1CO[C@@H]2[C@@H](O)CO[C@@H]21 YWXYYJSYQOXTPL-SLPGGIOYSA-N 0.000 description 1
- 125000001786 isothiazolyl group Chemical group 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 230000000155 isotopic effect Effects 0.000 description 1
- 210000002510 keratinocyte Anatomy 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 229940001447 lactate Drugs 0.000 description 1
- 229940099584 lactobionate Drugs 0.000 description 1
- JYTUSYBCFIZPBE-AMTLMPIISA-N lactobionic acid Chemical compound OC(=O)[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O JYTUSYBCFIZPBE-AMTLMPIISA-N 0.000 description 1
- 229960004942 lenalidomide Drugs 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 238000004811 liquid chromatography Methods 0.000 description 1
- 229910052744 lithium Inorganic materials 0.000 description 1
- YNESATAKKCNGOF-UHFFFAOYSA-N lithium bis(trimethylsilyl)amide Chemical compound [Li+].C[Si](C)(C)[N-][Si](C)(C)C YNESATAKKCNGOF-UHFFFAOYSA-N 0.000 description 1
- DLEDOFVPSDKWEF-UHFFFAOYSA-N lithium butane Chemical compound [Li+].CCC[CH2-] DLEDOFVPSDKWEF-UHFFFAOYSA-N 0.000 description 1
- UBJFKNSINUCEAL-UHFFFAOYSA-N lithium;2-methylpropane Chemical compound [Li+].C[C-](C)C UBJFKNSINUCEAL-UHFFFAOYSA-N 0.000 description 1
- GLXDVVHUTZTUQK-UHFFFAOYSA-M lithium;hydroxide;hydrate Chemical compound [Li+].O.[OH-] GLXDVVHUTZTUQK-UHFFFAOYSA-M 0.000 description 1
- JHBZAAACZVPPRQ-UHFFFAOYSA-L lithium;magnesium;2,2,6,6-tetramethylpiperidin-1-ide;dichloride Chemical compound [Li+].[Cl-].[Cl-].CC1(C)CCCC(C)(C)N1[Mg+] JHBZAAACZVPPRQ-UHFFFAOYSA-L 0.000 description 1
- DBTNVRCCIDISMV-UHFFFAOYSA-L lithium;magnesium;propane;dichloride Chemical compound [Li+].[Mg+2].[Cl-].[Cl-].C[CH-]C DBTNVRCCIDISMV-UHFFFAOYSA-L 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 230000004199 lung function Effects 0.000 description 1
- 206010025135 lupus erythematosus Diseases 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 159000000003 magnesium salts Chemical class 0.000 description 1
- 235000019341 magnesium sulphate Nutrition 0.000 description 1
- NXPHGHWWQRMDIA-UHFFFAOYSA-M magnesium;carbanide;bromide Chemical compound [CH3-].[Mg+2].[Br-] NXPHGHWWQRMDIA-UHFFFAOYSA-M 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 229940049920 malate Drugs 0.000 description 1
- BJEPYKJPYRNKOW-UHFFFAOYSA-L malate(2-) Chemical compound [O-]C(=O)C(O)CC([O-])=O BJEPYKJPYRNKOW-UHFFFAOYSA-L 0.000 description 1
- IWYDHOAUDWTVEP-UHFFFAOYSA-M mandelate Chemical compound [O-]C(=O)C(O)C1=CC=CC=C1 IWYDHOAUDWTVEP-UHFFFAOYSA-M 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- BCVXHSPFUWZLGQ-UHFFFAOYSA-N mecn acetonitrile Chemical compound CC#N.CC#N BCVXHSPFUWZLGQ-UHFFFAOYSA-N 0.000 description 1
- 229960003194 meglumine Drugs 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 229960002523 mercuric chloride Drugs 0.000 description 1
- LWJROJCJINYWOX-UHFFFAOYSA-L mercury dichloride Chemical compound Cl[Hg]Cl LWJROJCJINYWOX-UHFFFAOYSA-L 0.000 description 1
- 229940098779 methanesulfonic acid Drugs 0.000 description 1
- 125000004184 methoxymethyl group Chemical group [H]C([H])([H])OC([H])([H])* 0.000 description 1
- NIQRIYYEIXZIJI-UHFFFAOYSA-N methyl 5,5,5-trifluoro-3-oxopentanoate Chemical compound COC(=O)CC(=O)CC(F)(F)F NIQRIYYEIXZIJI-UHFFFAOYSA-N 0.000 description 1
- 229940102396 methyl bromide Drugs 0.000 description 1
- LRMHVVPPGGOAJQ-UHFFFAOYSA-N methyl nitrate Chemical compound CO[N+]([O-])=O LRMHVVPPGGOAJQ-UHFFFAOYSA-N 0.000 description 1
- JZMJDSHXVKJFKW-UHFFFAOYSA-M methyl sulfate(1-) Chemical compound COS([O-])(=O)=O JZMJDSHXVKJFKW-UHFFFAOYSA-M 0.000 description 1
- 229950009792 mirikizumab Drugs 0.000 description 1
- 125000002757 morpholinyl group Chemical group 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- PEECTLLHENGOKU-UHFFFAOYSA-N n,n-dimethylpyridin-4-amine Chemical compound CN(C)C1=CC=NC=C1.CN(C)C1=CC=NC=C1 PEECTLLHENGOKU-UHFFFAOYSA-N 0.000 description 1
- WOOWBQQQJXZGIE-UHFFFAOYSA-N n-ethyl-n-propan-2-ylpropan-2-amine Chemical compound CCN(C(C)C)C(C)C.CCN(C(C)C)C(C)C WOOWBQQQJXZGIE-UHFFFAOYSA-N 0.000 description 1
- 210000000581 natural killer T-cell Anatomy 0.000 description 1
- 210000000822 natural killer cell Anatomy 0.000 description 1
- 125000001971 neopentyl group Chemical group [H]C([*])([H])C(C([H])([H])[H])(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 125000001400 nonyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- VIKNJXKGJWUCNN-XGXHKTLJSA-N norethisterone Chemical compound O=C1CC[C@@H]2[C@H]3CC[C@](C)([C@](CC4)(O)C#C)[C@@H]4[C@@H]3CCC2=C1 VIKNJXKGJWUCNN-XGXHKTLJSA-N 0.000 description 1
- 150000007523 nucleic acids Chemical group 0.000 description 1
- 239000012038 nucleophile Substances 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- 125000002347 octyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- JRZJOMJEPLMPRA-UHFFFAOYSA-N olefin Natural products CCCCCCCC=C JRZJOMJEPLMPRA-UHFFFAOYSA-N 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 239000012074 organic phase Substances 0.000 description 1
- 201000008482 osteoarthritis Diseases 0.000 description 1
- 210000000963 osteoblast Anatomy 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 125000003566 oxetanyl group Chemical group 0.000 description 1
- 238000007248 oxidative elimination reaction Methods 0.000 description 1
- 230000036542 oxidative stress Effects 0.000 description 1
- MUJIDPITZJWBSW-UHFFFAOYSA-N palladium(2+) Chemical compound [Pd+2] MUJIDPITZJWBSW-UHFFFAOYSA-N 0.000 description 1
- 229940014662 pantothenate Drugs 0.000 description 1
- 235000019161 pantothenic acid Nutrition 0.000 description 1
- 239000011713 pantothenic acid Substances 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 235000019371 penicillin G benzathine Nutrition 0.000 description 1
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 238000009520 phase I clinical trial Methods 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- LGRFSURHDFAFJT-UHFFFAOYSA-N phthalic anhydride Chemical compound C1=CC=C2C(=O)OC(=O)C2=C1 LGRFSURHDFAFJT-UHFFFAOYSA-N 0.000 description 1
- 210000004694 pigment cell Anatomy 0.000 description 1
- 125000004193 piperazinyl group Chemical group 0.000 description 1
- 125000003386 piperidinyl group Chemical group 0.000 description 1
- 229950010765 pivalate Drugs 0.000 description 1
- IUGYQRQAERSCNH-UHFFFAOYSA-N pivalic acid Chemical compound CC(C)(C)C(O)=O IUGYQRQAERSCNH-UHFFFAOYSA-N 0.000 description 1
- 239000000902 placebo Substances 0.000 description 1
- 229940068196 placebo Drugs 0.000 description 1
- 230000036470 plasma concentration Effects 0.000 description 1
- 229960000688 pomalidomide Drugs 0.000 description 1
- 229940008606 pomalyst Drugs 0.000 description 1
- 230000034190 positive regulation of NF-kappaB transcription factor activity Effects 0.000 description 1
- 239000011698 potassium fluoride Substances 0.000 description 1
- 235000003270 potassium fluoride Nutrition 0.000 description 1
- FYRHIOVKTDQVFC-UHFFFAOYSA-M potassium phthalimide Chemical compound [K+].C1=CC=C2C(=O)[N-]C(=O)C2=C1 FYRHIOVKTDQVFC-UHFFFAOYSA-M 0.000 description 1
- 159000000001 potassium salts Chemical class 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 238000002953 preparative HPLC Methods 0.000 description 1
- 238000004237 preparative chromatography Methods 0.000 description 1
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 1
- 229960004919 procaine Drugs 0.000 description 1
- 235000018102 proteins Nutrition 0.000 description 1
- 102000004169 proteins and genes Human genes 0.000 description 1
- 238000000425 proton nuclear magnetic resonance spectrum Methods 0.000 description 1
- 125000003373 pyrazinyl group Chemical group 0.000 description 1
- 125000002098 pyridazinyl group Chemical group 0.000 description 1
- 125000004076 pyridyl group Chemical group 0.000 description 1
- 125000000719 pyrrolidinyl group Chemical group 0.000 description 1
- 150000003242 quaternary ammonium salts Chemical class 0.000 description 1
- 229960000948 quinine Drugs 0.000 description 1
- 108091006084 receptor activators Proteins 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 238000006722 reduction reaction Methods 0.000 description 1
- 238000006268 reductive amination reaction Methods 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 229940116176 remicade Drugs 0.000 description 1
- 230000004043 responsiveness Effects 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 229940120975 revlimid Drugs 0.000 description 1
- YGSDEFSMJLZEOE-UHFFFAOYSA-M salicylate Chemical compound OC1=CC=CC=C1C([O-])=O YGSDEFSMJLZEOE-UHFFFAOYSA-M 0.000 description 1
- 229960001860 salicylate Drugs 0.000 description 1
- 229930195734 saturated hydrocarbon Natural products 0.000 description 1
- HFHDHCJBZVLPGP-UHFFFAOYSA-N schardinger α-dextrin Chemical compound O1C(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(O)C2O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC2C(O)C(O)C1OC2CO HFHDHCJBZVLPGP-UHFFFAOYSA-N 0.000 description 1
- 150000003335 secondary amines Chemical class 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 239000000741 silica gel Substances 0.000 description 1
- 229910002027 silica gel Inorganic materials 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 229940068638 simponi Drugs 0.000 description 1
- 239000002356 single layer Substances 0.000 description 1
- 208000017520 skin disease Diseases 0.000 description 1
- 229940083542 sodium Drugs 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 239000012354 sodium borodeuteride Substances 0.000 description 1
- 229940001593 sodium carbonate Drugs 0.000 description 1
- 239000012312 sodium hydride Substances 0.000 description 1
- 235000010288 sodium nitrite Nutrition 0.000 description 1
- 239000001476 sodium potassium tartrate Substances 0.000 description 1
- AKHNMLFCWUSKQB-UHFFFAOYSA-L sodium thiosulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=S AKHNMLFCWUSKQB-UHFFFAOYSA-L 0.000 description 1
- 235000019345 sodium thiosulphate Nutrition 0.000 description 1
- VYPDUQYOLCLEGS-UHFFFAOYSA-M sodium;2-ethylhexanoate Chemical compound [Na+].CCCCC(CC)C([O-])=O VYPDUQYOLCLEGS-UHFFFAOYSA-M 0.000 description 1
- 208000024794 sputum Diseases 0.000 description 1
- 210000003802 sputum Anatomy 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 229940071598 stelara Drugs 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 239000012258 stirred mixture Substances 0.000 description 1
- WPLOVIFNBMNBPD-ATHMIXSHSA-N subtilin Chemical compound CC1SCC(NC2=O)C(=O)NC(CC(N)=O)C(=O)NC(C(=O)NC(CCCCN)C(=O)NC(C(C)CC)C(=O)NC(=C)C(=O)NC(CCCCN)C(O)=O)CSC(C)C2NC(=O)C(CC(C)C)NC(=O)C1NC(=O)C(CCC(N)=O)NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C1NC(=O)C(=C/C)/NC(=O)C(CCC(N)=O)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)CNC(=O)C(NC(=O)C(NC(=O)C2NC(=O)CNC(=O)C3CCCN3C(=O)C(NC(=O)C3NC(=O)C(CC(C)C)NC(=O)C(=C)NC(=O)C(CCC(O)=O)NC(=O)C(NC(=O)C(CCCCN)NC(=O)C(N)CC=4C5=CC=CC=C5NC=4)CSC3)C(C)SC2)C(C)C)C(C)SC1)CC1=CC=CC=C1 WPLOVIFNBMNBPD-ATHMIXSHSA-N 0.000 description 1
- 210000002437 synoviocyte Anatomy 0.000 description 1
- 201000004595 synovitis Diseases 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 229950002757 teoclate Drugs 0.000 description 1
- ORDMEFMUSKDHOL-UHFFFAOYSA-N tert-butyl n-(3-amino-2-methylpropyl)carbamate Chemical compound NCC(C)CNC(=O)OC(C)(C)C ORDMEFMUSKDHOL-UHFFFAOYSA-N 0.000 description 1
- JQXZBJAAOLPTKP-LURJTMIESA-N tert-butyl n-[(2s)-1-aminopropan-2-yl]carbamate Chemical compound NC[C@H](C)NC(=O)OC(C)(C)C JQXZBJAAOLPTKP-LURJTMIESA-N 0.000 description 1
- YBRBMKDOPFTVDT-UHFFFAOYSA-N tert-butylamine Chemical compound CC(C)(C)N YBRBMKDOPFTVDT-UHFFFAOYSA-N 0.000 description 1
- 125000005931 tert-butyloxycarbonyl group Chemical group [H]C([H])([H])C(OC(*)=O)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- WHRNULOCNSKMGB-UHFFFAOYSA-N tetrahydrofuran thf Chemical compound C1CCOC1.C1CCOC1 WHRNULOCNSKMGB-UHFFFAOYSA-N 0.000 description 1
- 125000003718 tetrahydrofuranyl group Chemical group 0.000 description 1
- 125000003831 tetrazolyl group Chemical group 0.000 description 1
- WROMPOXWARCANT-UHFFFAOYSA-N tfa trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F.OC(=O)C(F)(F)F WROMPOXWARCANT-UHFFFAOYSA-N 0.000 description 1
- 229960003433 thalidomide Drugs 0.000 description 1
- 125000001113 thiadiazolyl group Chemical group 0.000 description 1
- 125000000335 thiazolyl group Chemical group 0.000 description 1
- 125000001544 thienyl group Chemical group 0.000 description 1
- 125000004568 thiomorpholinyl group Chemical group 0.000 description 1
- 229960002898 threonine Drugs 0.000 description 1
- 210000001578 tight junction Anatomy 0.000 description 1
- 230000007838 tissue remodeling Effects 0.000 description 1
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- MYARHZGZFPTKKA-UHFFFAOYSA-N tributyl(propan-2-yloxymethyl)stannane Chemical compound CCCC[Sn](CCCC)(CCCC)COC(C)C MYARHZGZFPTKKA-UHFFFAOYSA-N 0.000 description 1
- FAQYAMRNWDIXMY-UHFFFAOYSA-N trichloroborane Chemical compound ClB(Cl)Cl FAQYAMRNWDIXMY-UHFFFAOYSA-N 0.000 description 1
- ITMCEJHCFYSIIV-UHFFFAOYSA-M triflate Chemical compound [O-]S(=O)(=O)C(F)(F)F ITMCEJHCFYSIIV-UHFFFAOYSA-M 0.000 description 1
- BPLKQGGAXWRFOE-UHFFFAOYSA-M trimethylsulfoxonium iodide Chemical compound [I-].C[S+](C)(C)=O BPLKQGGAXWRFOE-UHFFFAOYSA-M 0.000 description 1
- RIOQSEWOXXDEQQ-UHFFFAOYSA-O triphenylphosphanium Chemical compound C1=CC=CC=C1[PH+](C=1C=CC=CC=1)C1=CC=CC=C1 RIOQSEWOXXDEQQ-UHFFFAOYSA-O 0.000 description 1
- 235000019798 tripotassium phosphate Nutrition 0.000 description 1
- HJOAXCLZLHDZDX-UHFFFAOYSA-N tris(1,2,2-trifluoroethenyl) borate Chemical compound FC(F)=C(F)OB(OC(F)=C(F)F)OC(F)=C(F)F HJOAXCLZLHDZDX-UHFFFAOYSA-N 0.000 description 1
- 229910052722 tritium Inorganic materials 0.000 description 1
- 238000001665 trituration Methods 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 229940046728 tumor necrosis factor alpha inhibitor Drugs 0.000 description 1
- 239000002452 tumor necrosis factor alpha inhibitor Substances 0.000 description 1
- 125000002948 undecyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 238000006886 vinylation reaction Methods 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 238000007482 whole exome sequencing Methods 0.000 description 1
- 238000010626 work up procedure Methods 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
- 239000011701 zinc Substances 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D487/00—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00
- C07D487/02—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00 in which the condensed system contains two hetero rings
- C07D487/04—Ortho-condensed systems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07B—GENERAL METHODS OF ORGANIC CHEMISTRY; APPARATUS THEREFOR
- C07B2200/00—Indexing scheme relating to specific properties of organic compounds
- C07B2200/05—Isotopically modified compounds, e.g. labelled
Definitions
- This application contains a sequence listing, which is submitted electronically as an ST.26 XML formatted sequence listing with a file name “PRD4156WOPCT1_SL”, creation date of Jul. 1, 2022 and having a size of 3 KB.
- the sequence listing submitted is part of the specification and is herein incorporated by reference in its entirety.
- imidazopyridazine compounds and pharmaceutical compositions thereof, which modulate Interleukin-17A. Also disclosed herein is the therapeutic use of such compounds, for example, in treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease.
- Interleukin-17 also known as IL-17A and CTLA-8, is produced mainly by CD4+ Th17 cells, and also by other immune cells such as CD8+ T cells, ⁇ T cells, NK cells, NKT cells, and innate lymphoid cells (ILCs).
- IL-17A exists as a homodimer (A/A) or as a heterodimer (A/F) with IL-17F and signals through binding to dimeric receptor complex IL-17RA and IL-17RC.
- IL-17RA is ubiquitously expressed at particularly high levels by haematopoietic cell types, whereas IL-17RC is preferentially expressed by non-haematopoietic cells (Gaffen, S.
- IL-17A/IL-17R signaling induces de novo gene transcription by triggering NF-kB, C/EBP and MAPK pathways through ACT1-TRAF6-TRAF4. It can also stabilize target mRNA transcripts through the ACT1-TRAF2-TRAF5 complex (Amatya N. et al., Trends in Immunology, 2017, 38, 310-322).
- IL-17A stimulates the release of inflammatory mediators including IL-6, IL-8, G-CSF, TNF- ⁇ , and IL-1 ⁇ that recruit and activate lymphocytes to the site of injury or inflammation and maintain a proinflammatory state.
- IL-17A mRNA and/or protein levels are elevated in the lesional skin and blood of patients with psoriasis and correlate with disease severity.
- IL-17A acts directly in synergy with other cytokines (such as TNF ⁇ , IFN ⁇ or IL-22) on keratinocytes triggering a self-amplifying inflammatory response in the skin and leading to the formation of psoriatic plaques.
- cytokines such as TNF ⁇ , IFN ⁇ or IL-22
- IL-17 monoclonal antibodies such as secukinumab, ixekizumab, and brodalumab and their transformational efficacy for psoriasis have demonstrated IL-17A as a valid target for psoriasis treatments.
- IL-17A is mechanistically relevant to PsA through NF ⁇ B activation that triggers transcription of several PsA related genes including the receptor activator of nuclear factor KB ligand (RANKL).
- RANKL triggers the differentiation of osteoclast precursor cells into activated osteoclasts, resulting in bone resorption and subsequently joint deformity in PsA (Adamopoulos I. and Mellins E. Nature reviews Rheumatology 2015; 11:189-94).
- PsA joint is enriched for IL-17+CD8+ T cells, and the levels of this T cell subset are correlated with disease activity (Menon B.
- IL-17A has been recognized as critical to the progression of rheumatoid arthritis. “The recognition of IL-17 as a pro-inflammatory T cell derived cytokine, and its abundance within rheumatoid joints, provides the strongest candidate mechanism to date through which T cells can capture and localize macrophage effector functions in rheumatoid arthritis” Stamp, L. et al., Immunol. Cell Biol. 2004, 82(1): 1-9. Moreover, in rheumatoid arthritis IL-17A acts locally on synoviocytes and osteoblasts contributing to synovitis and joint destruction.
- Robert and Miossec have proposed the use of synovial biopsies and/or biomarkers to precisely identify patients that would respond to IL-17A inhibition. Their work concludes that IL-17 inhibitors should now be considered in the development of precision medicine in RA. (Robert M. and Miossec P., Front. Med., 2019, 5:364).
- AS Ankylosing Spondylitis
- HS hidradenitis suppurativa
- Increased IL-17 and IL-17-producing T helper cells in the skin lesions of HS patients were reported and molecular proteomics and gene expression data indicate that the IL-23/Th17 pathway is upregulated in HS lesions (Schlapbach C. et al., J. Am. Acad. Dermatol. 2011; 65(4):790; Kelly G. et al., British J. Dermatol. 2015 December; 173(6):1431-9; Moran B. et al., J. Invest. Dermatol. 2017; 137(11):2389; Thomi R. et al., JAMA Dermatol. 2018; 154(5):592).
- IL-17 is elevated in the blister fluid and perilesional skin of BP patients.
- Exome sequencing of BP patients revealed mutations in twelve IL-17-related genes in one third of patients, providing the genetic link between IL-17 pathway and BP (Chakievska L. J Autoimmun. 2019, 96:104-112).
- IL-17A ⁇ / ⁇ mice are protected, and anti-IL-17A treatment significantly reduced skin lesions in wild type (Chakievska L. J Autoimmun. 2019, 96:104-112).
- Ixekizumab Phase 2 of treatment naive and refractory BP patients is on-going (NCT03099538).
- IL-17 was found to be elevated in peripheral blood and lesions in AD patients and Th17 cells infiltrated more markedly in acute than chronic lesions, suggesting its role in acute phase of AD (Koga C. et al., J. Invest. Dermatol. 2008, 128, 2625-2630).
- Molecular profile analysis from ustekinumab Phase II suggest likely contribution of IL-23/Th17/IL-17 pathway in AD (Khattri S. et al., Exp. Dermatol. 2017 January; 26(1):28-35).
- IL-17 expression is increased in PBMCs, cerebrospinal fluid (CSF) as well as in brain lesions and cells from MS patients (Lock, C. et al., Nat. Med. 2002, 8: 500-508; Matusevicius, D. et al., Mult. Scler. 1999, 5: 101-104; Tzartos, J. et al., Am. J. Pathol. 2008, 172: 146-155).
- IL-17-producing T cells are enriched in active MS lesions (Tzartos, J. et al., Am. J. Pathol. 2008, 172: 146-155; Willing A. et al., J. Immunol.
- IL-17A levels were elevated in the CSF of relapsing-remitting MS (RRMS) patients and correlated with the CSF/serum albumin quotient, a measure of blood-brain barrier (BBB) dysfunction, together with in vitro data that IL-17A in combination with IL-6 reduced the expression of tight junction-associated genes and disrupted monolayer integrity in a BBB cell line, highlighting the potential importance of targeting IL-17A in preserving BBB integrity in RRMS (Setiadi A F et al., J Neuroimmunol. 2019, 332:147-154). Secukinumab yielded promising first results in a proof-of-concept study in MS patients (Havrdovi, E. et al., J. Neurol. 2016, 263: 1287-1295).
- IL-17 expression is increased in the lung, sputum, bronchoalveolar lavage fluid, and sera in patients with asthma, and the severity of airway hyperresponsiveness is positively correlated with IL-17 expression levels.
- IL-17 was reported to be increased in asthmatic airways and induce human bronchial fibroblasts to produce cytokines (Molet S. et al., J. Allergy Clin. Immunol. 2001, 108(3):430-8).
- Anti-IL-17 antibody modulates airway responsiveness, inflammation, tissue remodeling, and oxidative stress in chronic mouse asthma models (Camargo LdN. et al., Front Immunol. 2018; 8:1835; dos Santos T. et al., Front. Physiol. 2018, 9:1183).
- IL-17 promotes the release of inflammatory mediators from retinal pigment epithelium cell line, disrupting the retinal pigment epithelium barrier function (Chen Y. et al., PLoS One. 2011; 6:e18139). IL-17 levels were elevated in the serum or aqueous humor of uveitis patients (El-Asrar A. et al., Clin. Immunol. 2011; 139(2):177-84; Jawad S. et al., Ocul. Immunol. Inflamm. 2013; 21(6):434-9; Kuiper J. et al., Am. J. Ophthalmol. 2011; 152(2):177-182).
- Anti-IL-17 antibody delayed the onset of ocular inflammation and markedly inhibited the development of experimental autoimmune uveitis in rats (Zhang R. et al., Curr. Eye Res. 2009 April; 34(4):297-303).
- the analysis of secondary efficacy data from subcutaneous (sc) secukinumab phase 3 trials in uveitis suggested a beneficial effect of secukinumab in reducing the use of concomitant immunosuppressive medication (Dick A. et al., Ophthalmology 2013; 120(4):777-87).
- MM multiple myeloma
- IL-17A serum levels were significantly higher in MM patients and also in patients with advanced stage compared with healthy subjects (Lemancewicz D. et al., Med. Sci. Monit. 2012; 18(1): BR54-BR59).
- SLE systemic lupus erythematosus
- Th17 cells have been observed in SLE patients including quiescent stage (Ma J. et al., Clin. Rheumatol. 2010; 29(11):1251-1258; Dolff S. et al., Clin. Immunol. 2011, 141(2):197-204).
- Teg regulatory T
- Overexpression of IL-17A using adenovirus enhanced the severity of lupus nephritis, while blockade of IL-17A using neutralizing antibody resulted in decreased severity of lupus nephritis (Wen, Z. et al., PLoS One. 2013, 8: e58161).
- IL-17A plays crucial role in pathogenesis of the multiple diseases and/or conditions discussed above.
- the significance of targeting IL-17A has been demonstrated by the transformational efficacy of injectable IL-17A neutralizing antibodies in patients.
- IL-17A antagonist antibodies Despite the advances achieved with injectable IL-17A antagonist antibodies, there is a long-felt need for the development of an oral small molecule IL-17A inhibitor as it may broaden treatment options for many patients without access to biologics.
- a safe and efficacious small molecule IL-17A inhibitor may offer significant benefits to patients over the injectable IL-17A neutralizing antibodies such as convenient dosing regimens and cost savings, which in turn may provide effective long-term disease management.
- R 1 , R 2 , R 3 , and R 4 are as defined herein.
- the present application also discloses a pharmaceutical composition
- a pharmaceutical composition comprising a compound of Formula I, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier.
- the present application also discloses a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof.
- the IL-17A mediated inflammatory syndrome, disorder, or disease is selected from the group consisting of: psoriasis, psoriatic arthritis, rheumatoid arthritis, ankylosing spondylitis, hidradenitis suppurativa, bullous pemphigoid, atopic dermatitis, vitiligo, multiple sclerosis, asthma, uveitis, chronic obstructive pulmonary disorder, multiple myeloma, and systemic lupus erythematosus.
- administering means a method for therapeutically or prophylactically preventing, treating or ameliorating a syndrome, disorder or disease as described herein by using a compound of the disclosure, or pharmaceutically acceptable salt thereof, composition thereof, or medicament thereof.
- Such methods include administering a therapeutically effective amount of a compound of the disclosure, or pharmaceutically acceptable salt thereof, composition thereof, or medicament thereof, at different times during the course of a therapy or concurrently or sequentially as a combination therapy.
- subject refers to a patient, which may be an animal, preferably a mammal, most preferably a human, whom will be or has been treated by a method according to an embodiment of the application.
- mammals include, but are not limited to, cows, horses, sheep, pigs, cats, dogs, mice, rats, rabbits, guinea pigs, non-human primates (NHPs) such as monkeys or apes, humans, etc., more preferably a human.
- terapéuticaally effective amount means that amount of active compound or pharmaceutical agent that elicits the biological or medicinal response in a tissue system, animal or human, that is being sought by a researcher, veterinarian, medical doctor, or other clinician, which includes preventing, treating or ameliorating the symptoms of a syndrome, disorder or disease being treated.
- IL-17 or “IL-17A” refers to interleukin 17A. It is also named IL17, CTLA8, CTLA-8. Interleukin 17A is a pro-inflammatory cytokine. This cytokine is produced by a group of immune cells in response to their stimulation.
- An exemplary amino acid sequence of human IL-17 is represented in GenBank Accession No. NP_002181.1, which can be encoded by a nucleic acid sequence such as that of GenBank Accession No. NM_002190.3.
- modulator refers to any agents or molecules that can bind to IL-17, including small molecule compounds.
- Active moiety refers to a molecule or ion responsible for a physiological or pharmacological action.
- composition is intended to encompass a product comprising the specified ingredients in the specified amounts, as well as any product which results, directly or indirectly, from combinations of the specified ingredients in the specified amounts.
- the term “treat,” “treating,” or “treatment” of any disease, condition, syndrome or disorder refers, in one embodiment, to ameliorating the disease, condition, syndrome or disorder (i.e., slowing or arresting or reducing the development of the disease or at least one of the clinical symptoms thereof).
- “treat,” “treating,”, or “treatment” refers to alleviating or ameliorating at least one physiological or biochemical parameter associated with or causative of the disease, condition, syndrome or disorder, including those which may not be discernible by the patient.
- “treat,” “treating,” or “treatment” refers to modulating the disease, condition, syndrome or disorder either physically (e.g. stabilization of a discernible symptom), physiologically, (e.g. stabilization of a physical parameter), or both.
- “treat,” “treating,” or “treatment” refers to preventing or delaying the onset or development or progression of the disease, condition, syndrome or disorder.
- QD means once daily.
- BID means twice daily.
- alkyl is a straight or branched saturated hydrocarbon.
- an alkyl group can have 1 to 12 carbon atoms (i.e., (C 1 -C 12 )alkyl) or 1 to 6 carbon atoms (i.e., (C 1 -C 6 )alkyl).
- alkyl groups include, but are not limited to, methyl (Me, —CH 3 ), ethyl (Et, —CH 2 CH 3 ), 1-propyl (n-Pr, n-propyl, —CH 2 CH 2 CH 3 ), isopropyl (i-Pr, i-propyl, —CH(CH 3 ) 2 ), 1-butyl (n-bu, n-butyl, —CH 2 CH 2 CH 2 CH 3 ), 2-butyl (s-bu, s-butyl, —CH(CH 3 )CH 2 CH 3 ), tert-butyl (t-bu, t-butyl, —CH(CH 3 ) 3 ), 1-pentyl (n-pentyl, —CH 2 CH 2 CH 2 CH 2 CH 3 ), 2-pentyl (—CH(CH 3 ) CH 2 CH 2 CH 3 ), neopentyl (CH 2 C(CH 3 ) 3 ), 1-
- C (a-b) refers to an alkyl, alkenyl, alkynyl, alkoxy or cycloalkyl radical or to the alkyl portion of a radical in which alkyl appears as the prefix root containing from a to b carbon atoms inclusive.
- C (1-4) denotes a radical containing 1, 2, 3 or 4 carbon atoms.
- cycloalkyl refers to a saturated or partially unsaturated all carbon ring system having 3 to 8 carbon atoms (i.e., C (3-8) cycloalkyl), and preferably 3 to 6 carbon atoms (i.e., C (3-6) cycloalkyl), wherein the cycloalkyl ring system has a single ring or multiple rings in a spirocyclic or bicyclic form.
- exemplary cycloalkyls include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl.
- a cycloalkyl group may be unsubstituted or substituted.
- Some cycloalkyl groups may exist as spirocycloalkyls, wherein two cycloalkyl rings are fused through a single carbon atom; for example and without limitation, an example of a spiropentyl group is
- examples of spirohexyl groups include
- cycloheptyl groups include
- cyclooctyl groups include
- a spirocycloalkyl group may be unsubstituted or substituted.
- Bicyclic cycloalkyl ring systems also include
- heterocycle refers to a saturated or partially unsaturated ring system that has at least one atom other than carbon in the ring system, wherein the atom is selected from the group consisting of oxygen, nitrogen and sulfur.
- the heterocyclyl group may, for example, consist of a single ring or multiple rings (e.g., in the form of a spirocyclic or bicyclic ring system).
- heterocycles include, but are not limited to oxetanyl, aziridinyl, azetidinyl, pyrrolidinyl, piperidinyl, piperazinyl, morpholinyl, tetrahydropyranyl, tetrahydrofuranyl, and thiomorpholinyl.
- heteroaryl refers to a single aromatic ring that has at least one atom other than carbon in the ring, wherein the atom is selected from the group consisting of oxygen, nitrogen and sulfur.
- heteroaryl includes single aromatic rings of from 1 to 6 carbon atoms and 1 to 4 heteroatoms selected from the group consisting of oxygen, nitrogen and sulfur.
- heteroaryl ring systems include but are not limited to pyridinyl, pyrimidinyl, pyrazinyl, pyridazinyl, pyrimidinyl, pyrazolyl, oxazolyl, oxadiazolyl, isoxazolyl, triazolyl, imidazolyl, tetrazolyl, thienyl, thiazolyl, isothiazolyl, thiadiazolyl, or furyl.
- halogen refers to bromo (—Br), chloro (—Cl), fluoro (—F) or iodo (—I).
- “Diastereoisomers” are stereoisomers that have at least two asymmetric atoms, but which are not mirror images of each other.
- Enantiomers are a pair of stereoisomers that are non-superimposable mirror images of each other.
- a “racemic” mixture is a 1:1 mixture of a pair of enantiomers.
- a “scalemic” mixture of enantiomers is mixture of enantiomers at a ratio other than 1:1.
- the processes for the preparation of the compounds according to the invention give rise to mixture of stereoisomers
- these isomers may be separated by conventional techniques such as preparative chromatography.
- the compounds may be prepared in racemic form, a scalemic mixture, or individual enantiomers may be prepared either by enantiospecific synthesis or by resolution.
- the compounds may, for example, be resolved into their component enantiomers by standard techniques, such as the formation of diastereomeric pairs by salt formation with an optically active acid, such as ( ⁇ )-di-p-toluoyl-D-tartaric acid and/or (+)-di-p-toluoyl-L-tartaric acid followed by fractional crystallization and regeneration of the free base.
- the compounds may also be resolved by formation of diastereomeric esters or amides, followed by chromatographic separation and removal of the chiral auxiliary. Alternatively, the compounds may be resolved using a chiral column vial HPLC or SFC. In some instances rotamers of compounds may exist which are observable by 1 H NMR leading to complex multiplets and peak integration in the 1 H NMR spectrum.
- the absolute stereochemistry is specified according to the Cahn-Ingold-Prelog R-S system. Chiral centers, of which the absolute configurations are known, are labelled by prefixes R and S, assigned by the standard sequence-rule procedure, and preceded when necessary by the appropriate locants ( Pure & Appl. Chem. 45, 1976, 11-30). Certain pairs of enantiomers and diastereomers are presented together in the Examples. These enantiomers/diastereomers may be designated in the following synthetic method and characterized as enantiomer 1 or enantiomer 2 (or, alternately, diastereomer 1 or diastereomer 2).
- stereoisomers in this manner conveys the separate preparation or isolation of the compounds as pure single enantiomers or diastereomers at the identified stereocenter(s).
- a pure single enantiomer (or diastereomer) is presented together with the corresponding pure single enantiomer (or diastereomer) in the Examples of the present disclosure, the order in which the chemical structures/IUPAC names are presented do not necessarily correspond to the order in which the Example numbers are listed.
- Example X may be either the R enantiomer or the S enantiomer
- Example Y is the opposite enantiomer, regardless of the order in which the IUPAC names or chemical structures of the compounds are presented, unless otherwise specified in the method and characterization that follows.
- Certain examples contain chemical structures that are depicted or labelled as an (R*) or (S*).
- (R*) or (S*) is used in the name of a compound or in the chemical representation of the compound, it is intended to convey that the compound is a pure single isomer at that stereocenter; however, absolute configuration of that stereocenter has not been established.
- a compound designated as (R*) refers to a compound that is a pure single isomer at that stereocenter with an absolute configuration of either (R) or (S)
- a compound designated as (S*) refers to a compound that is a pure single isomer at that stereocenter with an absolute configuration of either (R) or (S).
- any of the processes for preparation of the compounds disclosed herein it may be necessary and/or desirable to protect sensitive or reactive groups on any of the molecules concerned. This may be achieved by means of conventional protecting groups, such as those described in Protective Groups in Organic Chemistry, ed. J. F. W. McOmie, Plenum Press, 1973; and T. W. Greene & P. G. M. Wuts, Protective Groups in Organic Synthesis, John Wiley & Sons, 1991.
- the protecting groups may be removed at a convenient subsequent stage using methods known from the art.
- any element in particular when mentioned in relation to a compound of the disclosure, or pharmaceutically acceptable salt thereof, shall comprise all isotopes and isotopic mixtures of said element, either naturally occurring or synthetically produced, either with natural abundance or in an isotopically enriched form.
- a reference to hydrogen includes within its scope 1 H, 2 H (i.e., deuterium or D), and 3 H (i.e., tritium or T).
- the compounds described herein include a 2 H (i.e., deuterium) isotope.
- the group denoted —C (1-6) alkyl includes not only —CH 3 , but also CD 3 ; not only CH 2 CH 3 , but also CD 2 CD 3 , etc.
- references to carbon and oxygen include within their scope respectively 12 C, 13 C and 14 C and 15 O and 16 O and 17 O and 18 O.
- the isotopes may be radioactive or non-radioactive.
- Radiolabelled compounds of the disclosure may include a radioactive isotope selected from the group comprising 3 H, 11 C, 18 F, 35 S, 122 I, 123 I, 125 I, 131 I, 75 Br, 76 Br, 77 Br and 82 Br.
- the radioactive isotope is selected from the group of 3 H, 11 C and 18 F.
- R 1 is:
- R 1a independently for each occurrence is —C (1-3) alkyl or —C (3-5) cycloalkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or when m1 is 2, two geminal R 1a groups together with the carbon atom to which they are attached form a spiro C (3-5) cycloalkyl;
- R 1b independently for each occurrence is halo or —C (1-3) alkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R 1b groups together with the carbon atoms to which they are attached form a fused C (3-7) cycloalkyl, wherein the C (3-7) cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n 1 or 2;
- n1, m2, and m3 are independently 0, 1, or 2;
- R 2 is H, —C (1-3) alkyl, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, —C (1-3) alkyl-O—C (3-5) cycloalkyl, or 4- to 6-membered heterocyclyl, wherein the —C (1-3) alkyl, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, and —C (1-3) alkyl-O—C (3-5) cycloalkyl groups are unsubstituted or substituted with one to six R 2a groups;
- R 2a independently for each occurrence is fluorine or —CN
- R 3 is —C (1-10) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, —C (1-6) alkyl-O—C (3-5) cycloalkyl, —C (1-6) alkyl-O—C (3-5) cycloalkyl-C (1-3) alkyl, —C (3-8) cycloalkyl, or —C (1-3) alkyl-(C (3-5) cycloalkyl) 1-2 , each of which is unsubstituted or substituted with one to six fluorine atoms;
- R 4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R 4a groups;
- R 4a is halo, —C (1-6) alkyl, —O—C (1-6) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, or —C (0-2) alkyl-C (3-6) cycloalkyl, wherein the —C (1-6) alkyl, —O—C (1-6) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, and —C (0-2) alkyl-C (3-6) cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH 3 , —CD 3 , —CD 2 CD 3 , —CH 2 F, —CHF 2 , and —CF 3 .
- R 1 is:
- R 1a independently for each occurrence is —C (1-3) alkyl or —C (3-5) cycloalkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or when m1 is 2, two geminal R 1a groups together with the carbon atom to which they are attached form a spiro C (3-5) cycloalkyl;
- R 1b independently for each occurrence is halo or —C (1-3) alkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R 1b groups together with the carbon atoms to which they are attached form a fused C (3-7) cycloalkyl, wherein the C (3-7) cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n 1 or 2;
- n1, m2, and m3 are independently 0, 1, or 2;
- R 2 is H, —C (1-3) alkyl, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, —C (1-3) alkyl-O—C (3-5) cycloalkyl, or 4- to 6-membered heterocyclyl, wherein the —C (1-3) alkyl, —C (3-5) cycloalkyl, —C (1-3 )alkyl-O—C (1-3) alkyl, and —C (1-3) alkyl-O—C (3-5) cycloalkyl groups are unsubstituted or substituted with one to six R 2a groups;
- R 2a independently for each occurrence is fluorine or —CN
- R 3 is —C (1-6) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, —C (1-6) alkyl-O—C (3-5) cycloalkyl, —C (1-6) alkyl-O—C (3-5) cycloalkyl-C (1-3) alkyl, —C (3-8) cycloalkyl, or —C (1-3) alkyl-(C (3-5) cycloalkyl) 1-2 , each of which is unsubstituted or substituted with one to six fluorine atoms;
- R 4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R 4a groups;
- R 4a is halo, —C (1-6) alkyl, —O—C (1-6) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, or —C (0-2) alkyl-C (3-6) cycloalkyl, wherein the —C (1-6) alkyl, —O—C (1-6) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, and —C (0-2) alkyl-C (3-6) cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH 3 , —CD 3 , —CD 2 CD 3 , —CH 2 F, —CHF 2 , and —CF 3 .
- R 1 is:
- R 1a independently for each occurrence is —C (1-3) alkyl or —C (3-5) cycloalkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms;
- R 1b independently for each occurrence is halo or —C (1-3) alkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R 1b groups together with the carbon atoms to which they are attached form a fused C (3-7) cycloalkyl, wherein the C (3-7) cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n 1 or 2;
- n1, m2, and m3 are independently 0, 1, or 2;
- R 2 is H, —C (1-3) alkyl, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, or —C (1-3) alkyl-O—C (3-5) cycloalkyl, wherein the —C (1-3) alkyl, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, and —C (1-3) alkyl-O—C (3-5) cycloalkyl groups are unsubstituted or substituted with one to six R 2a groups;
- R 2a independently for each occurrence is fluorine
- R 3 is —C (1-6) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, —C (1-6) alkyl-O—C (3-5) cycloalkyl, or —C (3-8) cycloalkyl, each of which is unsubstituted or substituted with one to six fluorine atoms;
- R 4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R 4a groups;
- R 4a is halo, —C (1-6) alkyl, —O—C (1-6) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, or —C (0-2) alkyl-C (3-6) cycloalkyl, wherein the —C (1-6) alkyl, —O—C (1-6) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, and —C (0-2) alkyl-C (3-6) cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH 3 , —CD 3 , —CD 2 CD 3 , —CH 2 F, —CHF 2 , and —CF 3 .
- R 1 is:
- R 1a independently for each occurrence is —C (1-3) alkyl or —C (3-5) cycloalkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or when m1 is 2, two geminal R 1a groups together with the carbon atom to which they are attached form a spiro C (3-5) cycloalkyl;
- R 1b independently for each occurrence is halo or —C (1-3) alkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R 1b groups together with the carbon atoms to which they are attached form a fused C (3-7) cycloalkyl, wherein the C (3-7) cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n1, m2, and m3 are independently 0, 1, or 2;
- R 2 is H, —C (1-3) alkyl, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, —C (1-3) alkyl-O—C (3-5) cycloalkyl, or 4- to 6-membered heterocyclyl, wherein the —C (1-3) alkyl and —C (3-5) cycloalkyl are unsubstituted or substituted with one to six R 2a groups;
- R 2a independently for each occurrence is fluorine or —CN
- R 3 is —C (1-6) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, —C (1-6) alkyl-O—C (3-5) cycloalkyl, —C (1-6) alkyl-O—C (3-5) cycloalkyl-C (1-3) alkyl, —C (3-8) cycloalkyl, or —CH(C (3-5) cycloalkyl) 2 , each of which is unsubstituted or substituted with one to six fluorine atoms;
- R 4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R 4a groups;
- R 4a is halo, —C (1-6) alkyl, —O—C (1-6) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, or —C (0-2) alkyl-C (3-6) cycloalkyl, wherein the —C (1-6) alkyl, —O—C (1-6) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, and —C (0-2) alkyl-C (3-6) cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH 3 , —CD 3 , —CD 2 CD 3 , —CH 2 F, —CHF 2 , and —CF 3 .
- R 1a independently for each occurrence is —C (1-3) alkyl or —C (3-5) cycloalkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms;
- R 1b independently for each occurrence is halo or —C (1-3) alkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R 1b groups together with the carbon atoms to which they are attached form a fused C (3-7) cycloalkyl, wherein the C (3-7) cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n 1 or 2;
- n1, m2, and m3 are independently 0, 1, or 2;
- R 2 is H, —C (1-3) alkyl, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, or —C (1-3) alkyl-O—C (3-5) cycloalkyl;
- R 3 is —C (1-6) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, —C (1-6) alkyl-O—C (3-5) cycloalkyl, or —C (3-8) cycloalkyl, each of which is unsubstituted or substituted with one to six fluorine atoms;
- R 4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R 4a groups;
- R 4a is halo, —C (1-6) alkyl, —O—C (1-6) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, or —C (0-2) alkyl-C (3-6) cycloalkyl, wherein the —C (1-6) alkyl, —O—C (1-6) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, and —C (0-2) alkyl-C (3-6) cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH 3 , —CD 3 , —CD 2 CD 3 , —CH 2 F, —CHF 2 , and —CF 3 .
- R 1 is:
- R 1a independently for each occurrence is —C (1-3) alkyl or —C (3-5) cycloalkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or when m1 is 2, two geminal R 1a groups together with the carbon atom to which they are attached form a spiro cyclopropyl;
- R 1b independently for each occurrence is halo or —C (1-3) alkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R 1b groups together with the carbon atoms to which they are attached form a fused C (3-5) cycloalkyl, wherein the C (3-5) cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n 1 or 2;
- n1, m2, and m3 are independently 0, 1, or 2;
- R 2 is H, —C (1-3) alkyl, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, —C (1-3) alkyl-O—C (3-5) cycloalkyl, or 4- to 6-membered heterocyclyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to six fluorine atoms, and wherein the —C (3-5) cycloalkyl is unsubstituted or substituted with one —CN group;
- R 3 is —C (1-6) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, —C (1-3) alkyl-O—C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (3-5) cycloalkyl-CH 3 , —C (5-6) cycloalkyl, or —CH(C (3-5) cycloalkyl) 2 , each of which is unsubstituted or substituted with one to six fluorine atoms;
- R 4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R 4a groups;
- R 4a is —C (1-4) alkyl, —O—C (1-4) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, or —C (0-2) alkyl-C (3-4) cycloalkyl, wherein the —C (1-4) alkyl, —O—C (1-4) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, and —C (0-2) alkyl-C (3-4) cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH 3 , —CD 3 , —CD 2 CD 3 , —CH 2 F, —CHF 2 , and —CF 3 .
- R 1 is:
- R 1a independently for each occurrence is —C (1-3) alkyl or —C (3-5) cycloalkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms;
- R 1b independently for each occurrence is halo or —C (1-3) alkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R 1b groups together with the carbon atoms to which they are attached form a fused C (3-5) cycloalkyl, wherein the C (3-5) cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n 1 or 2;
- n1, m2, and m3 are independently 0, 1, or 2;
- R 2 is H, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, or —C (1-3) alkyl-O—C (3-5) cycloalkyl;
- R 3 is —C (1-6) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, —C (1-3) alkyl-O—C (3-5) cycloalkyl, or cyclohexyl, each of which is substituted or unsubstituted with one to six fluorine atoms;
- R 4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R 4a groups;
- R 4a is —C (1-4) alkyl, —O—C (1-4) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, or —C (0-2) alkyl-C (3-4) cycloalkyl, wherein the —C (1-4) alkyl, —O—C (1-4) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, and —C (0-2) alkyl-C (3-4) cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH 3 , —CD 3 , —CD 2 CD 3 , —CH 2 F, —CHF 2 , and —CF 3 .
- R 1 is:
- R 1a independently for each occurrence is —C (1-3) alkyl or —C (3-5) cycloalkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or when m1 is 2, two geminal R 1a groups together with the carbon atom to which they are attached form a spiro cyclopropyl;
- R 1b independently for each occurrence is halo or —C (1-3) alkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R 1b groups together with the carbon atoms to which they are attached form a fused C (3-5) cycloalkyl, wherein the C (3-5) cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n 1 or 2;
- n1, m2, and m3 are independently 0, 1, or 2;
- R 2 is H, —C (1-3) alkyl, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, —C (1-3) alkyl-O—C (3-5) cycloalkyl, or tetrahydropyranyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to six fluorine atoms, and wherein the —C (3-5) cycloalkyl is unsubstituted or substituted with one —CN groups;
- R 3 is —C (5-6) alkyl substituted with two to three fluorine atoms, —C (5-6) cycloalkyl substituted with two fluorine atoms,
- R 3a , R 3b , R 3c , and R 3d are each independently H or —CH 3 ;
- R 3e and R 3f are each independently H or —CH 3 ;
- R 3g is H or —CF 3 ;
- R 4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R 4a groups;
- R 4a is —C (1-4) alkyl, —O—C (1-4) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, or —C (0-2) alkyl-C (3-4) cycloalkyl, wherein the —C (1-4) alkyl, —O—C (1-4) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, and —C (0-2) alkyl-C (3-4) cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH 3 , —CD 3 , —CD 2 CD 3 , —CH 2 F, —CHF 2 , and —CF 3 .
- R 1 is:
- R 1a independently for each occurrence is —C (1-3) alkyl or —C (3-5) cycloalkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms;
- R 1b independently for each occurrence is halo or —C (1-3) alkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R 1b groups together with the carbon atoms to which they are attached form a fused C (3-5) cycloalkyl, wherein the C (3-5) cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n 1 or 2;
- n1, m2, and m3 are independently 0, 1, or 2;
- R 2 is H, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, or —C (1-3) alkyl-O—C (3-5) cycloalkyl;
- R 3 is —C (1-5) alkyl substituted with one —CF 3 ,
- R 3a , R 3b , R 3c , and R 3d are each independently H or —CH 3 ;
- R 4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R 4a groups;
- R 4a is —C (1-4) alkyl, —O—C (1-4) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, or —C (0-2) alkyl-C (3-4) cycloalkyl, wherein the —C (1-4) alkyl, —O—C (1-4) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, and —C (0-2) alkyl-C (3-4) cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH 3 , —CD 3 , —CD 2 CD 3 , —CH 2 F, —CHF 2 , and —CF 3 .
- R 1 is:
- R 1a independently for each occurrence is —C (1-3) alkyl or —C (3-5) cycloalkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms;
- R 1b independently for each occurrence is halo or —C (1-3) alkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R 1b groups together with the carbon atoms to which they are attached form a fused C (3-5) cycloalkyl, wherein the C (3-5) cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n 1 or 2;
- n1, m2, and m3 are independently 0, 1, or 2;
- R 2 is H, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, or —C (1-3) alkyl-O—C (3-5) cycloalkyl;
- R 3 is:
- R 3a , R 3b , R 3c , and R 3d are each independently H or —CH 3 ;
- R 4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R 4a groups;
- R 4a is —C (1-4) alkyl, —O—C (1-4) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, or —C (0-2) alkyl-C (3-4) cycloalkyl, wherein the —C (1-4) alkyl, —O—C (1-4) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, and —C (0-2) alkyl-C (3-4) cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH 3 , —CD 3 , —CD 2 CD 3 , —CH 2 F, —CHF 2 , and —CF 3 .
- R 1 is:
- R 1a independently for each occurrence is —CH 3 , —CH 2 F, —CHF 2 , —CF 3 , or —C (3-4) cycloalkyl, or when m1 is 2, two geminal R 1a groups together with the carbon atom to which they are attached form a spiro cyclopropyl;
- R 1b independently for each occurrence is fluoro, —CH 3 , —CH 2 F, —CHF 2 , —CF 3 , or when n is 2, two R 1b groups together with the carbon atoms to which they are attached form a fused C (3-5) cycloalkyl, wherein the C (3-5) cycloalkyl is unsubstituted or substituted with one to five fluorine atoms
- n 1 or 2;
- n1 and m2 are independently 0, 1, or 2;
- R 2 is H, —C (1-3) alkyl, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, —C (1-3) alkyl-O—C (3-5) cycloalkyl, or tetrahydropyranyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to six fluorine atoms, and wherein the —C (3-5) cycloalkyl is unsubstituted or substituted with one —CN groups;
- R 3 is —C (5-6) alkyl substituted with two to three fluorine atoms, —C (5-6) cycloalkyl substituted with two fluorine atoms,
- R 3a , R 3b , R 3c , and R 3d are each independently H or —CH 3 ;
- R 3e and R 3f are each independently H or —CH 3 ;
- R 3g is H or —CF 3 ;
- R 4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R 4a groups;
- R 4a is —C (1-4) alkyl, —O—C (1-4) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, or —C (0-2) alkyl-C (3-4) cycloalkyl, wherein the —C (1-4) alkyl, —O—C (1-4) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, and —C (0-2) alkyl-C (3-4) cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH 3 , —CD 3 , —CD 2 CD 3 , —CH 2 F, —CHF 2 , and —CF 3 .
- R 1 is:
- R 1b independently for each occurrence is fluoro, —CH 3 , —CH 2 F, —CHF 2 , —CF 3 , or when n is 2, two R 1b groups together with the carbon atoms to which they are attached form a fused C (3-5) cycloalkyl, wherein the C (3-5) cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n 1 or 2;
- n2 0, 1, or 2;
- R 2 is H, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, or —C (1-3) alkyl-O—C (3-5) cycloalkyl;
- R 3 is —C (1-5) alkyl substituted with one —CF 3 ,
- R 3a , R 3b , R 3c , and R 3d are each independently H or —CH 3 ;
- R 4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R 4a groups;
- R 4a is —C (1-4) alkyl, —O—C (1-4) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, or —C (0-2) alkyl-C (3-4) cycloalkyl, wherein the —C (1-4) alkyl, —O—C (1-4) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, and —C (0-2) alkyl-C (3-4) cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH 3 , —CD 3 , —CD 2 CD 3 , —CH 2 F, —CHF 2 , and —CF 3 .
- R 1 is:
- R 1b independently for each occurrence is fluoro, —CH 3 , —CH 2 F, —CHF 2 , —CF 3 , or when n is 2, two R 1b groups together with the carbon atoms to which they are attached form a fused C (3-5) cycloalkyl, wherein the C (3-5) cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n 1 or 2;
- n2 0, 1, or 2;
- R 2 is H, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, or —C (1-3) alkyl-O—C (3-5) cycloalkyl;
- R 3 is:
- R 3a , R 3b , R 3c , and R 3d are each independently H or —CH 3 ;
- R 4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R 4a groups;
- R 4a is —C (1-4) alkyl, —O—C (1-4) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, or —C (0-2) alkyl-C (3-4) cycloalkyl, wherein the —C (1-4) alkyl, —O—C (1-4) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, and —C (0-2) alkyl-C (3-4) cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH 3 , —CD 3 , —CD 2 CD 3 , —CH 2 F, —CHF 2 , and —CF 3 .
- R 1 is:
- R 1b independently for each occurrence is fluoro, or when n is 2, two R 1b groups together with the carbon atoms to which they are attached form a fused C (3) cycloalkyl, wherein the C (3) cycloalkyl is unsubstituted or substituted with one to two fluorine atoms;
- n 1 or 2;
- n2 0, 1, or 2;
- R 2 is H, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, or —C (1-3) alkyl-O—C (3-5) cycloalkyl;
- R 3 is —C (5-6) alkyl substituted with two to three fluorine atoms, —C (5-6) cycloalkyl substituted with two fluorine atoms,
- R 3a , R 3b , R 3c , and R 3d are each independently H or —CH 3 ;
- R 3e and R 3f are each independently H or —CH 3 ;
- R 3g is H or —CF 3 ;
- R 4a is —C (1-4) alkyl, —O—C (1-4) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, or —C (0-2) alkyl-C (3-4) cycloalkyl, wherein the —C (1-4) alkyl, —O—C (1-4) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, and —C (0-2) alkyl-C (3-4) cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH 3 , —CD 3 , —CD 2 CD 3 , —CH 2 F, —CHF 2 , and —CF 3 .
- R 1 is:
- R 1b independently for each occurrence is fluoro, or when n is 2, two R 1b groups together with the carbon atoms to which they are attached form a fused C (3) cycloalkyl, wherein the C (3) cycloalkyl is unsubstituted or substituted with one to two fluorine atoms;
- n 1 or 2;
- n2 0, 1, or 2;
- R 2 is H, cyclopropyl, —CH 2 OCH 3 , or —CH 2 —O-cyclopropyl;
- R 3 is —C (5-6) alkyl substituted with two to three fluorine atoms, —C (5-6) cycloalkyl substituted with two fluorine atoms, or
- R 3a , R 3b , R 3c , and R 3d are each independently H or —CH 3 ;
- R 4a is methyl, ethyl, isopropyl, —CD 2 CD 3 , —CHF 2 , —CF 3 , —CH 2 CH 2 CF 3 , —OCH 3 , —OCH 2 CHF 2 , —CH 2 OCHF 2 , cyclopropyl, or —CH 2 -cyclopropyl.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 1a independently for each occurrence is —C (1-3) alkyl or —C (3-5) cycloalkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or when m1 is 2, two geminal R 1a groups together with the carbon atom to which they are attached form a spiro cyclopropyl.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 1a independently for each occurrence is —C (1-3) alkyl that is unsubstituted or substituted with one to five fluorine atoms, or when m1 is 2, two geminal R 1a groups together with the carbon atom to which they are attached form a spiro cyclopropyl.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 1a independently for each occurrence is —CH 3 , —CH 2 F, —CHF 2 , —CF 3 , or —C (3-4) cycloalkyl, or when m1 is 2, two geminal R 1a groups together with the carbon atom to which they are attached form a spiro cyclopropyl.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 1a independently for each occurrence is —CH 3 , —CH 2 F, —CHF 2 , or —CF 3 , or when m1 is 2, two geminal R 1a groups together with the carbon atom to which they are attached form a spiro cyclopropyl.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 1a independently for each occurrence is —C (1-3) alkyl or —C (3-5) cycloalkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 1a independently for each occurrence is —C (1-3) alkyl or —C (3-5) cycloalkyl.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 1a independently for each occurrence is —CH 3 , —CH 2 F, —CHF 2 , —CF 3 , or —C (3-4) cycloalkyl.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 1a independently for each occurrence is —C (1-3) alkyl that is unsubstituted or substituted with one to five fluorine atoms.
- R 1a independently for each occurrence is —C (3-5) cycloalkyl.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 1b independently for each occurrence is halo or —C (1-3) alkyl, or when n is 2, two R 1b groups together with the carbon atoms to which they are attached form a fused C (3-5) cycloalkyl, wherein the C (3-5) cycloalkyl is unsubstituted or substituted with one to five fluorine.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 1b independently for each occurrence is halo or —C (1-3) alkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R 1b groups together with the carbon atoms to which they are attached form a fused C (3-5) cycloalkyl, wherein the C (3-5) cycloalkyl is unsubstituted or substituted with one to five fluorine atoms.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 1b independently for each occurrence is fluoro, —CH 3 , —CH 2 F, —CHF 2 , —CF 3 , or when n is 2, two R 1b groups together with the carbon atoms to which they are attached form a fused C (3-5) cycloalkyl, wherein the C (3-5) cycloalkyl is unsubstituted or substituted with one to five fluorine atoms.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 1b independently for each occurrence is fluoro, —CH 3 , —CH 2 F, —CHF 2 , —CF 3 , or when n is 2, two R 1b groups together with the carbon atoms to which they are attached form a fused C (3) cycloalkyl, wherein the C (3) cycloalkyl is unsubstituted or substituted with one to two fluorine atoms.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 1b independently for each occurrence is fluoro, or when n is 2, two R 1b groups together with the carbon atoms to which they are attached form a fused C (3) cycloalkyl, wherein the C (3) cycloalkyl is unsubstituted or substituted with one to two fluorine atoms
- n 1
- n 2
- disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein m1 is 0, 1, or 2. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein m1 is 0. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein m2 is 0, 1, or 2. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein m3 is 0.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein m1 is 0, 1, or 2; m2 is 0, 1, or 2; and m3 is 0.
- a compound of Formula I, or a pharmaceutically acceptable salt thereof wherein m1 is 0; m2 is 0, 1, or 2; and m3 is 0.
- R 1 is:
- R 1a independently for each occurrence is —C (1-3) alkyl or —C (3-5) cycloalkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or when m1 is 2, two geminal R 1a groups together with the carbon atom to which they are attached form a spiro C (3-5) cycloalkyl;
- R 1b independently for each occurrence is halo or —C (1-3) alkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms; and m1, m2, and m3 are independently 0, 1, or 2.
- R 1 is:
- R 1a independently for each occurrence is —CH 3 , —CH 2 F, —CHF 2 , or —CF 3 , or when m1 is 2, two geminal R 1a groups together with the carbon atom to which they are attached form a spiro cyclopropyl;
- R 1b independently for each occurrence is fluoro, —CH 3 , —CH 2 F, —CHF 2 , —CF 3 ;
- n1, m2, and m3 are independently 0, 1, or 2.
- R 1 is:
- R 1a independently for each occurrence is —C (1-3) alkyl or —C (3-5) cycloalkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms;
- R 1b independently for each occurrence is halo or —C (1-3) alkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms; and m1, m2, and m3 are independently 0, 1, or 2.
- R 1 is:
- R 1a independently for each occurrence is —CH 3 , —CH 2 F, —CHF 2 , —CF 3 , or —C (3-4) cycloalkyl;
- R 1b independently for each occurrence is fluoro, —CH 3 , —CH 2 F, —CHF 2 , or —CF 3 ;
- n1, m2, and m3 are independently 0, 1, or 2.
- R 1 is:
- R 1a independently for each occurrence is —C (1-3) alkyl or —C (3-5) cycloalkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or when m1 is 2, two geminal R 1a groups together with the carbon atom to which they are attached form a spiro C (3-5) cycloalkyl;
- R 1b independently for each occurrence is halo or —C (1-3) alkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms;
- n1 and m2 are independently 0, 1, or 2.
- R 1 is:
- R 1a independently for each occurrence is —CH 3 , —CH 2 F, —CHF 2 , or —CF 3 , or when m1 is 2, two geminal R 1a groups together with the carbon atom to which they are attached form a spiro cyclopropyl;
- R 1b independently for each occurrence is fluoro, —CH 3 , —CH 2 F, —CHF 2 , —CF 3 ;
- n1 and m3 are independently 0, 1, or 2.
- R 1 is:
- R 1b independently for each occurrence is fluoro, —CH 3 , —CH 2 F, —CHF 2 , —CF 3 ;
- n2 0, 1, or 2.
- R 1 is:
- R 1b independently for each occurrence is fluoro, —CH 3 , —CH 2 F, —CHF 2 , —CF 3 ;
- n2 0, 1, or 2.
- R 1a independently for each occurrence is —C (1-3) alkyl or —C (3-5) cycloalkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms;
- R 1b independently for each occurrence is halo or —C (1-3) alkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or two vicinal R 1b groups together with the carbon atoms to which they are attached form a fused C (3-7) cycloalkyl, wherein the C (3-7) cycloalkyl is unsubstituted or substituted with one to five fluorine atoms; and
- n1, m2-1, m2-2, and m3 are independently 0, 1, or 2.
- R 1 is:
- R 1a independently for each occurrence is —CH 3 , —CH 2 F, —CHF 2 , —CF 3 , or —C (3-4) cycloalkyl;
- R 1b independently for each occurrence is fluoro, —CH 3 , —CH 2 F, —CHF 2 , —CF 3 , or two vicinal R 1b groups together with the carbon atoms to which they are attached form a fused C (3-5) cycloalkyl, wherein the C (3-5) cycloalkyl is unsubstituted or substituted with one to five fluorine atoms; and
- n1, m2-1, m2-2, and m3 are independently 0, 1, or 2.
- R 1 is:
- R 1a independently for each occurrence is —C (1-3) alkyl or —C (3-5) cycloalkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms;
- R 1b independently for each occurrence is halo or —C (1-3) alkyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to five fluorine atoms, or two vicinal R 1b groups together with the carbon atoms to which they are attached form a fused C (3-7) cycloalkyl, wherein the C (3-7) cycloalkyl is unsubstituted or substituted with one to five fluorine atoms; and
- n1, m2-1, and m2-2 are independently 0, 1, or 2.
- R 1 is:
- R 1a independently for each occurrence is —CH 3 , —CH 2 F, —CHF 2 , —CF 3 , or —C (3-4) cycloalkyl;
- R 1b independently for each occurrence is fluoro, —CH 3 , —CH 2 F, —CHF 2 , —CF 3 , or two vicinal R 1b groups together with the carbon atoms to which they are attached form a fused C (3-5) cycloalkyl, wherein the C (3-5) cycloalkyl is unsubstituted or substituted with one to five fluorine atoms; and
- n1, m2-1, and m2-2 are independently 0, 1, or 2.
- R 1 is:
- R 1b independently for each occurrence is fluoro, —CH 3 , —CH 2 F, —CHF 2 , —CF 3 , or two vicinal R 1b groups together with the carbon atoms to which they are attached form a fused C (3-5) cycloalkyl, wherein the C (3-5) cycloalkyl is unsubstituted or substituted with one to five fluorine atoms; and
- n2-1 and m2-2 are independently 0, 1, or 2.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 2 is H, —C (1-3) alkyl, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, or —C (1-3) alkyl-O—C (3-5) cycloalkyl, wherein the —C (1-3) alkyl, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, and —C (1-3) alkyl-O—C (3-5) cycloalkyl groups are unsubstituted or substituted with one to six R 2a groups.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 2 is H, —C (1-3) alkyl, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, —C (1-3) alkyl-O—C (3-5) cycloalkyl, or 4- to 6-membered heterocyclyl, wherein the —C (1-3) alkyl and —C (3-5) cycloalkyl are unsubstituted or substituted with one to six R 2a groups.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 2 is H, —C (1-3) alkyl, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, —C (1-3) alkyl-O—C (3-5) cycloalkyl, or 4- to 6-membered heterocyclyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to six fluorine atoms, and wherein the —C (3-5) cycloalkyl is unsubstituted or substituted with one —CN group.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 2 is H, —C (1-3) alkyl, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, —C (1-3) alkyl-O—C (3-5) cycloalkyl, or tetrahydropyranyl, wherein the —C (1-3) alkyl is unsubstituted or substituted with one to six fluorine atoms, and wherein the —C (3-5) cycloalkyl is unsubstituted or substituted with one —CN groups.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 2 is H, —C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (1-3) alkyl, or —C (1-3) alkyl-O—C (3-5) cycloalkyl.
- disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R 2 is H. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R 2 is —C (1-3) alkyl that is unsubstituted or substituted with one to six fluorine atoms. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R 2 is —C (3-5) cycloalkyl that is unsubstituted or substituted with one —CN group.
- disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R 2 is —C (1-3) alkyl-O—C (1-3) alkyl. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R 2 is —C (1-3) alkyl-O—C (3-5) cycloalkyl. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R 2 is 4- to 6-membered heterocyclyl.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 2 is H, cyclopropyl, —CH 2 OCH 2 CH 3 , —CH 2 OCH 3 , or —CH 2 —O-cyclopropyl.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 2 is H, cyclopropyl, —CH 2 OCH 3 , or —CH 2 —O-cyclopropyl.
- disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R 2 is H. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R 2 is —CH 3 . In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R 2 is —CHF 2 . In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R 2 is cyclopropyl. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R 2 is cyanocyclobutyl.
- disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R 2 is —CH 2 OCH 3 . In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R 2 is —CH 2 OCH 2 CH 3 . In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R 2 is —CH 2 OCH(CH 3 ) 2 . In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R 2 is —CH 2 —O-cyclopropyl.
- disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R 2 is —CH 2 —O-cyclobutyl. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R 2 is tetrahydropyranyl.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, which is a compound of Formula Ia:
- disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R 2a is fluorine. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R 2a is —CN.
- R 3 is —C (1-10) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, —C (1-6) alkyl-O—C (3-5) cycloalkyl, —C (1-6) alkyl-O—C (3-5) cycloalkyl-C (1-3) alkyl, —C (3-8) cycloalkyl, or —CH(C (3-5) cycloalkyl) 2 , each of which is unsubstituted or substituted with one to six fluorine atoms.
- R 3 is —C (1-8) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, —C (1-6) alkyl-O—C (3-5) cycloalkyl, —C (1-6) alkyl-O—C (3-5) cycloalkyl-C (1-3) alkyl, —C (3-8) cycloalkyl, or —CH(C (3-5) cycloalkyl) 2 , each of which is unsubstituted or substituted with one to six fluorine atoms.
- R 3 is —C (1-7) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, —C (1-6) alkyl-O—C (3-5) cycloalkyl, —C (1-6) alkyl-O—C (3-5) cycloalkyl-C (1-3) alkyl, —C (3-8) cycloalkyl, or —CH(C (3-5) cycloalkyl) 2 , each of which is unsubstituted or substituted with one to six fluorine atoms.
- R 3 is —C (1-6) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, —C (1-6) alkyl-O—C (3-5) cycloalkyl, —C (1-6) alkyl-O—C (3-5) cycloalkyl-C (1-3) alkyl, —C (3-8) cycloalkyl, or —CH(C (3-5) cycloalkyl) 2 , each of which is unsubstituted or substituted with one to six fluorine atoms.
- R 3 is —C (5-6) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, —C (1-3) alkyl-O—C (3-5) cycloalkyl, —C (1-3) alkyl-O—C (3-5) cycloalkyl-CH 3 , —C (5-6) cycloalkyl, or —CH(C (3-5) cycloalkyl) 2 , each of which is unsubstituted or substituted with one to six fluorine atoms.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 3 is —C (5-6) alkyl substituted with two to three fluorine atoms, —C (1-6) alkyl-O—C (1-5) alkyl-CF 3 , —C (1-6) alkyl-O—C (3-5) cycloalkyl, —C (1-6) alkyl-O—C (3-5) cycloalkyl-CF 3 , —C (5-6) cycloalkyl substituted with two fluorine atoms, or —CH(C (3-5) cycloalkyl) 2 .
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 3 is —C (5-7) alkyl substituted with two to three fluorine atoms, —C (1-6) alkyl-O—C (1-5) alkyl-CF 3 , —C (1-6) alkyl-O—C (3-5) cycloalkyl, —C (1-6) alkyl-O—C (3-5) cycloalkyl-CF 3 , —C (5-6) cycloalkyl substituted with two fluorine atoms, or —CH(C (3-5) cycloalkyl) 2 .
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 3 is —C (1-6) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, —C (1-6) alkyl-O—C (3-5) cycloalkyl, or —C (3-8) cycloalkyl, each of which is unsubstituted or substituted with one to six fluorine atoms.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 3 is —C (1-6) alkyl, —C (1-6) alkyl-O—C (1-6) alkyl, or —C (1-6) alkyl-O—C (3-5) cycloalkyl, each of which is unsubstituted or substituted with one to six fluorine atoms.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 3 is —C (1-6) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, —C (1-3) alkyl-O—C (3-5) cycloalkyl, or cyclohexyl, each of which is substituted or unsubstituted with one to six fluorine atoms.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 3 is —C (1-6) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, or cyclohexyl, each of which is substituted or unsubstituted with one to six fluorine atoms.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 3 is —C (1-6) alkyl, —C (1-6) alkyl-O—C (1-5) alkyl-CF 3 , or cyclohexyl, wherein the —C (1-6) alkyl is substituted with one to three fluorine atoms and wherein the cyclohexyl is substituted with two fluorine atoms.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 3 is —C (1-5) alkyl, —C (1-6) alkyl-O—C (1-5) alkyl-CF 3 , or cyclohexyl, wherein the —C (1-5) alkyl is substituted with one —CF 3 and wherein the cyclohexyl is substituted with two fluorine atoms.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 3 is —C (1-6) alkyl-O—C (1-5) alkyl-CF 3 or cyclohexyl, wherein the cyclohexyl is substituted with two fluorine atoms.
- a compound of Formula I, or a pharmaceutically acceptable salt thereof wherein R 3 is —C (1-6) alkyl that is unsubstituted or substituted with one to six fluorine atoms.
- a compound of Formula I, or a pharmaceutically acceptable salt thereof wherein R 3 is —C (5-6) alkyl substituted with two to three fluorine atoms.
- a compound of Formula I, or a pharmaceutically acceptable salt thereof wherein R 3 is —C (1-5) alkyl substituted with one —CF 3 .
- R 3 is —C (5) alkyl substituted with one —CF 3 .
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 3 is —C (1-6) alkyl-O—C (1-6) alkyl that is unsubstituted or substituted with one to six fluorine atoms.
- R 3 is —C (1-6) alkyl-O—C (1-5) alkyl-CF 3 .
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 3 is —C (1-6) alkyl-O—C (3-5) cycloalkyl that is unsubstituted or substituted with one to six fluorine atoms.
- R 3 is —C (1-6) alkyl-O—C (3-5) cycloalkyl-C (1-3) alkyl that is unsubstituted or substituted with one to six fluorine atoms.
- a compound of Formula I, or a pharmaceutically acceptable salt thereof wherein R 3 is —C (1-6) alkyl-O—C (3-5) cycloalkyl-CF 3 .
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 3 is —C (3-8) cycloalkyl that is unsubstituted or substituted with one to six fluorine atoms.
- R 3 is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R 3 is —C (5-6) cycloalkyl substituted with two fluorine atoms.
- R 3 is cyclohexyl substituted with two fluorine atoms.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 3 is —C (1-3) alkyl-(C (3-5) cycloalkyl) 1-2 that is unsubstituted or substituted with one to six fluorine atoms.
- R 3 is —CH(C (3-5) cycloalkyl) 2 .
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 3 is —C (5-6) alkyl substituted with two to three fluorine atoms, —C (5-6) cycloalkyl substituted with two fluorine atoms,
- R 3a , R 3b , R 3c , and R 3d are each independently H or —CH 3 ;
- R 3e and R 3f are each independently H or —CH 3 ;
- R 3g is H or —CF 3 .
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 3 is —C (5-6) alkyl substituted with two to three fluorine atoms, —C (5-6) cycloalkyl substituted with two fluorine atoms, or
- R 3a , R 3b , R 3c , and R 3d are each independently H or —CH 3 .
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 3 is —C (1-5) alkyl substituted with one —CF 3 ,
- R 3a , R 3b , R 3c , and R 3d are each independently H or —CH 3 .
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 3 is —C (1-5) alkyl substituted with one —CF 3 or
- R 3a , R 3b , R 3c , and R 3d are each independently H or —CH 3 .
- R 3a , R 3b , R 3c , and R 3d are each independently H or —CH 3 .
- R 3a , R 3b , R 3c , and R 3d are each independently H or —CH 3 .
- R 3e and R 3f are each independently H or —CH 3 ;
- R 3g is H or —CF 3 .
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 3 is —C (1-5) alkyl substituted with one —CF 3 .
- a compound of Formula I or a pharmaceutically acceptable salt thereof, which is a compound of Formula Ib:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, which is a compound of Formula Ib-1:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, which is a compound of Formula Ic:
- R 3a , R 3b , R 3c , and R 3d are each independently H or —CH 3 .
- a compound of Formula I or a pharmaceutically acceptable salt thereof, which is a compound of Formula Ic-1:
- R 3a , R 3b , R 3c , and R 3d are each independently H or —CH 3 .
- a compound of Formula I or a pharmaceutically acceptable salt thereof, which is a compound of Formula Ic-2:
- R 3a , R 3b , R 3c , and R 3d are each independently H or —CH 3 .
- a compound of Formula I or a pharmaceutically acceptable salt thereof, which is a compound of Formula Id:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, which is a compound of Formula Id-1:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, which is a compound of Formula Id-2:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 4 is a 5-membered heteroaryl that is substituted with one or two R 4a groups.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 4 is a 5-membered heteroaryl comprising one to three heteroatoms selected from O and N, wherein the 5-membered heteroaryl is unsubstituted or substituted with one to two R 4a groups.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 4 is pyrrolyl, pyrazolyl, imidazolyl, triazolyl, oxazolyl, isoxazolyl, or oxadiazolyl, each of which is unsubstituted or substituted with one to two R 4a groups.
- R 4 is pyrazolyl, triazolyl, isoxazolyl, or oxadiazolyl, each of which is unsubstituted or substituted with one to two R 4a groups.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 4 is pyrazolyl or oxadiazolyl, each of which is unsubstituted or substituted with one to two R 4a groups.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 4 is pyrrolyl, pyrazolyl, imidazolyl, 1,2,3-triazolyl, 1,2,4-triazolyl, oxazolyl, isoxazolyl, 1,2,3-oxadiazolyl, 1,2,4-oxadiazolyl, 1,2,5-oxadiazolyl, or 1,3,4-oxadiazolyl, each of which is unsubstituted or substituted with one to two R 4a groups.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 4 is pyrazolyl, 1,2,3-triazolyl, 1,2,4-triazolyl, isoxazolyl, or 1,2,5-oxadiazolyl, each of which is unsubstituted or substituted with one to two R 4a groups.
- R 4 is pyrazolyl or 1,2,5-oxadiazolyl, each of which is unsubstituted or substituted with one to two R 4a groups.
- R 4a is —C (1-4) alkyl, —O—C (1-4) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, or —C (0-2) alkyl-C (3-4) cycloalkyl, wherein the —C (1-4) alkyl, —O—C (1-4) alkyl, —C (1-4) alkyl-O—C (1-4) alkyl, and —C (0-2) alkyl-C (3-4) cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH 3 , —CD 3 , —CD 2 CD 3 , —CH 2 F, —CHF 2 , and —CF 3 .
- R 4a is —C (1-6) alkyl, —O—C (1-6) alkyl, or —C (0-2) alkyl-C (3-6) cycloalkyl, each of which are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH 3 , —CD 3 , —CD 2 CD 3 , —CH 2 F, —CHF 2 , and —CF 3 .
- R 4a is —C (1-4) alkyl, —O—C (1-4) alkyl, or —C (0-2) alkyl-C (3-4) cycloalkyl, each of which are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH 3 , —CD 3 , —CD 2 CD 3 , —CH 2 F, —CHF 2 , and —CF 3 .
- R 4a is —C (1-6) alkyl or —C (0-2) alkyl-C (3-6) cycloalkyl, each of which are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH 3 , —CD 3 , —CD 2 CD 3 , —CH 2 F, —CHF 2 , and —CF 3 .
- R 4a is —C (1-4) alkyl or —C (0-2) alkyl-C (3-4) cycloalkyl, each of which are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH 3 , —CD 3 , —CD 2 CD 3 , —CH 2 F, —CHF 2 , and —CF 3 .
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 4a is methyl, ethyl, isopropyl, —CD 2 CD 3 , —CHF 2 , —CF 3 , —CH 2 CH 2 CF 3 , —OCH 3 , —OCH 2 CHF 2 , —CH 2 OCHF 2 , cyclopropyl, or —CH 2 -cyclopropyl.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 4a is methyl, isopropyl, —CD 2 CD 3 , —CH 2 CH 2 CF 3 , —OCH 2 CHF 2 , —CH 2 OCHF 2 , cyclopropyl, or —CH 2 -cyclopropyl.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 4a is methyl, ethyl, isopropyl, —CHF 2 , —CF 3 , —OCH 3 , or cyclopropyl.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, wherein R 4a is methyl, isopropyl, or cyclopropyl.
- a compound of Formula I, or a pharmaceutically acceptable salt thereof that is a deuterated isotope comprising one to thirty deuterium atoms. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, that is a deuterated isotope comprising one to fifteen deuterium atoms. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, that is a deuterated isotope comprising one to seven deuterium atoms.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having a structure as shown in Tables 1A, 1B, 1C, 1D, 1E, and 1F.
- a compound of Formula I or a pharmaceutically acceptable salt thereof, selected from the group consisting of:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, selected from the group consisting of:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, selected from the group consisting of:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, selected from the group consisting of:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, selected from the group consisting of:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having the following structure:
- a compound of Formula I or a pharmaceutically acceptable salt thereof, having a structure as shown in Tables 2A, 2B, 2C, 2D, and 2E.
- a pharmaceutical composition comprising a compound of Formula I, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier.
- the pharmaceutical composition is formulated for oral administration (e.g., a tablet or capsule).
- a pharmaceutical composition made by mixing a compound of Formula I, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier.
- a process for making a pharmaceutical composition comprising mixing a compound of Formula I, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier.
- the present application is also directed to a method for treating and/or ameliorating a IL-17 mediated inflammatory syndrome, disorder or disease comprising administering to a subject in need thereof an effective amount of a compound of Formula I, or pharmaceutically acceptable salt thereof, composition thereof, or medicament thereof.
- disclosed herein is a method for treating or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof.
- a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is selected from the group consisting of: psoriasis, psoriatic arthritis, rheumatoid arthritis, ankylosing spondylitis, hidradenitis suppurativa, bullous pemphigoid, atopic dermatitis, vitiligo, multiple sclerosis, asthma, uveitis, chronic obstructive pulmonary disorder, multiple myeloma, and systemic lupus erythematosus.
- a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is psoriasis.
- a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is psoriatic arthritis.
- a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is rheumatoid arthritis.
- a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is ankylosing spondylitis.
- a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is hidradenitis suppurativa.
- a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is bullous pemphigoid.
- a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is atopic dermatitis.
- a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is vitiligo.
- a method for treating or ameliorating and/an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is multiple sclerosis.
- a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is systemic lupus erythematosus.
- a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is asthma.
- a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is uveitis.
- a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is chronic obstructive pulmonary disorder.
- a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is multiple myeloma.
- a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is selected from the group consisting of: psoriasis, psoriatic arthritis, rheumatoid arthritis, ankylosing spondylitis, hidradenitis suppurativa, bullous pemphigoid, atopic dermatitis, vitiligo, multiple sclerosis, asthma, uveitis, chronic obstructive pulmonary disorder, multiple myeloma, and systemic lupus erythematosus, wherein the compound of Formula I or the pharmaceutically acceptable salt thereof is administered orally (e.g., as a tablet or capsule).
- the compound of Formula I or the pharmaceutically acceptable salt thereof is administered orally (e.
- a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is selected from the group consisting of: psoriasis, psoriatic arthritis, rheumatoid arthritis, ankylosing spondylitis, hidradenitis suppurativa, bullous pemphigoid, atopic dermatitis, vitiligo, multiple sclerosis, asthma, uveitis, chronic obstructive pulmonary disorder, multiple myeloma, and systemic lupus erythematosus, wherein the therapeutically effective amount is a dose of about 10 mg to 300 mg QD. In some embodiments, the therapeutically effective amount is a dose of about 20 mg to 200 mg QD
- a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is selected from the group consisting of: psoriasis, psoriatic arthritis, rheumatoid arthritis, ankylosing spondylitis, hidradenitis suppurativa, bullous pemphigoid, atopic dermatitis, vitiligo, multiple sclerosis, asthma, uveitis, chronic obstructive pulmonary disorder, multiple myeloma, and systemic lupus erythematosus, wherein the therapeutically effective amount is a dose of about 10 mg to 300 mg BID. In some embodiments, the therapeutically effective amount is a dose of about 20 mg to 200 mg BID
- a therapeutically effective amount of compound of Formula I, or a pharmaceutically acceptable salt thereof for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease selected from the group consisting of: psoriasis, psoriatic arthritis, rheumatoid arthritis, ankylosing spondylitis, hidradenitis suppurativa, bullous pemphigoid, atopic dermatitis, vitiligo, multiple sclerosis, asthma, uveitis, chronic obstructive pulmonary disorder, multiple myeloma, and systemic lupus erythematosus.
- a compound of Formula I or pharmaceutically acceptable salt thereof, in the manufacture of a medicament for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease selected from the group consisting of: psoriasis, psoriatic arthritis, rheumatoid arthritis, ankylosing spondylitis, hidradenitis suppurativa, bullous pemphigoid, atopic dermatitis, vitiligo, multiple sclerosis, asthma, uveitis, chronic obstructive pulmonary disorder, multiple myeloma, and systemic lupus erythematosus.
- a method for treating and/or ameliorating an IL-17 mediated inflammatory syndrome, disorder or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or pharmaceutically acceptable salt thereof, a composition thereof, or a medicament thereof.
- a method of treating and/or ameliorating an IL-17 mediated inflammatory syndrome, disorder or disease wherein the syndrome, disorder or disease is selected from the group consisting of: psoriasis, psoriatic arthritis, rheumatoid arthritis, ankylosing spondylitis, hidradenitis suppurativa, atopic dermatitis, vitiligo, multiple sclerosis, asthma, allergic asthma, steroid resistant asthma, neutrophilic asthma, chronic obstructive pulmonary disease, uveitis, multiple myeloma, and systemic lupus erythematosus, comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or pharmaceutically acceptable salt thereof, a composition thereof, or a medicament thereof.
- the syndrome, disorder or disease is selected from the group consisting of: psoriasis, psoriatic arthritis, rheumatoid arthritis, ankylosing spond
- a method of treating or ameliorating an IL-17 mediated inflammatory syndrome, disorder or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or pharmaceutically acceptable salt thereof, a composition thereof, or a medicament thereof.
- disclosed herein are methods of modulating IL-17 activity in a mammal by administration of a therapeutically effective amount of at least one compound of Formula I, or pharmaceutically acceptable salt thereof.
- a compound of Formula I, or pharmaceutically acceptable salt thereof, a composition thereof, or a medicament thereof may also be used in combination with one or more additional therapeutic agents.
- the one or more additional therapeutic agents is selected from the group consisting of anti-inflammatory agents, immunomodulatory agents, and immunosuppressive agents.
- the one or more additional therapeutic agents is selected from the group consisting of: anti-TNFalpha agents such as infliximab (Remicade®), adalimumab (Humira®), certolizumab pegol (Cimzia®), golimumab (Simponi®), etanercept (Enbrel®), thalidomide (Immunoprin®), lenalidomide (Revlimid®), and pomalidomide (Pomalyst®/Imnovid®); anti-p40 antibody agents such as ustekinumab (Stelara®); and anti-p19 antibody agents such as guselkumab (Tremfya®), tildrakizumab (IlumyaTM/Ilumetri), risankizumab (Skyrizi®), and mirikizumab.
- anti-TNFalpha agents such as infliximab (Remicade®), ada
- a method of treating and/or ameliorating an IL-17 mediated inflammatory syndrome, disorder or disease, in a subject in need thereof comprising administering to the subject a therapeutically effective amount of the compound of Formula I, or pharmaceutically acceptable salt thereof, composition thereof, or medicament thereof in a combination therapy with one or more additional therapeutic agents, such as anti-inflammatory agents, immunomodulatory agents, or immunosuppressive agents, wherein said syndrome, disorder or disease is selected from the group consisting of psoriasis, psoriatic arthritis, rheumatoid arthritis, ankylosing spondylitis, hidradenitis suppurativa, atopic dermatitis, vitiligo, multiple sclerosis, asthma, allergic asthma, steroid resistant asthma, neutrophilic asthma, chronic obstructive pulmonary disease, uveitis, multiple myeloma, and systemic lupus erythematosus.
- additional therapeutic agents such as anti-inflammatory agents, immunomodulatory agents, or immunos
- a method of treating and/or ameliorating an IL-17 mediated inflammatory syndrome, disorder or disease, in a subject in need thereof comprising administering to the subject a therapeutically effective amount of the compound of Formula I, or pharmaceutically acceptable salt thereof, composition thereof, or medicament thereof in a combination therapy with one or more additional therapeutic agents, such as anti-inflammatory agents, or immunosuppressive agents, wherein said syndrome, disorder or disease is psoriasis, psoriatic arthritis, ankylosing spondylitis.
- the IL-17 mediated inflammatory syndrome, disorder or disease is psoriasis.
- the IL-17 mediated inflammatory syndrome, disorder or disease is psoriatic arthritis.
- the IL-17 mediated inflammatory syndrome, disorder or disease is ankylosing spondylitis.
- the compounds disclosed herein may be administered in an effective amount within the dosage range of about 0.5 mg to about 1 g, preferably between about 0.5 mg to about 500 mg, in single or divided daily doses.
- the dosage amount is about 5 mg to 400 mg.
- the dosage amount is about 10 mg to 300 mg.
- the dosage amount is about 0.5, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 mg of a compound of Formula I, or pharmaceutically acceptable salt thereof.
- the dosage amount is about 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, or 200 mg of a compound of Formula I, or pharmaceutically acceptable salt thereof. In some embodiments, the dosage amount is about 200, 205, 210, 215, 220, 225, 230, 235, 240, 245, 250, 255, 260, 265, 270, 275, 280, 285, 290, 295, or 300 mg of a compound of Formula I, or pharmaceutically acceptable salt thereof.
- the dosage amount is about 300, 315, 320, 325, 330, 335, 340, 345, 350, 355, 360, 365, 370, 375, 380, 385, 390, 395, or 400 mg of a compound of Formula I, or pharmaceutically acceptable salt thereof. In some embodiments, the dosage amount is about 400, 405, 410, 415, 420, 425, 430, 435, 440, 445, 450, 455, 460, 465, 470, 475, 480, 485, 490, 495, or 500 mg of a compound of Formula I, or pharmaceutically acceptable salt thereof.
- a compound of Formula I, or pharmaceutically acceptable salt thereof may be administered in an effective amount within the dosage range of about 10 mg to 300 mg QD. In some embodiments, a compound of Formula I, or pharmaceutically acceptable salt thereof, may be administered in an effective amount within the dosage range of about 20 mg to 200 mg QD. In some embodiments, a compound of Formula I, or pharmaceutically acceptable salt thereof, may be administered in an effective amount within the dosage range of about 50 mg to 100 mg QD.
- a compound of Formula I, or pharmaceutically acceptable salt thereof may be administered in an effective amount within the dosage range of about 10 mg to 300 mg BID. In some embodiments, a compound of Formula I, or pharmaceutically acceptable salt thereof, may be administered in an effective amount within the dosage range of about 20 mg to 200 mg BID. In some embodiments, a compound of Formula I, or pharmaceutically acceptable salt thereof, may be administered in an effective amount within the dosage range of about 50 mg to 100 mg BID.
- the dosage administered will be affected by factors such as the route of administration, the health, weight and age of the recipient, the frequency of the treatment and the presence of concurrent and unrelated treatments.
- the therapeutically effective dose for compounds of the present invention or a pharmaceutical composition thereof will vary according to the desired effect. Therefore, optimal dosages to be administered may be readily determined by one skilled in the art and will vary with the particular compound used, the mode of administration, the strength of the preparation, and the advancement of the disease condition. In addition, factors associated with the particular subject being treated, including subject age, weight, diet and time of administration, will result in the need to adjust the dose to an appropriate therapeutic level.
- the above dosages are thus exemplary of the average case. There can, of course, be individual instances where higher or lower dosage ranges are merited, and such are within the scope of this invention.
- Pharmaceutically acceptable acidic/anionic salts include, and are not limited to acetate, benzenesulfonate, benzoate, bicarbonate, bitartrate, bromide, calcium edetate, camsylate, carbonate, chloride, citrate, dihydrochloride, edetate, edisylate, estolate, esylate, fumarate, glyceptate, gluconate, glutamate, glycollylarsanilate, hexylresorcinate, hydrabamine, hydrobromide, hydrochloride, hydroxynaphthoate, iodide, isethionate, lactate, lactobionate, malate, maleate, mandelate, mesylate, methylbromide, methylnitrate, methylsulfate, mucate, napsylate, nitrate, pamoate, pantothenate, phosphate/diphosphate, polygalacturonate,
- Organic or inorganic acids also include, and are not limited to, hydriodic, perchloric, sulfuric, phosphoric, propionic, glycolic, methanesulfonic, hydroxyethanesulfonic, oxalic, 2-naphthalenesulfonic, p-toluenesulfonic, cyclohexanesulfamic, saccharinic or trifluoroacetic acid.
- Pharmaceutically acceptable basic/cationic salts include, and are not limited to aluminum, 2-amino-2-hydroxymethyl-propane-1,3-diol (also known as tris(hydroxymethyl)aminomethane, tromethane or “TRIS”), ammonia, benzathine, t-butylamine, calcium, calcium gluconate, calcium hydroxide, chloroprocaine, choline, choline bicarbonate, choline chloride, cyclohexylamine, diethanolamine, ethylenediamine, lithium, LiOMe, L-lysine, magnesium, meglumine, NH 3 , NH 4 OH, N-methyl-D-glucamine, piperidine, potassium, potassium-t-butoxide, potassium hydroxide (aqueous), procaine, quinine, sodium, sodium carbonate, sodium-2-ethylhexanoate, sodium hydroxide, triethanolamine, or zinc.
- TMS tris(hydroxymethyl)aminomethane
- the compounds of Formula I, or pharmaceutically acceptable salt thereof, may be formulated into pharmaceutical compositions comprising any known pharmaceutically acceptable carriers.
- exemplary carriers include, but are not limited to, any suitable solvents, dispersion media, coatings, antibacterial and antifungal agents and isotonic agents.
- exemplary excipients that may also be components of the formulation include fillers, binders, disintegrating agents and lubricants.
- the pharmaceutically-acceptable salts of the compounds of Formula I include the conventional non-toxic salts or the quaternary ammonium salts which are formed from inorganic or organic acids or bases.
- acid addition salts include acetate, adipate, benzoate, benzenesulfonate, citrate, camphorate, dodecylsulfate, hydrochloride, hydrobromide, lactate, maleate, methanesulfonate, nitrate, oxalate, pivalate, propionate, succinate, sulfate and tartrate.
- Base salts include ammonium salts, alkali metal salts such as sodium and potassium salts, alkaline earth metal salts such as calcium and magnesium salts, salts with organic bases such as dicyclohexylamino salts and salts with amino acids such as arginine. Also, the basic nitrogen-containing groups may be quaternized with, for example, alkyl halides.
- compositions of the invention may be administered by any means that accomplish their intended purpose. Examples include administration by parenteral, subcutaneous, intravenous, intramuscular, intraperitoneal, transdermal, topical, buccal or ocular routes. Alternatively or concurrently, administration may be by the oral route.
- suitable formulations for parenteral administration include aqueous solutions of the active compounds in water-soluble form, for example, water-soluble salts, acidic solutions, alkaline solutions, dextrose-water solutions, isotonic carbohydrate solutions and cyclodextrin inclusion complexes.
- Also disclosed herein is a method of making a pharmaceutical composition
- a pharmaceutical composition comprising mixing a pharmaceutically acceptable carrier with any of the compounds of Formula I, or pharmaceutically acceptable salt thereof.
- the present application includes pharmaceutical compositions made by mixing a pharmaceutically acceptable carrier with any of the compounds of the present invention.
- provided herein are processes and intermediates disclosed herein that are useful for preparing a compound of the disclosure or pharmaceutically acceptable salts thereof.
- Compounds of Formula I can be prepared according to Scheme 1.
- Compounds A-I can be converted to compounds A-II through a sequence of reactions which will be known as “urea formation conditions”. This can be achieved by reacting an amine as present in compounds A-I with an activated amino alcohol precursor, such as 3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl trifluoromethanesulfonate.
- an activated amino alcohol precursor such as 3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl trifluoromethanesulfonate.
- the adduct formed from this reaction is then subjected to hydrazine in a solvent such as ethanol.
- the resulting diamine can then be cyclized using CDI or triphosgene and DIPEA in a solvent such as THE or DCM to afford compounds A-II.
- compounds A-II can be prepared by reacting an amine as present in compounds A-I via a three-step process.
- Initial reaction of compounds A-I with a suitably protected amino aldehyde such as 2-(1-(1,3-dioxoisoindolin-2-yl)cyclopropyl)acetaldehyde, in the presence of a reducing agent such as NaCNBH 3 in a solvent such as methanol in the presence or absence of additives such as acetic acid provides a secondary amine adduct (structure not shown).
- this adduct is then subjected to hydrazine in a solvent such as ethanol to afford a diamine (structure not shown).
- this diamine can then be treated with CDI or triphosgene and DIPEA in a solvent such as THE or DCM to afford compounds A-II.
- Compounds A-II are treated with an acid such as TFA in a solvent such as DCM to afford compounds A-III. These conditions are herein known as “Boc deprotection conditions”.
- Amide bond formation between amines A-III and carboxylic acids can be achieved through the use of a coupling agent, such as HATU, EDCI or 2-chloro-1-methylpyridinium iodide in the presence of a base, such as DIPEA or TEA, in a solvent, such as DMF, MeCN, or DCM, with or without an additive, such as HOBt, to yield compounds of Formula I.
- a coupling agent such as HATU, EDCI or 2-chloro-1-methylpyridinium iodide
- a base such as DIPEA or TEA
- a solvent such as DMF, MeCN, or DCM
- amide bond formation can be achieved by treatment of amines A-III with a reagent such as a carboxylic acid chloride (R 4 CO 2 Cl) in the presence or absence of additives such as DIPEA or DMAP in solvents such as ACN, DCM or THE to yield compounds of Formula I.
- amines A-III can be treated with N-hydroxysuccinate esters in the presence of reagents such as DIPEA in a solvent such as acetonitrile to provide compounds of Formula I.
- amide bond formation can be achieved by treatment of amines A-III with a reagent such as an ester (R 4 CO 2 R 4a wherein R 4aa is —C (1-6) alkyl) with or without an additive, such as TEA, in a solvent such as ACN to afford compounds of Formula I.
- a reagent such as an ester (R 4 CO 2 R 4a wherein R 4aa is —C (1-6) alkyl) with or without an additive, such as TEA, in a solvent such as ACN to afford compounds of Formula I.
- Halogenated intermediates A-IV can be converted to compounds A-V via a two step sequence of 1) vinylation with a reagent such as potassium trifluoro(vinyl)boranide, and a catalyst such RuPhos Pd G3 in a solvent such as 1,4-dioxane, and 2) oxidative cleavage of the olefin prepared in the previous step with reagents such as K 2 OsO 4 .2H 2 O and NaIO 4 in solvents such as 1,4-dioxane and water.
- a reagent such as potassium trifluoro(vinyl)boranide
- RuPhos Pd G3 in a solvent such as 1,4-dioxane
- reagents such as K 2 OsO 4 .2H 2 O and NaIO 4 in solvents such as 1,4-dioxane and water.
- Sulfinimine formation may be achieved using a reagent such as 2-methylpropane-2-sulfinamide in the presence of CuSO 4 or Cs 2 CO 3 in a solvent such as DCM to afford compounds A-VI.
- a reagent such as 2-methylpropane-2-sulfinamide
- CuSO 4 or Cs 2 CO 3 in a solvent such as DCM
- suitable nucleophiles such as R 2 M where M is Li, MgCl, or MgBr
- sulfinimines A-VI then affords the corresponding sulfinamines (structure not shown) that upon deprotection of the sulfinamine with a reagent such as HCl in a solvent such as 1,4-dioxane then affords amines A-I.
- Ureas A-VII may be prepared by several methods, two of such methods are described in Scheme 3.
- Method 1 Aldehydes A-V can be treated with diamines such as 2,2-difluoropropane-1,3-diamine dihydrochloride under reductive amination conditions such as NaCNBH 3 in a solvent such as methanol in the presence of additives such as acetic acid, followed by treatment with a reagent such as triphosgene or CDI in a solvent such as DCM or THE to afford the corresponding cyclic ureas A-VII.
- diamines such as 2,2-difluoropropane-1,3-diamine dihydrochloride under reductive amination conditions such as NaCNBH 3 in a solvent such as methanol in the presence of additives such as acetic acid
- a reagent such as triphosgene or CDI in a solvent such as DCM or THE to afford the corresponding cyclic ureas A-VII.
- Method 2 In a two-step method, aldehydes A-V are subjected to reductive animation conditions with a mono-protected diamine, such as tert-butyl (S)-(1-aminopropan-2-yl)carbamate, using NaCNBH 3 in a solvent such as methanol in the presence of additives such as acetic acid.
- a mono-protected diamine such as tert-butyl (S)-(1-aminopropan-2-yl)carbamate
- NaCNBH 3 a mono-protected diamine
- a solvent such as methanol
- additives such as acetic acid
- the adduct formed in the first step is treated with reagents such as potassium tert-pentoxide in solvents such as tert-amyl alcohol to afford ureas A-VII.
- Compounds A-VII can be converted to compounds of Formula I using the methods described in Scheme 1 for the conversion of compounds
- Intermediates A-III may also be prepared as shown in Scheme 4.
- sulfinimides A-VIII with diethyl 1,4-dihydro-2,6-dimethyl-3,5-pyridinedicarboxylate and an appropriate radical precursor such as 1,3-dioxoisoindolin-2-yl 2-cyclopropoxypropanoate in a solvent such as DMSO in the presence of an amine base such as DIPEA, with 450 nm light affords the corresponding sulfinamides (structure not shown).
- a reagent such as HCl in a solvent such as 1,4-dioxane then affords amines A-III.
- Amines A-IIIa may be prepared as shown in Scheme 5.
- a reagent such as CuSO 4 and a solvent such as DCM
- a reagent such as CuSO 4 and a solvent such as DCM
- a reagent such as CuSO 4
- a solvent such as DCM
- a reagent such as CuSO 4
- a solvent such as DCM
- a reagent such as 3-[1-(trifluoromethyl)cyclopropyl]propanoic acid and a base, such as LDA in a solvent, such as THE affords compounds B-II.
- Compounds B-II can be converted to compounds B-III by a two-step process.
- compounds B-II are treated with N-hydroxyphthalimide in the presence of a reagent such as DCC, with an additive, such as DMAP, in a solvent, such as DCM.
- the second step of this process is reduction of the dioxoisoindoline substituent using a reagent, such as Hantzsch ester, in the presence of a base, such as DIPEA, in a solvent, such as DMSO.
- a reagent such as Hantzsch ester
- Step A 2-Fluoro-2-methylmalonamide. Diethyl 2-fluoromalonate (2.00 g, 11.2 mmol) and anhydrous THE (40 mL) were added in one portion to a nitrogen-purged 250 mL three-neck round-bottomed flask, which was charged with t-BuOK (13.5 mL, 13.5 mmol, 1 M in THF) and the resulting mixture stirred for 0.5 h at rt. The mixture was treated with Mel (0.840 mL, 13.5 mmol), via syringe over 1 min and the resulting mixture stirred for another 1 h at rt.
- Step B 2-Fluoro-2-methylpropane-1,3-diamine dihydrochloride.
- 2-Fluoro-2-methylmalonamide 1.2 g, 9.0 mmol, Step A
- THE 15 mL
- the mixture was treated with BH 3 .THF (45 mL, 45 mmol) dropwise via constant pressure dropping funnel over 10 min.
- the reaction mixture was stirred for 3 h at 50° C. before treating with MeOH (5.0 mL), portion-wise over 5 min.
- Step A tert-Butyl ((S)-(7-((R)-cyclopropyl((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step B tert-Butyl ((S)-(7-((R)-((3-amino-2,2-difluoropropyl)amino)(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step C tert-Butyl ((S)-(7-((R)-cyclopropyl(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step D 1-((R)-(2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)(cyclopropyl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one.
- Step A tert-Butyl ((S)-(7-((S)-1-(((R)-tert-butylsulfinyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- N 2 flushed flask was added tributyl(methoxymethyl)stannane (1.41 g, 4.22 mmol) and THE (20.1 mL).
- reaction mixture Upon stirring at ⁇ 78° C. for an additional 2 h, the reaction mixture was quenched with EtOH (0.35 mL), allowed to warm to rt, and diluted with saturated aqueous NaHCO 3 and EtOAc. The layers were separated and the aqueous layer was further extracted with EtOAc. The combined organic layers were dried over anhydrous Na 2 SO 4 , filtered, and concentrated to dryness. The residue was purified by silica gel chromatography (40-100% acetone/hexanes) to give the title compound (39% yield) as the second eluting isomer.
- Step B tert-Butyl ((S)-(7-((S)-1-amino-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step C tert-Butyl ((S)-(4,4-difluorocyclohexyl)(7-((S)-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate.
- Step A The title compound was prepared as described for the synthesis of Intermediate 2, Step A, using tert-butyl ((S)-(7-((S)-1-amino-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step B) in place of tert-butyl ((S)-(7-((R)-amino(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate to afford the title compound (84% yield).
- Step D tert-Butyl ((S)-(7-((S)-1-((3-amino-2,2-difluoropropyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step B The title compound was prepared as described for the synthesis of Intermediate 2, Step B, using tert-butyl ((S)-(4,4-difluorocyclohexyl)(7-((S)-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate (Step C) in place of tert-butyl ((S)-(7-((R)-cyclopropyl((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate to afford the title compound (86% yield).
- Step E tert-Butyl ((S)-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step F 1-((S)-1-(2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one.
- Step D The title compound was prepared as described for the synthesis of Intermediate 2, Step D, using tert-butyl ((S)-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step E) in place of tert-butyl ((S)-(7-((R)-cyclopropyl(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate and adding DCM (2 mL) as a co-solvent to afford the title compound that was used without further purification
- the reaction was stirred at rt for 3 h then filtered through diatomaceous earth (e.g., Celite®). The filter cake was washed with EtOAc and then the filtrate was concentrated under reduced pressure. The residue was purified by silica gel chromatography (10-100% EtOAc/hexanes) to provide the title compound in 69% yield.
- diatomaceous earth e.g., Celite®
- Step A tert-Butyl ((R)-1-(7-((S*)-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate.
- reaction mixture was heated at 50° C. for 36 h.
- the reaction mixture was then cooled to rt, concentrated under reduced pressure, and diluted with H 2 O.
- the mixture was extracted twice with EtOAc then the combined organic extracts were washed with saturated aqueous NH 4 Cl and brine, dried over anhydrous Na 2 SO 4 , filtered and concentrated under reduced pressure to afford the title compound that was used without further purification.
- Step B tert-Butyl ((R)-1-(7-((S*)-1-((3-amino-2,2-difluoropropyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate.
- Step C tert-Butyl ((R)-1-(7-((S*)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate.
- Step A tert-Butyl ((S)-(7-((S)-2-cyclopropoxy-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)ethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step B tert-Butyl ((S)-(7-((S)-1-((3-amino-2,2-difluoropropyl)amino)-2-cyclopropoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step C tert-Butyl ((S)-(7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step A tert-Butyl (S)-((7-(((3-amino-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step B tert-Butyl (S)-((7-((5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- reaction mixture was diluted with brine (20 mL) and the layers were separated. The organic layer was washed with aqueous 0.1 M HCl (2 ⁇ 10 mL) and brine (2 ⁇ 10 mL), dried over anhydrous MgSO 4 , filtered and concentrated to a gum that was used directly in the next step without further purification.
- Step C (S)-1-((2-(Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one.
- reaction mixture was concentrated to dryness, and then diluted with EtOAc (20 mL), brine (30 mL), aqueous 3 M sodium hydroxide (5 mL), and saturated aqueous sodium bicarbonate (3 mL). The layers were separated, and the aqueous layer was extracted with EtOAc (2 ⁇ 20 mL) and DCM (6 ⁇ 15 mL).
- Step A tert-Butyl ((1S)-(7-(((3-((tert-butoxycarbonyl)amino)-2-methylpropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- the title compound was synthesized in a manner analogous to Intermediate 20 Step A using tert-butyl (3-amino-2-methylpropyl)carbamate) in place of 2,2-difluoropropane-1,3-diamine dihydrochloride.
- Step B tert-Butyl ((1S)-(4,4-difluorocyclohexyl)(7-((5-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate.
- reaction mixture was cooled to rt, treated with aqueous 1 M HCl (5 mL), and diluted with EtOAc (30 mL), brine (30 mL) and saturated aqueous NaHCO 3 (30 mL). The layers were separated, and the aqueous layer was extracted with EtOAc (3 ⁇ 20 mL). The combined organics were dried over anhydrous Na 2 SO 4 , filtered, and concentrated to dryness to give an oil that was used in the next step without further purification.
- Step C 1-((2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5-methyltetrahydropyrimidin-2(1H)-one.
- Step A tert-Butyl (S)-((7-(((4-aminobutyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- the title compound was synthesized in a manner analogous to Intermediate 20 Step A using 1,4-diaminobutane in place of 2,2-difluoropropane-1,3-diamine dihydrochloride.
- Step B tert-Butyl (S)-((4,4-difluorocyclohexyl)(7-((2-oxo-1,3-diazepan-1-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate.
- Step C (S)-1-((2-(Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-1,3-diazepan-2-one.
- Step A tert-Butyl (S)-((7-(((3-amino-2,2-dimethylpropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- the title compound was synthesized in a manner analogous to Intermediate 20 Step A using 2,2-dimethylpropane-1,3-diamine in place of 2,2-difluoropropane-1,3-diamine dihydrochloride.
- Step B tert-Butyl (S)-((4,4-difluorocyclohexyl)(7-((5,5-dimethyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate.
- Step C (S)-1-((2-(Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-dimethyltetrahydropyrimidin-2(1H)-one.
- Step A tert-Butyl (S)-((7-(((3-aminopropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- the title compound was synthesized in a manner analogous to Intermediate 20 Step A using 1,3-diaminopropane in place of 2,2-difluoropropane-1,3-diamine dihydrochloride.
- Step B tert-Butyl (S)-((4,4-difluorocyclohexyl)(7-((2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate.
- Step C (S)-1-((2-(Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one.
- Step A Tributyl(ethoxymethyl)stannane.
- the title compound was prepared as described for the synthesis of Intermediate 12, using ethanol in place of cyclopropanol in 86% yield.
- Step B tert-Butyl ((S)-(7-((S*)-1-(((R)-tert-butylsulfinyl)amino)-2-ethoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- the title compound was prepared in a manner analogous to the synthesis of Intermediate 13, using tributyl(ethoxymethyl)stannane (Step A) in place of tributyl(cyclopropoxymethyl)stannane in 56% yield.
- Step C tert-Butyl ((S)-(7-((S*)-1-amino-2-ethoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step D tert-Butyl ((S)-(7-((S*)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-ethoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step E 1-((S*)-1-(2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-ethoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride.
- Step A 1-Isopropyl-1H-pyrazole-5-carbonyl chloride.
- a round bottom flask was charged with 1-isopropyl-1H-pyrazole-5-carboxylic acid (1 g, 6.5 mmol) and DCM (13 mL) and was cooled to 0° C. under a nitrogen atmosphere.
- To the solution was added oxalyl chloride (1.1 mL, 13.0 mmol) followed by DMF (0.05 mL, 0.65 mmol) dropwise. The reaction was stirred as it slowly warmed to rt. Once the gas evolution ceased the reaction was concentrated under reduced pressure into a yellow oil that was then dissolved in 12 mL of dry DCM and stored as a 2 M solution.
- Step B 2,5-Dioxopyrrolidin-1-yl 1-isopropyl-1H-pyrazole-5-carboxylate.
- a round bottom flask was charged with N-hydroxysuccinimide (1.1 g, 9.7 mmol), DCM (25 mL), and DIPEA (16 mL, 6.5 mmol), and cooled to 0° C. under a nitrogen atmosphere.
- To the solution was added a solution of 1-isopropyl-1H-pyrazole-5-carbonyl chloride (13 mL, 6.5 mmol, 2 M in DCM, Step A). The solution was allowed to warm to rt as it stirred for 1 h.
- Step A N-benzyl-2,2-difluoro-3,3-d 2 -3-hydroxypropanamide.
- a flask was charged with methyl 3-(benzylamino)-2,2-difluoro-3-oxopropanoate (2 g, 8.2 mmol), MeOH (42 mL), and cooled to 0° C.
- sodium borodeuteride 860 mg, 20.6 mmol portionwise.
- the reaction was stirred for an hour at 0° C. then quenched by the addition of water (15 mL).
- the reaction was concentrated to remove the MeOH.
- the resulting solution was further diluted with water and extracted with ethyl acetate (3 ⁇ 50 mL). The combined organics were washed with brine, dried over anhydrous MgSO4, filtered and concentrated to yield N-benzyl-2,2-difluoro-3,3-d 2 -3-hydroxypropanamide:
- Step B 3-(Benzylamino)-2,2-difluoropropan-1,1,3,3-d 4 -1-ol.
- a flask was charged with N-Benzyl-2,2-difluoro-3,3-d 2 -3-hydroxypropanamide (7.7 g, 35.5 mmol, Step A), and THE (230 mL).
- boron trifluoride diethyletherate (18.8 mL, 46.5 wt %, 70.9 mmol) portionwise.
- the reaction mixture was then heated to reflux and stirred for 1 h.
- the reaction mixture was cooled to room temperature and quenched by the careful addition of MeOH (50 mL).
- the resulting mixture was stirred for 30 minutes then concentrated to dryness. Ethyl acetate was added to the resulting white solid and the remaining solids were removed by filtration. The filtrate was concentrated to yield the title compound, which was used without further purification.
- Step C 3-Amino-2,2-difluoropropan-1,1,3,3-d 4 -1-ol.
- a flask was charged with a 3-(benzylamino)-2,2-difluoropropan-1,1,3,3-d 4 -1-ol (7.1 g, 34.3 mmol, Step B), MeOH (690 mL), Pd/C (3.7 g, 3.4 mmol, 10 wt % Pd), and ammonium formate (21.7 g, 343.9 mmol).
- the reaction was warmed to 60° C. and stirred for 3 h.
- the reaction was cooled to room temperature, filtered through a pad of diatomaceous earth (e.g., Celite®), and the solids were washed with ethyl acetate. The combined organic layers were concentrated to an off white solid that was used directly in the next step.
- diatomaceous earth e.g., Celite®
- Step D 2-(2,2-Difluoro-3-hydroxypropyl-1,1,3,3-d 4 )isoindoline-1,3-dione.
- a flask was charged with 3-amino-2,2-difluoropropan-1,1,3,3-d 4 -1-ol (3.6 g, 34.4 mmol, Step C), N-carbethoxyphthalimide (8.7 g, 39.6 mmol), THE (86 mL), and DIPEA (23.7 mL, 137 mmol).
- the reaction mixture was then heated to 60° C. for 12 h.
- the reaction mixture was cooled to room temperature, and concentrated to dryness. Water (250 mL) was added to the resulting residue and stirred for 30 min during which time a solid formed.
- the solid was collected by filtration, dried overnight under reduced pressure to yield the title compound as a white powder (59% yield over steps B, C and D).
- Step E 3-(1,3-Dioxoisoindolin-2-yl)-2,2-difluoropropyl-1,1,3,3-d 4 trifluoromethanesulfonate.
- a flask was charged with, 2-(2,2-difluoro-3-hydroxypropyl-1,1,3,3-d 4 )isoindoline-1,3-dione (1.5 g, 5.9 mmol, Step D), DCM (20 mL), and pyridine (0.53 mL, 6.6 mmol), and trifluoromethanesulfonic anhydride (1.1 mL, 6.3 mmol) was added dropwise.
- Step A tert-Butyl ((R)-1-(6-chloro-7-((S)-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl-1,1,3,3-d 4 )amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate.
- the resulting reaction mixture was stirred at 60° C. for 48 h.
- the reaction was cooled to rt and partitioned between water and ethyl acetate.
- the aqueous layer was further extracted with ethyl acetate (2 ⁇ ).
- the combined organic layers were washed with brine, dried over anhydrous MgSO 4 , filtered, concentrated, and purified by silica gel chromatography (0-100% ethyl acetate (w/10% MeOH): hexanes) to afford the title compound as a white solid (71%).
- Step B tert-Butyl ((R)-1-(7-((S)-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl-1,1,3,3-d 4 )amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate.
- the vial was warmed to 90° C., stirred for 1 h, then cooled to rt.
- the reaction mixture was filtered through a pad of diatomaceous earth (e.g., Celite®), and the solids were washed with ethanol.
- the combined organic layers were concentrated to yield the title compound as a yellow solid (100%).
- Step C tert-Butyl ((R)-1-(7-((S)-1-((3-amino-2,2-difluoropropyl-1,1,3,3-d 4 )amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate.
- the reaction was stirred at rt for 2 h.
- the reaction was then partitioned between water and ethyl acetate, the layers were separated, and the aqueous layer was further extracted with ethyl acetate (2 ⁇ ).
- the combined organic layers were washed with brine, dried over anhydrous MgSO 4 , filtered, and concentrated to a glassy solid (71%).
- Step D tert-Butyl ((R)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl-4,4,6,6-d 4 )-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate.
- the reaction was cooled to rt and partitioned between water and ethyl acetate. The layers were separated, and the aqueous phase was further extracted with ethyl acetate (2 ⁇ ). The combined organic layers were washed with brine, dried over anhydrous MgSO 4 , filtered, concentrated, and purified by silica gel chromatography (0-100% ethyl acetate (w/10% MeOH): hexanes) to afford the title compound as a glassy solid (45%).
- Step E 1-((S)-1-(2-((R)-1-Amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d 4 .
- Step A 4-Cyclopropyl-1,2,5-oxadiazole-3-carbonyl chloride.
- a flask was charged with 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid (200 mg, 1.3 mmol) and DCM (2.5 mL), and cooled to 0° C. Then, oxalyl chloride (0.22 mL, 2.6 mmol) and one drop of DMF were added. The resulting mixture was stirred for 1 h as it warmed to rt. The mixture was concentrated to a yellow oil and was used without further purification.
- Step B 2,5-Dioxopyrrolidin-1-yl 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylate.
- the residue from Step A was dissolved in DCM (3.2 mL) and cooled to 0° C. To the solution was added N-hydroxysuccinimide (231 mg, 1.9 mmol), and DIPEA (0.34 mL, 1.9 mmol). The reaction was stirred for 1 h as it warmed to rt. The reaction was quenched by the addition of water (3 mL), the layers were separated. The organic layer was washed with brine, dried over anhydrous MgSO 4 , filtered and concentrated to dryness. This material was purified by silica gel chromatography (0-100% ethyl acetate (with 10% MeOH)/hexanes) to afford the title compound as a clear oil (40% yield).
- Step A N-(6-Chloropyridazin-3-yl)pivalamide.
- 6-chloropyridazin-3-amine 350 g, 2.70 mol
- pyridine 427 g, 5.40 mol
- DCM 5000 mL
- 2,2-dimethylpropanoyl chloride 814 g, 6.75 mol
- the resulting mixture was stirred for 2 h at rt under a nitrogen atmosphere.
- the mixture was basified to pH 7 ⁇ 8 using saturated aqueous NaHCO 3 (aq.) and the resulting mixture was extracted with DCM (3 ⁇ 3 L).
- Step B N-(6-Chloro-5-iodopyridazin-3-yl)pivalamide.
- TMPMgCl.LiCl 6.8 L, 6.8 mol
- N-(6-chloropyridazin-3-yl)pivalamide 560 g, 2.62 mol, Step A) in THE (5.0 L) dropwise at ⁇ 60° C. under nitrogen atmosphere.
- the resulting mixture was stirred for 2.5 h at ⁇ 55° C. under nitrogen atmosphere, then iodine (998 g, 3.93 mol) in THE (3.0 L) dropwise at ⁇ 60° C.
- the resulting mixture was stirred for an additional 1 h at ⁇ 55° C.
- Step C N-(6-Chloro-5-formylpyridazin-3-yl)pivalamide.
- N-(6-chloro-5-iodopyridazin-3-yl)pivalamide 607 g, 1.79 mol, Step B) in THE (6.0 L) was added a 60% dispersion of NaH in mineral oil (93.0 g, 2.32 mol) in portions at 0° C. under nitrogen atmosphere.
- the resulting mixture was stirred for 30 min at rt under a nitrogen atmosphere and isopropylmagnesium chloride lithium chloride complex (1.99 L, 2.59 mol) was added dropwise at ⁇ 60° C.
- Step D (R,E)-N-(5-(((tert-Butylsulfinyl)imino)methyl)-6-chloropyridazin-3-yl)pivalamide.
- N-(6-chloro-5-formylpyridazin-3-yl)pivalamide (372 g, 1.54 mol, Step C) and (R)-2-methylpropane-2-sulfinamide (243 g, 2.00 mol) in DCM (2.20 L) was added potassium bisulfate (272 g, 2.00 mol) in portions at rt. The resulting mixture was stirred overnight at rt and then quenched with water (2 L) at rt.
- MOMBr (22.1 g, 177 mmol) in toluene (30 mL) was then added dropwise at rt and stirred for an additional 20 min. The reaction mixture was then cooled to ⁇ 15° C. followed by the addition of more MOMBr (200 g, 1.60 mol) in toluene (270 mL) dropwise and the resulting mixture was stirred for 40 min at ⁇ 15° C. To the mixture was added LiCl (74.0 g, 1.74 mol) in portions and the resulting mixture was stirred for 30 min at ⁇ 15° C.
- the product was purified by silica gel chromatography (0-80% EtOAc/petroleum ether), preparative HPLC (Xtimate C18, 10 ⁇ m, 40 ⁇ 150 mm, 35-65% MeCN/water (0.05% aqueous NH 3 with 10 mM NH 4 HCO 3 )), and chiral SFC (DAICEL CHIRALPAK AD, 10 ⁇ m, 30 ⁇ 250 mm, 10% EtOH (with 0.1% aqueous ammonia)/CO 2 ) to afford the title compound as the second eluting fraction in 6% yield.
- Step A (S)—N-(5-(1-Amino-2-methoxyethyl)-6-chloropyridazin-3-yl)pivalamide.
- N-(5-((S)-1-(((R)-tert-butylsulfinyl)amino)-2-methoxyethyl)-6-chloropyridazin-3-yl)pivalamide (Intermediate 33, 8.00 g, 20.5 mmol) in EtOAc (102 mL) at room temperature was added a solution of HCl in 1,4-dioxane (4 M, 20.5 mL, 81.9 mmol).
- the reaction mixture was diluted with hexanes (150 mL) and water (200 mL). The layers were separated, and the organic layer was extracted with aqueous HCl (0.05 M, 2 ⁇ 50 mL). The combined aqueous layers were diluted with EtOAc (50 mL) and brought to pH 11 with aqueous 3 M NaOH. The layers were separated, and the aqueous layers were extracted with EtOAc (4 ⁇ 50 mL). The combined organic layers were dried over anhydrous Na 2 SO 4 and concentrated to give the title compound as a solid (>99% yield, heavy with trace EtOAc), which was used without further purification.
- Step B (S)—N-(6-Chloro-5-(1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)-2-methoxyethyl)pyridazin-3-yl)pivalamide.
- Step C (S)-2-(3-((1-(6-Amino-3-chloropyridazin-4-yl)-2-methoxyethyl)amino)-2,2-difluoropropyl)isoindoline-1,3-dione.
- the reaction mixture was cooled to rt, diluted with EtOAc (80 mL) and water (80 mL), cooled to 0° C. and treated with NaHCO 3 (40 g) in a portion wise manner with stirring (gas evolution).
- the reaction mixture was diluted with saturated aqueous NaHCO 3 (100 mL), and the layers were separated.
- the aqueous layer was extracted with EtOAc (4 ⁇ 100 mL), and the combined organic layers were dried over anhydrous Na 2 SO 4 and concentrated to give the title compound as a solid (>99% yield, heavy with trace EtOAc), which was used without further purification.
- Step D (S)—N 1 -(1-(6-Amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-2,2-difluoropropane-1,3-diamine.
- Step E (S)-1-(1-(6-Amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one.
- reaction mixture was cooled to rt, evaporated to dryness, and purified by reverse phase basic HPLC (X-Bridge Prep C18 5 ⁇ m column 50 ⁇ 250 mm, 5-100% acetonitrile/water (with 20 nM NH 4 OH).
- reverse phase basic HPLC X-Bridge Prep C18 5 ⁇ m column 50 ⁇ 250 mm, 5-100% acetonitrile/water (with 20 nM NH 4 OH).
- the product containing fractions were lyophilized to give the title compound (71% yield) as a white solid.
- Step A (S)—N-(5-(1-Amino-2-cyclopropoxyethyl)-6-chloropyridazin-3-yl)pivalamide.
- the title compound was synthesized in a manner analogous to Intermediate 35 Step A using N-(5-((S)-1-(((R)-tert-butylsulfinyl)amino)-2-cyclopropoxyethyl)-6-chloropyridazin-3-yl)pivalamide (Intermediate 34) in place of N-(5-((S)-1-(((R)-tert-butylsulfinyl)amino)-2-methoxyethyl)-6-chloropyridazin-3-yl)pivalamide (99% yield) that was used without further purification.
- Step B (S)—N-(6-Chloro-5-(2-cyclopropoxy-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)ethyl)pyridazin-3-yl)pivalamide.
- Step C (S)-2-(3-((1-(6-Amino-3-chloropyridazin-4-yl)-2-cyclopropoxyethyl)amino)-2,2-difluoropropyl)isoindoline-1,3-dione.
- Step D (S)—N 1 -(1-(6-Amino-3-chloropyridazin-4-yl)-2-cyclopropoxyethyl)-2,2-difluoropropane-1,3-diamine.
- Step E (S)-1-(1-(6-Amino-3-chloropyridazin-4-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one.
- Step A (R)-2-(((R)-1,1,1-Trifluoropropan-2-yl)oxy)propanoic acid.
- Sodium hydride (3.5 g, 88 mmol, 60% dispersion in mineral oil) was added in portions to a solution of (R)-1,1,1-trifluoropropan-2-ol (5.0 g, 44 mmol) in DMF (70 mL) at 0° C.
- the resultant mixture was stirred for 30 min at rt before recooling to 0° C.
- a separate solution of (S)-2-bromopropanoic acid (6.0 g, 40 mmol) in DMF (5 mL) was added at 0° C.
- Step B (R)—N-Methoxy-N-methyl-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propanamide.
- a round-bottom flask was charged with (R)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propanoic acid (7.6 g, 41 mmol, Step A), DMF (70 mL), HATU (20 g, 53 mmol), and DIPEA (18 mL, 102 mmol). The mixture was stirred for 5 min before the addition of N,O-dimethylhydroxylamine hydrochloride (6.0 g, 61 mmol).
- Step C (R)-2-(((R)-1,1,1-Trifluoropropan-2-yl)oxy)propanal.
- a round-bottom flask was charged with (R)—N-methoxy-N-methyl-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propanamide (5.4 g, 24 mmol, Step B) and THE (300 mL), cooled to ⁇ 78° C. and LAH (4.5 g, 120 mmol) was added portion wise. The resulting mixture was stirred for about 1 h at ⁇ 78° C. and was subsequently quenched with water (20 mL) dropwise at ⁇ 78° C.
- Step D (S)-2-Methyl-N—((R,E)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propylidene)propane-2-sulfinamide.
- a round-bottom flask was charged with (R)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propanal (7.4 g, 44 mmol, Step C), THE (250 mL), CuSO 4 (28 g, 174 mmol), (S)-2-methylpropane-2-sulfinamide (7.9 g, 65 mmol), and PPTS (2.2 g, 8.7 mmol), and the resulting mixture was stirred at 30° C.
- Step E (S)—N-((1R,2R)-1-Cyano-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)-2-methylpropane-2-sulfinamide.
- Step F O—((R)-1,1,1-Trifluoropropan-2-yl)-L-threonine hydrogen chloride.
- Step G N-(tert-Butoxycarbonyl)-O—((R)-1,1,1-trifluoropropan-2-yl)-L-threonine.
- a round bottom flask was charged with O—((R)-1,1,1-trifluoropropan-2-yl)-L-threonine hydrogen chloride (7.3 g, 25 mmol, Step F), THE (100 mL), and 1 M aqueous NaOH (101 mL) and allowed to stir at rt for 0.5 h.
- Boc 2 O 5.5 g, 25 mmol
- reaction mixture was poured into water (100 mL) and the biphasic mixture was extracted with EtOAc (3 ⁇ 100 mL). The aqueous layer was then acidified with citric acid to pH 3-4. The acidic aqueous layer was then extracted with EtOAc (3 ⁇ 100 mL) and the combined organic layers were washed with brine, dried over anhydrous MgSO 4 , filtered, and concentrated under reduced pressure to afford the title compound in 88% yield, which was used without further purification.
- Step H tert-Butyl ((3S,4R)-1-(dimethyl(oxo)- ⁇ 6 -sulfaneylidene)-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate.
- Step A (R)—(((S)-1,1,1-Trifluoropropan-2-yl)oxy)propanoic acid.
- the title compound was synthesized in a manner analogous to Intermediate 37 Step A using (S)-1,1,1-trifluoropropan-2-ol in place of (R)-1,1,1-trifluoropropan-2-ol in 80% yield.
- Step B (R)—N-Methoxy-N-methyl-2-(((S)-1,1,1-trifluoropropan-2-yl)oxy)propanamide.
- the title compound was synthesized in a manner analogous to Intermediate 37 Step B using (R)—(((S)-1,1,1-trifluoropropan-2-yl)oxy)propanoic acid (Step A) in place of (R)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propanoic acid in 46% yield.
- Step C (R)-2-(((S)-1,1,1-Trifluoropropan-2-yl)oxy)propanal.
- the title compound was synthesized in a manner analogous to Intermediate 37 Step C using (R)—N-methoxy-N-methyl-2-(((S)-1,1,1-trifluoropropan-2-yl)oxy)propanamide (Step B) in place of (R)—N-methoxy-N-methyl-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propanamide in 80% yield.
- Step D (S)-2-Methyl-N—((R,E)-2-(((S)-1,1,1-trifluoropropan-2-yl)oxy)propylidene)propane-2-sulfinamide.
- the title compound was synthesized in a manner analogous to Intermediate 37 Step D using (R)-2-(((S)-1,1,1-trifluoropropan-2-yl)oxy)propanal (Step C) in place of (R)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propanal in 55% yield.
- Step E (S)—N-((1R,2R)-1-Cyano-2-(((S)-1,1,1-trifluoropropan-2-yl)oxy)propyl)-2-methylpropane-2-sulfinamide.
- Step F O—((S)-1,1,1-Trifluoropropan-2-yl)-L-threonine hydrogen chloride.
- the title compound was synthesized in a manner analogous to Intermediate 37 Step F using (S)—N-((1R,2R)-1-cyano-2-(((S)-1,1,1-trifluoropropan-2-yl)oxy)propyl)-2-methylpropane-2-sulfinamide (Step E) in place of (S)—N-((1R,2R)-1-cyano-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)-2-methylpropane-2-sulfinamide assuming 100% yield.
- Step G N-(tert-Butoxycarbonyl)-O—((S)-1,1,1-trifluoropropan-2-yl)-L-threonine.
- the title compound was synthesized in a manner analogous to Intermediate 37 Step G using O—((S)-1,1,1-trifluoropropan-2-yl)-L-threonine hydrogen chloride (Step F) in place of O—((R)-1,1,1-trifluoropropan-2-yl)-L-threonine hydrogen chloride and was used without further purification.
- Step H tert-Butyl ((3S,4R)-1-(dimethyl(oxo)- ⁇ 6 -sulfaneylidene)-2-oxo-4-(((S)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate.
- the product was purified by silica gel chromatography (0-100% EtOAc/petroleum ether) and chiral SFC (DAICEL CHRALPAK AD, 10 ⁇ m, 50 ⁇ 250 mm, 15% EtOH (with 0.1% of 25% aqueous NH 3 )/CO 2 ) to afford the title compound as the first eluting fraction in 19% yield.
- Step A tert-Butyl ((3S,4R)-1-chloro-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate.
- Step B tert-Butyl ((3S,4R)-1-iodo-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate.
- a mixture of tert-butyl ((3S,4R)-1-chloro-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate (354 mg, 1.02 mmol, Step A) and NaI (1.53 g, 10.2 mmol) in acetone was stirred at rt for 1 h then diluted with EtOAc and filtered. The filtrate was washed with saturated aqueous sodium thiosulfate then dried over anhydrous Na 2 SO 4 , filtered, and concentrated to afford the title compound that was used without further purification.
- Step A tert-Butyl ((3S,4R)-1-chloro-2-oxo-4-(((S)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate.
- Step B tert-Butyl ((3S,4R)-1-iodo-2-oxo-4-(((S)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Medicinal Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Rheumatology (AREA)
- Immunology (AREA)
- Pain & Pain Management (AREA)
- Physical Education & Sports Medicine (AREA)
- Dermatology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Epidemiology (AREA)
- Pulmonology (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Plural Heterocyclic Compounds (AREA)
- Hospice & Palliative Care (AREA)
- Psychiatry (AREA)
Abstract
Description
- This application claims the benefit of U.S. Provisional Application 63/248,566, filed on Sep. 27, 2021, U.S. Provisional Application 63/273,422, filed on Oct. 29, 2021, and U.S. Provisional Application 63/367,546, filed on Jul. 1, 2022.
- This application contains a sequence listing, which is submitted electronically as an ST.26 XML formatted sequence listing with a file name “PRD4156WOPCT1_SL”, creation date of Jul. 1, 2022 and having a size of 3 KB. The sequence listing submitted is part of the specification and is herein incorporated by reference in its entirety.
- Disclosed herein are imidazopyridazine compounds, and pharmaceutical compositions thereof, which modulate Interleukin-17A. Also disclosed herein is the therapeutic use of such compounds, for example, in treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease.
- Interleukin-17 (“IL-17”), also known as IL-17A and CTLA-8, is produced mainly by CD4+ Th17 cells, and also by other immune cells such as CD8+ T cells, γδ T cells, NK cells, NKT cells, and innate lymphoid cells (ILCs). IL-17A exists as a homodimer (A/A) or as a heterodimer (A/F) with IL-17F and signals through binding to dimeric receptor complex IL-17RA and IL-17RC. IL-17RA is ubiquitously expressed at particularly high levels by haematopoietic cell types, whereas IL-17RC is preferentially expressed by non-haematopoietic cells (Gaffen, S. Structure and signaling in the IL-17 receptor family. Nat. Rev. Immunol. 2009, 9, 556-567). IL-17A/IL-17R signaling induces de novo gene transcription by triggering NF-kB, C/EBP and MAPK pathways through ACT1-TRAF6-TRAF4. It can also stabilize target mRNA transcripts through the ACT1-TRAF2-TRAF5 complex (Amatya N. et al., Trends in Immunology, 2017, 38, 310-322). IL-17A stimulates the release of inflammatory mediators including IL-6, IL-8, G-CSF, TNF-α, and IL-1β that recruit and activate lymphocytes to the site of injury or inflammation and maintain a proinflammatory state.
- As discussed below, preclinical and clinical data have demonstrated the significant pathological role of IL-17A in multiple autoimmune and inflammatory diseases.
- For psoriasis: IL-17A mRNA and/or protein levels are elevated in the lesional skin and blood of patients with psoriasis and correlate with disease severity. IL-17A acts directly in synergy with other cytokines (such as TNFα, IFNγ or IL-22) on keratinocytes triggering a self-amplifying inflammatory response in the skin and leading to the formation of psoriatic plaques. The blockade of IL-17A by means of antibodies to IL-17A or IL-23 results in complete reversal of the molecular and clinical disease features in majority of psoriasis patients, manifesting the significant role of IL-17A and IL-17-producing T-cells in the immunopathogenesis of psoriasis. (Hawkes et al., Psoriasis Pathogenesis and the Development of Novel, Targeted Immune Therapies. J Allergy Clin Immunol. 2017, 140(3): 645-653). The development and approval of IL-17 monoclonal antibodies such as secukinumab, ixekizumab, and brodalumab and their transformational efficacy for psoriasis have demonstrated IL-17A as a valid target for psoriasis treatments. (Blauvelt A. and Chiricozzi A. The Immunologic Role of IL-17 in Psoriasis and Psoriatic Arthritis Pathogenesis. Clin Rev Allergy Immunol. 2018, 55(3):379-390).
- For psoriatic arthritis (PsA): IL-17A is mechanistically relevant to PsA through NFκB activation that triggers transcription of several PsA related genes including the receptor activator of nuclear factor KB ligand (RANKL). RANKL triggers the differentiation of osteoclast precursor cells into activated osteoclasts, resulting in bone resorption and subsequently joint deformity in PsA (Adamopoulos I. and Mellins E. Nature reviews Rheumatology 2015; 11:189-94). PsA joint is enriched for IL-17+CD8+ T cells, and the levels of this T cell subset are correlated with disease activity (Menon B. et al., Arthritis & Rheumatology 2014; 66: 1272-81). Synovial fibroblasts isolated from PsA patients also contain elevated IL-17R expression and secrete increased IL-6, CXCL8 and MMP3 ex vivo compared to osteoarthritis patients. Both secukinumab and ixekizumab are FDA approval drugs for PsA. In matching-adjusted indirect comparison analysis, secukinumab was associated with higher ACR 20/50/70 response rates in patients with active PsA than anti-TNFα antibodies (Mease P. et al., Eur. J. Rheumatol. 2019 Jul. 1; 6(3):113-121; Strand V. et al., J. Comp. Eff. Res. 2019, 8(7):497-510; Nash P. et al., Rheumatol. Ther. 2018, 5(1):99-122). In a recent head-to-head study, ixekizumab was superior to adalimumab in achieving simultaneous improvement of joint and skin disease (ACR50 and PASI100) in patients with PsA and inadequate response to conventional synthetic disease-modifying antirheumatic drug (Mease, P. et al. Ann Rheum Diss 2020; 79:123-131). By hitting the same target, IL-17A small molecule inhibitor compounds may exert similar or better efficacy than biologics considering that small molecules generally have better tissue penetration.
- For rheumatoid arthritis (RA): IL-17A has been recognized as critical to the progression of rheumatoid arthritis. “The recognition of IL-17 as a pro-inflammatory T cell derived cytokine, and its abundance within rheumatoid joints, provides the strongest candidate mechanism to date through which T cells can capture and localize macrophage effector functions in rheumatoid arthritis” Stamp, L. et al., Immunol. Cell Biol. 2004, 82(1): 1-9. Moreover, in rheumatoid arthritis IL-17A acts locally on synoviocytes and osteoblasts contributing to synovitis and joint destruction. Robert and Miossec have proposed the use of synovial biopsies and/or biomarkers to precisely identify patients that would respond to IL-17A inhibition. Their work concludes that IL-17 inhibitors should now be considered in the development of precision medicine in RA. (Robert M. and Miossec P., Front. Med., 2019, 5:364).
- For Ankylosing Spondylitis (AS): Various studies have reported elevated IL-17A and Th17 and other cells producing IL-17 in AS blood samples (Wendling D. et al., Joint Bone Spine. 2007; 74:304-305; Shen H. et al., Arthritis Rheum. 2009; 60(6):1647-56; Zhang L. et al., PLoS One. 2012; 7(4):e31000; Jansen D. et al., Rheumatology (Oxford). 2015 April; 54(4): 728-735). In situ analysis of AS spine has revealed increased IL-17A-producing cells in bone of facet (zygapophyseal) joints (Appel H. et al., Arthritis Res. Ther. 2011; 13(3):R95). Two advanced IL-17A neutralizing antibodies, secukinumab, approved by FDA for AS, and ixekizumab, have demonstrated efficacy over placebo even in anti-TNF inadequate responders. In contrast, anti-IL-23 p40 and p19 biologics failed to demonstrate beneficial effect (Deodhar A. et al., Arthritis Rheumatol. 2019, 71(2):258-270; BaetenD. et al., Ann. Rheum. Dis. 2018, 77(9):1295-1302), indicating the differential underling mechanism along IL-23/IL-17 pathway in AS and providing a strong evidence to support continuing developing IL-17A inhibitors.
- For hidradenitis suppurativa (HS): Increased IL-17 and IL-17-producing T helper cells in the skin lesions of HS patients were reported and molecular proteomics and gene expression data indicate that the IL-23/Th17 pathway is upregulated in HS lesions (Schlapbach C. et al., J. Am. Acad. Dermatol. 2011; 65(4):790; Kelly G. et al., British J. Dermatol. 2015 December; 173(6):1431-9; Moran B. et al., J. Invest. Dermatol. 2017; 137(11):2389; Thomi R. et al., JAMA Dermatol. 2018; 154(5):592). Seven of nine (78%) patients with moderate-to-severe HS achieved HiSCR in an open-label pilot-trial with Secukinumab (Prussick L. et al., British J. Dermatol. 2019 September; 181(3):609-611), and more clinical trials with anti-IL-17 mAbs in HS are on-going.
- For bullous pemphigoid (BP): IL-17 is elevated in the blister fluid and perilesional skin of BP patients. (Le Jan S. et al., J. Invest. Dermatol. 2014; 134 (12):2908-2917; Chakievska L. J Autoimmun. 2019, 96:104-112). Exome sequencing of BP patients revealed mutations in twelve IL-17-related genes in one third of patients, providing the genetic link between IL-17 pathway and BP (Chakievska L. J Autoimmun. 2019, 96:104-112). In experimental murine BP, IL-17A−/− mice are protected, and anti-IL-17A treatment significantly reduced skin lesions in wild type (Chakievska L. J Autoimmun. 2019, 96:104-112). Ixekizumab Phase 2 of treatment naive and refractory BP patients is on-going (NCT03099538).
- For atopic dermatitis (AD): IL-17 was found to be elevated in peripheral blood and lesions in AD patients and Th17 cells infiltrated more markedly in acute than chronic lesions, suggesting its role in acute phase of AD (Koga C. et al., J. Invest. Dermatol. 2008, 128, 2625-2630). Molecular profile analysis from ustekinumab Phase II suggest likely contribution of IL-23/Th17/IL-17 pathway in AD (Khattri S. et al., Exp. Dermatol. 2017 January; 26(1):28-35).
- For vitiligo: Many studies in vitiligo patients have demonstrated an increased frequency of Th17 cells and higher levels of IL-17 in both circulation and lesions that positively correlates with disease duration, extent, and activity (Singh R. et al., Autoimmun. Rev 2016, April; 15(4):397-404). Mouse studies demonstrated that depigmentation correlates with greater IL-17 expression/secretion, which modulates vitiligo development (Eby J. et al., Pigment Cell & Melanoma Res. 2014, November; 27(6):1075-85).
- For multiple sclerosis (MS): IL-17 expression is increased in PBMCs, cerebrospinal fluid (CSF) as well as in brain lesions and cells from MS patients (Lock, C. et al., Nat. Med. 2002, 8: 500-508; Matusevicius, D. et al., Mult. Scler. 1999, 5: 101-104; Tzartos, J. et al., Am. J. Pathol. 2008, 172: 146-155). IL-17-producing T cells are enriched in active MS lesions (Tzartos, J. et al., Am. J. Pathol. 2008, 172: 146-155; Willing A. et al., J. Immunol. 2018, 200(3):974-982). IL-17A levels were elevated in the CSF of relapsing-remitting MS (RRMS) patients and correlated with the CSF/serum albumin quotient, a measure of blood-brain barrier (BBB) dysfunction, together with in vitro data that IL-17A in combination with IL-6 reduced the expression of tight junction-associated genes and disrupted monolayer integrity in a BBB cell line, highlighting the potential importance of targeting IL-17A in preserving BBB integrity in RRMS (Setiadi A F et al., J Neuroimmunol. 2019, 332:147-154). Secukinumab yielded promising first results in a proof-of-concept study in MS patients (Havrdovi, E. et al., J. Neurol. 2016, 263: 1287-1295).
- For Asthma: IL-17 expression is increased in the lung, sputum, bronchoalveolar lavage fluid, and sera in patients with asthma, and the severity of airway hyperresponsiveness is positively correlated with IL-17 expression levels. (Chakir J. et al., J. Allergy Clin. Immunol. 2003,111(6):1293-8). IL-17 was reported to be increased in asthmatic airways and induce human bronchial fibroblasts to produce cytokines (Molet S. et al., J. Allergy Clin. Immunol. 2001, 108(3):430-8). Anti-IL-17 antibody modulates airway responsiveness, inflammation, tissue remodeling, and oxidative stress in chronic mouse asthma models (Camargo LdN. et al., Front Immunol. 2018; 8:1835; dos Santos T. et al., Front. Physiol. 2018, 9:1183).
- For Chronic Obstructive Pulmonary Disease (COPD): An increase in Th17 cells was observed in patients with COPD compared with current smokers without COPD and healthy subjects, and inverse correlations were found between Th17 cells with lung function (Vargas-Rojas M. et al., Respir. Med. 2011 November; 105(11):1648-54). In three recent human COPD studies, gene expression profile in bronchial epithelia showed that higher IL-17 signature expression is associated with a lack of response to inhaled corticosteroid, suggesting that there is a COPD subgroup that may benefit from IL-17 inhibitor therapy (Christenson S. et al., J. Clin. Invest. 2019; 129(1):169-181).
- For Uveitis: IL-17 promotes the release of inflammatory mediators from retinal pigment epithelium cell line, disrupting the retinal pigment epithelium barrier function (Chen Y. et al., PLoS One. 2011; 6:e18139). IL-17 levels were elevated in the serum or aqueous humor of uveitis patients (El-Asrar A. et al., Clin. Immunol. 2011; 139(2):177-84; Jawad S. et al., Ocul. Immunol. Inflamm. 2013; 21(6):434-9; Kuiper J. et al., Am. J. Ophthalmol. 2011; 152(2):177-182). Anti-IL-17 antibody delayed the onset of ocular inflammation and markedly inhibited the development of experimental autoimmune uveitis in rats (Zhang R. et al., Curr. Eye Res. 2009 April; 34(4):297-303). The analysis of secondary efficacy data from subcutaneous (sc) secukinumab phase 3 trials in uveitis suggested a beneficial effect of secukinumab in reducing the use of concomitant immunosuppressive medication (Dick A. et al., Ophthalmology 2013; 120(4):777-87). Later study of intravenous secukinumab in uveitis demonstrated greater efficacy than sc dosing, suggesting requiring optimal exposure for efficacy and confirming the therapeutic potential of IL-17A inhibition (Letko E. et al., Ophthalmology 2015, 122(5), 939-948). Ustekinumab that blocks IL-23/IL-17 pathway was also reported to successfully treat a noninfectious uveitis patient who had severe concomitant psoriasis and PsA and failed to respond to conventional immune suppressants (Mugheddu C. et al., Dermatol. Ther. 2017 September; 30(5); e12527).
- For multiple myeloma (MM): IL-17A serum levels were significantly higher in MM patients and also in patients with advanced stage compared with healthy subjects (Lemancewicz D. et al., Med. Sci. Monit. 2012; 18(1): BR54-BR59). Administration of secukinumab in the SCIDhu model of human myeloma weekly for 4 weeks after the first detection of tumor in mice led to a significant inhibition of tumor growth and reduced bone damage compared to isotype control mice (Prabhala R. et al., Leukemia. 2016 February; 30(2): 379-389).
- For systemic lupus erythematosus (SLE): Increased serum or plasma levels of IL-17, expansion of IL-17-producing T cells in the peripheral blood, and infiltration of Th17 cells in target organs like the kidneys was observed in SLE patients (Wong C. et al., Lupus. 2000; 9(8):589-593; Wong C. et al., Clinical Immunology. 2008; 127(3):385-393; Zhao X-F. et al., Mol. Biol. Rep. 2010 January; 37(1):81-5; Chen X. et al., J. Clin. Immunol. 2010 March; 30(2):221-5; Xing Q. et al., Rheumatol. Int. 2012 April; 32(4):949-58). Imbalance between Th17 cells and regulatory T (Treg) cells has been observed in SLE patients including quiescent stage (Ma J. et al., Clin. Rheumatol. 2010; 29(11):1251-1258; Dolff S. et al., Clin. Immunol. 2011, 141(2):197-204). Overexpression of IL-17A using adenovirus enhanced the severity of lupus nephritis, while blockade of IL-17A using neutralizing antibody resulted in decreased severity of lupus nephritis (Wen, Z. et al., PLoS One. 2013, 8: e58161). In a phase 2 study, ustekinumab, an anti-IL-12/23 p40 monoclonal antibody blocking IL-23/IL-17 pathway, has demonstrated efficacy in SLE patients (van Vollenhoven R. et al., Lancet 2018; 392: 1330-39). Human expression studies, animal models, and clinical trials indicate that IL-17 blockade may become a promising therapeutic strategy for SLE (Koga T. et al., Expert Rev. Clin. Immunol. 2019, 15 (6) 629-637).
- In summary, animal and human studies have shown that IL-17A plays crucial role in pathogenesis of the multiple diseases and/or conditions discussed above. The significance of targeting IL-17A has been demonstrated by the transformational efficacy of injectable IL-17A neutralizing antibodies in patients.
- Despite the advances achieved with injectable IL-17A antagonist antibodies, there is a long-felt need for the development of an oral small molecule IL-17A inhibitor as it may broaden treatment options for many patients without access to biologics. In addition, a safe and efficacious small molecule IL-17A inhibitor may offer significant benefits to patients over the injectable IL-17A neutralizing antibodies such as convenient dosing regimens and cost savings, which in turn may provide effective long-term disease management.
- However, the development of an oral small molecule treatment has remained challenging. For example, no oral small molecule IL-17A inhibitor has progressed into late-stage clinical trials yet, and only two oral small molecule IL-17A inhibitors have progressed into phase I clinical trials (NCT04586920 and NCT04883333) as of Sep. 28, 2021. Additionally, as of December 2021, one of these clinical trials (NCT04586920) was suspended due to safety review. Accordingly, there is a need for new small molecule IL-17A modulators (e.g., inhibitors).
- The present application discloses a compound of Formula I:
- or a pharmaceutically acceptable salt thereof, wherein R1, R2, R3, and R4 are as defined herein.
- The present application also discloses a pharmaceutical composition comprising a compound of Formula I, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier.
- The present application also discloses a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof. In some embodiments, the IL-17A mediated inflammatory syndrome, disorder, or disease is selected from the group consisting of: psoriasis, psoriatic arthritis, rheumatoid arthritis, ankylosing spondylitis, hidradenitis suppurativa, bullous pemphigoid, atopic dermatitis, vitiligo, multiple sclerosis, asthma, uveitis, chronic obstructive pulmonary disorder, multiple myeloma, and systemic lupus erythematosus.
- Various publications, articles and patents are cited or described in the background and throughout the specification; each of these references is herein incorporated by reference in its entirety. Discussion of documents, acts, materials, devices, articles or the like which has been included in the present specification is for the purpose of providing context for the invention. Such discussion is not an admission that any or all of these matters form part of the prior art with respect to any inventions disclosed or claimed.
- Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art to which this invention pertains. Otherwise, certain terms used herein have the meanings as set forth in the specification. All patents, published patent applications and publications cited herein are incorporated by reference as if set forth fully herein.
- It must be noted that as used herein and in the appended claims, the singular forms “a,” “an,” and “the” include plural reference unless the context clearly dictates otherwise.
- In an attempt to help the reader of the application, the description has been separated in various paragraphs or sections, or is directed to various embodiments of the application. These separations should not be considered as disconnecting the substance of a paragraph or section or embodiments from the substance of another paragraph or section or embodiments. To the contrary, one skilled in the art will understand that the description has broad application and encompasses all the combinations of the various sections, paragraphs and sentences that can be contemplated. The discussion of any embodiment is meant only to be exemplary and is not intended to suggest that the scope of the disclosure, including the claims, is limited to these examples.
- The term “administering” with respect to the methods of the invention, means a method for therapeutically or prophylactically preventing, treating or ameliorating a syndrome, disorder or disease as described herein by using a compound of the disclosure, or pharmaceutically acceptable salt thereof, composition thereof, or medicament thereof. Such methods include administering a therapeutically effective amount of a compound of the disclosure, or pharmaceutically acceptable salt thereof, composition thereof, or medicament thereof, at different times during the course of a therapy or concurrently or sequentially as a combination therapy.
- The term “subject” refers to a patient, which may be an animal, preferably a mammal, most preferably a human, whom will be or has been treated by a method according to an embodiment of the application. Examples of mammals include, but are not limited to, cows, horses, sheep, pigs, cats, dogs, mice, rats, rabbits, guinea pigs, non-human primates (NHPs) such as monkeys or apes, humans, etc., more preferably a human.
- The term “therapeutically effective amount” or “effective amount” means that amount of active compound or pharmaceutical agent that elicits the biological or medicinal response in a tissue system, animal or human, that is being sought by a researcher, veterinarian, medical doctor, or other clinician, which includes preventing, treating or ameliorating the symptoms of a syndrome, disorder or disease being treated.
- As used herein, “IL-17” or “IL-17A” refers to interleukin 17A. It is also named IL17, CTLA8, CTLA-8. Interleukin 17A is a pro-inflammatory cytokine. This cytokine is produced by a group of immune cells in response to their stimulation. An exemplary amino acid sequence of human IL-17 is represented in GenBank Accession No. NP_002181.1, which can be encoded by a nucleic acid sequence such as that of GenBank Accession No. NM_002190.3.
- The term “modulator” as used herein refers to any agents or molecules that can bind to IL-17, including small molecule compounds.
- “Active moiety” refers to a molecule or ion responsible for a physiological or pharmacological action. A compound of formula (I), as exemplified in the Examples and also described herein, is an active moiety.
- As used herein, the term “composition” is intended to encompass a product comprising the specified ingredients in the specified amounts, as well as any product which results, directly or indirectly, from combinations of the specified ingredients in the specified amounts.
- As used herein, the term “treat,” “treating,” or “treatment” of any disease, condition, syndrome or disorder refers, in one embodiment, to ameliorating the disease, condition, syndrome or disorder (i.e., slowing or arresting or reducing the development of the disease or at least one of the clinical symptoms thereof). In another embodiment, “treat,” “treating,”, or “treatment” refers to alleviating or ameliorating at least one physiological or biochemical parameter associated with or causative of the disease, condition, syndrome or disorder, including those which may not be discernible by the patient. In a further embodiment, “treat,” “treating,” or “treatment” refers to modulating the disease, condition, syndrome or disorder either physically (e.g. stabilization of a discernible symptom), physiologically, (e.g. stabilization of a physical parameter), or both. In yet another embodiment, “treat,” “treating,” or “treatment” refers to preventing or delaying the onset or development or progression of the disease, condition, syndrome or disorder.
- As used herein, the term “QD” means once daily.
- As used herein, the term “BID” means twice daily.
- The term “alkyl” is a straight or branched saturated hydrocarbon. For example, an alkyl group can have 1 to 12 carbon atoms (i.e., (C1-C12)alkyl) or 1 to 6 carbon atoms (i.e., (C1-C6)alkyl). Examples of alkyl groups include, but are not limited to, methyl (Me, —CH3), ethyl (Et, —CH2CH3), 1-propyl (n-Pr, n-propyl, —CH2CH2CH3), isopropyl (i-Pr, i-propyl, —CH(CH3)2), 1-butyl (n-bu, n-butyl, —CH2CH2CH2CH3), 2-butyl (s-bu, s-butyl, —CH(CH3)CH2CH3), tert-butyl (t-bu, t-butyl, —CH(CH3)3), 1-pentyl (n-pentyl, —CH2CH2CH2CH2CH3), 2-pentyl (—CH(CH3) CH2CH2CH3), neopentyl (CH2C(CH3)3), 1-hexyl (—CH2CH2CH2CH2CH2CH3), 2-hexyl (—CH(CH3)CH2CH2CH2CH3), heptyl (—(CH2)6CH3), octyl (—(CH2)7CH3), 2,2,4-trimethylpentyl (—CH2C(CH3)2CH2CH(CH3)2), nonyl (—(CH2)8CH3), decyl (—(CH2)9CH3), undecyl (—(CH2)10CH3), and dodecyl (—(CH2)11CH3). Any alkyl group may be unsubstituted or substituted.
- The term “C(a-b)” (where a and b are integers referring to a designated number of carbon atoms) refers to an alkyl, alkenyl, alkynyl, alkoxy or cycloalkyl radical or to the alkyl portion of a radical in which alkyl appears as the prefix root containing from a to b carbon atoms inclusive. For example, C(1-4) denotes a radical containing 1, 2, 3 or 4 carbon atoms.
- The term “cycloalkyl” refers to a saturated or partially unsaturated all carbon ring system having 3 to 8 carbon atoms (i.e., C(3-8)cycloalkyl), and preferably 3 to 6 carbon atoms (i.e., C(3-6)cycloalkyl), wherein the cycloalkyl ring system has a single ring or multiple rings in a spirocyclic or bicyclic form. Exemplary cycloalkyls include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl. Unless otherwise stated specifically in the specification, a cycloalkyl group may be unsubstituted or substituted. Some cycloalkyl groups may exist as spirocycloalkyls, wherein two cycloalkyl rings are fused through a single carbon atom; for example and without limitation, an example of a spiropentyl group is
- for example and without limitation, examples of spirohexyl groups include
- for example and without limitation examples of cycloheptyl groups include
- for example and without limitation examples of cyclooctyl groups include
- Unless otherwise stated specifically in the specification, a spirocycloalkyl group may be unsubstituted or substituted. Bicyclic cycloalkyl ring systems also include
- The term “heterocycle” or “heterocyclyl” refers to a saturated or partially unsaturated ring system that has at least one atom other than carbon in the ring system, wherein the atom is selected from the group consisting of oxygen, nitrogen and sulfur. The heterocyclyl group may, for example, consist of a single ring or multiple rings (e.g., in the form of a spirocyclic or bicyclic ring system). Exemplary heterocycles include, but are not limited to oxetanyl, aziridinyl, azetidinyl, pyrrolidinyl, piperidinyl, piperazinyl, morpholinyl, tetrahydropyranyl, tetrahydrofuranyl, and thiomorpholinyl.
- The term “heteroaryl” refers to a single aromatic ring that has at least one atom other than carbon in the ring, wherein the atom is selected from the group consisting of oxygen, nitrogen and sulfur. The term “heteroaryl” includes single aromatic rings of from 1 to 6 carbon atoms and 1 to 4 heteroatoms selected from the group consisting of oxygen, nitrogen and sulfur. Exemplary heteroaryl ring systems include but are not limited to pyridinyl, pyrimidinyl, pyrazinyl, pyridazinyl, pyrimidinyl, pyrazolyl, oxazolyl, oxadiazolyl, isoxazolyl, triazolyl, imidazolyl, tetrazolyl, thienyl, thiazolyl, isothiazolyl, thiadiazolyl, or furyl.
- The term “halogen” or “halo” refers to bromo (—Br), chloro (—Cl), fluoro (—F) or iodo (—I).
- Where the compounds disclosed herein have at least one stereocenter, they may accordingly exist as enantiomers or diastereomers. It is to be understood that all such isomers and mixtures thereof are encompassed within the scope of the present invention.
- “Diastereoisomers” are stereoisomers that have at least two asymmetric atoms, but which are not mirror images of each other.
- “Enantiomers” are a pair of stereoisomers that are non-superimposable mirror images of each other. A “racemic” mixture is a 1:1 mixture of a pair of enantiomers. A “scalemic” mixture of enantiomers is mixture of enantiomers at a ratio other than 1:1.
- Where the processes for the preparation of the compounds according to the invention give rise to mixture of stereoisomers, these isomers may be separated by conventional techniques such as preparative chromatography. The compounds may be prepared in racemic form, a scalemic mixture, or individual enantiomers may be prepared either by enantiospecific synthesis or by resolution. The compounds may, for example, be resolved into their component enantiomers by standard techniques, such as the formation of diastereomeric pairs by salt formation with an optically active acid, such as (−)-di-p-toluoyl-D-tartaric acid and/or (+)-di-p-toluoyl-L-tartaric acid followed by fractional crystallization and regeneration of the free base. The compounds may also be resolved by formation of diastereomeric esters or amides, followed by chromatographic separation and removal of the chiral auxiliary. Alternatively, the compounds may be resolved using a chiral column vial HPLC or SFC. In some instances rotamers of compounds may exist which are observable by 1H NMR leading to complex multiplets and peak integration in the 1H NMR spectrum.
- The absolute stereochemistry is specified according to the Cahn-Ingold-Prelog R-S system. Chiral centers, of which the absolute configurations are known, are labelled by prefixes R and S, assigned by the standard sequence-rule procedure, and preceded when necessary by the appropriate locants (Pure & Appl. Chem. 45, 1976, 11-30). Certain pairs of enantiomers and diastereomers are presented together in the Examples. These enantiomers/diastereomers may be designated in the following synthetic method and characterized as enantiomer 1 or enantiomer 2 (or, alternately, diastereomer 1 or diastereomer 2). The presentation of stereoisomers in this manner conveys the separate preparation or isolation of the compounds as pure single enantiomers or diastereomers at the identified stereocenter(s). However, unless otherwise specified, when a pure single enantiomer (or diastereomer) is presented together with the corresponding pure single enantiomer (or diastereomer) in the Examples of the present disclosure, the order in which the chemical structures/IUPAC names are presented do not necessarily correspond to the order in which the Example numbers are listed. By way of example, where R and S enantiomers of a compound are presented side-by-side under the header “Example X and Example Y,” then Example X may be either the R enantiomer or the S enantiomer, and Example Y is the opposite enantiomer, regardless of the order in which the IUPAC names or chemical structures of the compounds are presented, unless otherwise specified in the method and characterization that follows.
- Certain examples contain chemical structures that are depicted or labelled as an (R*) or (S*). When (R*) or (S*) is used in the name of a compound or in the chemical representation of the compound, it is intended to convey that the compound is a pure single isomer at that stereocenter; however, absolute configuration of that stereocenter has not been established. Thus, a compound designated as (R*) refers to a compound that is a pure single isomer at that stereocenter with an absolute configuration of either (R) or (S), and a compound designated as (S*) refers to a compound that is a pure single isomer at that stereocenter with an absolute configuration of either (R) or (S). For example, 4-cyclopropyl-N—((S)-(4,4-difluorocyclohexyl)(7-(((R*)-5-fluoro-5-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1,2,5-oxadiazole-3-carboxamide:
- refers to a compound that is either:
- Pseudoasymmetric stereogenic centers are treated in the same way as chiral centers, but are given lower-case symbols, r or s (Angew. Chem. Int. Ed. Engl. 1982, 21, 567-583).
- During any of the processes for preparation of the compounds disclosed herein, it may be necessary and/or desirable to protect sensitive or reactive groups on any of the molecules concerned. This may be achieved by means of conventional protecting groups, such as those described in Protective Groups in Organic Chemistry, ed. J. F. W. McOmie, Plenum Press, 1973; and T. W. Greene & P. G. M. Wuts, Protective Groups in Organic Synthesis, John Wiley & Sons, 1991. The protecting groups may be removed at a convenient subsequent stage using methods known from the art.
- Furthermore, it is intended that within the scope of the present invention, any element, in particular when mentioned in relation to a compound of the disclosure, or pharmaceutically acceptable salt thereof, shall comprise all isotopes and isotopic mixtures of said element, either naturally occurring or synthetically produced, either with natural abundance or in an isotopically enriched form. For example, a reference to hydrogen includes within its scope 1H, 2H (i.e., deuterium or D), and 3H (i.e., tritium or T). In some embodiments, the compounds described herein include a 2H (i.e., deuterium) isotope. By way of example, the group denoted —C(1-6)alkyl includes not only —CH3, but also CD3; not only CH2CH3, but also CD2CD3, etc. Similarly, references to carbon and oxygen include within their scope respectively 12C, 13C and 14C and 15O and 16O and 17O and 18O. The isotopes may be radioactive or non-radioactive. Radiolabelled compounds of the disclosure may include a radioactive isotope selected from the group comprising 3H, 11C, 18F, 35S, 122I, 123I, 125I, 131I, 75Br, 76Br, 77Br and 82Br. Preferably, the radioactive isotope is selected from the group of 3H, 11C and 18F.
- The present application discloses a compound of Formula I:
- or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1a independently for each occurrence is —C(1-3)alkyl or —C(3-5)cycloalkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or when m1 is 2, two geminal R1a groups together with the carbon atom to which they are attached form a spiro C(3-5)cycloalkyl;
- R1b independently for each occurrence is halo or —C(1-3)alkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R1b groups together with the carbon atoms to which they are attached form a fused C(3-7)cycloalkyl, wherein the C(3-7)cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n is 1 or 2;
- m1, m2, and m3 are independently 0, 1, or 2;
- R2 is H, —C(1-3)alkyl, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, —C(1-3)alkyl-O—C(3-5)cycloalkyl, or 4- to 6-membered heterocyclyl, wherein the —C(1-3)alkyl, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, and —C(1-3)alkyl-O—C(3-5)cycloalkyl groups are unsubstituted or substituted with one to six R2a groups;
- R2a independently for each occurrence is fluorine or —CN;
- R3 is —C(1-10)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, —C(1-6)alkyl-O—C(3-5)cycloalkyl, —C(1-6)alkyl-O—C(3-5)cycloalkyl-C(1-3)alkyl, —C(3-8)cycloalkyl, or —C(1-3)alkyl-(C(3-5)cycloalkyl)1-2, each of which is unsubstituted or substituted with one to six fluorine atoms;
- R4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R4a groups; and
- R4a is halo, —C(1-6)alkyl, —O—C(1-6)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, or —C(0-2)alkyl-C(3-6)cycloalkyl, wherein the —C(1-6)alkyl, —O—C(1-6)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, and —C(0-2)alkyl-C(3-6)cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH3, —CD3, —CD2CD3, —CH2F, —CHF2, and —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1a independently for each occurrence is —C(1-3)alkyl or —C(3-5)cycloalkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or when m1 is 2, two geminal R1a groups together with the carbon atom to which they are attached form a spiro C(3-5)cycloalkyl;
- R1b independently for each occurrence is halo or —C(1-3)alkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R1b groups together with the carbon atoms to which they are attached form a fused C(3-7)cycloalkyl, wherein the C(3-7)cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n is 1 or 2;
- m1, m2, and m3 are independently 0, 1, or 2;
- R2 is H, —C(1-3)alkyl, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, —C(1-3)alkyl-O—C(3-5)cycloalkyl, or 4- to 6-membered heterocyclyl, wherein the —C(1-3)alkyl, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, and —C(1-3)alkyl-O—C(3-5)cycloalkyl groups are unsubstituted or substituted with one to six R2a groups;
- R2a independently for each occurrence is fluorine or —CN;
- R3 is —C(1-6)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, —C(1-6)alkyl-O—C(3-5)cycloalkyl, —C(1-6)alkyl-O—C(3-5)cycloalkyl-C(1-3)alkyl, —C(3-8)cycloalkyl, or —C(1-3)alkyl-(C(3-5)cycloalkyl)1-2, each of which is unsubstituted or substituted with one to six fluorine atoms;
- R4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R4a groups; and
- R4a is halo, —C(1-6)alkyl, —O—C(1-6)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, or —C(0-2)alkyl-C(3-6)cycloalkyl, wherein the —C(1-6)alkyl, —O—C(1-6)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, and —C(0-2)alkyl-C(3-6)cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH3, —CD3, —CD2CD3, —CH2F, —CHF2, and —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1a independently for each occurrence is —C(1-3)alkyl or —C(3-5)cycloalkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms;
- R1b independently for each occurrence is halo or —C(1-3)alkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R1b groups together with the carbon atoms to which they are attached form a fused C(3-7)cycloalkyl, wherein the C(3-7)cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n is 1 or 2;
- m1, m2, and m3 are independently 0, 1, or 2;
- R2 is H, —C(1-3)alkyl, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, or —C(1-3)alkyl-O—C(3-5)cycloalkyl, wherein the —C(1-3)alkyl, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, and —C(1-3)alkyl-O—C(3-5)cycloalkyl groups are unsubstituted or substituted with one to six R2a groups;
- R2a independently for each occurrence is fluorine;
- R3 is —C(1-6)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, —C(1-6)alkyl-O—C(3-5)cycloalkyl, or —C(3-8)cycloalkyl, each of which is unsubstituted or substituted with one to six fluorine atoms;
- R4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R4a groups; and
- R4a is halo, —C(1-6)alkyl, —O—C(1-6)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, or —C(0-2)alkyl-C(3-6)cycloalkyl, wherein the —C(1-6)alkyl, —O—C(1-6)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, and —C(0-2)alkyl-C(3-6)cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH3, —CD3, —CD2CD3, —CH2F, —CHF2, and —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1a independently for each occurrence is —C(1-3)alkyl or —C(3-5)cycloalkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or when m1 is 2, two geminal R1a groups together with the carbon atom to which they are attached form a spiro C(3-5)cycloalkyl;
- R1b independently for each occurrence is halo or —C(1-3)alkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R1b groups together with the carbon atoms to which they are attached form a fused C(3-7)cycloalkyl, wherein the C(3-7)cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n is 1 or 2;
- m1, m2, and m3 are independently 0, 1, or 2;
- R2 is H, —C(1-3)alkyl, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, —C(1-3)alkyl-O—C(3-5)cycloalkyl, or 4- to 6-membered heterocyclyl, wherein the —C(1-3)alkyl and —C(3-5)cycloalkyl are unsubstituted or substituted with one to six R2a groups;
- R2a independently for each occurrence is fluorine or —CN;
- R3 is —C(1-6)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, —C(1-6)alkyl-O—C(3-5)cycloalkyl, —C(1-6)alkyl-O—C(3-5)cycloalkyl-C(1-3)alkyl, —C(3-8)cycloalkyl, or —CH(C(3-5)cycloalkyl)2, each of which is unsubstituted or substituted with one to six fluorine atoms;
- R4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R4a groups; and
- R4a is halo, —C(1-6)alkyl, —O—C(1-6)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, or —C(0-2)alkyl-C(3-6)cycloalkyl, wherein the —C(1-6)alkyl, —O—C(1-6)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, and —C(0-2)alkyl-C(3-6)cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH3, —CD3, —CD2CD3, —CH2F, —CHF2, and —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1a independently for each occurrence is —C(1-3)alkyl or —C(3-5)cycloalkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms;
- R1b independently for each occurrence is halo or —C(1-3)alkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R1b groups together with the carbon atoms to which they are attached form a fused C(3-7)cycloalkyl, wherein the C(3-7)cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n is 1 or 2;
- m1, m2, and m3 are independently 0, 1, or 2;
- R2 is H, —C(1-3)alkyl, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, or —C(1-3)alkyl-O—C(3-5)cycloalkyl;
- R3 is —C(1-6)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, —C(1-6)alkyl-O—C(3-5)cycloalkyl, or —C(3-8)cycloalkyl, each of which is unsubstituted or substituted with one to six fluorine atoms;
- R4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R4a groups; and
- R4a is halo, —C(1-6)alkyl, —O—C(1-6)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, or —C(0-2)alkyl-C(3-6)cycloalkyl, wherein the —C(1-6)alkyl, —O—C(1-6)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, and —C(0-2)alkyl-C(3-6)cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH3, —CD3, —CD2CD3, —CH2F, —CHF2, and —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1a independently for each occurrence is —C(1-3)alkyl or —C(3-5)cycloalkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or when m1 is 2, two geminal R1a groups together with the carbon atom to which they are attached form a spiro cyclopropyl;
- R1b independently for each occurrence is halo or —C(1-3)alkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R1b groups together with the carbon atoms to which they are attached form a fused C(3-5)cycloalkyl, wherein the C(3-5)cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n is 1 or 2;
- m1, m2, and m3 are independently 0, 1, or 2;
- R2 is H, —C(1-3)alkyl, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, —C(1-3)alkyl-O—C(3-5)cycloalkyl, or 4- to 6-membered heterocyclyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to six fluorine atoms, and wherein the —C(3-5)cycloalkyl is unsubstituted or substituted with one —CN group;
- R3 is —C(1-6)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, —C(1-3)alkyl-O—C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(3-5)cycloalkyl-CH3, —C(5-6)cycloalkyl, or —CH(C(3-5)cycloalkyl)2, each of which is unsubstituted or substituted with one to six fluorine atoms;
- R4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R4a groups; and
- R4a is —C(1-4)alkyl, —O—C(1-4)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, or —C(0-2)alkyl-C(3-4)cycloalkyl, wherein the —C(1-4)alkyl, —O—C(1-4)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, and —C(0-2)alkyl-C(3-4)cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH3, —CD3, —CD2CD3, —CH2F, —CHF2, and —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1a independently for each occurrence is —C(1-3)alkyl or —C(3-5)cycloalkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms;
- R1b independently for each occurrence is halo or —C(1-3)alkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R1b groups together with the carbon atoms to which they are attached form a fused C(3-5)cycloalkyl, wherein the C(3-5)cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n is 1 or 2;
- m1, m2, and m3 are independently 0, 1, or 2;
- R2 is H, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, or —C(1-3)alkyl-O—C(3-5)cycloalkyl;
- R3 is —C(1-6)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, —C(1-3)alkyl-O—C(3-5)cycloalkyl, or cyclohexyl, each of which is substituted or unsubstituted with one to six fluorine atoms;
- R4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R4a groups; and
- R4a is —C(1-4)alkyl, —O—C(1-4)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, or —C(0-2)alkyl-C(3-4)cycloalkyl, wherein the —C(1-4)alkyl, —O—C(1-4)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, and —C(0-2)alkyl-C(3-4)cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH3, —CD3, —CD2CD3, —CH2F, —CHF2, and —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1a independently for each occurrence is —C(1-3)alkyl or —C(3-5)cycloalkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or when m1 is 2, two geminal R1a groups together with the carbon atom to which they are attached form a spiro cyclopropyl;
- R1b independently for each occurrence is halo or —C(1-3)alkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R1b groups together with the carbon atoms to which they are attached form a fused C(3-5)cycloalkyl, wherein the C(3-5)cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n is 1 or 2;
- m1, m2, and m3 are independently 0, 1, or 2;
- R2 is H, —C(1-3)alkyl, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, —C(1-3)alkyl-O—C(3-5)cycloalkyl, or tetrahydropyranyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to six fluorine atoms, and wherein the —C(3-5)cycloalkyl is unsubstituted or substituted with one —CN groups;
- R3 is —C(5-6)alkyl substituted with two to three fluorine atoms, —C(5-6)cycloalkyl substituted with two fluorine atoms,
- R3a, R3b, R3c, and R3d are each independently H or —CH3;
- R3e and R3f are each independently H or —CH3;
- R3g is H or —CF3;
- R4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R4a groups; and
- R4a is —C(1-4)alkyl, —O—C(1-4)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, or —C(0-2)alkyl-C(3-4)cycloalkyl, wherein the —C(1-4)alkyl, —O—C(1-4)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, and —C(0-2)alkyl-C(3-4)cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH3, —CD3, —CD2CD3, —CH2F, —CHF2, and —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein: R1 is:
- R1a independently for each occurrence is —C(1-3)alkyl or —C(3-5)cycloalkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms;
- R1b independently for each occurrence is halo or —C(1-3)alkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R1b groups together with the carbon atoms to which they are attached form a fused C(3-5)cycloalkyl, wherein the C(3-5)cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n is 1 or 2;
- m1, m2, and m3 are independently 0, 1, or 2;
- R2 is H, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, or —C(1-3)alkyl-O—C(3-5)cycloalkyl;
- R3 is —C(1-5)alkyl substituted with one —CF3,
- R3a, R3b, R3c, and R3d are each independently H or —CH3;
- R4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R4a groups; and
- R4a is —C(1-4)alkyl, —O—C(1-4)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, or —C(0-2)alkyl-C(3-4)cycloalkyl, wherein the —C(1-4)alkyl, —O—C(1-4)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, and —C(0-2)alkyl-C(3-4)cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH3, —CD3, —CD2CD3, —CH2F, —CHF2, and —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1a independently for each occurrence is —C(1-3)alkyl or —C(3-5)cycloalkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms;
- R1b independently for each occurrence is halo or —C(1-3)alkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R1b groups together with the carbon atoms to which they are attached form a fused C(3-5)cycloalkyl, wherein the C(3-5)cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n is 1 or 2;
- m1, m2, and m3 are independently 0, 1, or 2;
- R2 is H, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, or —C(1-3)alkyl-O—C(3-5)cycloalkyl;
- R3 is:
- R3a, R3b, R3c, and R3d are each independently H or —CH3;
- R4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R4a groups; and
- R4a is —C(1-4)alkyl, —O—C(1-4)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, or —C(0-2)alkyl-C(3-4)cycloalkyl, wherein the —C(1-4)alkyl, —O—C(1-4)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, and —C(0-2)alkyl-C(3-4)cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH3, —CD3, —CD2CD3, —CH2F, —CHF2, and —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1a independently for each occurrence is —CH3, —CH2F, —CHF2, —CF3, or —C(3-4)cycloalkyl, or when m1 is 2, two geminal R1a groups together with the carbon atom to which they are attached form a spiro cyclopropyl;
- R1b independently for each occurrence is fluoro, —CH3, —CH2F, —CHF2, —CF3, or when n is 2, two R1b groups together with the carbon atoms to which they are attached form a fused C(3-5)cycloalkyl, wherein the C(3-5)cycloalkyl is unsubstituted or substituted with one to five fluorine atoms
- n is 1 or 2;
- m1 and m2 are independently 0, 1, or 2;
- R2 is H, —C(1-3)alkyl, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, —C(1-3)alkyl-O—C(3-5)cycloalkyl, or tetrahydropyranyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to six fluorine atoms, and wherein the —C(3-5)cycloalkyl is unsubstituted or substituted with one —CN groups;
- R3 is —C(5-6)alkyl substituted with two to three fluorine atoms, —C(5-6)cycloalkyl substituted with two fluorine atoms,
- R3a, R3b, R3c, and R3d are each independently H or —CH3;
- R3e and R3f are each independently H or —CH3;
- R3g is H or —CF3;
- R4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R4a groups; and
- R4a is —C(1-4)alkyl, —O—C(1-4)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, or —C(0-2)alkyl-C(3-4)cycloalkyl, wherein the —C(1-4)alkyl, —O—C(1-4)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, and —C(0-2)alkyl-C(3-4)cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH3, —CD3, —CD2CD3, —CH2F, —CHF2, and —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1b independently for each occurrence is fluoro, —CH3, —CH2F, —CHF2, —CF3, or when n is 2, two R1b groups together with the carbon atoms to which they are attached form a fused C(3-5)cycloalkyl, wherein the C(3-5)cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n is 1 or 2;
- m2 is 0, 1, or 2;
- R2 is H, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, or —C(1-3)alkyl-O—C(3-5)cycloalkyl;
- R3 is —C(1-5)alkyl substituted with one —CF3,
- R3a, R3b, R3c, and R3d are each independently H or —CH3;
- R4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R4a groups; and
- R4a is —C(1-4)alkyl, —O—C(1-4)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, or —C(0-2)alkyl-C(3-4)cycloalkyl, wherein the —C(1-4)alkyl, —O—C(1-4)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, and —C(0-2)alkyl-C(3-4)cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH3, —CD3, —CD2CD3, —CH2F, —CHF2, and —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1b independently for each occurrence is fluoro, —CH3, —CH2F, —CHF2, —CF3, or when n is 2, two R1b groups together with the carbon atoms to which they are attached form a fused C(3-5)cycloalkyl, wherein the C(3-5)cycloalkyl is unsubstituted or substituted with one to five fluorine atoms;
- n is 1 or 2;
- m2 is 0, 1, or 2;
- R2 is H, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, or —C(1-3)alkyl-O—C(3-5)cycloalkyl;
- R3 is:
- R3a, R3b, R3c, and R3d are each independently H or —CH3;
- R4 is a 5-membered heteroaryl that is unsubstituted or substituted with one to two R4a groups; and
- R4a is —C(1-4)alkyl, —O—C(1-4)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, or —C(0-2)alkyl-C(3-4)cycloalkyl, wherein the —C(1-4)alkyl, —O—C(1-4)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, and —C(0-2)alkyl-C(3-4)cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH3, —CD3, —CD2CD3, —CH2F, —CHF2, and —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1b independently for each occurrence is fluoro, or when n is 2, two R1b groups together with the carbon atoms to which they are attached form a fused C(3)cycloalkyl, wherein the C(3)cycloalkyl is unsubstituted or substituted with one to two fluorine atoms;
- n is 1 or 2;
- m2 is 0, 1, or 2;
- R2 is H, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, or —C(1-3)alkyl-O—C(3-5)cycloalkyl;
- R3 is —C(5-6)alkyl substituted with two to three fluorine atoms, —C(5-6)cycloalkyl substituted with two fluorine atoms,
- R3a, R3b, R3c, and R3d are each independently H or —CH3;
- R3e and R3f are each independently H or —CH3;
- R3g is H or —CF3;
- R4 is
- and
- R4a is —C(1-4)alkyl, —O—C(1-4)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, or —C(0-2)alkyl-C(3-4)cycloalkyl, wherein the —C(1-4)alkyl, —O—C(1-4)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, and —C(0-2)alkyl-C(3-4)cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH3, —CD3, —CD2CD3, —CH2F, —CHF2, and —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1b independently for each occurrence is fluoro, or when n is 2, two R1b groups together with the carbon atoms to which they are attached form a fused C(3)cycloalkyl, wherein the C(3)cycloalkyl is unsubstituted or substituted with one to two fluorine atoms;
- n is 1 or 2;
- m2 is 0, 1, or 2;
- R2 is H, cyclopropyl, —CH2OCH3, or —CH2—O-cyclopropyl;
- R3 is —C(5-6)alkyl substituted with two to three fluorine atoms, —C(5-6)cycloalkyl substituted with two fluorine atoms, or
- R3a, R3b, R3c, and R3d are each independently H or —CH3;
- R4 is
- and
- R4a is methyl, ethyl, isopropyl, —CD2CD3, —CHF2, —CF3, —CH2CH2CF3, —OCH3, —OCH2CHF2, —CH2OCHF2, cyclopropyl, or —CH2-cyclopropyl.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1a independently for each occurrence is —C(1-3)alkyl or —C(3-5)cycloalkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or when m1 is 2, two geminal R1a groups together with the carbon atom to which they are attached form a spiro cyclopropyl.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1a independently for each occurrence is —C(1-3)alkyl that is unsubstituted or substituted with one to five fluorine atoms, or when m1 is 2, two geminal R1a groups together with the carbon atom to which they are attached form a spiro cyclopropyl.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1a independently for each occurrence is —CH3, —CH2F, —CHF2, —CF3, or —C(3-4)cycloalkyl, or when m1 is 2, two geminal R1a groups together with the carbon atom to which they are attached form a spiro cyclopropyl.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1a independently for each occurrence is —CH3, —CH2F, —CHF2, or —CF3, or when m1 is 2, two geminal R1a groups together with the carbon atom to which they are attached form a spiro cyclopropyl.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1a independently for each occurrence is —C(1-3)alkyl or —C(3-5)cycloalkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1a independently for each occurrence is —C(1-3)alkyl or —C(3-5)cycloalkyl.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1a independently for each occurrence is —CH3, —CH2F, —CHF2, —CF3, or —C(3-4)cycloalkyl.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1a independently for each occurrence is —C(1-3)alkyl that is unsubstituted or substituted with one to five fluorine atoms. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1a independently for each occurrence is —C(3-5)cycloalkyl. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein m1 is 2, and two geminal R1a groups together with the carbon atom to which they are attached form a spiro cyclopropyl.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1b independently for each occurrence is halo or —C(1-3)alkyl, or when n is 2, two R1b groups together with the carbon atoms to which they are attached form a fused C(3-5)cycloalkyl, wherein the C(3-5)cycloalkyl is unsubstituted or substituted with one to five fluorine.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1b independently for each occurrence is halo or —C(1-3)alkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or when n is 2, two R1b groups together with the carbon atoms to which they are attached form a fused C(3-5)cycloalkyl, wherein the C(3-5)cycloalkyl is unsubstituted or substituted with one to five fluorine atoms.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1b independently for each occurrence is fluoro, —CH3, —CH2F, —CHF2, —CF3, or when n is 2, two R1b groups together with the carbon atoms to which they are attached form a fused C(3-5)cycloalkyl, wherein the C(3-5)cycloalkyl is unsubstituted or substituted with one to five fluorine atoms.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1b independently for each occurrence is fluoro, —CH3, —CH2F, —CHF2, —CF3, or when n is 2, two R1b groups together with the carbon atoms to which they are attached form a fused C(3)cycloalkyl, wherein the C(3)cycloalkyl is unsubstituted or substituted with one to two fluorine atoms.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1b independently for each occurrence is fluoro, or when n is 2, two R1b groups together with the carbon atoms to which they are attached form a fused C(3)cycloalkyl, wherein the C(3)cycloalkyl is unsubstituted or substituted with one to two fluorine atoms
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein n is 1. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein n is 2.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein m1 is 0, 1, or 2. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein m1 is 0. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein m2 is 0, 1, or 2. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein m3 is 0.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein m1 is 0, 1, or 2; m2 is 0, 1, or 2; and m3 is 0. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein m1 is 0; m2 is 0, 1, or 2; and m3 is 0.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1a independently for each occurrence is —C(1-3)alkyl or —C(3-5)cycloalkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or when m1 is 2, two geminal R1a groups together with the carbon atom to which they are attached form a spiro C(3-5)cycloalkyl;
- R1b independently for each occurrence is halo or —C(1-3)alkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms; and m1, m2, and m3 are independently 0, 1, or 2.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1a independently for each occurrence is —CH3, —CH2F, —CHF2, or —CF3, or when m1 is 2, two geminal R1a groups together with the carbon atom to which they are attached form a spiro cyclopropyl;
- R1b independently for each occurrence is fluoro, —CH3, —CH2F, —CHF2, —CF3; and
- m1, m2, and m3 are independently 0, 1, or 2.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1a independently for each occurrence is —C(1-3)alkyl or —C(3-5)cycloalkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms;
- R1b independently for each occurrence is halo or —C(1-3)alkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms; and m1, m2, and m3 are independently 0, 1, or 2.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1a independently for each occurrence is —CH3, —CH2F, —CHF2, —CF3, or —C(3-4)cycloalkyl;
- R1b independently for each occurrence is fluoro, —CH3, —CH2F, —CHF2, or —CF3; and
- m1, m2, and m3 are independently 0, 1, or 2.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1a independently for each occurrence is —C(1-3)alkyl or —C(3-5)cycloalkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or when m1 is 2, two geminal R1a groups together with the carbon atom to which they are attached form a spiro C(3-5)cycloalkyl;
- R1b independently for each occurrence is halo or —C(1-3)alkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms; and
- m1 and m2 are independently 0, 1, or 2.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1a independently for each occurrence is —CH3, —CH2F, —CHF2, or —CF3, or when m1 is 2, two geminal R1a groups together with the carbon atom to which they are attached form a spiro cyclopropyl;
- R1b independently for each occurrence is fluoro, —CH3, —CH2F, —CHF2, —CF3; and
- m1 and m3 are independently 0, 1, or 2.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1b independently for each occurrence is fluoro, —CH3, —CH2F, —CHF2, —CF3; and
- m2 is 0, 1, or 2.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1b independently for each occurrence is fluoro, —CH3, —CH2F, —CHF2, —CF3; and
- m2 is 0, 1, or 2.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1a independently for each occurrence is —C(1-3)alkyl or —C(3-5)cycloalkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms;
- R1b independently for each occurrence is halo or —C(1-3)alkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or two vicinal R1b groups together with the carbon atoms to which they are attached form a fused C(3-7)cycloalkyl, wherein the C(3-7)cycloalkyl is unsubstituted or substituted with one to five fluorine atoms; and
- m1, m2-1, m2-2, and m3 are independently 0, 1, or 2.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1a independently for each occurrence is —CH3, —CH2F, —CHF2, —CF3, or —C(3-4)cycloalkyl;
- R1b independently for each occurrence is fluoro, —CH3, —CH2F, —CHF2, —CF3, or two vicinal R1b groups together with the carbon atoms to which they are attached form a fused C(3-5)cycloalkyl, wherein the C(3-5)cycloalkyl is unsubstituted or substituted with one to five fluorine atoms; and
- m1, m2-1, m2-2, and m3 are independently 0, 1, or 2.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1a independently for each occurrence is —C(1-3)alkyl or —C(3-5)cycloalkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms;
- R1b independently for each occurrence is halo or —C(1-3)alkyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to five fluorine atoms, or two vicinal R1b groups together with the carbon atoms to which they are attached form a fused C(3-7)cycloalkyl, wherein the C(3-7)cycloalkyl is unsubstituted or substituted with one to five fluorine atoms; and
- m1, m2-1, and m2-2 are independently 0, 1, or 2.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1a independently for each occurrence is —CH3, —CH2F, —CHF2, —CF3, or —C(3-4)cycloalkyl;
- R1b independently for each occurrence is fluoro, —CH3, —CH2F, —CHF2, —CF3, or two vicinal R1b groups together with the carbon atoms to which they are attached form a fused C(3-5)cycloalkyl, wherein the C(3-5)cycloalkyl is unsubstituted or substituted with one to five fluorine atoms; and
- m1, m2-1, and m2-2 are independently 0, 1, or 2.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein:
- R1 is:
- R1b independently for each occurrence is fluoro, —CH3, —CH2F, —CHF2, —CF3, or two vicinal R1b groups together with the carbon atoms to which they are attached form a fused C(3-5)cycloalkyl, wherein the C(3-5)cycloalkyl is unsubstituted or substituted with one to five fluorine atoms; and
- m2-1 and m2-2 are independently 0, 1, or 2.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R1 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is H, —C(1-3)alkyl, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, or —C(1-3)alkyl-O—C(3-5)cycloalkyl, wherein the —C(1-3)alkyl, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, and —C(1-3)alkyl-O—C(3-5)cycloalkyl groups are unsubstituted or substituted with one to six R2a groups.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is H, —C(1-3)alkyl, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, —C(1-3)alkyl-O—C(3-5)cycloalkyl, or 4- to 6-membered heterocyclyl, wherein the —C(1-3)alkyl and —C(3-5)cycloalkyl are unsubstituted or substituted with one to six R2a groups.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is H, —C(1-3)alkyl, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, —C(1-3)alkyl-O—C(3-5)cycloalkyl, or 4- to 6-membered heterocyclyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to six fluorine atoms, and wherein the —C(3-5)cycloalkyl is unsubstituted or substituted with one —CN group.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is H, —C(1-3)alkyl, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, —C(1-3)alkyl-O—C(3-5)cycloalkyl, or tetrahydropyranyl, wherein the —C(1-3)alkyl is unsubstituted or substituted with one to six fluorine atoms, and wherein the —C(3-5)cycloalkyl is unsubstituted or substituted with one —CN groups.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is H, —C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(1-3)alkyl, or —C(1-3)alkyl-O—C(3-5)cycloalkyl.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is H. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is —C(1-3)alkyl that is unsubstituted or substituted with one to six fluorine atoms. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is —C(3-5)cycloalkyl that is unsubstituted or substituted with one —CN group. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is —C(1-3)alkyl-O—C(1-3)alkyl. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is —C(1-3)alkyl-O—C(3-5)cycloalkyl. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is 4- to 6-membered heterocyclyl.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is H, cyclopropyl, —CH2OCH2CH3, —CH2OCH3, or —CH2—O-cyclopropyl.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is H, cyclopropyl, —CH2OCH3, or —CH2—O-cyclopropyl.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is H. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is —CH3. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is —CHF2. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is cyclopropyl. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is cyanocyclobutyl. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is —CH2OCH3. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is —CH2OCH2CH3. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is —CH2OCH(CH3)2. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is —CH2—O-cyclopropyl. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is —CH2—O-cyclobutyl. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2 is tetrahydropyranyl.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, which is a compound of Formula Ia:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2a is fluorine. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R2a is —CN.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-10)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, —C(1-6)alkyl-O—C(3-5)cycloalkyl, —C(1-6)alkyl-O—C(3-5)cycloalkyl-C(1-3)alkyl, —C(3-8)cycloalkyl, or —CH(C(3-5)cycloalkyl)2, each of which is unsubstituted or substituted with one to six fluorine atoms.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-8)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, —C(1-6)alkyl-O—C(3-5)cycloalkyl, —C(1-6)alkyl-O—C(3-5)cycloalkyl-C(1-3)alkyl, —C(3-8)cycloalkyl, or —CH(C(3-5)cycloalkyl)2, each of which is unsubstituted or substituted with one to six fluorine atoms.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-7)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, —C(1-6)alkyl-O—C(3-5)cycloalkyl, —C(1-6)alkyl-O—C(3-5)cycloalkyl-C(1-3)alkyl, —C(3-8)cycloalkyl, or —CH(C(3-5)cycloalkyl)2, each of which is unsubstituted or substituted with one to six fluorine atoms.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-6)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, —C(1-6)alkyl-O—C(3-5)cycloalkyl, —C(1-6)alkyl-O—C(3-5)cycloalkyl-C(1-3)alkyl, —C(3-8)cycloalkyl, or —CH(C(3-5)cycloalkyl)2, each of which is unsubstituted or substituted with one to six fluorine atoms.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(5-6)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, —C(1-3)alkyl-O—C(3-5)cycloalkyl, —C(1-3)alkyl-O—C(3-5)cycloalkyl-CH3, —C(5-6)cycloalkyl, or —CH(C(3-5)cycloalkyl)2, each of which is unsubstituted or substituted with one to six fluorine atoms.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(5-6)alkyl substituted with two to three fluorine atoms, —C(1-6)alkyl-O—C(1-5)alkyl-CF3, —C(1-6)alkyl-O—C(3-5)cycloalkyl, —C(1-6)alkyl-O—C(3-5)cycloalkyl-CF3, —C(5-6)cycloalkyl substituted with two fluorine atoms, or —CH(C(3-5)cycloalkyl)2.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(5-7)alkyl substituted with two to three fluorine atoms, —C(1-6)alkyl-O—C(1-5)alkyl-CF3, —C(1-6)alkyl-O—C(3-5)cycloalkyl, —C(1-6)alkyl-O—C(3-5)cycloalkyl-CF3, —C(5-6)cycloalkyl substituted with two fluorine atoms, or —CH(C(3-5)cycloalkyl)2.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-6)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, —C(1-6)alkyl-O—C(3-5)cycloalkyl, or —C(3-8)cycloalkyl, each of which is unsubstituted or substituted with one to six fluorine atoms.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-6)alkyl, —C(1-6)alkyl-O—C(1-6)alkyl, or —C(1-6)alkyl-O—C(3-5)cycloalkyl, each of which is unsubstituted or substituted with one to six fluorine atoms.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-6)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, —C(1-3)alkyl-O—C(3-5)cycloalkyl, or cyclohexyl, each of which is substituted or unsubstituted with one to six fluorine atoms.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-6)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, or cyclohexyl, each of which is substituted or unsubstituted with one to six fluorine atoms.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-6)alkyl, —C(1-6)alkyl-O—C(1-5)alkyl-CF3, or cyclohexyl, wherein the —C(1-6)alkyl is substituted with one to three fluorine atoms and wherein the cyclohexyl is substituted with two fluorine atoms.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-5)alkyl, —C(1-6)alkyl-O—C(1-5)alkyl-CF3, or cyclohexyl, wherein the —C(1-5)alkyl is substituted with one —CF3 and wherein the cyclohexyl is substituted with two fluorine atoms.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-6)alkyl-O—C(1-5)alkyl-CF3 or cyclohexyl, wherein the cyclohexyl is substituted with two fluorine atoms.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-6)alkyl that is unsubstituted or substituted with one to six fluorine atoms. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(5-6)alkyl substituted with two to three fluorine atoms. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-5)alkyl substituted with one —CF3. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(5)alkyl substituted with one —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-6)alkyl-O—C(1-6)alkyl that is unsubstituted or substituted with one to six fluorine atoms. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-6)alkyl-O—C(1-5)alkyl-CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-6)alkyl-O—C(3-5)cycloalkyl that is unsubstituted or substituted with one to six fluorine atoms. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-6)alkyl-O—C(3-5)cycloalkyl-C(1-3)alkyl that is unsubstituted or substituted with one to six fluorine atoms. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-6)alkyl-O—C(3-5)cycloalkyl-CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(3-8)cycloalkyl that is unsubstituted or substituted with one to six fluorine atoms. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(5-6)cycloalkyl substituted with two fluorine atoms. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is cyclohexyl substituted with two fluorine atoms.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-3)alkyl-(C(3-5)cycloalkyl)1-2 that is unsubstituted or substituted with one to six fluorine atoms. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —CH(C(3-5)cycloalkyl)2.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(5-6)alkyl substituted with two to three fluorine atoms, —C(5-6)cycloalkyl substituted with two fluorine atoms,
- R3a, R3b, R3c, and R3d are each independently H or —CH3;
- R3e and R3f are each independently H or —CH3; and
- R3g is H or —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(5-6)alkyl substituted with two to three fluorine atoms, —C(5-6)cycloalkyl substituted with two fluorine atoms, or
- and
- R3a, R3b, R3c, and R3d are each independently H or —CH3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-5)alkyl substituted with one —CF3,
- R3a, R3b, R3c, and R3d are each independently H or —CH3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-5)alkyl substituted with one —CF3 or
- R3a, R3b, R3c, and R3d are each independently H or —CH3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is:
- R3a, R3b, R3c, and R3d are each independently H or —CH3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is:
- R3a, R3b, R3c, and R3d are each independently H or —CH3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is:
- R3e and R3f are each independently H or —CH3; and
- R3g is H or —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is —C(1-5)alkyl substituted with one —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R3 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, which is a compound of Formula Ib:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, which is a compound of Formula Ib-1:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, which is a compound of Formula Ic:
- wherein R3a, R3b, R3c, and R3d are each independently H or —CH3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, which is a compound of Formula Ic-1:
- wherein R3a, R3b, R3c, and R3d are each independently H or —CH3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, which is a compound of Formula Ic-2:
- wherein R3a, R3b, R3c, and R3d are each independently H or —CH3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, which is a compound of Formula Id:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, which is a compound of Formula Id-1:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, which is a compound of Formula Id-2:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is a 5-membered heteroaryl that is substituted with one or two R4a groups.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is a 5-membered heteroaryl comprising one to three heteroatoms selected from O and N, wherein the 5-membered heteroaryl is unsubstituted or substituted with one to two R4a groups.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is pyrrolyl, pyrazolyl, imidazolyl, triazolyl, oxazolyl, isoxazolyl, or oxadiazolyl, each of which is unsubstituted or substituted with one to two R4a groups. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is pyrazolyl, triazolyl, isoxazolyl, or oxadiazolyl, each of which is unsubstituted or substituted with one to two R4a groups. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is pyrazolyl or oxadiazolyl, each of which is unsubstituted or substituted with one to two R4a groups.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is pyrrolyl, pyrazolyl, imidazolyl, 1,2,3-triazolyl, 1,2,4-triazolyl, oxazolyl, isoxazolyl, 1,2,3-oxadiazolyl, 1,2,4-oxadiazolyl, 1,2,5-oxadiazolyl, or 1,3,4-oxadiazolyl, each of which is unsubstituted or substituted with one to two R4a groups. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is pyrazolyl, 1,2,3-triazolyl, 1,2,4-triazolyl, isoxazolyl, or 1,2,5-oxadiazolyl, each of which is unsubstituted or substituted with one to two R4a groups. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is pyrazolyl or 1,2,5-oxadiazolyl, each of which is unsubstituted or substituted with one to two R4a groups.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4a is —C(1-4)alkyl, —O—C(1-4)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, or —C(0-2)alkyl-C(3-4)cycloalkyl, wherein the —C(1-4)alkyl, —O—C(1-4)alkyl, —C(1-4)alkyl-O—C(1-4)alkyl, and —C(0-2)alkyl-C(3-4)cycloalkyl are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH3, —CD3, —CD2CD3, —CH2F, —CHF2, and —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4a is —C(1-6)alkyl, —O—C(1-6)alkyl, or —C(0-2)alkyl-C(3-6)cycloalkyl, each of which are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH3, —CD3, —CD2CD3, —CH2F, —CHF2, and —CF3. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4a is —C(1-4)alkyl, —O—C(1-4)alkyl, or —C(0-2)alkyl-C(3-4)cycloalkyl, each of which are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH3, —CD3, —CD2CD3, —CH2F, —CHF2, and —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4a is —C(1-6)alkyl or —C(0-2)alkyl-C(3-6)cycloalkyl, each of which are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH3, —CD3, —CD2CD3, —CH2F, —CHF2, and —CF3. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4a is —C(1-4)alkyl or —C(0-2)alkyl-C(3-4)cycloalkyl, each of which are unsubstituted or substituted with one to six substituents independently selected from fluorine, —CH3, —CD3, —CD2CD3, —CH2F, —CHF2, and —CF3.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4a is methyl, ethyl, isopropyl, —CD2CD3, —CHF2, —CF3, —CH2CH2CF3, —OCH3, —OCH2CHF2, —CH2OCHF2, cyclopropyl, or —CH2-cyclopropyl.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4a is methyl, isopropyl, —CD2CD3, —CH2CH2CF3, —OCH2CHF2, —CH2OCHF2, cyclopropyl, or —CH2-cyclopropyl.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4a is methyl, ethyl, isopropyl, —CHF2, —CF3, —OCH3, or cyclopropyl.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4a is methyl, isopropyl, or cyclopropyl.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein R4 is
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, that is a deuterated isotope comprising one to thirty deuterium atoms. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, that is a deuterated isotope comprising one to fifteen deuterium atoms. In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, that is a deuterated isotope comprising one to seven deuterium atoms.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having a structure as shown in Tables 1A, 1B, 1C, 1D, 1E, and 1F.
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, selected from the group consisting of:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, selected from the group consisting of:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, selected from the group consisting of:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, selected from the group consisting of:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, selected from the group consisting of:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having the following structure:
- In some embodiments, disclosed herein is a compound of Formula I, or a pharmaceutically acceptable salt thereof, having a structure as shown in Tables 2A, 2B, 2C, 2D, and 2E.
- In some embodiments, disclosed herein is a pharmaceutical composition, comprising a compound of Formula I, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier. In some embodiments, the pharmaceutical composition is formulated for oral administration (e.g., a tablet or capsule).
- In some embodiments, disclosed herein is a pharmaceutical composition made by mixing a compound of Formula I, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier.
- In some embodiments, disclosed herein is a process for making a pharmaceutical composition comprising mixing a compound of Formula I, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier.
- The present application is also directed to a method for treating and/or ameliorating a IL-17 mediated inflammatory syndrome, disorder or disease comprising administering to a subject in need thereof an effective amount of a compound of Formula I, or pharmaceutically acceptable salt thereof, composition thereof, or medicament thereof.
- In some embodiments, disclosed herein is a method for treating or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof.
- In some embodiments, disclosed herein is a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is selected from the group consisting of: psoriasis, psoriatic arthritis, rheumatoid arthritis, ankylosing spondylitis, hidradenitis suppurativa, bullous pemphigoid, atopic dermatitis, vitiligo, multiple sclerosis, asthma, uveitis, chronic obstructive pulmonary disorder, multiple myeloma, and systemic lupus erythematosus.
- In some embodiments, disclosed herein is a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is psoriasis.
- In some embodiments, disclosed herein is a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is psoriatic arthritis.
- In some embodiments, disclosed herein is a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is rheumatoid arthritis.
- In some embodiments, disclosed herein is a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is ankylosing spondylitis.
- In some embodiments, disclosed herein is a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is hidradenitis suppurativa.
- In some embodiments, disclosed herein is a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is bullous pemphigoid.
- In some embodiments, disclosed herein is a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is atopic dermatitis.
- In some embodiments, disclosed herein is a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is vitiligo.
- In some embodiments, disclosed herein is a method for treating or ameliorating and/an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is multiple sclerosis.
- In some embodiments, disclosed herein is a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is systemic lupus erythematosus.
- In some embodiments, disclosed herein is a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is asthma.
- In some embodiments, disclosed herein is a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is uveitis.
- In some embodiments, disclosed herein is a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is chronic obstructive pulmonary disorder.
- In some embodiments, disclosed herein is a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is multiple myeloma.
- In some embodiments, disclosed herein is a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is selected from the group consisting of: psoriasis, psoriatic arthritis, rheumatoid arthritis, ankylosing spondylitis, hidradenitis suppurativa, bullous pemphigoid, atopic dermatitis, vitiligo, multiple sclerosis, asthma, uveitis, chronic obstructive pulmonary disorder, multiple myeloma, and systemic lupus erythematosus, wherein the compound of Formula I or the pharmaceutically acceptable salt thereof is administered orally (e.g., as a tablet or capsule).
- In some embodiments, disclosed herein is a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is selected from the group consisting of: psoriasis, psoriatic arthritis, rheumatoid arthritis, ankylosing spondylitis, hidradenitis suppurativa, bullous pemphigoid, atopic dermatitis, vitiligo, multiple sclerosis, asthma, uveitis, chronic obstructive pulmonary disorder, multiple myeloma, and systemic lupus erythematosus, wherein the therapeutically effective amount is a dose of about 10 mg to 300 mg QD. In some embodiments, the therapeutically effective amount is a dose of about 20 mg to 200 mg QD. In some embodiments, the therapeutically effective amount is a dose of about 50 mg to 100 mg QD.
- In some embodiments, disclosed herein is a method for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the IL-17A mediated inflammatory syndrome, disorder, or disease is selected from the group consisting of: psoriasis, psoriatic arthritis, rheumatoid arthritis, ankylosing spondylitis, hidradenitis suppurativa, bullous pemphigoid, atopic dermatitis, vitiligo, multiple sclerosis, asthma, uveitis, chronic obstructive pulmonary disorder, multiple myeloma, and systemic lupus erythematosus, wherein the therapeutically effective amount is a dose of about 10 mg to 300 mg BID. In some embodiments, the therapeutically effective amount is a dose of about 20 mg to 200 mg BID. In some embodiments, the therapeutically effective amount is a dose of about 50 mg to 100 mg BID.
- In some embodiments, disclosed herein is the use of a therapeutically effective amount of compound of Formula I, or a pharmaceutically acceptable salt thereof, for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease selected from the group consisting of: psoriasis, psoriatic arthritis, rheumatoid arthritis, ankylosing spondylitis, hidradenitis suppurativa, bullous pemphigoid, atopic dermatitis, vitiligo, multiple sclerosis, asthma, uveitis, chronic obstructive pulmonary disorder, multiple myeloma, and systemic lupus erythematosus.
- In some embodiments, disclosed herein is the use of a compound of Formula I, or pharmaceutically acceptable salt thereof, in the manufacture of a medicament for treating and/or ameliorating an IL-17A mediated inflammatory syndrome, disorder, or disease selected from the group consisting of: psoriasis, psoriatic arthritis, rheumatoid arthritis, ankylosing spondylitis, hidradenitis suppurativa, bullous pemphigoid, atopic dermatitis, vitiligo, multiple sclerosis, asthma, uveitis, chronic obstructive pulmonary disorder, multiple myeloma, and systemic lupus erythematosus.
- In some embodiments, disclosed herein is a method for treating and/or ameliorating an IL-17 mediated inflammatory syndrome, disorder or disease comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or pharmaceutically acceptable salt thereof, a composition thereof, or a medicament thereof.
- In some embodiments, disclosed herein is a method of treating and/or ameliorating an IL-17 mediated inflammatory syndrome, disorder or disease, wherein the syndrome, disorder or disease is selected from the group consisting of: psoriasis, psoriatic arthritis, rheumatoid arthritis, ankylosing spondylitis, hidradenitis suppurativa, atopic dermatitis, vitiligo, multiple sclerosis, asthma, allergic asthma, steroid resistant asthma, neutrophilic asthma, chronic obstructive pulmonary disease, uveitis, multiple myeloma, and systemic lupus erythematosus, comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or pharmaceutically acceptable salt thereof, a composition thereof, or a medicament thereof.
- In some embodiments, disclosed herein is a method of treating or ameliorating an IL-17 mediated inflammatory syndrome, disorder or disease, wherein the syndrome, disorder or disease is selected from the group consisting of: psoriasis, psoriatic arthritis, and ankylosing spondylitis, comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or pharmaceutically acceptable salt thereof, a composition thereof, or a medicament thereof.
- In some embodiments, disclosed herein are methods of modulating IL-17 activity in a mammal by administration of a therapeutically effective amount of at least one compound of Formula I, or pharmaceutically acceptable salt thereof.
- Also disclosed herein is a method of inhibiting production of interleukin-17, comprising administering to a subject in need thereof a therapeutically effective amount of a compound of Formula I, or pharmaceutically acceptable salt thereof.
- A compound of Formula I, or pharmaceutically acceptable salt thereof, a composition thereof, or a medicament thereof may also be used in combination with one or more additional therapeutic agents.
- In some embodiments, the one or more additional therapeutic agents is selected from the group consisting of anti-inflammatory agents, immunomodulatory agents, and immunosuppressive agents.
- In some embodiments, the one or more additional therapeutic agents is selected from the group consisting of: anti-TNFalpha agents such as infliximab (Remicade®), adalimumab (Humira®), certolizumab pegol (Cimzia®), golimumab (Simponi®), etanercept (Enbrel®), thalidomide (Immunoprin®), lenalidomide (Revlimid®), and pomalidomide (Pomalyst®/Imnovid®); anti-p40 antibody agents such as ustekinumab (Stelara®); and anti-p19 antibody agents such as guselkumab (Tremfya®), tildrakizumab (Ilumya™/Ilumetri), risankizumab (Skyrizi®), and mirikizumab.
- In some embodiments, disclosed herein is a method of treating and/or ameliorating an IL-17 mediated inflammatory syndrome, disorder or disease, in a subject in need thereof comprising administering to the subject a therapeutically effective amount of the compound of Formula I, or pharmaceutically acceptable salt thereof, composition thereof, or medicament thereof in a combination therapy with one or more additional therapeutic agents, such as anti-inflammatory agents, immunomodulatory agents, or immunosuppressive agents, wherein said syndrome, disorder or disease is selected from the group consisting of psoriasis, psoriatic arthritis, rheumatoid arthritis, ankylosing spondylitis, hidradenitis suppurativa, atopic dermatitis, vitiligo, multiple sclerosis, asthma, allergic asthma, steroid resistant asthma, neutrophilic asthma, chronic obstructive pulmonary disease, uveitis, multiple myeloma, and systemic lupus erythematosus.
- In some embodiments, disclosed herein is a method of treating and/or ameliorating an IL-17 mediated inflammatory syndrome, disorder or disease, in a subject in need thereof comprising administering to the subject a therapeutically effective amount of the compound of Formula I, or pharmaceutically acceptable salt thereof, composition thereof, or medicament thereof in a combination therapy with one or more additional therapeutic agents, such as anti-inflammatory agents, or immunosuppressive agents, wherein said syndrome, disorder or disease is psoriasis, psoriatic arthritis, ankylosing spondylitis. In some embodiments, the IL-17 mediated inflammatory syndrome, disorder or disease is psoriasis. In some embodiments, the IL-17 mediated inflammatory syndrome, disorder or disease is psoriatic arthritis. In some embodiments, the IL-17 mediated inflammatory syndrome, disorder or disease is ankylosing spondylitis.
- When employed as IL-17A modulators, the compounds disclosed herein may be administered in an effective amount within the dosage range of about 0.5 mg to about 1 g, preferably between about 0.5 mg to about 500 mg, in single or divided daily doses. In some embodiments, the dosage amount is about 5 mg to 400 mg. In some embodiments, the dosage amount is about 10 mg to 300 mg. In some embodiments, the dosage amount is about 0.5, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 mg of a compound of Formula I, or pharmaceutically acceptable salt thereof. In some embodiments, the dosage amount is about 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, or 200 mg of a compound of Formula I, or pharmaceutically acceptable salt thereof. In some embodiments, the dosage amount is about 200, 205, 210, 215, 220, 225, 230, 235, 240, 245, 250, 255, 260, 265, 270, 275, 280, 285, 290, 295, or 300 mg of a compound of Formula I, or pharmaceutically acceptable salt thereof. In some embodiments, the dosage amount is about 300, 315, 320, 325, 330, 335, 340, 345, 350, 355, 360, 365, 370, 375, 380, 385, 390, 395, or 400 mg of a compound of Formula I, or pharmaceutically acceptable salt thereof. In some embodiments, the dosage amount is about 400, 405, 410, 415, 420, 425, 430, 435, 440, 445, 450, 455, 460, 465, 470, 475, 480, 485, 490, 495, or 500 mg of a compound of Formula I, or pharmaceutically acceptable salt thereof.
- In some embodiments, a compound of Formula I, or pharmaceutically acceptable salt thereof, may be administered in an effective amount within the dosage range of about 10 mg to 300 mg QD. In some embodiments, a compound of Formula I, or pharmaceutically acceptable salt thereof, may be administered in an effective amount within the dosage range of about 20 mg to 200 mg QD. In some embodiments, a compound of Formula I, or pharmaceutically acceptable salt thereof, may be administered in an effective amount within the dosage range of about 50 mg to 100 mg QD.
- In some embodiments, a compound of Formula I, or pharmaceutically acceptable salt thereof, may be administered in an effective amount within the dosage range of about 10 mg to 300 mg BID. In some embodiments, a compound of Formula I, or pharmaceutically acceptable salt thereof, may be administered in an effective amount within the dosage range of about 20 mg to 200 mg BID. In some embodiments, a compound of Formula I, or pharmaceutically acceptable salt thereof, may be administered in an effective amount within the dosage range of about 50 mg to 100 mg BID.
- The dosage administered will be affected by factors such as the route of administration, the health, weight and age of the recipient, the frequency of the treatment and the presence of concurrent and unrelated treatments.
- It is also apparent to one skilled in the art that the therapeutically effective dose for compounds of the present invention or a pharmaceutical composition thereof will vary according to the desired effect. Therefore, optimal dosages to be administered may be readily determined by one skilled in the art and will vary with the particular compound used, the mode of administration, the strength of the preparation, and the advancement of the disease condition. In addition, factors associated with the particular subject being treated, including subject age, weight, diet and time of administration, will result in the need to adjust the dose to an appropriate therapeutic level. The above dosages are thus exemplary of the average case. There can, of course, be individual instances where higher or lower dosage ranges are merited, and such are within the scope of this invention.
- Pharmaceutically acceptable acidic/anionic salts include, and are not limited to acetate, benzenesulfonate, benzoate, bicarbonate, bitartrate, bromide, calcium edetate, camsylate, carbonate, chloride, citrate, dihydrochloride, edetate, edisylate, estolate, esylate, fumarate, glyceptate, gluconate, glutamate, glycollylarsanilate, hexylresorcinate, hydrabamine, hydrobromide, hydrochloride, hydroxynaphthoate, iodide, isethionate, lactate, lactobionate, malate, maleate, mandelate, mesylate, methylbromide, methylnitrate, methylsulfate, mucate, napsylate, nitrate, pamoate, pantothenate, phosphate/diphosphate, polygalacturonate, salicylate, stearate, subacetate, succinate, sulfate, tannate, tartrate, teoclate, tosylate and triethiodide. Organic or inorganic acids also include, and are not limited to, hydriodic, perchloric, sulfuric, phosphoric, propionic, glycolic, methanesulfonic, hydroxyethanesulfonic, oxalic, 2-naphthalenesulfonic, p-toluenesulfonic, cyclohexanesulfamic, saccharinic or trifluoroacetic acid.
- Pharmaceutically acceptable basic/cationic salts include, and are not limited to aluminum, 2-amino-2-hydroxymethyl-propane-1,3-diol (also known as tris(hydroxymethyl)aminomethane, tromethane or “TRIS”), ammonia, benzathine, t-butylamine, calcium, calcium gluconate, calcium hydroxide, chloroprocaine, choline, choline bicarbonate, choline chloride, cyclohexylamine, diethanolamine, ethylenediamine, lithium, LiOMe, L-lysine, magnesium, meglumine, NH3, NH4OH, N-methyl-D-glucamine, piperidine, potassium, potassium-t-butoxide, potassium hydroxide (aqueous), procaine, quinine, sodium, sodium carbonate, sodium-2-ethylhexanoate, sodium hydroxide, triethanolamine, or zinc.
- The compounds of Formula I, or pharmaceutically acceptable salt thereof, may be formulated into pharmaceutical compositions comprising any known pharmaceutically acceptable carriers. Exemplary carriers include, but are not limited to, any suitable solvents, dispersion media, coatings, antibacterial and antifungal agents and isotonic agents. Exemplary excipients that may also be components of the formulation include fillers, binders, disintegrating agents and lubricants.
- The pharmaceutically-acceptable salts of the compounds of Formula I include the conventional non-toxic salts or the quaternary ammonium salts which are formed from inorganic or organic acids or bases. Examples of such acid addition salts include acetate, adipate, benzoate, benzenesulfonate, citrate, camphorate, dodecylsulfate, hydrochloride, hydrobromide, lactate, maleate, methanesulfonate, nitrate, oxalate, pivalate, propionate, succinate, sulfate and tartrate. Base salts include ammonium salts, alkali metal salts such as sodium and potassium salts, alkaline earth metal salts such as calcium and magnesium salts, salts with organic bases such as dicyclohexylamino salts and salts with amino acids such as arginine. Also, the basic nitrogen-containing groups may be quaternized with, for example, alkyl halides.
- The pharmaceutical compositions of the invention may be administered by any means that accomplish their intended purpose. Examples include administration by parenteral, subcutaneous, intravenous, intramuscular, intraperitoneal, transdermal, topical, buccal or ocular routes. Alternatively or concurrently, administration may be by the oral route. Suitable formulations for parenteral administration include aqueous solutions of the active compounds in water-soluble form, for example, water-soluble salts, acidic solutions, alkaline solutions, dextrose-water solutions, isotonic carbohydrate solutions and cyclodextrin inclusion complexes.
- Also disclosed herein is a method of making a pharmaceutical composition comprising mixing a pharmaceutically acceptable carrier with any of the compounds of Formula I, or pharmaceutically acceptable salt thereof. Additionally, the present application includes pharmaceutical compositions made by mixing a pharmaceutically acceptable carrier with any of the compounds of the present invention.
- Herein and throughout the application, the following abbreviations may be used.
- Å Angstrom
- Ac acetyl
- ACN acetonitrile
- atm atmosphere
- Boc tert-butoxycarbonyl
- br broad
- Bu butyl
- CDI 1,1′-carbonyldiimidazole
- Cp cyclopentadienyl
- δ NMR chemical shift in parts per million downfield from a standard
- d doublet
- d day(s)
- DCC N,N-dicyclohexylcarbodiimide
- DCM dichloromethane
- DCE dichloroethane
- Dess-Martin Periodinane 1,1,1-tris(acetyloxy)-1,1-dihydro-1,2-benziodoxol-3-(1H)-one
- DIBAL diisobutylaluminum hydride
- DIPA diisopropylamine
- DIPEA N,N-diisopropylethylamine (Hünig's base)
- DMAP 4-(dimethylamino)pyridine
- DMSO dimethyl sulfoxide
- EDCI 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide hydrochloride
- ESI electrospray ionization
- Et ethyl
- EtOAc ethyl acetate
- g gram(s)
- h hour(s)
- Hantzsch ester diethyl 1,4-dihydro-2,6-dimethyl-3,5-pyridinedicarboxylate
- HOBt 1-hydroxybenzotriazole
- HPLC high pressure liquid chromatography
- Hz Hertz
- IPA isopropanol
- J coupling constant (NMR spectroscopy)
- L liter(s)
- LC liquid chromatography
- LED light emitting diode
- m milli or multiplet
- m/z mass-to-charge ratio
- M+ parent molecular ion
- M molar (moles/liter)
- Me methyl
- MeCN acetonitrile
- min minute(s)
- MOM methoxymethyl
- μ micro
- MS mass spectrometry
- N normal (equivalent concentration)
- NMP 1-methyl-2-pyrrolidone
- NMR nuclear magnetic resonance
- PPTS pyridinium p-toluenesulfonate
- Rochelle salt potassium sodium tartrate tetrahydrate
- rt room temperature
- RuPhos Pd G3 (2-Dicyclohexylphosphino-2′,6′-diisopropoxy-1,1′-biphenyl)[2-(2′-amino-1,1′-biphenyl)]palladium(II) methanesulfonate
- s singlet
- SFC supercritical fluid chromatography
- spt septet
- t triplet
- T3P 1-propanephosphonic anhydride
- TEA triethylamine
- Tf trifluoromethanesulfonate
- TFA trifluoroacetic acid
- TFE 2,2,2-trifluoroethan-1-ol
- THF tetrahydrofuran
- TLC thin layer chromatography
- TMP 2,2,6,6-tetramethylpiperidine
- TMS trimethylsilyl
- In some embodiments, provided herein are processes and intermediates disclosed herein that are useful for preparing a compound of the disclosure or pharmaceutically acceptable salts thereof.
- Compounds of Formula I can be prepared according to Scheme 1. Compounds A-I can be converted to compounds A-II through a sequence of reactions which will be known as “urea formation conditions”. This can be achieved by reacting an amine as present in compounds A-I with an activated amino alcohol precursor, such as 3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl trifluoromethanesulfonate. The adduct formed from this reaction is then subjected to hydrazine in a solvent such as ethanol. The resulting diamine can then be cyclized using CDI or triphosgene and DIPEA in a solvent such as THE or DCM to afford compounds A-II. Alternatively, compounds A-II can be prepared by reacting an amine as present in compounds A-I via a three-step process. Initial reaction of compounds A-I with a suitably protected amino aldehyde such as 2-(1-(1,3-dioxoisoindolin-2-yl)cyclopropyl)acetaldehyde, in the presence of a reducing agent such as NaCNBH3 in a solvent such as methanol in the presence or absence of additives such as acetic acid provides a secondary amine adduct (structure not shown). In step 2, this adduct is then subjected to hydrazine in a solvent such as ethanol to afford a diamine (structure not shown). Finally in step 3, this diamine can then be treated with CDI or triphosgene and DIPEA in a solvent such as THE or DCM to afford compounds A-II. Compounds A-II are treated with an acid such as TFA in a solvent such as DCM to afford compounds A-III. These conditions are herein known as “Boc deprotection conditions”. Amide bond formation between amines A-III and carboxylic acids (R4CO2H) can be achieved through the use of a coupling agent, such as HATU, EDCI or 2-chloro-1-methylpyridinium iodide in the presence of a base, such as DIPEA or TEA, in a solvent, such as DMF, MeCN, or DCM, with or without an additive, such as HOBt, to yield compounds of Formula I. Alternatively, amide bond formation can be achieved by treatment of amines A-III with a reagent such as a carboxylic acid chloride (R4CO2Cl) in the presence or absence of additives such as DIPEA or DMAP in solvents such as ACN, DCM or THE to yield compounds of Formula I. In addition, amines A-III can be treated with N-hydroxysuccinate esters in the presence of reagents such as DIPEA in a solvent such as acetonitrile to provide compounds of Formula I. Alternatively, amide bond formation can be achieved by treatment of amines A-III with a reagent such as an ester (R4CO2R4a wherein R4aa is —C(1-6)alkyl) with or without an additive, such as TEA, in a solvent such as ACN to afford compounds of Formula I.
- Amines A-I can also be prepared as shown in Scheme 2. Halogenated intermediates A-IV can be converted to compounds A-V via a two step sequence of 1) vinylation with a reagent such as potassium trifluoro(vinyl)boranide, and a catalyst such RuPhos Pd G3 in a solvent such as 1,4-dioxane, and 2) oxidative cleavage of the olefin prepared in the previous step with reagents such as K2OsO4.2H2O and NaIO4 in solvents such as 1,4-dioxane and water. Sulfinimine formation may be achieved using a reagent such as 2-methylpropane-2-sulfinamide in the presence of CuSO4 or Cs2CO3 in a solvent such as DCM to afford compounds A-VI. Addition of suitable nucleophiles, such as R2M where M is Li, MgCl, or MgBr to sulfinimines A-VI then affords the corresponding sulfinamines (structure not shown) that upon deprotection of the sulfinamine with a reagent such as HCl in a solvent such as 1,4-dioxane then affords amines A-I.
- Ureas A-VII may be prepared by several methods, two of such methods are described in Scheme 3. Method 1: Aldehydes A-V can be treated with diamines such as 2,2-difluoropropane-1,3-diamine dihydrochloride under reductive amination conditions such as NaCNBH3 in a solvent such as methanol in the presence of additives such as acetic acid, followed by treatment with a reagent such as triphosgene or CDI in a solvent such as DCM or THE to afford the corresponding cyclic ureas A-VII. Method 2: In a two-step method, aldehydes A-V are subjected to reductive animation conditions with a mono-protected diamine, such as tert-butyl (S)-(1-aminopropan-2-yl)carbamate, using NaCNBH3 in a solvent such as methanol in the presence of additives such as acetic acid. In the second step, the adduct formed in the first step is treated with reagents such as potassium tert-pentoxide in solvents such as tert-amyl alcohol to afford ureas A-VII. Compounds A-VII can be converted to compounds of Formula I using the methods described in Scheme 1 for the conversion of compounds A-II to compounds of Formula I.
- Intermediates A-III may also be prepared as shown in Scheme 4. Treatment of sulfinimides A-VIII with diethyl 1,4-dihydro-2,6-dimethyl-3,5-pyridinedicarboxylate and an appropriate radical precursor such as 1,3-dioxoisoindolin-2-yl 2-cyclopropoxypropanoate in a solvent such as DMSO in the presence of an amine base such as DIPEA, with 450 nm light affords the corresponding sulfinamides (structure not shown). Subsequent deprotection of the sulfinamide with a reagent such as HCl in a solvent such as 1,4-dioxane then affords amines A-III.
- Amines A-IIIa may be prepared as shown in Scheme 5. Treatment of aldehydes B-I with (S)-(−)-2-methyl-2-propanesulfinamide in the presence of a reagent such as CuSO4 and a solvent such as DCM provides the corresponding sulfinimines (structure not shown). Subsequent reaction of the sulfinimines with a reagent, such as 3-[1-(trifluoromethyl)cyclopropyl]propanoic acid and a base, such as LDA in a solvent, such as THE affords compounds B-II. Compounds B-II can be converted to compounds B-III by a two-step process. Initially, compounds B-II are treated with N-hydroxyphthalimide in the presence of a reagent such as DCC, with an additive, such as DMAP, in a solvent, such as DCM. The second step of this process is reduction of the dioxoisoindoline substituent using a reagent, such as Hantzsch ester, in the presence of a base, such as DIPEA, in a solvent, such as DMSO. Deprotection of sulfinamines B-III with a reagent such as HCl in a solvent such as 1,4-dioxane then affords amines A-IIIa.
-
- Step A: 2-Fluoro-2-methylmalonamide. Diethyl 2-fluoromalonate (2.00 g, 11.2 mmol) and anhydrous THE (40 mL) were added in one portion to a nitrogen-purged 250 mL three-neck round-bottomed flask, which was charged with t-BuOK (13.5 mL, 13.5 mmol, 1 M in THF) and the resulting mixture stirred for 0.5 h at rt. The mixture was treated with Mel (0.840 mL, 13.5 mmol), via syringe over 1 min and the resulting mixture stirred for another 1 h at rt. The mixture was then treated with ammonia (60 mL, 7 M in MeOH) in one portion and the reaction mixture was stirred for another 16 h at rt. The reaction mixture was then concentrated to dryness to provide a white solid. The solid was washed with H2O (40 mL) and dried under vacuum to afford 2-fluoro-2-methylmalonamide (80% yield) as a white solid.
- Step B: 2-Fluoro-2-methylpropane-1,3-diamine dihydrochloride. 2-Fluoro-2-methylmalonamide (1.2 g, 9.0 mmol, Step A) and THE (15 mL) were added to an oven-dried and nitrogen-purged 100 mL three-neck round-bottomed flask, which was subsequently cooled to 0° C. in an ice/water bath. The mixture was treated with BH3.THF (45 mL, 45 mmol) dropwise via constant pressure dropping funnel over 10 min. The reaction mixture was stirred for 3 h at 50° C. before treating with MeOH (5.0 mL), portion-wise over 5 min. The resulting mixture was stirred for another 1 h at rt. The reaction mixture was then concentrated to dryness and the residue dissolved in MeOH (20 mL) and HCl (5 mL, 4 M in MeOH). The resulting mixture was stirred for another 0.5 h at rt, filtered and the filter cake was dried under vacuum to afford 2-fluoro-2-methylpropane-1,3-diamine dihydrochloride (62% yield) as a white solid.
-
- Step A: tert-Butyl ((S)-(7-((R)-cyclopropyl((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. To tert-butyl ((S)-(7-((R)-amino(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (100 mg, 0.23 mmol), and 3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl trifluoromethanesulfonate (172 mg, 0.46 mmol) in acetonitrile (1.2 mL) was added DIPEA (44 μL, 0.25 mmol) and the reaction mixture was heated at 50° C. for 18 h. The reaction mixture was cooled to rt, concentrated under vacuum, and purified by silica gel chromatography (0-100% EtOAc (with 10% MeOH)/hexanes) to provide the title compound (81% yield).
- Step B: tert-Butyl ((S)-(7-((R)-((3-amino-2,2-difluoropropyl)amino)(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. To tert-butyl ((S)-(7-((R)-cyclopropyl((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (500 mg, 0.76 mmol, Step A) in EtOH (3.8 mL) was added hydrazine monohydrate (110 μL, 2.28 mmol). The reaction mixture was warmed to 35° C. and stirred for 18 h, at which time a thick slurry had formed. The reaction mixture was cooled in an ice bath, filtered, washed with 10 mL of ice cold EtOH, and the filtrate concentrated to give the title compound which was used without further purification in the next step (assume 100% yield).
- Step C: tert-Butyl ((S)-(7-((R)-cyclopropyl(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. To a stirred solution of tert-butyl ((S)-(7-((R)-((3-amino-2,2-difluoropropyl)amino)(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (0.76 mmol, theoretical, Step B) in THE (12 mL) was added CDI (185 mg, 1.14 mmol) and the reaction mixture was stirred at 60° C. for 18 h. The reaction mixture was cooled to rt, treated with aqueous 3 M NaOH (2 mL) while stirring for 10 min, then diluted with brine, and the layers separated. The organic layer was washed with brine, dried over anhydrous Na2SO4, filtered and concentrated. This material was purified by silica gel chromatography (0-100% EtOAc (with 10% MeOH)/hexanes) to provide the title compound (77% yield).
- Step D: 1-((R)-(2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)(cyclopropyl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. A vial was charged with tert-butyl ((S)-(7-((R)-cyclopropyl(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (153 mg, 0.28 mmol, Step C) and TFA (2 mL, 26.13 mmol). The reaction was stirred for 2 h at rt and then concentrated. The resulting oil was dissolved in DCM and carefully quenched by the addition of 0.5 M aqueous NaOH until the pH of the solution was >pH 7. The water layer was washed with DCM. The combined organic phases were washed with brine, dried over anhydrous Na2SO4, filtered and concentrated to give the title compound which was used without further purification (assume 100% yield).
-
- Step A: tert-Butyl ((S)-(7-((S)-1-(((R)-tert-butylsulfinyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. To an oven-dried, N2 flushed flask was added tributyl(methoxymethyl)stannane (1.41 g, 4.22 mmol) and THE (20.1 mL). The flask was cooled (−78° C.) and n-butyllithium (1.76 mL, 4.22 mmol, 2.4 M in hexanes) was added in a dropwise manner. After a further 15 min at −78° C., the reaction mixture was treated with a solution of tert-butyl ((S)-(7-((E)-(((R)-tert-butylsulfinyl)imino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (1.00 g, 2.01 mmol) in THE (5 mL) in a dropwise manner. Upon stirring at −78° C. for an additional 2 h, the reaction mixture was quenched with EtOH (0.35 mL), allowed to warm to rt, and diluted with saturated aqueous NaHCO3 and EtOAc. The layers were separated and the aqueous layer was further extracted with EtOAc. The combined organic layers were dried over anhydrous Na2SO4, filtered, and concentrated to dryness. The residue was purified by silica gel chromatography (40-100% acetone/hexanes) to give the title compound (39% yield) as the second eluting isomer.
- Step B: tert-Butyl ((S)-(7-((S)-1-amino-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound was prepared as described for the synthesis of Intermediate 9, using tert-butyl ((S)-(7-((S)-1-(((R)-tert-butylsulfinyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step A) in place of tert-butyl ((R)-1-(7-((S*)-1-(((R)-tert-butylsulfinyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate to afford the title compound as a white foam (100% yield).
- Step C: tert-Butyl ((S)-(4,4-difluorocyclohexyl)(7-((S)-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate. The title compound was prepared as described for the synthesis of Intermediate 2, Step A, using tert-butyl ((S)-(7-((S)-1-amino-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step B) in place of tert-butyl ((S)-(7-((R)-amino(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate to afford the title compound (84% yield).
- Step D: tert-Butyl ((S)-(7-((S)-1-((3-amino-2,2-difluoropropyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound was prepared as described for the synthesis of Intermediate 2, Step B, using tert-butyl ((S)-(4,4-difluorocyclohexyl)(7-((S)-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate (Step C) in place of tert-butyl ((S)-(7-((R)-cyclopropyl((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate to afford the title compound (86% yield).
- Step E: tert-Butyl ((S)-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound was prepared as described for the synthesis of Intermediate 2, Step C, using tert-butyl ((S)-(7-((S)-1-((3-amino-2,2-difluoropropyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step D) in place of tert-butyl ((S)-(7-((R)-((3-amino-2,2-difluoropropyl)amino)(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate to afford the title compound (100% yield).
- Step F: 1-((S)-1-(2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. The title compound was prepared as described for the synthesis of Intermediate 2, Step D, using tert-butyl ((S)-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step E) in place of tert-butyl ((S)-(7-((R)-cyclopropyl(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate and adding DCM (2 mL) as a co-solvent to afford the title compound that was used without further purification (93% yield).
-
- An oven dried round-bottom flask was charged with 5-chloropyridazin-3-amine (4.45 g, 34.3 mmol), tert-butyl (S)-(4-(dimethyl(oxo)-λ6-sulfaneylidene)-3-oxo-1-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)butan-2-yl)carbamate (12.7 g, 32.6 mmol), chlorocyclopentadienylbis(triphenylphosphine)ruthenium (II) (630 mg, 0.868 mmol), sodium trifluoromethanesulfonate (313 mg, 1.82 mmol) and 4 Å molecular sieves (8.9 g). Anhydrous toluene (110 mL) was added under an atmosphere of N2 and then the reaction was heated to 90° C. for 24 h. The mixture was allowed to cool to rt then filtered through diatomaceous earth (e.g., Celite®). The filter cake was washed with EtOAc and then the filtrate was concentrated under reduced pressure. The residue was purified by silica gel chromatography (0-40% EtOAc/hexanes) to provide the title compound in 28% yield.
-
- To a solution of tert-butyl (R)-(1-(7-chloroimidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (4.05 g, 9.58 mmol, Intermediate 4) and potassium vinyltrifluoroborate (1.93 g, 14.4 mmol) in 1,4-dioxane (33 mL) was added a solution of potassium phosphate tribasic (6.10 g, 28.7 mmol) in H2O (5 mL). The mixture was degassed by N2 sparging for 10 min then RuPhos Pd G3 (200 mg, 0.239 mmol) was added, the vessel sealed with a Teflon septum, and the reaction mixture was heated to 100° C. for 2 h. After this time, the mixture was concentrated under reduced pressure, diluted with H2O and extracted three times with EtOAc. The combined organic extracts were washed with brine, dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to afford the title compound that was used without further purification.
-
- To a well-stirred mixture of tert-butyl (R)-(2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)-1-(7-vinylimidazo[1,2-b]pyridazin-2-yl)ethyl)carbamate (3.97 g, 9.58 mmol, Intermediate 5) and potassium osmate(VI) dihydrate (88 mg, 0.24 mmol) in 1,4-dioxane (12 mL) was added a suspension of sodium periodate (8.20 g, 38.3 mmol) in H2O (11 mL). The reaction was stirred at rt for 3 h then filtered through diatomaceous earth (e.g., Celite®). The filter cake was washed with EtOAc and then the filtrate was concentrated under reduced pressure. The residue was purified by silica gel chromatography (10-100% EtOAc/hexanes) to provide the title compound in 69% yield.
-
- A mixture of tert-butyl (R)-(1-(7-formylimidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (2.75 g, 6.60 mmol, Intermediate 6), (R)-2-methylpropane-2-sulfinamide (1.12 g, 9.25 mmol), and Cs2CO3 (3.01 g, 9.25 mmol) in CH2C2 (21 mL) was stirred for 16 h at rt then filtered through diatomaceous earth (e.g., Celite®) and the filtrate was concentrated under reduced pressure. The residue was purified by silica gel chromatography (10-100% EtOAc/hexanes) to provide the title compound in 87% yield.
-
- A solution of tributyl(methoxymethyl)stannane (948 mg, 2.83 mmol) in THE (10 mL) was cooled to −78° C. then n-butyllithium (1.8 mL, 1.6 M in hexanes, 2.8 mmol) was added dropwise. The reaction was stirred for 20 min then a solution of tert-butyl ((R)-1-(7-((E)-(((R)-tert-butylsulfinyl)imino)methyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (700 mg, 1.35 mmol, Intermediate 7) in THE (5 mL) was added slowly over a period of 10 min. The reaction was stirred at −78° C. for 2.5 h then quenched with EtOH (0.24 mL) and allowed to warm to rt. To this mixture was added saturated aqueous NaHCO3 (1.5 mL) and potassium fluoride (1.3 g, 11 mmol, 50% w/w on diatomaceous earth (e.g., Celite®)). The resulting suspension was stirred for 16 h then the solids were removed by filtration and the filtrate was concentrated under reduced pressure. Purification by silica gel chromatography (10-100% EtOAc/hexanes) provided the title compound in 17% yield.
-
- To a solution of tert-butyl ((R)-1-(7-((S*)-1-(((R)-tert-butylsulfinyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (126 mg, 0.223 mmol, Intermediate 8) in EtOAc (1 mL) was added HCl (0.11 mL, 0.45 mmol, 4 M in 1,4-dioxane). The reaction was stirred at rt for 4.5 h then HCl (0.055 mL, 0.23 mmol, 4 M in 1,4-dioxane) was added. The reaction was stirred at rt for 30 min then diluted with H2O (5 mL). The resulting solution was washed twice with 3:2 hexanes/EtOAc and these extracts were discarded. The pH of the aqueous mixture was adjusted by the addition of Na2CO3 (71 mg). The resulting solution was extracted three times with EtOAc. The combined organic layers were dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to provide the title compound in 68% yield.
-
- Step A: tert-Butyl ((R)-1-(7-((S*)-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate. To a stirred solution of tert-butyl ((R)-1-(7-((S*)-1-amino-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (70 mg, 0.15 mmol, Intermediate 9), and 3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl trifluoromethanesulfonate (113 mg, 0.303 mmol) in acetonitrile (0.8 mL) was added DIPEA (29 μL, 0.17 mmol). The reaction mixture was heated at 50° C. for 36 h. The reaction mixture was then cooled to rt, concentrated under reduced pressure, and diluted with H2O. The mixture was extracted twice with EtOAc then the combined organic extracts were washed with saturated aqueous NH4Cl and brine, dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to afford the title compound that was used without further purification.
- Step B: tert-Butyl ((R)-1-(7-((S*)-1-((3-amino-2,2-difluoropropyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate. To a solution of tert-butyl ((R)-1-(7-((S*)-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (104 mg, 0.152 mmol, Step A) in EtOH (1.5 mL) was added hydrazine monohydrate (120 μL, 1.85 mmol). The reaction mixture was heated to 50° C. and stirred for 2 h, at which time a thick slurry had formed. The reaction mixture was diluted with H2O and extracted twice with EtOAc. The combined organic extracts were washed with water and brine, dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to afford the title compound that was used without further purification.
- Step C: tert-Butyl ((R)-1-(7-((S*)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate. To a stirred solution of tert-butyl ((R)-1-(7-((S*)-1-((3-amino-2,2-difluoropropyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (84 mg, 0.15 mmol, Step B) in THE (3 mL) was added CDI (74 mg, 0.46 mmol) and the reaction mixture was heated to 60° C. for 1 h. The reaction mixture was then cooled to rt then quenched with H2O. The mixture was diluted with EtOAc, washed with 0.05 M aqueous HCl and brine, dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to provide the title compound that was used without further purification.
-
- HCl (0.76 mL, 3.0 mmol, 4 M in 1,4-dioxane) was added to tert-butyl ((R)-1-(7-((S*)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (84 mg, 0.15 mmol, Intermediate 10). The reaction was stirred at rt for 45 min then diluted with MeOH and concentrated under reduced pressure. The residue was dissolved in MeCN then concentrated under reduced pressure to provide the title compound that was used without further purification.
-
- To a reaction vial containing NaH (0.500 g, 12.5 mmol, 60% in mineral oil) under N2 was added DMF (40 mL). The resulting suspension was cooled to 0° C. then cyclopropanol (0.789 mL, 12.5 mmol) was added dropwise. The reaction was stirred at this temperature for 10 min then tributyl(iodomethyl)stannane (3.32 mL, 10.0 mmol) was added. The reaction was allowed to warm to rt and stirred for 1 h then quenched with H2O and diluted with aqueous 5% LiCl. The resulting mixture was extracted with CH2Cl2 (3×25 mL) then the combined organics were washed with brine, dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure. Purification by silica gel chromatography (0-20% EtOAc/hexanes) provided the title compound in 100% yield.
-
- A solution of tributyl(cyclopropoxymethyl)stannane (800 mg, 2.22 mmol, Intermediate 12) in THE (10 mL) was cooled to −78° C. then n-butyllithium (1.4 mL, 1.6 M in hexanes, 2.2 mmol) was added dropwise. The reaction was stirred for 20 min then a solution of tert-butyl ((S)-(7-((E)-(((R)-tert-butylsulfinyl)imino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (525 mg, 1.06 mmol) in THE (5 mL) was added slowly over a period of 10 min. The reaction was stirred at −78° C. for 30 min then quenched with EtOH (0.19 mL) and allowed to warm to rt. The resulting mixture was diluted with EtOAc, washed with saturated aqueous NaHCO3 and brine, dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (10-60% acetone/(hexanes with 0.1% TEA)) to provide the title compound in 48% yield. The stereochemistry was assigned by Mosher ester analysis of Intermediate 14.
-
- To a solution of tert-butyl ((S)-(7-((S)-1-(((R)-tert-butylsulfinyl)amino)-2-cyclopropoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (300 mg, 0.527 mmol, Intermediate 13) in EtOAc (3.5 mL) was added HCl (0.33 mL, 1.3 mmol, 4 M in 1,4-dioxane). The reaction was stirred at rt for 1 h then diluted with H2O. The resulting solution was washed twice with hexanes and these extracts were discarded. The pH of the aqueous mixture was adjusted by the addition of 3 M aqueous NaOH (0.7 mL) then extracted three times with EtOAc. The combined organic layers were dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to provide the title compound that was used without further purification. The stereochemistry was assigned by Mosher ester analysis.
-
- Step A: tert-Butyl ((S)-(7-((S)-2-cyclopropoxy-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)ethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. To a stirred solution of tert-butyl ((S)-(7-((S)-1-amino-2-cyclopropoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (245 mg, 0.527 mmol, Intermediate 14), and 3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl trifluoromethanesulfonate (354 mg, 0.949 mmol) in acetonitrile (2.6 mL) was added DIPEA (138 μL, 0.791 mmol). The reaction mixture was heated at 55° C. for 16 h. The reaction was cooled to rt and concentrated under reduced pressure. Purification by silica gel chromatography (10-100% (10% MeOH in EtOAc)/hexanes) provided the title compound in 55% yield.
- Step B: tert-Butyl ((S)-(7-((S)-1-((3-amino-2,2-difluoropropyl)amino)-2-cyclopropoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. To a solution of tert-butyl ((S)-(7-((S)-2-cyclopropoxy-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)ethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (0.20 g, 0.29 mmol, Step A) in EtOH (3 mL) was added hydrazine monohydrate (220 μL, 2.9 mmol). The reaction mixture was heated to 50° C. and stirred for 2 h, at which time a thick slurry had formed. The reaction mixture was diluted with EtOAc then washed with aqueous 5% LiCl and brine, dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to afford the title compound in 92% yield.
- Step C: tert-Butyl ((S)-(7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. A stirred solution of tert-butyl ((S)-(7-((S)-1-((3-amino-2,2-difluoropropyl)amino)-2-cyclopropoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (150 mg, 0.27 mmol, Step B) and DIPEA. (116 μL, 0.671 mmol) in CH2Cl2 (5 mL) was cooled to 0° C. then a solution of triphosgene (32 mg, 0.11 mmol) in CH2Cl2 (0.5 mL) was added. The reaction was stirred for 15 min at 0° C. then quenched with H2O and 2 M aqueous HCl (0.67 mL, 1.3 mmol). The resulting mixture was extracted three times with CH2Cl2 then the combined organic layers were dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to provide the title compound that was used without further purification.
-
- The title compound was prepared as described for the synthesis of Intermediate 11, using tert-butyl ((S)-(7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Intermediate 15) in place of tert-butyl ((R)-1-(7-((S*)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate. 1-((S)-1-(2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride was converted to 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (hereafter known as Intermediate 16A) by dissolving 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride (1.12 g, 1.87 mmol) in EtOAc (50 mL) and saturated aqueous NaHCO3 (30 mL) and then adjusting the pH of the solution to pH 11 by the addition of 3 M aqueous NaOH. The layers were separated and the aqueous layer further extracted with EtOAc (4×25 mL). The organic layers were combined, washed with brine, dried over anhydrous Na2SO4, filtered, and concentrated to dryness to provide Intermediate 16A as a white solid (99% yield).
-
- To a flask charged with tert-butyl (R)-(1-(7-formylimidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (72 mg, 0.173 mmol, Intermediate 6) and 2,2-difluoropropane-1,3-diamine dihydrochloride (63.3 mg, 0.346 mmol) in DCM (6 mL) was added triethylamine (0.121 mL, 0.865 mmol). The reaction was stirred at rt until the solids dissolved and then heated to 40° C. After 1 h, reaction was cooled to rt and MeOH (1 mL), sodium cyanoborohydride (65.2 mg, 1.04 mmol), and AcOH (0.040 mL, 0.692 mmol) were added and the resulting mixture stirred at rt. After 1 h, LCMS analysis indicated that all of the tert-butyl (R)-(1-(7-formylimidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate had been consumed. The mixture was concentrated under reduced pressure and diluted with saturated aqueous NaHCO3 and CH2Cl2. The resulting mixture was extracted twice with CH2Cl2. The combined organic layers were washed with brine, dried over anhydrous MgSO4, filtered, and concentrated under reduced pressure to provide the title compound that was used without further purification.
-
- To tert-butyl (R)-(1-(7-(((3-amino-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (84.1 mg, 0.165 mmol, Intermediate 17) in THF (4.3 mL) was added CDI (84.1 mg, 0.519 mmol). The resulting mixture was heated to 65° C. After 75 min, LCMS analysis indicated that all of the tert-butyl (R)-(1-(7-(((3-amino-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate had been consumed. The mixture was cooled to rt and quenched with 1 M aqueous NaOH (1.5 mL). The mixture was then concentrated under reduced pressure and partitioned between saturated aqueous NaHCO3 and EtOAc. The aqueous layer was further extracted (twice) with EtOAc. The combined organic layers were washed with brine, dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure. Purification by silica gel chromatography (10-100% (10% MeOH in EtOAc)/hexanes) provided the title compound in 67% yield (62.4 mg).
-
- To a mixture of tert-butyl (R)-(1-(7-((5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (62.4 mg, 0.116 mmol, Intermediate 18) in CH2Cl2 (21 mL) was added 2,2,2-trifluoroacetic acid (0.18 mL, 2.33 mmol) and the resulting mixture was stirred at rt. After 20 min, LCMS analysis indicated that all of the of tert-butyl (R)-(1-(7-((5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate had been consumed. The mixture was diluted with EtOAc (2 mL) and washed twice with saturated aqueous NaHCO3. The aqueous layer was then washed with 4:1 DCM/IPA mixture. The combined organic layers were washed with brine, dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to provide the title compound that was used without further purification.
-
- Step A: tert-Butyl (S)-((7-(((3-amino-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. A solution of tert-butyl (S)-((4,4-difluorocyclohexyl)(7-formylimidazo[1,2-b]pyridazin-2-yl)methyl)carbamate (300 mg, 0.761 mmol), 2,2-difluoropropane-1,3-diamine dihydrochloride (418 mg, 2.28 mmol), and triethylamine (0.742 mL, 5.32 mmol) in DCM (8.6 mL) was stirred at rt. After 2 h, acetic acid (0.261 mL, 4.56 mmol) and MeOH (1.5 mL) were added. After a further 5 min, sodium cyanoborohydride (167 mg, 2.65 mmol) was added and the heterogenous reaction mixture was stirred for 16 h at rt. The reaction mixture was diluted with DCM (30 mL), saturated aqueous sodium bicarbonate (30 mL), and aqueous 3 M sodium hydroxide (30 mL) were added. The layers were separated, and the aqueous layer was extracted with DCM (3×20 mL). The combined organic layers were dried over anhydrous Na2SO4, filtered and concentrated to a gum that was used directly in the next step without further purification.
- Step B: tert-Butyl (S)-((7-((5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The tert-butyl (S)-((7-(((3-amino-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (0.76 mmol, theoretical) prepared in Step A was diluted with THE (10 mL) and treated with CDI (370 mg, 2.28 mmol). The resulting mixture was stirred at rt for 45 min. The reaction mixture was then diluted with THE (90 mL) and warmed to 60° C. for 45 min. The reaction mixture was cooled to rt and treated with aqueous 3 M sodium hydroxide (3 mL). After stirring for 1 h at rt, the reaction mixture was diluted with brine (20 mL) and the layers were separated. The organic layer was washed with aqueous 0.1 M HCl (2×10 mL) and brine (2×10 mL), dried over anhydrous MgSO4, filtered and concentrated to a gum that was used directly in the next step without further purification.
- Step C: (S)-1-((2-(Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. To a cooled (0° C.) solution of tert-butyl (S)-((7-((5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (500 mg) prepared in Step B in DCM (3.7 mL) was added TFA (3.7 mL, 48 mmol). After stirring at 0° C. for 1.5 h, the reaction mixture was concentrated to dryness, and then diluted with EtOAc (20 mL), brine (30 mL), aqueous 3 M sodium hydroxide (5 mL), and saturated aqueous sodium bicarbonate (3 mL). The layers were separated, and the aqueous layer was extracted with EtOAc (2×20 mL) and DCM (6×15 mL).
- The combined organic extracts were dried over anhydrous Na2SO4, filtered and concentrated to dryness to provide the title compound as a yellow film (88.3% yield over 3 steps) that was used without further purification.
-
- Step A: tert-Butyl ((1S)-(7-(((3-((tert-butoxycarbonyl)amino)-2-methylpropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 20 Step A using tert-butyl (3-amino-2-methylpropyl)carbamate) in place of 2,2-difluoropropane-1,3-diamine dihydrochloride.
- Step B: tert-Butyl ((1S)-(4,4-difluorocyclohexyl)(7-((5-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate. tert-Butyl ((1S)-(7-(((3-((tert-butoxycarbonyl)amino)-2-methylpropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (0.76 mmol, theoretical, Step A) was diluted with THE (10 mL), treated with potassium tert-pentoxide (1.5 mL, 2 M in tert-amyl alcohol), and warmed to 60° C. After 2.5 h the reaction mixture was cooled to rt, treated with aqueous 1 M HCl (5 mL), and diluted with EtOAc (30 mL), brine (30 mL) and saturated aqueous NaHCO3 (30 mL). The layers were separated, and the aqueous layer was extracted with EtOAc (3×20 mL). The combined organics were dried over anhydrous Na2SO4, filtered, and concentrated to dryness to give an oil that was used in the next step without further purification.
- Step C: 1-((2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5-methyltetrahydropyrimidin-2(1H)-one. The title compound was prepared as described for the synthesis of Intermediate 20 Step C using tert-butyl ((1S)-(4,4-difluorocyclohexyl)(7-((5-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate (Step B) in place of tert-butyl (S)-((7-((5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate to provide the title compound (312 mg,) that was used without further purification.
-
- Step A: tert-Butyl (S)-((7-(((4-aminobutyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 20 Step A using 1,4-diaminobutane in place of 2,2-difluoropropane-1,3-diamine dihydrochloride.
- Step B: tert-Butyl (S)-((4,4-difluorocyclohexyl)(7-((2-oxo-1,3-diazepan-1-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 20 Step B using tert-butyl (S)-((7-(((4-aminobutyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step A) in place of tert-butyl (S)-((7-(((3-amino-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step C: (S)-1-((2-(Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-1,3-diazepan-2-one. The title compound was synthesized in a manner analogous to Intermediate 20 Step C using tert-butyl (S)-((4,4-difluorocyclohexyl)(7-((2-oxo-1,3-diazepan-1-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate (Step B) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one to give the title compound that was used without further purification.
-
- Step A: tert-Butyl (S)-((7-(((3-amino-2,2-dimethylpropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 20 Step A using 2,2-dimethylpropane-1,3-diamine in place of 2,2-difluoropropane-1,3-diamine dihydrochloride.
- Step B: tert-Butyl (S)-((4,4-difluorocyclohexyl)(7-((5,5-dimethyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 20 Step B using tert-butyl (S)-((7-(((3-amino-2,2-dimethylpropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step A) in place of tert-butyl (S)-((7-(((3-amino-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step C: (S)-1-((2-(Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-dimethyltetrahydropyrimidin-2(1H)-one. The title compound was synthesized in a manner analogous to Intermediate 20, Step C using tert-butyl (S)-((4,4-difluorocyclohexyl)(7-((5,5-dimethyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate (Step B) in place of tert-butyl (S)-((7-((5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate to give the title compound that was used without further purification.
-
- Step A: tert-Butyl (S)-((7-(((3-aminopropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 20 Step A using 1,3-diaminopropane in place of 2,2-difluoropropane-1,3-diamine dihydrochloride.
- Step B: tert-Butyl (S)-((4,4-difluorocyclohexyl)(7-((2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 20 Step B using tert-butyl (S)-((7-(((3-aminopropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step A) in place of tert-butyl (S)-((7-(((3-amino-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step C: (S)-1-((2-(Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one. The title compound was synthesized in a manner analogous to Intermediate 20 Step C using tert-butyl (S)-((4,4-difluorocyclohexyl)(7-((2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate (Step B) in place of tert-butyl (S)-((7-((5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate to give the title compound that was used without further purification.
-
- Step A. Tributyl(ethoxymethyl)stannane. The title compound was prepared as described for the synthesis of Intermediate 12, using ethanol in place of cyclopropanol in 86% yield.
- Step B. tert-Butyl ((S)-(7-((S*)-1-(((R)-tert-butylsulfinyl)amino)-2-ethoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound was prepared in a manner analogous to the synthesis of Intermediate 13, using tributyl(ethoxymethyl)stannane (Step A) in place of tributyl(cyclopropoxymethyl)stannane in 56% yield.
- Step C. tert-Butyl ((S)-(7-((S*)-1-amino-2-ethoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound was prepared as described for the synthesis of Intermediate 14, using tert-butyl ((S)-(7-((S*)-1-(((R)-tert-butylsulfinyl)amino)-2-ethoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step B) in place of tert-butyl ((S)-(7-((S-1-(((R)-tert-butylsulfinyl)amino)-2-cyclopropoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate and was used without further purification.
- Step D. tert-Butyl ((S)-(7-((S*)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-ethoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound was prepared as described for the synthesis of Intermediate 15, using tert-butyl ((S)-(7-((S*)-1-amino-2-ethoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step C) in place of tert-butyl ((S)-(7-((S)-1-amino-2-cyclopropoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate in 60% yield.
- Step E. 1-((S*)-1-(2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-ethoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. The title compound was prepared as described for the synthesis of Intermediate 11, using tert-butyl ((S)-(7-((S*)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-ethoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step D) in place of tert-butyl ((R)-1-(7-((S*)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate in 92% yield.
-
- Step A. 1-Isopropyl-1H-pyrazole-5-carbonyl chloride. A round bottom flask was charged with 1-isopropyl-1H-pyrazole-5-carboxylic acid (1 g, 6.5 mmol) and DCM (13 mL) and was cooled to 0° C. under a nitrogen atmosphere. To the solution was added oxalyl chloride (1.1 mL, 13.0 mmol) followed by DMF (0.05 mL, 0.65 mmol) dropwise. The reaction was stirred as it slowly warmed to rt. Once the gas evolution ceased the reaction was concentrated under reduced pressure into a yellow oil that was then dissolved in 12 mL of dry DCM and stored as a 2 M solution.
- Step B. 2,5-Dioxopyrrolidin-1-yl 1-isopropyl-1H-pyrazole-5-carboxylate. A round bottom flask was charged with N-hydroxysuccinimide (1.1 g, 9.7 mmol), DCM (25 mL), and DIPEA (16 mL, 6.5 mmol), and cooled to 0° C. under a nitrogen atmosphere. To the solution was added a solution of 1-isopropyl-1H-pyrazole-5-carbonyl chloride (13 mL, 6.5 mmol, 2 M in DCM, Step A). The solution was allowed to warm to rt as it stirred for 1 h. The solution was washed with water and then with brine, dried over anhydrous MgSO4, filtered, and concentrated. The isolated material was purified by silica gel chromatography (0-100% EtOAc (with 10% MeOH)/hexanes) to afford the title compound as an off white solid.
-
- Step A. N-benzyl-2,2-difluoro-3,3-d2-3-hydroxypropanamide. A flask was charged with methyl 3-(benzylamino)-2,2-difluoro-3-oxopropanoate (2 g, 8.2 mmol), MeOH (42 mL), and cooled to 0° C. To the cold solution was added sodium borodeuteride (860 mg, 20.6 mmol) portionwise. The reaction was stirred for an hour at 0° C. then quenched by the addition of water (15 mL). The reaction was concentrated to remove the MeOH. The resulting solution was further diluted with water and extracted with ethyl acetate (3×50 mL). The combined organics were washed with brine, dried over anhydrous MgSO4, filtered and concentrated to yield N-benzyl-2,2-difluoro-3,3-d2-3-hydroxypropanamide:
- as a white solid (100% yield) that was used without further purification.
- Step B. 3-(Benzylamino)-2,2-difluoropropan-1,1,3,3-d4-1-ol. A flask was charged with N-Benzyl-2,2-difluoro-3,3-d2-3-hydroxypropanamide (7.7 g, 35.5 mmol, Step A), and THE (230 mL). To the reaction was added boron trifluoride diethyletherate (18.8 mL, 46.5 wt %, 70.9 mmol) portionwise. The reaction mixture was then heated to reflux and stirred for 1 h. The reaction mixture was cooled to room temperature and quenched by the careful addition of MeOH (50 mL). The resulting mixture was stirred for 30 minutes then concentrated to dryness. Ethyl acetate was added to the resulting white solid and the remaining solids were removed by filtration. The filtrate was concentrated to yield the title compound, which was used without further purification.
- Step C. 3-Amino-2,2-difluoropropan-1,1,3,3-d4-1-ol. A flask was charged with a 3-(benzylamino)-2,2-difluoropropan-1,1,3,3-d4-1-ol (7.1 g, 34.3 mmol, Step B), MeOH (690 mL), Pd/C (3.7 g, 3.4 mmol, 10 wt % Pd), and ammonium formate (21.7 g, 343.9 mmol). The reaction was warmed to 60° C. and stirred for 3 h. The reaction was cooled to room temperature, filtered through a pad of diatomaceous earth (e.g., Celite®), and the solids were washed with ethyl acetate. The combined organic layers were concentrated to an off white solid that was used directly in the next step.
- Step D. 2-(2,2-Difluoro-3-hydroxypropyl-1,1,3,3-d4)isoindoline-1,3-dione. A flask was charged with 3-amino-2,2-difluoropropan-1,1,3,3-d4-1-ol (3.6 g, 34.4 mmol, Step C), N-carbethoxyphthalimide (8.7 g, 39.6 mmol), THE (86 mL), and DIPEA (23.7 mL, 137 mmol). The reaction mixture was then heated to 60° C. for 12 h. The reaction mixture was cooled to room temperature, and concentrated to dryness. Water (250 mL) was added to the resulting residue and stirred for 30 min during which time a solid formed. The solid was collected by filtration, dried overnight under reduced pressure to yield the title compound as a white powder (59% yield over steps B, C and D).
- Step E: 3-(1,3-Dioxoisoindolin-2-yl)-2,2-difluoropropyl-1,1,3,3-d4 trifluoromethanesulfonate. A flask was charged with, 2-(2,2-difluoro-3-hydroxypropyl-1,1,3,3-d4)isoindoline-1,3-dione (1.5 g, 5.9 mmol, Step D), DCM (20 mL), and pyridine (0.53 mL, 6.6 mmol), and trifluoromethanesulfonic anhydride (1.1 mL, 6.3 mmol) was added dropwise. The reaction mixture was stirred for 30 min at rt then quenched by the addition of water (5 mL). The resulting layers were separated and the aqueous layer was further extracted with DCM (2×5 mL). The combined organic layers were washed with brine, dried over anhydrous MgSO4, filtered and concentrated to afford an off white solid in 50% yield.
-
- Step A: tert-Butyl ((R)-1-(6-chloro-7-((S)-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl-1,1,3,3-d4)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate. A flask was charged with tert-butyl ((R)-1-(7-((S)-1-amino-2-methoxyethyl)-6-chloroimidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (484 mg, 0.98 mmol, Intermediate 48), 3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl-1,1,3,3-d4 trifluoromethanesulfonate (458 mg, 1.2 mmol, Intermediate 27), MeCN (3.5 mL), and DIPEA (0.33 mL, 1.9 mmol). The resulting reaction mixture was stirred at 60° C. for 48 h. The reaction was cooled to rt and partitioned between water and ethyl acetate. The aqueous layer was further extracted with ethyl acetate (2×). The combined organic layers were washed with brine, dried over anhydrous MgSO4, filtered, concentrated, and purified by silica gel chromatography (0-100% ethyl acetate (w/10% MeOH): hexanes) to afford the title compound as a white solid (71%).
- Step B: tert-Butyl ((R)-1-(7-((S)-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl-1,1,3,3-d4)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate. A vial was charged with tert-butyl ((R)-1-(6-chloro-7-((S)-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl-1,1,3,3-d4)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (450 mg, 0.62 mmol, Step A), 2-methyl-2-butanol (20 mL), 2,2,2-trifluoroethanol (10 mL), Pd/C (381 mg, 10 wt % Pd), and ammonium formate (1.3 g, 21.7 mmol). The vial was warmed to 90° C., stirred for 1 h, then cooled to rt. The reaction mixture was filtered through a pad of diatomaceous earth (e.g., Celite®), and the solids were washed with ethanol. The combined organic layers were concentrated to yield the title compound as a yellow solid (100%).
- Step C: tert-Butyl ((R)-1-(7-((S)-1-((3-amino-2,2-difluoropropyl-1,1,3,3-d4)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate. A flask was charged with a stir bar, tert-butyl ((R)-1-(7-((S)-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl-1,1,3,3-d4)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (435 mg, 0.63 mmol, Step B), ethanol (3.3 mL), and hydrazine monohydrate (0.42 mL, 6.3 mmol). The reaction was stirred at rt for 2 h. The reaction was then partitioned between water and ethyl acetate, the layers were separated, and the aqueous layer was further extracted with ethyl acetate (2×). The combined organic layers were washed with brine, dried over anhydrous MgSO4, filtered, and concentrated to a glassy solid (71%).
- Step D: tert-Butyl ((R)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl-4,4,6,6-d4)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate. A flask was charged with tert-butyl ((R)-1-(7-((S)-1-((3-amino-2,2-difluoropropyl-1,1,3,3-d4)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (241 mg, 0.43 mmol, Step C), THF (8.6 mL), CDI (209 mg, 1.3 mmol), and DIPEA (0.22 mL, 1.3 mmol). The reaction was warmed to 60° C. and stirred for 1 h. The reaction was cooled to rt and partitioned between water and ethyl acetate. The layers were separated, and the aqueous phase was further extracted with ethyl acetate (2×). The combined organic layers were washed with brine, dried over anhydrous MgSO4, filtered, concentrated, and purified by silica gel chromatography (0-100% ethyl acetate (w/10% MeOH): hexanes) to afford the title compound as a glassy solid (45%).
- Step E: 1-((S)-1-(2-((R)-1-Amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4. A flask was charged with tert-butyl ((R)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl-4,4,6,6-d4)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (105 mg, 0.18 mmol, Step D), and TFA (1 mL). The reaction was stirred at rt for 5 min then concentrated. The residue was partitioned between saturated aqueous NaHCO3 and ethyl acetate. The organic layer was washed with brine, dried over anhydrous MgSO4, filtered, and concentrated to give a yellow solid (100%).
-
- The title compound was prepared as described for Intermediate 10 using 3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl-1,1,3,3-d4 trifluoromethanesulfonate (Intermediate 27) in place of 3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl trifluoromethanesulfonate, and tert-butyl ((S)-(7-((S)-1-amino-2-cyclopropoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Intermediate 14) in place of tert-butyl ((R)-1-(7-((S*)-1-amino-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (30% yield).
-
- The title compound was prepared as described for Intermediate 28, Step B using tert-butyl ((S)-(7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl-4,4,6,6-d4)ethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Intermediate 29) in place of tert-butyl ((R)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl-4,4,6,6-d4)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (71% yield).
-
- Step A: 4-Cyclopropyl-1,2,5-oxadiazole-3-carbonyl chloride. A flask was charged with 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid (200 mg, 1.3 mmol) and DCM (2.5 mL), and cooled to 0° C. Then, oxalyl chloride (0.22 mL, 2.6 mmol) and one drop of DMF were added. The resulting mixture was stirred for 1 h as it warmed to rt. The mixture was concentrated to a yellow oil and was used without further purification.
- Step B: 2,5-Dioxopyrrolidin-1-yl 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylate. The residue from Step A was dissolved in DCM (3.2 mL) and cooled to 0° C. To the solution was added N-hydroxysuccinimide (231 mg, 1.9 mmol), and DIPEA (0.34 mL, 1.9 mmol). The reaction was stirred for 1 h as it warmed to rt. The reaction was quenched by the addition of water (3 mL), the layers were separated. The organic layer was washed with brine, dried over anhydrous MgSO4, filtered and concentrated to dryness. This material was purified by silica gel chromatography (0-100% ethyl acetate (with 10% MeOH)/hexanes) to afford the title compound as a clear oil (40% yield).
-
- Step A: N-(6-Chloropyridazin-3-yl)pivalamide. To a stirred solution of 6-chloropyridazin-3-amine (350 g, 2.70 mol) and pyridine (427 g, 5.40 mol) in DCM (5000 mL) was added 2,2-dimethylpropanoyl chloride (814 g, 6.75 mol) dropwise at 0° C. under nitrogen atmosphere. The resulting mixture was stirred for 2 h at rt under a nitrogen atmosphere. The mixture was basified to pH 7˜8 using saturated aqueous NaHCO3 (aq.) and the resulting mixture was extracted with DCM (3×3 L). The combined organic layers were washed with brine (1×2 L) and water (1×2 L), dried over anhydrous Na2SO4. After filtration, the filtrate was concentrated under reduced pressure and the residue was purified by trituration with petroleum ether (2 L). The precipitated solids were collected by filtration affording the title compound in 87% yield.
- Step B: N-(6-Chloro-5-iodopyridazin-3-yl)pivalamide. To a stirred solution of TMPMgCl.LiCl (6.8 L, 6.8 mol) was added N-(6-chloropyridazin-3-yl)pivalamide (560 g, 2.62 mol, Step A) in THE (5.0 L) dropwise at −60° C. under nitrogen atmosphere. The resulting mixture was stirred for 2.5 h at −55° C. under nitrogen atmosphere, then iodine (998 g, 3.93 mol) in THE (3.0 L) dropwise at −60° C. The resulting mixture was stirred for an additional 1 h at −55° C. and the reaction was then quenched by the addition of sat. NH4Cl (aq.) (2 L) at −40° C. The resulting mixture was extracted with EtOAc (3×3 L) and the combined organic layers were washed with sat. aqueous Na2S3O4 (1×2 L) and brine (1×2 L), dried over anhydrous Na2SO4, and filtered. The filtrate was concentrated under reduced pressure and the residue was purified by silica gel column chromatography (33% EtOAc/petroleum ether) to afford the title compound in 69% yield.
- Step C: N-(6-Chloro-5-formylpyridazin-3-yl)pivalamide. To a stirred solution of N-(6-chloro-5-iodopyridazin-3-yl)pivalamide (607 g, 1.79 mol, Step B) in THE (6.0 L) was added a 60% dispersion of NaH in mineral oil (93.0 g, 2.32 mol) in portions at 0° C. under nitrogen atmosphere. The resulting mixture was stirred for 30 min at rt under a nitrogen atmosphere and isopropylmagnesium chloride lithium chloride complex (1.99 L, 2.59 mol) was added dropwise at −60° C. The resulting mixture was stirred for additional 1.5 h at −55° C. and then dimethylformamide (653 g, 8.94 mol) in THE (700 mL) was added dropwise at −60° C. The resulting mixture was stirred for additional 1 h at rt and then quenched by the addition of saturated aqueous NH4Cl (2 L) at 0° C. The resulting mixture was extracted with EtOAc (3×3 L). The combined organic layers were washed with brine (1×2 L) and water (1×2 L), dried over anhydrous Na2SO4, and filtered. The filtrate was concentrated under reduced pressure to afford the title compound that was used without further purification.
- Step D: (R,E)-N-(5-(((tert-Butylsulfinyl)imino)methyl)-6-chloropyridazin-3-yl)pivalamide. To a stirred solution of N-(6-chloro-5-formylpyridazin-3-yl)pivalamide (372 g, 1.54 mol, Step C) and (R)-2-methylpropane-2-sulfinamide (243 g, 2.00 mol) in DCM (2.20 L) was added potassium bisulfate (272 g, 2.00 mol) in portions at rt. The resulting mixture was stirred overnight at rt and then quenched with water (2 L) at rt. The mixture was extracted with DCM (3×1.5 L), and the combined organic layers were washed with water (1×1 L), dried over anhydrous Na2SO4, and filtered. The filtrate was concentrated under reduced pressure and purified by silica gel column chromatography (25% EtOAc/petroleum ether) to afford the title compound in 60% yield over 2 steps.
-
- To a stirred solution of magnesium (47.4 g, 1.95 mol) in THF (360 mL) was added dibromoethane (13.7 g, 74.0 mmol) dropwise at rt under a nitrogen atmosphere. The resulting mixture was stirred for 30 min at rt under a nitrogen atmosphere and additional dibromoethane (60.0 g, 222 mmol) was added. Then the reaction mixture was heated to 40° C., mercuric chloride (4.72 g, 17.4 hmmol) was added in portions and the reaction mixture was stirred for an additional 20 min at rt. MOMBr (22.1 g, 177 mmol) in toluene (30 mL) was then added dropwise at rt and stirred for an additional 20 min. The reaction mixture was then cooled to −15° C. followed by the addition of more MOMBr (200 g, 1.60 mol) in toluene (270 mL) dropwise and the resulting mixture was stirred for 40 min at −15° C. To the mixture was added LiCl (74.0 g, 1.74 mol) in portions and the resulting mixture was stirred for 30 min at −15° C. To the mixture was added (R,E)-N-(5-(((tert-butylsulfinyl)imino)methyl)-6-chloropyridazin-3-yl)pivalamide (60.0 g, 174 mmol, Intermediate 32) in THE (360 mL) dropwise at −20° C. The resulting mixture was stirred for additional 30 min at −10° C. The reaction was quenched by the addition of sat. NH4Cl (aq.) (5 L) at 0° C. The mixture was extracted with EtOAc (3×2 L) and the combined organic layers were washed with water (1×2 L), dried over anhydrous Na2SO4, and filtered. The filtrate was concentrated under reduced pressure and purified sequentially by silica gel column chromatography (50% EtOAc/petroleum ether), reverse phase flash chromatography (40%) MeCN/water (0.1% NH4HCO3), and chiral SFC (CHIRAL ART Cellulose-SC, 5 μm, 5×25 cm, 30% MeOH/CO2) to afford the title compound as the second eluting isomer in 21% yield.
-
- The title compound was synthesized in a manner analogous to Intermediate 13 using (R,E)-N-(5-(((tert-butylsulfinyl)imino)methyl)-6-chloropyridazin-3-yl)pivalamide (Intermediate 32) in place of tert-butyl ((S)-(7-((E)-(((R)-tert-butylsulfinyl)imino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The product was purified by silica gel chromatography (0-80% EtOAc/petroleum ether), preparative HPLC (Xtimate C18, 10 μm, 40×150 mm, 35-65% MeCN/water (0.05% aqueous NH3 with 10 mM NH4HCO3)), and chiral SFC (DAICEL CHIRALPAK AD, 10 μm, 30×250 mm, 10% EtOH (with 0.1% aqueous ammonia)/CO2) to afford the title compound as the second eluting fraction in 6% yield.
-
- Step A: (S)—N-(5-(1-Amino-2-methoxyethyl)-6-chloropyridazin-3-yl)pivalamide. To a stirred solution of N-(5-((S)-1-(((R)-tert-butylsulfinyl)amino)-2-methoxyethyl)-6-chloropyridazin-3-yl)pivalamide (Intermediate 33, 8.00 g, 20.5 mmol) in EtOAc (102 mL) at room temperature was added a solution of HCl in 1,4-dioxane (4 M, 20.5 mL, 81.9 mmol). After 5 h, the reaction mixture was diluted with hexanes (150 mL) and water (200 mL). The layers were separated, and the organic layer was extracted with aqueous HCl (0.05 M, 2×50 mL). The combined aqueous layers were diluted with EtOAc (50 mL) and brought to pH 11 with aqueous 3 M NaOH. The layers were separated, and the aqueous layers were extracted with EtOAc (4×50 mL). The combined organic layers were dried over anhydrous Na2SO4 and concentrated to give the title compound as a solid (>99% yield, heavy with trace EtOAc), which was used without further purification.
- Step B: (S)—N-(6-Chloro-5-(1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)-2-methoxyethyl)pyridazin-3-yl)pivalamide. To a stirred solution of (S)—N-(5-(1-amino-2-methoxyethyl)-6-chloropyridazin-3-yl)pivalamide (5.87 g, 20.6 mmol, Step A) in ACN (68.8 mL) under an N2 atmosphere was added DIPEA (5.75 mL, 33.0 mmol) and 3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl trifluoromethanesulfonate (10.8 g, 28.9 mmol) and the reaction mixture was heated to 55° C. After 23 h, additional portions of DIPEA (0.90 mL, 5.22 mmol) and 3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl trifluoromethanesulfonate (1.60 g, 4.29 mmol) were added and heating was continued for an additional 72 h. The reaction mixture was concentrated and purified by silica gel chromatography (10 to 50% acetone in hexanes with 0.1% TEA V/V) to give the title compound (80%).
- Step C: (S)-2-(3-((1-(6-Amino-3-chloropyridazin-4-yl)-2-methoxyethyl)amino)-2,2-difluoropropyl)isoindoline-1,3-dione. To a stirred solution of (S)—N-(6-chloro-5-(1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)-2-methoxyethyl)pyridazin-3-yl)pivalamide (4.11 g, 8.06 mmol, Step B) in 1,4-dioxane (40 mL) was added aqueous H2SO4 (3 M, 80.6 mL, 242 mmol) and the reaction mixture was heated to 60° C. for 6 h. The reaction mixture was cooled to rt, diluted with EtOAc (80 mL) and water (80 mL), cooled to 0° C. and treated with NaHCO3 (40 g) in a portion wise manner with stirring (gas evolution). The reaction mixture was diluted with saturated aqueous NaHCO3 (100 mL), and the layers were separated. The aqueous layer was extracted with EtOAc (4×100 mL), and the combined organic layers were dried over anhydrous Na2SO4 and concentrated to give the title compound as a solid (>99% yield, heavy with trace EtOAc), which was used without further purification.
- Step D: (S)—N1-(1-(6-Amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-2,2-difluoropropane-1,3-diamine. To a stirred suspension of (S)-2-(3-((1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)amino)-2,2-difluoropropyl)isoindoline-1,3-dione (3.43 g, 8.06 mmol, Step C) in EtOH (115 mL) was added hydrazine hydrate (1.20 mL, 24.2 mmol) and the reaction mixture was heated to 40° C. for 56 h. The reaction mixture was cooled to 0° C., filtered and the filter cake was washed with ice cold EtOH (3×5 mL). The filtrate was evaporated to dryness to give the title compound (98%), which was used without further purification.
- Step E: (S)-1-(1-(6-Amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. To a cooled (0° C.) stirred solution of CDI (1.40 g, 8.63 mmol) in THE (200 mL) was added a suspension of (S)—N1-(1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-2,2-difluoropropane-1,3-diamine (2.22 g, 7.51 mmol, Step D) in THF (50 mL) in a dropwise manner over 5 min. After 2 h, the reaction mixture was allowed to warm to rt and was stirred for 12 h. The reaction mixture was then heated to 60° C. for 6 h. The reaction mixture was cooled to rt, evaporated to dryness, and purified by reverse phase basic HPLC (X-Bridge Prep C18 5 μm column 50×250 mm, 5-100% acetonitrile/water (with 20 nM NH4OH). The product containing fractions were lyophilized to give the title compound (71% yield) as a white solid.
-
- Step A: (S)—N-(5-(1-Amino-2-cyclopropoxyethyl)-6-chloropyridazin-3-yl)pivalamide. The title compound was synthesized in a manner analogous to Intermediate 35 Step A using N-(5-((S)-1-(((R)-tert-butylsulfinyl)amino)-2-cyclopropoxyethyl)-6-chloropyridazin-3-yl)pivalamide (Intermediate 34) in place of N-(5-((S)-1-(((R)-tert-butylsulfinyl)amino)-2-methoxyethyl)-6-chloropyridazin-3-yl)pivalamide (99% yield) that was used without further purification.
- Step B: (S)—N-(6-Chloro-5-(2-cyclopropoxy-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)ethyl)pyridazin-3-yl)pivalamide. The title compound was synthesized in a manner analogous to Intermediate 35 Step B using (S)—N-(5-(1-amino-2-cyclopropoxyethyl)-6-chloropyridazin-3-yl)pivalamide (Step A) in place of (S)—N-(5-(1-amino-2-methoxyethyl)-6-chloropyridazin-3-yl)pivalamide (78% yield).
- Step C: (S)-2-(3-((1-(6-Amino-3-chloropyridazin-4-yl)-2-cyclopropoxyethyl)amino)-2,2-difluoropropyl)isoindoline-1,3-dione. The title compound was synthesized in a manner analogous to Intermediate 35 Step C using (S)—N-(6-chloro-5-(2-cyclopropoxy-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)ethyl)pyridazin-3-yl)pivalamide (Step B) in place of (S)—N-(6-chloro-5-(1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)-2-methoxyethyl)pyridazin-3-yl)pivalamide (99% yield that was used without further purification).
- Step D: (S)—N1-(1-(6-Amino-3-chloropyridazin-4-yl)-2-cyclopropoxyethyl)-2,2-difluoropropane-1,3-diamine. The title compound was synthesized in a manner analogous to Intermediate 35 Step D using (S)-2-(3-((1-(6-amino-3-chloropyridazin-4-yl)-2-cyclopropoxyethyl)amino)-2,2-difluoropropyl)isoindoline-1,3-dione (Step C) in place (S)-2-(3-((1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)amino)-2,2-difluoropropyl)isoindoline-1,3-dione (99% yield that was used without further purification).
- Step E: (S)-1-(1-(6-Amino-3-chloropyridazin-4-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. The title compound was synthesized in a manner analogous to Intermediate 35 Step E using (S)—N1-(1-(6-amino-3-chloropyridazin-4-yl)-2-cyclopropoxyethyl)-2,2-difluoropropane-1,3-diamine (Step D) in place of (S)—N1-(1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-2,2-difluoropropane-1,3-diamine (18% yield).
-
- Step A: (R)-2-(((R)-1,1,1-Trifluoropropan-2-yl)oxy)propanoic acid. Sodium hydride (3.5 g, 88 mmol, 60% dispersion in mineral oil) was added in portions to a solution of (R)-1,1,1-trifluoropropan-2-ol (5.0 g, 44 mmol) in DMF (70 mL) at 0° C. The resultant mixture was stirred for 30 min at rt before recooling to 0° C. A separate solution of (S)-2-bromopropanoic acid (6.0 g, 40 mmol) in DMF (5 mL) was added at 0° C. and the resulting mixture was allowed to warm to rt and stir for 12 h. After this time, the reaction mixture was poured into ice chilled water (100 mL) and extracted with MTBE (25 mL). The pH of the aqueous layer was adjusted by the addition of 2 N aqueous HCl (15 mL) until the pH of the mixture was pH=5-6. This aqueous layer was extracted with MTBE (80 mL×3). The combined organic layers were washed with brine, dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to afford the title compound in 93% yield as a yellow oil that was used without further purification.
- Step B: (R)—N-Methoxy-N-methyl-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propanamide. A round-bottom flask was charged with (R)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propanoic acid (7.6 g, 41 mmol, Step A), DMF (70 mL), HATU (20 g, 53 mmol), and DIPEA (18 mL, 102 mmol). The mixture was stirred for 5 min before the addition of N,O-dimethylhydroxylamine hydrochloride (6.0 g, 61 mmol). The resulting solution stirred for 12 h, after which time, the reaction was quenched with water (30 mL) and diluted with MTBE (50 mL). The organic layer was separated, and the aqueous layer was extracted with MTBE (80 mL×2). The combined organic layers were washed with water and brine, dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure. The product was purified by silica gel chromatography (9-17% EtOAc/petroleum ether) to afford the title compound in 58% yield as a yellow oil.
- Step C: (R)-2-(((R)-1,1,1-Trifluoropropan-2-yl)oxy)propanal. A round-bottom flask was charged with (R)—N-methoxy-N-methyl-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propanamide (5.4 g, 24 mmol, Step B) and THE (300 mL), cooled to −78° C. and LAH (4.5 g, 120 mmol) was added portion wise. The resulting mixture was stirred for about 1 h at −78° C. and was subsequently quenched with water (20 mL) dropwise at −78° C. A saturated aqueous solution of sodium potassium tartrate (120 mL) was added, and the solution was stirred for 30 min and then extracted with MTBE (120 mL×3). The combined organic layers were washed with brine, dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to afford the title compound in 100% yield that was used without further purification.
- Step D: (S)-2-Methyl-N—((R,E)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propylidene)propane-2-sulfinamide. A round-bottom flask was charged with (R)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propanal (7.4 g, 44 mmol, Step C), THE (250 mL), CuSO4 (28 g, 174 mmol), (S)-2-methylpropane-2-sulfinamide (7.9 g, 65 mmol), and PPTS (2.2 g, 8.7 mmol), and the resulting mixture was stirred at 30° C. for 16 h. The suspension was filtered through diatomaceous earth (e.g., Celite®), and the filtrate was concentrated under reduced pressure. This product was purified by silica gel chromatography (0-50% EtOAc/petroleum ether) to afford the title compound in 73% yield as a colorless oil.
- Step E: (S)—N-((1R,2R)-1-Cyano-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)-2-methylpropane-2-sulfinamide. A mixture of (S)-2-methyl-N—((R,E)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propylidene)propane-2-sulfinamide (8.7 g, 32 mmol, Step D), TMSCN (5.5 mL, 44 mmol), Sc(OTf)3 (3.1 g, 6.4 mmol), and 4 Å molecular sieves (5 g) in DCM (100 mL) was stirred at rt for 16 h. The reaction was then filtered and concentrated under reduced pressure. Purification by silica gel chromatography (0-60 EtOAc/petroleum ether) provided the title compound as a colorless oil in 79% yield.
- Step F: O—((R)-1,1,1-Trifluoropropan-2-yl)-L-threonine hydrogen chloride. (S)—N-((1R,2R)-1-Cyano-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)-2-methylpropane-2-sulfinamide (7.6 g, 25 mmol, Step E) was dissolved in 4M HCl in 1,4-dioxane (120 mL) and water (20 mL). The resulting mixture was stirred for 16 h at 80° C. The reaction was then cooled to rt and concentrated to dryness to afford the title compound as a brown oil, which was used without further purification assuming 100% yield.
- Step G: N-(tert-Butoxycarbonyl)-O—((R)-1,1,1-trifluoropropan-2-yl)-L-threonine. A round bottom flask was charged with O—((R)-1,1,1-trifluoropropan-2-yl)-L-threonine hydrogen chloride (7.3 g, 25 mmol, Step F), THE (100 mL), and 1 M aqueous NaOH (101 mL) and allowed to stir at rt for 0.5 h. Boc2O (5.5 g, 25 mmol) was then added in one portion and the reaction was allowed to stir for 16 h at rt. The reaction mixture was poured into water (100 mL) and the biphasic mixture was extracted with EtOAc (3×100 mL). The aqueous layer was then acidified with citric acid to pH 3-4. The acidic aqueous layer was then extracted with EtOAc (3×100 mL) and the combined organic layers were washed with brine, dried over anhydrous MgSO4, filtered, and concentrated under reduced pressure to afford the title compound in 88% yield, which was used without further purification.
- Step H: tert-Butyl ((3S,4R)-1-(dimethyl(oxo)-λ6-sulfaneylidene)-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate. To a suspension of trimethylsulfoxonium iodide (15.5 g, 49.2 mmol) in THE (250 mL) was added 1 M THE solution of potassium tert-butoxide (73.7 mL, 73.7 mmol). The mixture was stirred at rt for 2 h. In a separate flask a solution of N-(tert-butoxycarbonyl)-O—((R)-1,1,1-trifluoropropan-2-yl)-L-threonine (15.5 g, 49.2 mmol, Step G) in THE (250 mL) was cooled to 0° C., charged with CDI (9.57 g, 59.0 mmol) in one portion, and stirred for 2 h at 0° C. This solution was then added dropwise to the previously prepared solution and allowed to stir for 2 h at 25° C. The reaction mixture was then poured into water (200 mL) and extracted with EtOAc (100 mL×3). The combined organic layers were washed with brine, dried over anhydrous MgSO4, filtered, and concentrated to dryness. The product was purified by silica gel chromatography (0-100% EtOAc/petroleum ether) and chiral SFC (DAICEL CHRALPAK AD, 10 μm, 50×250 mm, 20% EtOH (with 0.1% of 25% aqueous NH3)/CO2) to afford the title compound in 21% yield as the first eluting fraction.
-
- Step A: (R)—(((S)-1,1,1-Trifluoropropan-2-yl)oxy)propanoic acid. The title compound was synthesized in a manner analogous to Intermediate 37 Step A using (S)-1,1,1-trifluoropropan-2-ol in place of (R)-1,1,1-trifluoropropan-2-ol in 80% yield.
- Step B: (R)—N-Methoxy-N-methyl-2-(((S)-1,1,1-trifluoropropan-2-yl)oxy)propanamide. The title compound was synthesized in a manner analogous to Intermediate 37 Step B using (R)—(((S)-1,1,1-trifluoropropan-2-yl)oxy)propanoic acid (Step A) in place of (R)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propanoic acid in 46% yield.
- Step C: (R)-2-(((S)-1,1,1-Trifluoropropan-2-yl)oxy)propanal. The title compound was synthesized in a manner analogous to Intermediate 37 Step C using (R)—N-methoxy-N-methyl-2-(((S)-1,1,1-trifluoropropan-2-yl)oxy)propanamide (Step B) in place of (R)—N-methoxy-N-methyl-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propanamide in 80% yield.
- Step D: (S)-2-Methyl-N—((R,E)-2-(((S)-1,1,1-trifluoropropan-2-yl)oxy)propylidene)propane-2-sulfinamide. The title compound was synthesized in a manner analogous to Intermediate 37 Step D using (R)-2-(((S)-1,1,1-trifluoropropan-2-yl)oxy)propanal (Step C) in place of (R)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propanal in 55% yield.
- Step E: (S)—N-((1R,2R)-1-Cyano-2-(((S)-1,1,1-trifluoropropan-2-yl)oxy)propyl)-2-methylpropane-2-sulfinamide. The title compound was synthesized in a manner analogous to Intermediate 37 Step E using (S)-2-methyl-N—((R,E)-2-(((S)-1,1,1-trifluoropropan-2-yl)oxy)propylidene)propane-2-sulfinamide (Step D) in place of (S)-2-methyl-N—((R,E)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propylidene)propane-2-sulfinamide in 91% yield.
- Step F: O—((S)-1,1,1-Trifluoropropan-2-yl)-L-threonine hydrogen chloride. The title compound was synthesized in a manner analogous to Intermediate 37 Step F using (S)—N-((1R,2R)-1-cyano-2-(((S)-1,1,1-trifluoropropan-2-yl)oxy)propyl)-2-methylpropane-2-sulfinamide (Step E) in place of (S)—N-((1R,2R)-1-cyano-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)-2-methylpropane-2-sulfinamide assuming 100% yield.
- Step G: N-(tert-Butoxycarbonyl)-O—((S)-1,1,1-trifluoropropan-2-yl)-L-threonine. The title compound was synthesized in a manner analogous to Intermediate 37 Step G using O—((S)-1,1,1-trifluoropropan-2-yl)-L-threonine hydrogen chloride (Step F) in place of O—((R)-1,1,1-trifluoropropan-2-yl)-L-threonine hydrogen chloride and was used without further purification.
- Step H: tert-Butyl ((3S,4R)-1-(dimethyl(oxo)-λ6-sulfaneylidene)-2-oxo-4-(((S)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 37 Step H using N-(tert-butoxycarbonyl)-O—((S)-1,1,1-trifluoropropan-2-yl)-L-threonine (Step G) in place of N-(tert-butoxycarbonyl)-O—((R)-1,1,1-trifluoropropan-2-yl)-L-threonine. The product was purified by silica gel chromatography (0-100% EtOAc/petroleum ether) and chiral SFC (DAICEL CHRALPAK AD, 10 μm, 50×250 mm, 15% EtOH (with 0.1% of 25% aqueous NH3)/CO2) to afford the title compound as the first eluting fraction in 19% yield.
-
- Step A: tert-Butyl ((3S,4R)-1-chloro-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate. An oven dried round bottom flask was charged with anhydrous lithium chloride (120 mg, 2.85 mmol) and tert-butyl ((3S,4R)-1-(dimethyl(oxo)-λ6-sulfaneylidene)-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate (400 mg, 1.03 mmol, Intermediate 37) under an N2 atmosphere. Anhydrous THF (7.2 mL) was added, the reaction was cooled to 0° C., then methanesulfonic acid (71.5 μL, 1.01 mmol) was added dropwise. The reaction was maintained at 0° C. for 10 min then heated to 60° C. for 3 h. After this time the mixture was cooled to rt, diluted with H2O, and extracted with 1:1 EtOAc:hexanes. The organic extracts were washed with brine, dried over anhydrous Na2SO4, filtered, and concentrated to provide the title compound that was used without further purification.
- Step B: tert-Butyl ((3S,4R)-1-iodo-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate. A mixture of tert-butyl ((3S,4R)-1-chloro-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate (354 mg, 1.02 mmol, Step A) and NaI (1.53 g, 10.2 mmol) in acetone was stirred at rt for 1 h then diluted with EtOAc and filtered. The filtrate was washed with saturated aqueous sodium thiosulfate then dried over anhydrous Na2SO4, filtered, and concentrated to afford the title compound that was used without further purification.
-
- Step A: tert-Butyl ((3S,4R)-1-chloro-2-oxo-4-(((S)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 39 Step A using tert-butyl ((3S,4R)-1-(dimethyl(oxo)-λ6-sulfaneylidene)-2-oxo-4-(((S)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate (Intermediate 38) in place of tert-butyl ((3S,4R)-1-(dimethyl(oxo)-λ6-sulfaneylidene)-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate and was used without further purification.
- Step B: tert-Butyl ((3S,4R)-1-iodo-2-oxo-4-(((S)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 39 Step B using tert-butyl ((3S,4R)-1-chloro-2-oxo-4-(((S)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate (Step A) in place of tert-butyl ((3S,4R)-1-chloro-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate that was used without further purification.
-
- Step A: tert-Butyl ((1R,2R)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)carbamate. An oven dried round bottom flask was charged with (S)-1-(1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (80 mg, 0.25 mmol, Intermediate 35) and activated 4 Å mol sieves and DMA (3.3 mL). A separate solution of tert-butyl ((3S,4R)-1-iodo-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate (273 mg, 0.62 mmol, Intermediate 39) in DMA (2 mL) was added and the reaction was heated to 50° C. for 16 h under an a N2 atmosphere. After this time, the reaction was cooled to rt and filtered over diatomaceous earth (e.g., Celite®). The filtrate was then diluted with 5% LiCl solution and the aqueous layer was extracted with EtOAc (3×). The combined organic layers were washed with brine, dried over anhydrous MgSO4, filtered, and concentrated under reduced pressure. The product was purified by silica gel chromatography (0-100% Acetone/hexanes (0.1% TEA)) to afford the title compound in 82% yield.
- Step B: tert-Butyl ((1R,2R)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)carbamate. tert-Butyl ((1R,2R)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)carbamate (125 mg, 0.203 mmol, Step A) was dissolved in EtOH (15.6 mL) and TFE (10 mL) and ammonium formate (192 mg, 3.05 mmol) and 10% wt Pd/C (124 mg) were sequentially added. The resulting heterogenous solution was heated to 85° C. for 1 h under N2 atmosphere. The reaction mixture was then filtered through diatomaceous earth (e.g., Celite®), concentrated under reduced pressure, and used without further purification.
- Step C: (1R,2R)-1-(7-((S)-1-(5,5-Difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propan-1-aminium trifluoroacetate. tert-Butyl ((1R,2R)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)carbamate (118 mg, 0.203 mmol, Step B) was dissolved in DCM (6.6 mL) and cooled to 0° C. TFA (6.5 mL) was then added dropwise, and the resulting mixture was allowed to stir for 40 min. After this time, the reaction was concentrated under reduced pressure to afford the title compound, which was used without further purification.
-
- Step A: tert-Butyl ((1R,2R)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((S)-1,1,1-trifluoropropan-2-yl)oxy)propyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 41, Step A using tert-butyl ((3S,4R)-1-iodo-2-oxo-4-(((S)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate (Intermediate 40) in place of tert-butyl ((3S,4R)-1-iodo-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate to afford the title compound after silica gel chromatography (0-100% Acetone/hexanes (0.1% TEA)) in 68% yield.
- Step B: tert-Butyl ((1R,2R)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((S)-1,1,1-trifluoropropan-2-yl)oxy)propyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 41, Step B using tert-butyl ((1R,2R)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((S)-1,1,1-trifluoropropan-2-yl)oxy)propyl)carbamate (Step A) in place of tert-butyl ((1R,2R)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)carbamate to afford the title compound after silica gel chromatography (0-100% Acetone/hexanes (0.1% TEA)) in 74% yield.
- Step C: (1R,2R)-1-(7-((S)-1-(5,5-Difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((S)-1,1,1-trifluoropropan-2-yl)oxy)propan-1-aminium trifluoroacetate. The title compound was synthesized in a manner analogous to Intermediate 41, Step C using tert-butyl ((1R,2R)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((S)-1,1,1-trifluoropropan-2-yl)oxy)propyl)carbamate (Step B) in place of tert-butyl ((1R,2R)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)carbamate to afford the title compound that was used without further purification.
-
- Step A: tert-Butyl ((S)-1-(6-chloro-7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-4,4,4-trifluoro-3,3-dimethylbutyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 41, Step A using (S)-1-(1-(6-amino-3-chloropyridazin-4-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 36) in place of (S)-1-(1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one and tert-butyl (S)-(6,6,6-trifluoro-1-iodo-5,5-dimethyl-2-oxohexan-3-yl)carbamate in place of tert-butyl ((3S,4R)-1-iodo-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate to afford the title compound after silica gel chromatography (0-100% Acetone/hexanes (0.1% TEA)) in >99% yield.
- Step B: tert-Butyl ((S)-1-(7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-4,4,4-trifluoro-3,3-dimethylbutyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 41, Step B using tert-butyl ((S)-1-(6-chloro-7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-4,4,4-trifluoro-3,3-dimethylbutyl)carbamate (Step A) in place of tert-butyl ((1R,2R)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)carbamate to afford the title compound that was used without further purification.
- Step C: (S)-1-(7-((S)-2-Cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-4,4,4-trifluoro-3,3-dimethylbutan-1-aminium trifluoroacetate. The title compound was synthesized in a manner analogous to Intermediate 41, Step C using tert-butyl ((S)-1-(7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-4,4,4-trifluoro-3,3-dimethylbutyl)carbamate (Step B) in place of tert-butyl ((1R,2R)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)carbamate to afford the title compound that was used without further purification.
-
- Step A. tert-Butyl ((S)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-4,4,4-trifluoro-3,3-dimethylbutyl)carbamate. To an oven dried N2 flushed vial was added oven dried 4 Å molecular sieves (3.5 g), (S)-1-(1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 35, 138 mg, 0.43 mmol), tert-butyl (S)-(6,6,6-trifluoro-1-iodo-5,5-dimethyl-2-oxohexan-3-yl)carbamate (910 mg, 2.15 mmol) and dimethyl acetamide (9 mL). The reaction mixture was heated (50° C.) and stirred for 72 h, at which time an additional portion of tert-butyl (S)-(6,6,6-trifluoro-1-iodo-5,5-dimethyl-2-oxohexan-3-yl)carbamate (1.27 g, 3.00 mmol) was added. After a further 36 h, a final portion of tert-butyl (S)-(6,6,6-trifluoro-1-iodo-5,5-dimethyl-2-oxohexan-3-yl)carbamate (280 mg, 0.66 mmol) was added and heating continued for an additional 36 h. The reaction mixture was cooled to rt, filtered, and the solids were washed with EtOAc (10 mL) and DCM (10 mL). The filtrate was diluted with brine (50 mL), and the layers were separated. The aqueous layer was extracted with EtOAc (3×20 mL) and the combined organic layers were washed with brine (2×30 mL), saturated aqueous NaS2O3 (1×20 mL), and brine (1×20 mL). The combined organic layers were dried over anhydrous Na2SO4, concentrated, and purified by silica gel chromatography (5 to 60% acetone in hexanes with 0.1% TEA V/V) to give the title compound (48%).
- Step B. tert-Butyl ((S)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-4,4,4-trifluoro-3,3-dimethylbutyl)carbamate. To a suspension of ammonium formate (194 mg, 3.08 mmol) and 10% Pd/C (126 mg, dry) in EtOH (20 mL) was added tert-butyl ((S)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-4,4,4-trifluoro-3,3-dimethylbutyl)carbamate (123 mg, 0.21 mmol, Step A). The reaction mixture was attached to a nitrogen bubbler, heated (80° C.) and stirred for 70 minutes. The reaction mixture was cooled to room temperature, filtered over diatomaceous earth (e.g., Celite®), and washed with EtOH (20 mL). Filtrate was evaporated to dryness and partitioned between saturated aqueous NaHCO3 (15 mL) and DCM (20 mL). The layers were separated and the aqueous layer was extracted with DCM (1×20 mL). The combined organic layers were dried over anhydrous Na2SO4, and concentrated to give the title compound (99%), which was used without further purification.
- Step C. 1-((S)-1-(2-((S)-1-Amino-4,4,4-trifluoro-3,3-dimethylbutyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. The title compound was prepared as described for the synthesis of Intermediate 20 Step C using tert-butyl ((S)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-4,4,4-trifluoro-3,3-dimethylbutyl)carbamate (Step B) in place of tert-butyl (S)-((7-((5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate to provide the title compound (100%) that was used without further purification.
-
- Step A: 1,1,1-Trifluoro-4-iodo-2,2-dimethylbutane. To a stirring solution of 4,4,4-trifluoro-3,3-dimethylbutan-1-ol (9.75 g, 62.5 mmol) in DCM (125 mL) was added triphenylphosphine (24.6 g, 93.7 mmol) and imidazole (5.53 g, 81.2 mmol), and the resulting mixture was cooled to 0° C. Iodine (23.8 g, 93.7 mmol) was then added portion-wise and the mixture was stirred for 24 h at which time it was quenched with saturated aqueous NaHCO3 and stirred for 15 min. The organic layer was removed and washed sequentially with half-saturated aqueous NaHCO3 and brine, dried over anhydrous MgSO4, filtered, and concentrated to a residue. To the residue was added chilled hexanes (50 mL), and the mixture was stirred vigorously for 10 min at which time a white precipitated formed. The white solid was removed by filtration through a pad of silica and the solids were washed with a second portion of chilled hexanes. The filtrates were concentrated to afford the title compound as a clear, colorless oil (66% yield) that was used without further purification.
- Step B: (2R, 5S)-2-Isopropyl-3,6-dimethoxy-5-(4,4,4-trifluoro-3,3-dimethylbutyl)-2,5-dihydropyrazine. To a stirred solution of (R)-2-isopropyl-3,6-dimethoxy-2,5-dihydropyrazine (0.66 g, 3.59 mmol) in THE (7 mL) at −78° C. was added t-BuLi (2.33 mL, 3.95 mmol, 1.7 M in pentane), and the reaction was allowed to stir at −78° C. After 1 hour, a solution of 1,1,1-trifluoro-4-iodo-2,2-dimethylbutane (1.05 g, 3.95 mmol, Step A) in THE (6 mL) was added dropwise, and the reaction was stirred for 24 h at room temperature. The reaction was quenched by the addition of aqueous phosphate buffer (50 mL, 0.1 M, pH 7) and was diluted with diethyl ether. The organic layer was removed, and the aqueous layer was extracted with diethyl ether (2×50 mL). The combined organic layers were dried over anhydrous MgSO4, filtered and concentrated to give an oil. LC/MS of this oil revealed a mixture of diastereomers in ˜1.5:1 ratio. This mixture was separated by silica gel chromatography (0-30% ethyl acetate in hexanes) to afford the first-eluting isomer (50% yield), which was designated as the R,S diastereomer, as a yellow oil. The second-eluting isomer, designated as the R,R diastereomer, (2R,5R)-2-isopropyl-3,6-dimethoxy-5-(4,4,4-trifluoro-3,3-dimethylbutyl)-2,5-dihydropyrazine, was isolated in 28% yield.
- Step C: Methyl (S)-2-amino-6,6,6-trifluoro-5,5-dimethylhexanoate. To a stirred solution of (2R, 5S)-2-isopropyl-3,6-dimethoxy-5-(4,4,4-trifluoro-3,3-dimethylbutyl)-2,5-dihydropyrazine (1.15 g, 3.57 mmol, Step B first-eluting isomer) in ACN (14.3 mL) at room temperature was added aqueous HCl (14.3 mL, 1 M). After stirring for 2 h, the reaction mixture was poured onto saturated aqueous NaHCO3 at 0° C. and was then extracted with EtOAc (3×150 mL). The combined organic layers were washed with brine, dried over anhydrous MgSO4, filtered, and concentrated to give an oil that was used without further purification.
- Step D: Methyl (S)-2-((tert-butoxycarbonyl)amino)-6,6,6-trifluoro-5,5-dimethylhexanoate. To a stirred solution of methyl (S)-2-amino-6,6,6-trifluoro-5,5-dimethylhexanoate (810.6 mg, 3.57 mmol, Step C) in DCM (15.1 mL) was added Boc2O (1.56 g, 7.14 mmol). After 24 h, the reaction was quenched with aq. HCl (10 mL, 1 M), and the layers were separated. The organic layer was washed with aq. HCl (10 mL, 1 M), water, brine, dried over anhydrous MgSO4, filtered, and concentrated to give an oil that was used in the next step without further purification.
- Step E: (S)-2-((tert-Butoxycarbonyl)amino)-6,6,6-trifluoro-5,5-dimethylhexanoic acid. To a stirred solution of methyl (S)-2-((tert-butoxycarbonyl)amino)-6,6,6-trifluoro-5,5-dimethylhexanoate (925 mg, 2.83 mmol, Step D) in THE (22.4 mL) at 0° C. was added aq. LiOH (8.50 mL, 1 M) and the resulting mixture was stirred for 2 h. The reaction mixture was then acidified to pH 2 using aq. HCl (1 M). The mixture was extracted with EtOAc (3×60 mL). The combined organic layers were washed with brine, dried over anhydrous MgSO4, filtered, and concentrated to give a clear oil that was used in the next step without further purification.
- Step F: tert-Butyl (S)-(1-(dimethyl(oxo)-λ6-sulfaneylidene)-7,7,7-trifluoro-6,6-dimethyl-2-oxoheptan-3-yl)carbamate. To a suspension of trimethylsulfoxonium chloride (0.581 g, 4.52 mmol) in THE (7 mL) was added a solution of t-BuOK (4.24 mL, 4.24 mmol, 1 M in THF) and the resulting solution was allowed to stir for 2 h. Separately, to a solution of (S)-2-((tert-butoxycarbonyl)amino)-6,6,6-trifluoro-5,5-dimethylhexanoic acid (885 mg, 2.83 mmol, Step E) in THE (7 mL) cooled to 0° C. was added CDI (550 mg, 3.39 mmol) and the resulting mixture was stirred for 2 h at 0° C. This mixture was then added via cannula to the trimethylsulfoxonium derived suspension, and the resulting mixture was stirred at rt. After 2 h, the reaction mixture was filtered through diatomaceous earth (e.g., Celite®), concentrated, and purified via silica gel chromatography (0-100% ethyl acetate in hexanes) to afford the title compound (56% yield) as a white foam.
-
- Step A: tert-Butyl (S)-(1-chloro-7,7,7-trifluoro-6,6-dimethyl-2-oxoheptan-3-yl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 39 Step A, using tert-butyl (S)-(1-(dimethyl(oxo)-λ6-sulfaneylidene)-7,7,7-trifluoro-6,6-dimethyl-2-oxoheptan-3-yl)carbamate (Intermediate 45) in place of tert-butyl ((3S,4R)-1-(dimethyl(oxo)-λ6-sulfaneylidene)-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate and was used without further purification.
- Step B: tert-Butyl (S)-(7,7,7-trifluoro-1-iodo-6,6-dimethyl-2-oxoheptan-3-yl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 39 Step B, using tert-butyl (S)-(1-chloro-7,7,7-trifluoro-6,6-dimethyl-2-oxoheptan-3-yl)carbamate (Step A) in place of tert-butyl ((3S,4R)-1-chloro-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate and was used without further purification.
-
- Step A: tert-Butyl ((S)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 44 Step A, using tert-butyl (S)-(7,7,7-trifluoro-1-iodo-6,6-dimethyl-2-oxoheptan-3-yl)carbamate (Intermediate 46) in place of tert-butyl (S)-(6,6,6-trifluoro-1-iodo-5,5-dimethyl-2-oxohexan-3-yl)carbamate to provide the title compound (20% yield) as a brown oil.
- Step B: tert-Butyl ((S)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 44 Step B, using tert-butyl ((S)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate (Step A) in place of tert-butyl ((S)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-4,4,4-trifluoro-3,3-dimethylbutyl)carbamate to provide the title compound as a brown oil that was used without further purification.
- Step C: 1-((S)-1-(2-((S)-1-Amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. The title compound was synthesized in a manner analogous to Intermediate 44 Step C, using tert-butyl ((S)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate (Step B) in place of tert-butyl ((S)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-4,4,4-trifluoro-3,3-dimethylbutyl)carbamate to afford the title compound as a yellow oil that was used without further purification.
-
- Step A: (S)—N-(5-(1-Amino-2-methoxyethyl)-6-chloropyridazin-3-yl)pivalamide. To a stirred solution of N-(5-((5)-1-(((R)-tert-butylsulfinyl)amino)-2-methoxyethyl)-6-chloropyridazin-3-yl)pivalamide (8.00 g, 20.5 mmol, Intermediate 33) in EtOAc (102 mL) at rt was added a solution of HCl in 1,4-dioxane (4 M, 20.5 mL, 81.9 mmol). After 5 h, the reaction mixture was diluted with hexanes (150 mL) and water (200 mL). The layers were separated, and the organic layer was extracted with aqueous HCl (0.05 M, 2×50 mL). The combined aqueous layers were diluted with EtOAc (50 mL) and the pH of the solution was adjusted to pH 11 with aqueous 3 M NaOH. The layers were separated, and the aqueous layers were extracted with EtOAc (4×50 mL). The combined organic layers were dried over anhydrous Na2SO4 and concentrated to give the title compound as a solid (>99% yield, trace EtOAc was present), which was used without further purification.
- Step B: (S)—N-(6-Chloro-5-(1-(1,3-dioxoisoindolin-2-yl)-2-methoxyethyl)pyridazin-3-yl)pivalamide. To a stirred solution of (S)—N-(5-(1-amino-2-methoxyethyl)-6-chloropyridazin-3-yl)pivalamide (1.17 g, 4.07 mmol, Step A) and isobenzofuran-1,3-dione (0.81 g, 5.48 mmol) in toluene (25 mL) was added DIPEA (1.1 mL, 6.3 mmol) and the resulting solution was heated at 100° C. for 17 h. The reaction mixture was cooled to rt and concentrated to a residue, then purified by silica gel chromatography (0-100% EtOAc in hexanes) to give the title compound (89.5%).
- Step C: (S)-2-(1-(6-Amino-3-chloropyridazin-4-yl)-2-methoxyethyl)isoindoline-1,3-dione. To a 50 mL pear shaped flask charged with (S)—N-(6-chloro-5-(1-(1,3-dioxoisoindolin-2-yl)-2-methoxyethyl)pyridazin-3-yl)pivalamide (1.2 g, 2.9 mmol, Step B), 1,4-dioxane (7.2 mL) then 6 M H2SO4 (4.8 mL, 28.8 mmol) were added and the resulting yellow solution was heated at 60° C. for 11 h. Then this solution was cooled to 0° C. and the pH was adjusted to pH 8 by the slow addition of 58.7 mL of saturated aqueous sodium bicarbonate. The aqueous portion of this mixture was extracted with EtOAc (3×25 mL). The combined organic layers were dried over anhydrous Na2SO4, filtered, and concentrated to give a brown oil. The product was purified by silica gel chromatography (0-100% EtOAc in hexanes) to give the title compound as a white foam (74.1%).
- Step D: tert-Butyl ((R)-1-(6-chloro-7-((S)-1-(1,3-dioxoisoindolin-2-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate. The title compound was prepared as described for the synthesis of Intermediate 41 Step A using (S)-2-(1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)isoindoline-1,3-dione (Step C) in place of (S)-1-(1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one and tert-butyl (S)-(4-iodo-3-oxo-1-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)butan-2-yl)carbamate in place of tert-butyl ((3S,4R)-1-iodo-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate to provide the title compound (65%) as a brown oil.
- Step E: tert-Butyl ((R)-1-(7-((S)-1-amino-2-methoxyethyl)-6-chloroimidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate. To tert-butyl ((R)-1-(6-chloro-7-((S)-1-(1,3-dioxoisoindolin-2-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (473 mg, 0.756 mmol, Step D) in EtOH (5 mL) was added hydrazine monohydrate (565 μL, 7.56 mmol) and the resulting red-brown solution was stirred at rt for 4 h. The mixture was concentrated to a residue that was then diluted with H2O (5 mL) and was extracted with EtOAc (3×5 mL). NaCl (solid) was added to this mixture to facilitate separation of the aqueous and organic layers. The organic layer was dried over anhydrous MgSO4, filtered, concentrated, and purified by silica gel chromatography (0-5% (2 M NH3 in MeOH)/DCM) to give the title compound (95%) as a brown oil.
-
- Step A. 2-(1-(2-Hydroxyethyl)cyclopropyl)isoindoline-1,3-dione. To a mixture of 2-(1-aminocyclopropyl)ethan-1-ol hydrochloride (3.40 g, 24.7 mmol), ethyl 1,3-dioxoisoindoline-2-carboxylate (6.04 g, 27.6 mmol) and anhydrous THE (60 mL) under N2 was added DIPEA (14.4 mL, 82.4 mmol) dropwise over 1 min. The resulting mixture was heated at 75° C. for 2 d. The mixture was diluted with water (100 mL) and extracted with DCM (3×100 mL). The organic layers were combined, washed with brine (100 mL), dried over anhydrous Na2SO4, filtered, and concentrated to dryness to provide a light-yellow oil. The oil was purified by silica gel chromatography (0-30% EtOAc/petroleum ether) to provide the title compound as a white solid (34% yield).
- Step B. 2-(1-(1,3-Dioxoisoindolin-2-yl)cyclopropyl)acetaldehyde. A mixture of 2-(1-(2-hydroxyethyl)cyclopropyl)isoindoline-1,3-dione (100 mg, 0.430 mmol, Step A), Dess-Martin periodinane (367 mg, 0.860 mmol), NaHCO3 (254 mg, 3.03 mmol), 4 Å molecular sieves (200 mg) and anhydrous DCM (10 mL) was stirred at rt for 1 h. The mixture was then filtered and concentrated to dryness to provide a light-yellow oil. The oil was purified by silica gel chromatography (0-30% EtOAc/petroleum ether) to afford the title compound as a white solid (61% yield).
-
- Step A. 2-(1,1,1-Trifluoro-4-hydroxybutan-2-yl)isoindoline-1,3-dione. To a mixture of 3-amino-4,4,4-trifluorobutan-1-ol (5.04 g, 35.2 mmol), ethyl 1,3-dioxoisoindoline-2-carboxylate (8.50 g, 38.8 mmol) and anhydrous THE (100 mL) under N2 was added DIPEA (20.3 mL, 116 mmol). The resulting mixture was heated at 75° C. for 40 h. The mixture was concentrated to dryness and then dissolved in DCM (100 mL) and washed with 2 M aqueous HCl (2×50 mL). The organic layer was dried over anhydrous Na2SO4, filtered and concentrated to dryness to provide a yellow gum. The gum was initially purified by silica gel chromatography (0-50% EtOAc/petroleum ether) and then further purified by preparative HPLC (Welch Xtimate C18, 5 μm, 30×150 mm, 31-61% MeCN/water (formic acid)) to provide the title compound as a yellow oil (31% yield).
- Step B. 3-(1,3-Dioxoisoindolin-2-yl)-4,4,4-trifluorobutanal. A mixture of 2-(1,1,1-trifluoro-4-hydroxybutan-2-yl)isoindoline-1,3-dione (500 mg, 1.83 mmol, Step A), NaHCO3 (769 mg, 9.15 mmol) and anhydrous DCM (15 mL) was cooled to 0° C. in an ice bath and then Dess-Martin periodinane (1.16 g, 2.75 mmol) was added in one portion and the resulting mixture was stirred at rt for 1 h. After that time, the mixture was treated with saturated aqueous Na2S2O3 (100 mL) dropwise over 30 min and then extracted with EtOAc (2×50 mL). The organic layers were combined, washed with brine (100 mL), dried over anhydrous Na2SO4, filtered, and concentrated to dryness to provide a white solid. The solid was purified by silica gel chromatography (20-50% EtOAc/petroleum ether) to afford the title compound as a yellow oil (66% yield).
-
- Step A: tert-Butyl ((S*)-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)((1R,5S,6r)-3,3-difluorobicyclo[3.1.0]hexan-6-yl)methyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 41 Step A using tert-butyl ((S*)-1-((1R,3s,5S)-6,6-difluorobicyclo[3.1.0]hexan-3-yl)-3-iodo-2-oxopropyl)carbamate in place of tert-butyl ((3S,4R)-1-iodo-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate. The title compound (70% yield) was purified by silica gel chromatography (0-100% acetone/hexanes (0.1% TEA)).
- Step B: tert-Butyl ((S*)-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)((1R,5S,6r)-3,3-difluorobicyclo[3.1.0]hexan-6-yl)methyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 41 Step B using tert-butyl ((S*)-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)((1R,5S,6r)-3,3-difluorobicyclo[3.1.0]hexan-6-yl)methyl)carbamate (Step A) in place of tert-butyl ((1R,2R)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)carbamate. The title compound (68% yield) was purified via silica gel chromatography (0-100% acetone/hexanes (0.1% TEA)).
- Step C: (S*)-(7-((S)-1-(5,5-Difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)((1R,5S,6r)-3,3-difluorobicyclo[3.1.0]hexan-6-yl)methanaminium 2,2,2-trifluoroacetate. The title compound was synthesized in a manner analogous to Intermediate 41 Step C using tert-butyl ((S*)-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)((1R,5S,6r)-3,3-difluorobicyclo[3.1.0]hexan-6-yl)methyl)carbamate (Step B) in place of tert-butyl ((1R,2R)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)carbamate. The title compound was used without further purification assuming a quantitative yield.
-
- Step A: (S)—N-((E)-(3,3-Difluorocyclopentyl)methylene)-2-methylpropane-2-sulfinamide. The title compound was synthesized in a manner analogous to Intermediate 37 Step D using 3,3-difluorocyclopentane-1-carbaldehyde in place of (R)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propanal in 43% yield. This material was found to epimerize over time and was used in Step B.
- Step B: (S)—N-(Cyano(3,3-difluorocyclopentyl)methyl)-2-methylpropane-2-sulfinamide.
- The title compound (90% yield) was synthesized in a manner analogous to Intermediate 37 Step E using (S)—N-((E)-(3,3-difluorocyclopentyl)methylene)-2-methylpropane-2-sulfinamide (Step A) in place of (S)-2-methyl-N—((R,E)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propylidene)propane-2-sulfinamide.
- Step C: Carboxy(3,3-difluorocyclopentyl)methanaminium chloride. The title compound was synthesized in a manner analogous to Intermediate 37 Step F using (S)—N-(cyano(3,3-difluorocyclopentyl)methyl)-2-methylpropane-2-sulfinamide (Step B) in place of (S)—N-((1R,2R)-1-cyano-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)-2-methylpropane-2-sulfinamide and used without further purification.
- Step D: 2-((tert-Butoxycarbonyl)amino)-2-(3,3-difluorocyclopentyl)acetic acid. The title compound was synthesized in a manner analogous to Intermediate 37 Step G using carboxy(3,3-difluorocyclopentyl)methanaminium chloride (Step C) in place of O—((R)-1,1,1-trifluoropropan-2-yl)-L-threonine hydrogen chloride and was used without further purification.
- Step E: tert-Butyl ((R*)-1-((R*)-3,3-difluorocyclopentyl)-3-(dimethyl(oxo)-λ6-sulfaneylidene)-2-oxopropyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 37, Step H using 2-((tert-butoxycarbonyl)amino)-2-(3,3-difluorocyclopentyl)acetic acid (Step D) in place of N-(tert-butoxycarbonyl)-O—((R)-1,1,1-trifluoropropan-2-yl)-L-threonine. Because of the epimerization of the product of Step A, four diastereomers were formed. These diastereomers were first purified by silica gel chromatography (0-100% EtOAc/hexanes) and then subsequently purified by preparative acidic HPLC (YMC-Triart Prep C18 10 μm column, 50×250 mm, 10-50% acetonitrile/water (0.225% formic acid)). The four distereomers were then separated using SFC. The compounds were first separated by (DAICEL CHIRALPAK IG, 10 μm, 50×250 mm, 35% EtOH (with 0.1% of 25% aqueous NH3)/CO2) followed by two additional separations by (DAICEL CHIRALPAK IG, 10 μm, 50×250 mm, 30% MeOH (with 0.1% of 25% aqueous NH3)/CO2) to obtain the pure title compound after lyophilization in a 10% yield. Additional analysis of the title compound provided the following data: analytical SFC using (DAICEL CHIRALPAK IG, 3 μm, 5×100 mm, 5 to 40% MeOH (0.05% DEA)/CO2 over 4.5 min) retention time 3.82 min and optical rotation of [α]D 23=−28.6 (MeOH, c=0.29).
-
- Step A: tert-Butyl ((R*)-3-chloro-1-((R*)-3,3-difluorocyclopentyl)-2-oxopropyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 39 Step A using tert-butyl ((R*)-1-((R*)-3,3-difluorocyclopentyl)-3-(dimethyl(oxo)-λ6-sulfaneylidene)-2-oxopropyl)carbamate (Intermediate 52) in place of tert-butyl ((3S,4R)-1-(dimethyl(oxo)-λ6-sulfaneylidene)-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate and was used without further purification (100% yield).
- Step B: tert-Butyl ((R*)-1-((R*)-3,3-difluorocyclopentyl)-3-iodo-2-oxopropyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 39 Step B using tert-butyl ((R*)-3-chloro-1-((R*)-3,3-difluorocyclopentyl)-2-oxopropyl)carbamate (Step A) in place of tert-butyl ((3S,4R)-1-chloro-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate and was used without further purification (100% yield).
-
- Step A: tert-Butyl ((R*)-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)((R*)-3,3-difluorocyclopentyl)methyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 41 Step A using tert-butyl ((R*)-1-((R*)-3,3-difluorocyclopentyl)-3-iodo-2-oxopropyl)carbamate (Intermediate 53) in place of tert-butyl ((3S,4R)-1-iodo-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate. The title compound (61% yield) was purified by silica gel chromatography (0-100% acetone/hexanes (0.1% TEA)).
- Step B: tert-Butyl ((R*)-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)((R*)-3,3-difluorocyclopentyl)methyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 41 Step B using tert-butyl ((R*)-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)((R*)-3,3-difluorocyclopentyl)methyl)carbamate (Step A) in place of tert-butyl ((1R,2R)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)carbamate. The title compound (>99% yield) was purified by silica gel chromatography (0-100% acetone/hexanes (0.1% TEA)).
- Step C: (R*)-(7-((S)-1-(5,5-Difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)((R*)-3,3-difluorocyclopentyl)methanaminium 2,2,2-trifluoroacetate. The title compound was synthesized in a manner analogous to Intermediate 41 Step C using tert-butyl ((R*)-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)((R*)-3,3-difluorocyclopentyl)methyl)carbamate (Step B) in place of tert-butyl ((1R,2R)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)carbamate and was used without further purification.
-
- Step A: 2-Cyclopropoxypropanoic acid. The title compound was synthesized in a manner analogous to Intermediate 37 Step A using cyclopropanol in place of (R)-1,1,1-trifluoropropan-2-ol and 2-bromopropanoic acid in place of (S)-2-bromopropanoic acid and was used without further purification.
- Step B: 1,3-Dioxoisoindolin-2-yl 2-cyclopropoxypropanoate. 2-Cyclopropoxypropanoic acid (3.2 g, 25 mmol, Step A), DMAP (310 mg, 2.50 mmol), and 2-hydroxyisoindoline-1,3-dione (6.3 g, 37 mmol) was dissolved in DCM (90 mL) at 0° C. Separately, DCC (5.7 g, 27 mmol) was dissolved in DCM (35 mL) and this DCC solution was then added dropwise to the reaction mixture. The reaction was then warmed to rt and allowed to stir overnight. The reaction mixture was then filtered through diatomaceous earth (e.g., Celite®), concentrated to dryness, and purified by silica gel chromatography (0-70% EtOAc/hexanes) to afford the title compound in 65% yield.
-
- Step A: Ethyl (S)-6-chloro-7-(1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazine-2-carboxylate. (S)-1-(1-(6-Amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (4.0 g, 12 mmol, Intermediate 35) was dissolved in EtOH (83 mL). 4 Å Molecular sieves (5 g) and ethyl bromopyruvate (3.5 mL, 25 mmol) were added sequentially, and the resulting reaction mixture was heated to 70° C. overnight. The reaction mixture was then filtered through diatomaceous earth (e.g., Celite®) and washed with EtOH. The solution was than partitioned between DCM (50 mL), a saturated aqueous solution of NaHCO3 (80 mL) and aqueous NaS2O3 (40 mL, 0.5 M). The aqueous layer was further extracted with DCM (4×30 mL). The combined organic layers were dried over anhydrous Na2SO4, filtered, concentrated to dryness and purified by silica gel chromatography (15-90% acetone/hexanes (0.1% TEA)) to afford the title compound as a tan foam in 78% yield.
- Step B: Ethyl (S)-7-(1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazine-2-carboxylate. Ethyl (S)-6-chloro-7-(1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazine-2-carboxylate (4.0 g, 9.7 mmol, Step A), 10% Pd/C (1.2 g, 9.7 mmol), and 28% NH4OH (2.0 mL, 29 mmol) were added sequentially to a Parr shaker containing MeOH (195 mL). The vessel was then pressurized to 20 psi of H2 and shaken for about 1 h. After this time, the reaction vessel was depressurized, and the reaction mixture was filtered and concentrated to dryness. The residue was partitioned between EtOAc (40 mL) and saturated aqueous NaHCO3 (40 mL). The aqueous layer was further extracted with DCM (3×20 mL). The combined organic layers were dried over anhydrous Na2SO4, filtered, and concentrated to dryness to afford the title compound, which was used without further purification in 90% yield.
- Step C: (S)-7-(1-(5,5-Difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazine-2-carbaldehyde. Ethyl (S)-7-(1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazine-2-carboxylate (3.4 g, 8.8 mmol, Step B) was dissolved in THE (88 mL) and the reaction mixture was cooled to −78° C. A DIBAL solution (24 mL, 24 mmol, 1 M in DCM) was then added dropwise over 5 min. The reaction mixture was allowed to stir at −78° C. for 1.5 h and then quenched with Rochelle salt (10 g), a saturated aqueous solution of Rochelle salt (25 mL), and EtOAc (75 mL). The solution was allowed to warm to rt and stir overnight. After that time, the solution was diluted with EtOAc (75 mL), brine (30 mL), and 0.1 M aqueous HCl (40 mL). The layers were separated and the aqueous layer was further extracted with EtOAc (4×40 mL). The combined organic layers were washed with brine, dried over anhydrous Na2SO4, filtered, and concentrated to dryness to afford the title compound that was used without further purification in 99% yield.
- Step D: (S)—N-((E)-(7-((S)-1-(5,5-Difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methylene)-2,4,6-trimethylbenzenesulfinamide. (S)-7-(1-(5,5-Difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazine-2-carbaldehyde (2.9 g, 8.7 mmol, Step C) and Cs2CO3 (20 g, 61 mmol) were added to DCM (115 mL). (S)-2,4,6-Trimethylbenzenesulfinamide (1.7 g, 9.5 mmol) was then added and the reaction was allowed to stir at rt for 4 h. The reaction was filtered and washed with DCM. The solution was concentrated to dryness and then triturated with hexanes (45 mL) and DCM (16 mL). The turbid solution was filtered and the solid was dried to afford the title compound in 92% yield.
-
- Step A: (S)—N-((1R*)-2-Cyclopropoxy-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)propyl)-2,4,6-trimethylbenzenesulfinamide. (S)—N-((E)-(7-((S)-1-(5,5-Difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methylene)-2,4,6-trimethylbenzenesulfinamide (160 mg, 0.32 mmol, Intermediate 56) was dissolved in DMSO (4.9 mL) and then DIPEA (0.14 mL, 0.79 mmol), diethyl 1,4-dihydro-2,6-dimethyl-3,5-pyridinedicarboxylate (160 mg, 0.63 mmol), and 1,3-dioxoisoindolin-2-yl 2-cyclopropoxypropanoate (180 mg, 0.63 mmol, Intermediate 55) were added sequentially. The reaction mixture was sparged with N2 for 15 min and then irradiated with 450 nm light (40% LED intensity, max rpm fan, 1000 rpm stir) for 3 h. After this time DIPEA (30 μL, 0.16 mmol), diethyl 1,4-dihydro-2,6-dimethyl-3,5-pyridinedicarboxylate (32 mg, 0.13 mmol), and 1,3-dioxoisoindolin-2-yl 2-cyclopropoxypropanoate (34 mg, 0.13 mmol) were added. The reaction mixture was re-sparged for 5 min, and irradiated for an additional 30 min (450 nm light (40% LED intensity, max rpm fan, 1000 rpm stir)). The reaction mixture was than diluted with brine (30 mL), saturated aqueous NaHCO3 (15 mL), water (15 mL), and EtOAc (30 mL). The layers were separated and the aqueous layer was extracted with EtOAc (4×20 mL). The combined organic layers were dried over anhydrous Na2SO4, filtered, and concentrated to dryness. The residue was then purified by silica gel chromatography (0-100% of (25% EtOH and 0.1% TEA in EtOAc)/EtOAc) to afford the title compound in 52% yield.
- Step B: 1-((1S)-1-(2-((1R*)-1-Amino-2-cyclopropoxypropyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. The title compound was synthesized in a manner analogous to Intermediate 9 using (S)—N-((1R*)-2-cyclopropoxy-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)propyl)-2,4,6-trimethylbenzenesulfinamide (Step A) in place of tert-butyl ((R)-1-(7-((S*)-1-(((R)-tert-butylsulfinyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate and was used without further purification (100% yield).
-
- Step A: tert-Butyl ((S)-1-(6-chloro-7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate. tert-Butyl (S)-(7,7,7-trifluoro-1-iodo-6,6-dimethyl-2-oxoheptan-3-yl)carbamate (150 mg, 0.33 mmol, Intermediate 46) was added to a solution of (S)-1-(1-(6-amino-3-chloropyridazin-4-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (77 mg, 0.22 mmol, Intermediate 36) and sodium phosphate dibasic (41 mg, 0.29 mmol) in NMP (0.16 mL) and the reaction mixture was heated to 40° C. for 18 h. After this time an additional aliquot of tert-butyl (S)-(7,7,7-trifluoro-1-iodo-6,6-dimethyl-2-oxoheptan-3-yl)carbamate (100 mg, 0.22 mmol, Intermediate 46) and sodium phosphate dibasic (40 mg, 0.28 mmol) were added and the mixture was heated at 40° C. for an additional 8 h. The reaction mixture was then poured into water and was extracted with EtOAc (3×). The combined organic layers were washed with brine twice, dried over anhydrous MgSO4, filtered, and concentrated to dryness. The residue was the purified by silica gel chromatography (0-100% acetone/hexanes (0.1% TEA)) to afford the title compound in 99% yield.
- Step B: tert-Butyl ((S)-1-(7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 41 Step B, using tert-butyl ((S)-1-(6-chloro-7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate (Step A) in place of tert-butyl ((1R,2R)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)carbamate. The material was purified by silica gel chromatography (0-100% acetone/hexanes (0.1% TEA)) to provide the title compound in 55% yield.
- Step C: (S)-1-(7-((S)-2-Cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentan-1-aminium 2,2,2-trifluoroacetate. The title compound was synthesized in a manner analogous to Intermediate 41 Step C using tert-butyl ((S)-1-(7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate (Step B) in place of tert-butyl ((1R,2R)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)carbamate and was used without further purification (100% yield).
-
- Under dry conditions, sodium hydride (250 mg, 6.25 mmol, 60% dispersion in mineral oil) was dissolved in DMF (20 mL) and cooled to 0° C. Propan-2-ol (478 μL, 6.25 mmol) was added dropwise and stirred for 5 min before adding tributyl(iodomethyl)stannane (1.66 mL, 5.00 mmol) dropwise. The ice bath was removed and after stirring for 1 h, the reaction was quenched with H2O (15 mL), diluted with aqueous 5% LiCl (10 mL) and extracted with DCM (2×20 mL). The combined organic layers were washed with aqueous 5% LiCl, dried over anhydrous Na2SO4, filtered, and concentrated to dryness. The residue was purified by silica gel chromatography (10% EtOAc/hexanes) to provide the title compound in 95% yield.
-
- The title compound (100% yield) was prepared as described for the synthesis of Intermediate 59 using cyclobutanol in place of propan-2-ol.
-
- Step A: tert-Butyl ((S)-(7-((S*)-1-(((R)-tert-butylsulfinyl)amino)-2-cyclobutoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound (50% yield) was synthesized in a manner analogous to Intermediate 3 Step A using tributyl(cyclobutoxymethyl)stannane (Intermediate 60) in place of tributyl(methoxymethyl)stannane.
- Step B: tert-Butyl ((S)-(7-((S*)-1-amino-2-cyclobutoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound (94% yield) was prepared as described for the synthesis of Intermediate 9 using tert-butyl ((S)-(7-((S*)-1-(((R)-tert-butylsulfinyl)amino)-2-cyclobutoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step A) in place of tert-butyl ((R)-1-(7-((S*)-1-(((R)-tert-butylsulfinyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate.
- Step C: tert-Butyl ((S)-(7-((S*)-2-cyclobutoxy-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)ethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound (78% yield) was prepared as described for the synthesis of Intermediate 2 Step A using tert-butyl ((S)-(7-((S*)-1-amino-2-cyclobutoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step B) in place of tert-butyl ((S)-(7-((R)-amino(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step D: tert-Butyl ((S)-(7-((S*)-1-((3-amino-2,2-difluoropropyl)amino)-2-cyclobutoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound (90% yield) was prepared as described for the synthesis of Intermediate 2 Step B using tert-butyl ((S)-(7-((S*)-2-cyclobutoxy-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)ethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step C) in place of tert-butyl ((S)-(7-((R)-cyclopropyl((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step E: tert-Butyl ((S)-(7-((S*)-2-cyclobutoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound (66% yield) was prepared as described for the synthesis of Intermediate 2 Step C using tert-butyl ((S)-(7-((S*)-1-((3-amino-2,2-difluoropropyl)amino)-2-cyclobutoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step D) in place of tert-butyl ((S)-(7-((R)-((3-amino-2,2-difluoropropyl)amino)(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step F: 1-((S*)-1-(2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclobutoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. The title compound was prepared as described for the synthesis of Intermediate 2 Step D using tert-butyl ((S)-(7-((S*)-2-cyclobutoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step E) in place of tert-butyl ((S)-(7-((R)-cyclopropyl(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate and adding DCM (2 mL) as a co-solvent, and the residue was used without further purification (82% yield).
-
- The title compound (27% yield) was prepared as described for the synthesis of Intermediate 61 using tributyl(isopropoxymethyl)stannane (Intermediate 59) in place of tributyl(cyclobutoxymethyl)stannane.
-
- Step A: tert-Butyl ((S)-(7-((R*)—(((S)-tert-butylsulfinyl)amino)(tetrahydro-2H-pyran-4-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. A solution of tert-butyl ((S)-(7-((E)-(((S)-tert-butylsulfinyl)imino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (3.00 g, 6.03 mmol) in CH2Cl2 (60 mL) was cooled to −78° C. then tetrahydropyran-4-yl magnesium bromide (25 mL, 0.5 M in THF, 13 mmol) was added dropwise. The reaction was stirred for 20 min then warmed to 0° C. The reaction was stirred at this temperature for 30 min then another portion of tetrahydropyran-4-yl magnesium bromide (12 mL, 0.5 M in THF, 6.0 mmol) was added. The reaction was stirred at 0° C. for 1 h then another portion of tetrahydropyran-4-yl magnesium bromide (6.0 mL, 0.5 M in THF, 3.0 mmol) was added. The reaction was stirred at 0° C. for 1 h then quenched with acetic acid (1.4 mL, 24 mmol), diluted with saturated aqueous NaHCO3, and the layers were separated. The aqueous phase was extracted with CH2Cl2 then the combined organic layers were washed with brine, dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure. The two diastereoisomers that resulted were purified and separated by silica gel chromatography (30-60% acetone/hexanes). The major diastereomer (second eluting peak) was further purified by silica gel chromatography (50-60% acetone/hexanes with 0.1% TEA) (21% yield) and was designated as the R* isomer.
- Step B: tert-Butyl ((S)-(7-((R*)-amino(tetrahydro-2H-pyran-4-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound (86% yield) was prepared in a manner analogous to Intermediate 9 using tert-butyl ((S)-(7-((R*)—(((S)-tert-butylsulfinyl)amino)(tetrahydro-2H-pyran-4-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step A) in place of tert-butyl ((R)-1-(7-((S*)-1-(((R)-tert-butylsulfinyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate.
- Step C: tert-Butyl ((S)-(7-((R*)-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)(tetrahydro-2H-pyran-4-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound was prepared in a manner analogous to Intermediate 10 using tert-butyl ((S)-(7-((R*)-amino(tetrahydro-2H-pyran-4-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step B) in place of tert-butyl ((R)-1-(7-((S*)-1-amino-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate. Purification by silica gel chromatography (20-100% (10% MeOH/EtOAc)/(0.1% TEA/hexanes)) afforded the title compound in 29% yield.
- Step D: 1-((R*)-(2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)(tetrahydro-2H-pyran-4-yl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. To a solution of tert-butyl ((S)-(7-((R*)-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)(tetrahydro-2H-pyran-4-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (0.21 g, 0.32 mmol, Step C) in CH2Cl2 (0.2 mL) was added TFA (1.0 mL, 13 mmol). The reaction mixture was stirred at rt for 10 min then diluted with H2O and Na2CO3 was added until the pH of the mixture was pH 10. The mixture was extracted with 4:1 CH2Cl2:IPA, then the combined organics were dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to afford the title compound in 57% yield.
-
- Step A: 2-((1,1,1-Trifluoro-2-methylpropan-2-yl)oxy)propanoic acid. The title compound was synthesized in a manner analogous to Intermediate 37 Step A using 1,1,1-trifluoro-2-methylpropan-2-ol in place of (R)-1,1,1-trifluoropropan-2-ol and 2-bromopropanoic acid in place of (S)-2-bromopropanoic acid and was used without further purification.
- Step B: 1,3-Dioxoisoindolin-2-yl 2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)propanoate. The title compound (18% yield) was synthesized in a manner analogous to Intermediate 55 Step B using 2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)propanoic acid (Step A) in place of 2-cyclopropoxypropanoic acid.
-
- Step A: (S)—N-((1R*)-1-(7-((S)-1-(5,5-Difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)propyl)-2,4,6-trimethylbenzenesulfinamide. The title compound (45% yield) was synthesized in a manner analogous to Intermediate 57 Step A using 1,3-dioxoisoindolin-2-yl 2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)propanoate (Intermediate 64) in place of 1,3-dioxoisoindolin-2-yl 2-cyclopropoxypropanoate.
- Step B: 1-((1S)-1-(2-((1R*)-1-Amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)propyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. The title compound was synthesized in a manner analogous to Intermediate 9 using (S)—N-((1R*)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)propyl)-2,4,6-trimethylbenzenesulfinamide (Step A) in place of tert-butyl ((R)-1-(7-((S*)-1-(((R)-tert-butylsulfinyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate and was used without further purification (100% yield).
-
- Step A: (S,E)-N-(Cyclopropylmethylene)-2-methylpropane-2-sulfinamide. To a mixture of cyclopropanecarboxaldehyde (23.7 mL, 317.7 mmol) and (S)-2-methylpropane-2-sulfinamide (35 g, 289 mmol) in DCM (271 mL) were added CuSO4 (138 g, 866 mmol) and PPTS (3.63 g, 14.4 mmol) and the resulting mixture stirred at rt for 40 h. Then, additional cyclopropanecarboxaldehyde (2.15 mL, 28.9 mmol) and CuSO4 (23 g, 140 mmol) were added. The mixture was stirred for 2.5 d at rt and then filtered through diatomaceous earth (e.g., Celite®), and the filtrate was concentrated under reduced pressure. The concentrate was filtered through a pad of silica gel, rinsing with 40% EtOAc/hexanes. The filtrate was concentrated to dryness to provide the title compound as a pale-yellow oil (86% yield).
- Step B: N-(5-((R)—(((S)-tert-Butylsulfinyl)amino)(cyclopropyl)methyl)-6-chloropyridazin-3-yl)pivalamide. To a solution of 2,2,6,6-tetramethylpiperidinylmagnesium chloride lithium chloride complex in THE/toluene (75 mL, 61 mmol, 0.82 M) at −40° C. was added a solution of N-(6-chloropyridazin-3-yl)pivalamide (5.00 g, 23.4 mmol, Intermediate 32, Step A) in THF (50 mL) dropwise over 20 min via an addition funnel. The residue in the addition funnel was rinsed into the reaction mixture using an additional aliquot of THE (10 mL). The resulting solution was stirred at −40° C. for 3 h, then (S,E)-N-(cyclopropylmethylene)-2-methylpropane-2-sulfinamide (5.12 g, 28.1 mmol, Step A) was added. The solution was removed from the cold bath and allowed to warm to rt. After 1 h, additional (S,E)-N-(cyclopropylmethylene)-2-methylpropane-2-sulfinamide (1.28 g, 7.02 mmol, Step A) was added and the mixture was stirred at rt overnight. After that time, saturated aqueous NH4Cl was added and the mixture was extracted with EtOAc (3×). The organic layers were combined, washed with brine, dried over anhydrous MgSO4, filtered, and concentrated to dryness. The residue was purified by silica gel chromatography (20-50% acetone/hexanes) to provide the title compound as a light-yellow foam (65% yield).
- Step C: (R)—N-(5-(Amino(cyclopropyl)methyl)-6-chloropyridazin-3-yl)pivalamide. To a mixture of N-(5-((R)—(((S)-tert-butylsulfinyl)amino)(cyclopropyl)methyl)-6-chloropyridazin-3-yl)pivalamide (6.00 g, 15.5 mmol, Step B) in EtOAc (77.5 mL) was added 4 M HCl in 1,4-dioxane (15.5 mL, 62 mmol) and the resulting mixture stirred at rt for 3 d. The mixture was then poured into water (200 mL) and diluted with hexanes (150 mL). The layers were separated and the organic layer was extracted with 0.05 M aqueous HCl (50 mL). The aqueous layers were combined and washed with hexanes (50 mL). Then, the aqueous layers were poured into a flask with EtOAc (100 mL) and the pH of the solution was adjusted to pH 10 by the addition of 3 M aqueous NaOH. The layers were separated and the aqueous layer was further extracted with EtOAc (4×50 mL). The EtOAc layers were combined, dried over anhydrous Na2SO4, filtered, and concentrated to dryness to provide the title compound as a foam (86% yield).
- Step D: (R)—N-(6-Chloro-5-(cyclopropyl((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)methyl)pyridazin-3-yl)pivalamide. A mixture of (R)—N-(5-(amino(cyclopropyl)methyl)-6-chloropyridazin-3-yl)pivalamide (2.0 g, 7.1 mmol, Step C), 3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl trifluoromethanesulfonate (4.22 g, 11.3 mmol), DIPEA (1.85 mL, 10.6 mmol) and ACN (24 mL) was heated at 55° C. for 2.5 d. The mixture was cooled to rt and concentrated to dryness. The residue was purified by silica gel chromatography (10-50% acetone/hexanes (0.1% TEA)) to provide the title compound as a white solid (78% yield).
- Step E: (R)-2-(3-(((6-Amino-3-chloropyridazin-4-yl)(cyclopropyl)methyl)amino)-2,2-difluoropropyl)isoindoline-1,3-dione. To a solution of (R)—N-(6-chloro-5-(cyclopropyl((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)methyl)pyridazin-3-yl)pivalamide (1 g, 2 mmol, Step D) in MeOH (15 mL) was added H2SO4 (15 mL, 45 mmol, 3 M in water) and the resulting solution was heated at 55° C. for 8 h. The mixture was cooled to rt and diluted with half-saturated brine (50 mL) and EtOAc, and then the pH of the mixture was adjusted to pH 12 by the addition of 3 M aqueous NaOH. The layers were separated and the aqueous layer was further extracted with EtOAc (50 mL) followed by DCM (2×30 mL). The organic layers were combined, dried over anhydrous Na2SO4, filtered, and concentrated to dryness to provide the title compound (68% yield).
- Step F: (R)—N1-((6-Amino-3-chloropyridazin-4-yl)(cyclopropyl)methyl)-2,2-difluoropropane-1,3-diamine. The title compound was prepared as described for Intermediate 2 Step B using (R)-2-(3-(((6-amino-3-chloropyridazin-4-yl)(cyclopropyl)methyl)amino)-2,2-difluoropropyl)isoindoline-1,3-dione (Step E) in place of tert-butyl ((S)-(7-((R)-cyclopropyl((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate and was used without further purification.
- Step G: (R)-1-((6-Amino-3-chloropyridazin-4-yl)(cyclopropyl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. The title compound (69% yield) was prepared as described for Intermediate 15 Step C using (R)—N1-((6-amino-3-chloropyridazin-4-yl)(cyclopropyl)methyl)-2,2-difluoropropane-1,3-diamine (Step F) in place of tert-butyl ((S)-(7-((S)-1-((3-amino-2,2-difluoropropyl)amino)-2-cyclopropoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step H: tert-Butyl ((R)-1-(6-chloro-7-((R)-cyclopropyl(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate. The title compound was prepared as described for Intermediate 41 Step A using (R)-1-((6-amino-3-chloropyridazin-4-yl)(cyclopropyl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Step G) in place of (S)-1-(1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one and tert-butyl (S)-(4-iodo-3-oxo-1-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)butan-2-yl)carbamate in place of tert-butyl ((3S,4R)-1-iodo-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate. In addition, the reaction mixture was heated at 50° C. for 48 h instead of 16 h and purified by silica gel chromatography (5-60% acetone/hexanes (0.1% TEA)) to provide the title compound in 79% yield.
- Step I: tert-Butyl ((R)-1-(7-((R)-cyclopropyl(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate. To a Parr shaker bottle was added 10% Pd/C (469 mg, 3.83 mmol) and MeOH (10 mL). Then, a solution of tert-butyl ((R)-1-(6-chloro-7-((R)-cyclopropyl(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (385 mg, 0.63 mmol, Step H) in MeOH (20 mL) was added and the bottle was placed under 50 psi H2 on the Parr shaker for 17 h. The bottle was sparged with air, filtered through diatomaceous earth (e.g., Celite®), and the filtrate was concentrated under reduced pressure. The residue was purified by silica gel chromatography (5-50% acetone/hexanes (0.1% TEA)) to provide the title compound as a light-yellow oil (5% yield).
- Step J: 1-((R)-(2-((R)-1-Amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)(cyclopropyl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. The title compound (100% yield) was prepared as described in Intermediate 20 Step C using tert-butyl ((R)-1-(7-((R)-cyclopropyl(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (Step I) in place of tert-butyl (S)-((7-((5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
-
- Step A: tert-Butyl ((S)-(6-chloro-7-((R)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. An oven dried vial was charged with (R)-1-(1-(6-amino-3-chloropyridazin-4-yl)ethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (79 mg, 0.27 mmol, Intermediate 84), activated 4 Å mol sieves and DMA (1.2 mL). A separate solution of tert-butyl (S)-(1-(4,4-difluorocyclohexyl)-3-iodo-2-oxopropyl)carbamate (451 mg, 1.08 mmol) in DMA (6 mL) was added and the reaction mixture was heated to 50° C. for 2.5 d under an a N2 atmosphere. After this time, an additional aliquot of tert-butyl (S)-(1-(4,4-difluorocyclohexyl)-3-iodo-2-oxopropyl)carbamate (451 mg, 1.08 mmol) in DMA (3 mL) was added and the reaction mixture was heated at 50° C. for 1 h. The reaction mixture was then cooled to rt, diluted with EtOAc, filtered, and the collected solids were rinsed with EtOAc and DCM. To the filtrate was added ¼ saturated brine (50 mL) and the layers were separated. The aqueous layer was further extracted with EtOAc (20 mL), then the organic layers were combined, dried over anhydrous Na2SO4, filtered, and concentrated to dryness. The residue was purified by silica gel chromatography (5-60% acetone/hexanes (0.1% TEA)) to provide the title compound (100% yield).
- Step B: 1-((R)-1-(2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)ethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. To a Parr shaker bottle was added 10% Pd/C (250 mg, 2.04 mmol) and MeOH (10 mL). Then, a solution of tert-butyl ((S)-(6-chloro-7-((R)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (189 mg, 0.34 mmol, Step A) in MeOH (15 mL) was added followed by NH4OH (0.28 mL, 2.12 mmol, 28-30% in water) and the bottle was placed under 50 psi H2 on the Parr shaker for 3.5 h. The bottle was sparged with air and concentrated to dryness. The residue was dissolved in DCM (6 mL), cooled to 0° C. in an ice-bath and then TFA (2 mL, 26 mmol) was added. The resulting mixture was stirred at rt for 75 min, then concentrated to dryness to provide the title compound (99% yield), which was used without further purification.
-
- Step A: tert-Butyl ((R)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate. The title compound (50% yield) was prepared as described in Intermediate 67 Step A using (S)-1-(1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 35) in place of (R)-1-(1-(6-amino-3-chloropyridazin-4-yl)ethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one and tert-butyl (S)-(4-iodo-3-oxo-1-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)butan-2-yl)carbamate in place of tert-butyl (S)-(1-(4,4-difluorocyclohexyl)-3-iodo-2-oxopropyl)carbamate.
- Step B: tert-Butyl ((R)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate. A vial was charged with tert-butyl ((R)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (127 mg, 0.21 mmol, Step A), EtOH (20 mL), Pd/C (63 mg, 0.52 mmol, 10 wt % Pd) and ammonium formate (130 mg, 2.07 mmol). The vial was heated to 80° C., stirred for 6 h, then stirred at rt overnight. The reaction mixture was filtered through a pad of diatomaceous earth (e.g., Celite®), and the solids were washed with EtOH. The combined organic layers were concentrated to dryness, then partitioned between DCM (20 mL) and saturated aqueous NaHCO3 (15 mL). The aqueous layer was further extracted with DCM (20 mL), then the organic layers were combined, dried over anhydrous Na2SO4, filtered and concentrated to dryness to provide the title compound (100% yield) that was used without further purification.
- Step C: 1-((S)-1-(2-((R)-1-Amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. To a mixture of tert-butyl ((R)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (120 mg, 0.21 mmol, Step B) in DCM (6.7 mL) at 0° C. was added TFA (6 mL) and the resulting solution was stirred at 0° C. for 1.5 h. The mixture was concentrated to dryness and azeotroped with toluene to provide the title compound in 100% yield, which was used without further purification.
-
- The title compound (59% yield) was prepared as described for the synthesis of Intermediate 45 Steps C-F using (2R,5R)-2-isopropyl-3,6-dimethoxy-5-(4,4,4-trifluoro-3,3-dimethylbutyl)-2,5-dihydropyrazine (Intermediate 45, Step B second-eluting isomer) in place of (2R,5S)-2-isopropyl-3,6-dimethoxy-5-(4,4,4-trifluoro-3,3-dimethylbutyl)-2,5-dihydropyrazine in Step C.
-
- The title compound was prepared as described for the synthesis of Intermediate 46 using tert-butyl (R)-(1-(dimethyl(oxo)-λ6-sulfaneylidene)-7,7,7-trifluoro-6,6-dimethyl-2-oxoheptan-3-yl)carbamate (Intermediate 69) in place of tert-butyl (S)-(1-(dimethyl(oxo)-λ6-sulfaneylidene)-7,7,7-trifluoro-6,6-dimethyl-2-oxoheptan-3-yl)carbamate in Step A.
-
- The title compound was prepared as described for the synthesis of Intermediate 44, using tert-butyl (R)-(7,7,7-trifluoro-1-iodo-6,6-dimethyl-2-oxoheptan-3-yl)carbamate (Intermediate 70) in place of tert-butyl (S)-(6,6,6-trifluoro-1-iodo-5,5-dimethyl-2-oxohexan-3-yl)carbamate in Step A. In step B, instead of an aqueous extraction, the residue was directly purified by silica gel chromatography (5-70% acetone/hexanes (with 0.1% TEA)), and in step C, the mixture was concentrated to dryness and used directly without aqueous workup or further purification.
-
- A mixture of 4,4-difluoro-3,3-dimethylpentanoic acid (1 g, 6.02 mmol), N-hydroxyphthalimide (1.11 g, 6.62 mmol), EDCI (1.27 g, 6.62 mmol) and DMAP (74 mg, 0.6 mmol) in DCM (17 mL) was stirred at rt overnight. After that time, the mixture was concentrated to dryness and the residue was purified by silica gel chromatography (10-90% EtOAc/hexanes) to provide the title compound as a white solid (44% yield).
-
- Step A: (S)—N-(6-Chloro-5-(1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl-1,1,3,3-d4)amino)-2-methoxyethyl)pyridazin-3-yl)pivalamide. The title compound was prepared as described in Intermediate 35 Step B using 3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl-1,1,3,3-d4 trifluoromethanesulfonate (Intermediate 27) in place of 3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl trifluoromethanesulfonate. The reaction was heated at 55° C. for 45 h and subsequently heated at 60° C. for 54 h with no additional aliquots of starting materials added to provide the title compound as a white foam (79% yield).
- Step B: (S)-2-(3-((1-(6-Amino-3-chloropyridazin-4-yl)-2-methoxyethyl)amino)-2,2-difluoropropyl-1,1,3,3-d4)isoindoline-1,3-dione. The title compound was prepared as described in Intermediate 35 Step C using (S)—N-(6-chloro-5-(1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl-1,1,3,3-d4)amino)-2-methoxyethyl)pyridazin-3-yl)pivalamide (Step A) in place of (S)—N-(6-chloro-5-(1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)-2-methoxyethyl)pyridazin-3-yl)pivalamide and was used without further purification.
- Step C: (S)—N1-(1-(6-Amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-2,2-difluoropropane-1,1,3,3-d4-1,3-diamine. The title compound was prepared as described in Intermediate 35 Step D using (S)-2-(3-((1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)amino)-2,2-difluoropropyl-1,1,3,3-d4)isoindoline-1,3-dione (Step B) in place of (S)-2-(3-((1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)amino)-2,2-difluoropropyl)isoindoline-1,3-dione. The reaction mixture was stirred at rt for 1.5 h and then heated at 35° C. for 40 h to provide the title compound as a yellow oil that was used without further purification.
- Step D: (S)-1-(1-(6-Amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4. The title compound was prepared as described in Intermediate 35 Step E using (S)—N1-(1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-2,2-difluoropropane-1,1,3,3-d4-1,3-diamine (Step C) in place of (S)—N1-(1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-2,2-difluoropropane-1,3-diamine, and the reaction mixture was heated at 55° C. for 3 h to provide the title compound in 5% yield.
- Step E: tert-Butyl ((S)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl-4,4,6,6-d4)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate. The title compound was prepared as described in Intermediate 44 Step A using (S)-1-(1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 (Step D) in place of (S)-1-(1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one and tert-butyl (S)-(7,7,7-trifluoro-1-iodo-6,6-dimethyl-2-oxoheptan-3-yl)carbamate (Intermediate 46) in place of tert-butyl (S)-(6,6,6-trifluoro-1-iodo-5,5-dimethyl-2-oxohexan-3-yl)carbamate. The reaction mixture was heated at 50° C. for 4.5 h to provide the title compound in 54% yield.
- Step F: tert-Butyl ((5)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl-4,4,6,6-d4)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate. To a Parr shaker bottle was added 10% Pd/C (250 mg, 2.04 mmol) and tert-butyl ((5)-1-(6-chloro-7-((5)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl-4,4,6,6-d4)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate (174 mg, 0.28 mmol, Step E) in MeOH (25 mL) followed by NH4OH (0.11 mL, 0.85 mmol, 28-30% in water) and the bottle was placed under 50 psi H2 on the Parr shaker for 3 h. The bottle was sparged with air, then the mixture was filtered, rinsed with MeOH, and the filtrate was concentrated to dryness to provide the title compound that was used without further purification.
- Step G: 1-((S)-1-(2-((S)-1-Amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4. A solution of tert-butyl ((S)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl-4,4,6,6-d4)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate (164 mg, 0.28 mmol, Step F) in DCM (9.4 mL) was cooled to 0° C. Then, TFA (3 mL, 39 mmol) was added and the resulting mixture stirred at rt for 4.5 h. The mixture was concentrated to dryness and the residue diluted with EtOAc (50 mL) and saturated aqueous NaHCO3 (50 mL). The pH of the mixture was adjusted to pH 11 by the addition of 3 M aqueous NaOH and brine (15 mL). The layers were separated and the aqueous portion was further extracted with EtOAc (4×30 mL). The organic layers were combined, dried over anhydrous Na2SO4, filtered, and concentrated to dryness to provide the title compound as a light-yellow foam that was used without further purification.
-
- Step A: (S)—N-(6-Chloro-5-(2-cyclopropoxy-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl-1,1,3,3-d4)amino)ethyl)pyridazin-3-yl)pivalamide. The title compound was prepared as described in Intermediate 35 Step B using (S)—N-(5-(1-amino-2-cyclopropoxyethyl)-6-chloropyridazin-3-yl)pivalamide (Intermediate 36, Step A) in place of (S)—N-(5-(1-amino-2-methoxyethyl)-6-chloropyridazin-3-yl)pivalamide and 3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl-1,1,3,3-d4 trifluoromethanesulfonate (Intermediate 27) in place of 3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl trifluoromethanesulfonate. The reaction mixture was heated at 55° C. for 46 h and then heated at 60° C. for 54 h with no additional aliquots of starting materials added to provide the title compound as a white foam (82% yield).
- Step B: (S)-2-(3-((1-(6-Amino-3-chloropyridazin-4-yl)-2-cyclopropoxyethyl)amino)-2,2-difluoropropyl-1,1,3,3-d4)isoindoline-1,3-dione. The title compound was prepared as described in Intermediate 35 Step C using (S)—N-(6-chloro-5-(2-cyclopropoxy-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl-1,1,3,3-d4)amino)ethyl)pyridazin-3-yl)pivalamide (Step A) in place of (S)—N-(6-chloro-5-(1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)-2-methoxyethyl)pyridazin-3-yl)pivalamide and was used without further purification.
- Step C: (S)—N1-(1-(6-Amino-3-chloropyridazin-4-yl)-2-cyclopropoxyethyl)-2,2-difluoropropane-1,1,3,3-d4-1,3-diamine. The title compound was prepared as described in Intermediate 35 Step D using (S)-2-(3-((1-(6-amino-3-chloropyridazin-4-yl)-2-cyclopropoxyethyl)amino)-2,2-difluoropropyl-1,1,3,3-d4)isoindoline-1,3-dione (Step B) in place of (S)-2-(3-((1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)amino)-2,2-difluoropropyl)isoindoline-1,3-dione. The reaction mixture was heated at rt for 1.5 h followed by 35° C. for 39.5 h to provide the title compound as a gummy solid that was used without further purification.
- Step D: (S)-1-(1-(6-Amino-3-chloropyridazin-4-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4. The title compound (73% yield) was prepared as described in Intermediate 35 Step E using (S)—N1-(1-(6-amino-3-chloropyridazin-4-yl)-2-cyclopropoxyethyl)-2,2-difluoropropane-1,1,3,3-d4-1,3-diamine (Step C) in place of (S)—N1-(1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-2,2-difluoropropane-1,3-diamine.
- Step E: tert-Butyl ((S)-1-(6-chloro-7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl-4,4,6,6-d4)ethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate. The title compound was prepared as described in Intermediate 44 Step A using (S)-1-(1-(6-amino-3-chloropyridazin-4-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 (Step D) in place of (S)-1-(1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one and tert-butyl (S)-(7,7,7-trifluoro-1-iodo-6,6-dimethyl-2-oxoheptan-3-yl)carbamate (Intermediate 46) in place of tert-butyl (S)-(6,6,6-trifluoro-1-iodo-5,5-dimethyl-2-oxohexan-3-yl)carbamate. The reaction mixture was heated at 50° C. for 16.5 h and no additional iodide was added to provide the title compound in 84% yield.
- Step F: tert-Butyl ((S)-1-(7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl-4,4,6,6-d4)ethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate. The title compound was prepared as described in Intermediate 73 Step F using tert-butyl ((S)-1-(6-chloro-7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl-4,4,6,6-d4)ethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate (Step E) in place of tert-butyl ((S)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl-4,4,6,6-d4)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate and was used without further purification.
- Step G: 1-((S)-1-(2-((S)-1-Amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4. The title compound was prepared as described in Intermediate 73 Step G using tert-butyl ((5)-1-(7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl-4,4,6,6-d4)ethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate (Step F) in place of tert-butyl ((5)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl-4,4,6,6-d4)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate and was used without further purification.
-
- Step A: Ethyl (E)-4,4-difluoro-2-(hydroxyimino)-3-oxobutanoate. To a solution of ethyl 4,4-difluoro-3-oxobutanoate (24 mL, 181 mmol) in acetic acid (181 mL, 3.16 mol) was added a solution of sodium nitrite (18.8 g, 271.8 mmol) in water (60 mL) dropwise over 10 min. The resulting solution was stirred at 0° C. for 1.5 h. The mixture was then diluted with water (250 mL) and extracted with EtOAc (3×200 mL). The organic layers were combined and washed with saturated aqueous NaHCO3 (4×100 mL). Then, the pH of the aqueous layer was adjusted to pH 6 by the addition of solid NaHCO3, EtOAc (200 mL) was added and the mixture stirred vigorously for 1 h. The layers were separated and the aqueous layer was further extracted with EtOAc (3×100 mL). The EtOAc layers were combined, dried over anhydrous Na2SO4, filtered, and concentrated to dryness to provide the title compound as a brown oil (92% yield), which was used without further purification.
- Step B: Ethyl (2E,3E)-4,4-difluoro-2,3-bis(hydroxyimino)butanoate. To a mixture of ethyl (E)-4,4-difluoro-2-(hydroxyimino)-3-oxobutanoate (22.4 g, 114.7 mmol, Step A) in EtOH (114 mL) were added hydroxylamine hydrochloride (36.2 g, 516 mmol) and HCl (114 mL, 457 mmol, 4 M in 1,4-dioxane) and the resulting mixture was heated at 50° C. for 25 h. The reaction was cooled to rt, filtered, and the solids rinsed with DCM. The filtrate was concentrated to dryness and the residue was diluted with saturated aqueous NaHCO3 (150 mL). The mixture was extracted with EtOAc (100 mL followed by 2×50 mL). The organic layers were combined, dried over anhydrous Na2SO4, filtered, and concentrated to dryness. DCM (40 mL) was added to the residue and the mixture was stirred at rt for 2 h. A white precipitate formed and was removed by filtration, washing with DCM. The filtrate was concentrated to dryness and the residue purified by silica gel chromatography (0-100 EtOAc/hexanes) to provide the title compound as a pink solid (43% yield).
- Step C: Ethyl 4-(difluoromethyl)-1,2,5-oxadiazole-3-carboxylate. To a solution of ethyl (2E,3E)-4,4-difluoro-2,3-bis(hydroxyimino)butanoate (1.5 g, 7.1 mmol, Step B) in THE (29 mL) at 0° C. was added CDI (1.45 g, 8.92 mmol). The mixture was stirred at 0° C. for 5 min and then heated to 45° C. for 4.5 h. The mixture was cooled to rt and concentrated to dryness. The residue was purified by silica gel chromatography (0-100% EtOAc/hexanes) to provide the title compound as a colorless oil (42% yield).
-
- To a mixture of ethyl 4-(difluoromethyl)-1,2,5-oxadiazole-3-carboxylate (550 mg, 2.86 mmol, Intermediate 75) in water (5.7 mL) and 1,4-dioxane (5.7 mL) was added HCl (2.39 mL, 28.6 mmol, concentrated) and the resulting mixture was heated at 100° C. for 4 h. The reaction was cooled to rt, diluted with water (20 mL) and brine (15 mL) and extracted with diethyl ether (5×25 mL). The organic layers were combined, dried over anhydrous MgSO4 overnight, filtered, and concentrated to dryness to provide the title compound as a colorless oil (approximately 52% yield, title compound contained approximately 10% 1,4-dioxane) that was used without further purification.
-
- Step A: Ethyl (E)-4,4,4-trifluoro-2-(hydroxyimino)-3-oxobutanoate. The title compound was prepared as described in Intermediate 75 Step A using ethyl 4,4,4-trifluoroacetoacetate in place of ethyl 4,4-difluoro-3-oxobutanoate to provide the title compound as a colorless oil (74% yield).
- Step B: Ethyl (2E,3E)-4,4,4-trifluoro-2,3-bis(hydroxyimino)butanoate. To a mixture of ethyl (E)-4,4,4-trifluoro-2-(hydroxyimino)-3-oxobutanoate (8.45 g, 39.7 mmol, Step A) in EtOH (200 mL) was added hydroxylamine hydrochloride (11.1 g, 159 mmol) followed by sodium acetate (9.76 g, 119 mmol) and the resulting mixture was heated at 80° C. for 7 h followed by rt for 9 h. The mixture was filtered and the filtrate concentrated to dryness. The residue was suspended in diethyl ether (300 mL) and sonicated. The remaining solids were filtered and rinsed with diethyl ether. The diethyl ether layers were combined, washed with saturated aqueous NaHCO3 (100 mL) then by brine (100 mL), and dried over anhydrous Na2SO4. The mixture was filtered, concentrated to dryness and purified by silica gel chromatography (0-100% EtOAc/hexanes) to provide the title compound as a light orange-red oil (20% yield).
- Step C: Ethyl 4-(trifluoromethyl)-1,2,5-oxadiazole-3-carboxylate. The title compound (15% yield) was prepared as described in Intermediate 75 Step C using ethyl (2E,3E)-4,4,4-trifluoro-2,3-bis(hydroxyimino)butanoate (Step B) in place of ethyl (2E,3E)-4,4-difluoro-2,3-bis(hydroxyimino)butanoate and heated at 45° C. for 2 d and then stirred at rt for 1 d.
-
- The title compound (96% yield) was prepared as described for the synthesis of Intermediate 14 using tert-butyl ((S)-(7-((S)—(((R)-tert-butylsulfinyl)amino)(1-cyanocyclobutyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate in place of ((S)-(7-((S)-1-(((R)-tert-butylsulfinyl)amino)-2-cyclopropoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
-
- Step A: tert-Butyl ((S)-(7-((S)-(1-cyanocyclobutyl)((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound (45% yield) was prepared as described for the synthesis of Intermediate 15 Step A using tert-butyl ((S)-(7-((S)-amino(1-cyanocyclobutyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Intermediate 78) in place of tert-butyl ((S)-(7-((S)-1-amino-2-cyclopropoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step B: tert-Butyl ((S)-(7-((S)-((3-amino-2,2-difluoropropyl)amino)(1-cyanocyclobutyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound (91% yield) was prepared as described for the synthesis of Intermediate 15 Step B using tert-butyl ((S)-(7-((S)-(1-cyanocyclobutyl)((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step A) in place of tert-butyl ((S)-(7-((S)-2-cyclopropoxy-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)ethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step C: tert-Butyl ((S)-(7-((S)-(1-cyanocyclobutyl)(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound (22% yield) was prepared as described for the synthesis of Intermediate 15 Step C using tert-butyl ((S)-(7-((S)-((3-amino-2,2-difluoropropyl)amino)(1-cyanocyclobutyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step B) in place of tert-butyl ((S)-(7-((S)-1-((3-amino-2,2-difluoropropyl)amino)-2-cyclopropoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
-
- The title compound was prepared as described for the synthesis of Intermediate 20 Step C using tert-butyl ((S)-(7-((S)-(1-cyanocyclobutyl)(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Intermediate 79) in place of tert-butyl ((R)-1-(7-((S*)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate and was used without further purification.
-
- Step A: tert-Butyl (S)-((7-(((4-amino-2,2,3,3-tetrafluorobutyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 20 Step A using 2,2,3,3-tetrafluorobutane-1,4-diamine in place of 2,2-difluoropropane-1,3-diamine dihydrochloride and was used without further purification.
- Step B: tert-Butyl ((1S)-(4,4-difluorocyclohexyl)(7-((5-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 20 Step B using tert-butyl (S)-((7-(((4-amino-2,2,3,3-tetrafluorobutyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step A) in place of tert-butyl (S)-((7-(((3-amino-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate to afford the title compound in 30% yield over the two steps.
- Step C: (S)-1-((2-(Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5,6,6-tetrafluoro-1,3-diazepan-2-one. The title compound (93% yield) was prepared as described for the synthesis of Intermediate 20 Step C using tert-butyl ((1S)-(4,4-difluorocyclohexyl)(7-((5-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate (Step B) in place of tert-butyl (S)-((7-((5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
-
- To a stirred solution of (S)-(−)-2-methyl-2-propanesulfinamide (10.0 g, 80.9 mmol) in DCM (40.4 mL) was added acetaldehyde (32.1 g, 728 mmol), anhydrous MgSO4 (29.2 g, 243 mmol), and PPTS (1.02 g, 4.04 mmol). The reaction mixture was stirred at rt for 12 h, at which point the reaction mixture was filtered through diatomaceous earth (e.g., Celite®) and the filter cake washed with DCM. The filtrate was transferred to a separatory funnel and washed with water (100 mL), half-saturated brine (100 mL), and saturated brine (100 mL). The organic layer was collected, dried over anhydrous MgSO4, filtered, and concentrated to afford the title compound in 94% yield.
-
- To a stirred solution of TMPMgCl.LiCl (128.1 mL, 121.7 mmol, 1.0 M in THE/toluene) was added N-(6-chloropyridazin-3-yl)pivalamide (10 g, 46.8 mmol, Intermediate 32 Step A) in THE (100 mL) dropwise at −40° C. under a nitrogen atmosphere. The resulting mixture was stirred for 2.5 h at −40° C. under nitrogen atmosphere, then (S,E)-N-ethylidene-2-methylpropane-2-sulfinamide (11.2 g, 76.1 mmol, Intermediate 82) was added dropwise over 5 min. The reaction mixture was stirred at −40° C. for 20 min at which point the cooling bath was removed and then the reaction mixture was allowed to warm to rt. After 24 h, the reaction mixture was cooled to 0° C. and quenched by the addition of saturated aqueous NH4Cl (30 mL). The resulting mixture was extracted with EtOAc (3×200 mL) and the combined organic layers were dried over anhydrous Na2SO4, and filtered. The filtrate was concentrated to dryness and the residue was initially purified by silica gel chromatography (10-45% acetone/hexanes (with 0.1% TEA)) and then further purified by SFC (Whelk O1 SS 3 μm, 50×3 mm, Mobile phase: 20% MeOH, 80% CO2) to afford the title compound in 30% yield.
-
- Step A: (R)—N-(5-(1-Aminoethyl)-6-chloropyridazin-3-yl)pivalamide. The title compound (92% yield) was prepared as described for the synthesis of Intermediate 35 Step A using N-(5-((R)-1-(((S)-tert-butylsulfinyl)amino)ethyl)-6-chloropyridazin-3-yl)pivalamide (Intermediate 83) in place of N-(5-((5)-1-(((R)-tert-butylsulfinyl)amino)-2-methoxyethyl)-6-chloropyridazin-3-yl)pivalamide.
- Step B: (R)—N-(6-Chloro-5-(1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)ethyl)pyridazin-3-yl)pivalamide. The title compound (79% yield) was prepared as described for the synthesis of Intermediate 35 Step B using (R)—N-(5-(1-aminoethyl)-6-chloropyridazin-3-yl)pivalamide (Step A) in place of (S)—N-(5-(1-amino-2-methoxyethyl)-6-chloropyridazin-3-yl)pivalamide.
- Step C: (R)-2-(3-((1-(6-Amino-3-chloropyridazin-4-yl)ethyl)amino)-2,2-difluoropropyl)isoindoline-1,3-dione. The title compound (63% yield) was prepared as described for the synthesis of Intermediate 35 Step C using (R)—N-(6-chloro-5-(1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)ethyl)pyridazin-3-yl)pivalamide (Step B) in place of (S)—N-(6-chloro-5-(1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)-2-methoxyethyl)pyridazin-3-yl)pivalamide.
- Step D: (R)—N1-(1-(6-Amino-3-chloropyridazin-4-yl)ethyl)-2,2-difluoropropane-1,3-diamine. The title compound was prepared as described for the synthesis of Intermediate 35 Step D using (R)-2-(3-((1-(6-amino-3-chloropyridazin-4-yl)ethyl)amino)-2,2-difluoropropyl)isoindoline-1,3-dione (Step C) in place of (S)-2-(3-((1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)amino)-2,2-difluoropropyl)isoindoline-1,3-dione and was used without further purification.
- Step E: (R)-1-(1-(6-Amino-3-chloropyridazin-4-yl)ethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. The title compound (100% yield over Step D and Step E) was prepared as described for the synthesis of Intermediate 35 Step E using (R)—N1-(1-(6-amino-3-chloropyridazin-4-yl)ethyl)-2,2-difluoropropane-1,3-diamine (Step D) in place of (S)—N1-(1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-2,2-difluoropropane-1,3-diamine.
-
- Step A: tert-Butyl ((R)-1-(6-chloro-7-((R)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate. The title compound (42% yield) was synthesized in a manner analogous to Intermediate 41 Step A using (R)-1-(1-(6-amino-3-chloropyridazin-4-yl)ethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 84) in place of (S)-1-(1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one and tert-butyl (S)-(4-iodo-3-oxo-1-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)butan-2-yl)carbamate in place of tert-butyl ((3S,4R)-1-iodo-2-oxo-4-(((R)-1,1,1-trifluoropropan-2-yl)oxy)pentan-3-yl)carbamate.
- Step B: tert-Butyl ((R)-1-(7-((R)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate. To a solution of tert-butyl ((R)-1-(6-chloro-7-((R)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (133.4 mg, 0.228 mmol, Step A) in MeOH (9.1 mL) in a Parr shaker was added 10% wt Pd/C (97.1 mg, 0.09 mmol). To the vessel was attached a vacuum line and the vessel was purged and backfilled with 1 atm N2 three times. The vessel was then purged and backfilled with 3 atm of H2 (three times) and was shaken at this pressure for 5 h. After 5 h, the reaction mixture was filtered through diatomaceous earth (e.g., Celite®) and the pad was washed with MeOH. The filtrate was concentrated to dryness and the residue was purified by silica gel chromatography (0-100% EtOAc/hexanes) to afford the title compound in 31% yield.
- Step C: 1-((R)-1-(2-((R)-1-Amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)ethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. The title compound (100% yield) was synthesized in a manner analogous to Intermediate 41 Step C using tert-butyl ((R)-1-(7-((R)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate (Step B) in place of tert-butyl ((1R,2R)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propyl)carbamate.
-
- Step A: tert-Butyl ((S)-1-(6-chloro-7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-4,4,4-trifluoro-3,3-dimethylbutyl)carbamate. The title compound (34% yield) was synthesized in a manner analogous to Intermediate 44 Step A using (R)-1-(1-(6-amino-3-chloropyridazin-4-yl)ethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 84) in place of (S)-1-(1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one.
- Step B: tert-Butyl ((S)-1-(7-((R)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-4,4,4-trifluoro-3,3-dimethylbutyl)carbamate. The title compound (31% yield) was synthesized in a manner analogous to Intermediate 85 Step B using tert-butyl ((S)-1-(6-chloro-7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-4,4,4-trifluoro-3,3-dimethylbutyl)carbamate (Step A) in place of tert-butyl ((R)-1-(6-chloro-7-((R)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate.
- Step C: 1-((R)-1-(2-((S)-1-Amino-4,4,4-trifluoro-3,3-dimethylbutyl)imidazo[1,2-b]pyridazin-7-yl)ethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. The title compound (100% yield) was prepared in a manner analogous to Intermediate 20 Step C using tert-butyl ((S)-1-(7-((R)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-4,4,4-trifluoro-3,3-dimethylbutyl)carbamate (Step B) in place of tert-butyl (S)-((7-((5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
-
- Step A: tert-Butyl ((S)-(7-((S)-1-(((R)-tert-butylsulfinyl)amino)-2,2-difluoroethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. To a stirred solution of tert-butyl ((S)-(7-((E)-(((R)-tert-butylsulfinyl)imino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (1.89 g, 3.81 mmol) and (difluoromethyl)trimethylsilane (1.51 mL, 11.0 mmol) in THE (30 mL) was added t-BuOK (1 M in THF, 11.3 mL, 11.3 mmol) at −78° C. After stirring for 1.5 h at −78° C., the reaction was quenched at −78° C. via the addition of saturated aqueous NH4Cl (20 mL) and allowed to warm to rt. The reaction was then diluted with water (150 mL) and Et2O (150 mL) and transferred to a separatory funnel where the layers were separated. The aqueous layer was then washed with Et2O (3×100 mL). The combined organic layers were washed with brine, dried over anhydrous MgSO4, filtered, concentrated to dryness, and purified by silica gel chromatography (10-50% acetone/hexanes) to afford the title compound in 17% yield.
- Step B: tert-Butyl ((S)-(7-((S)-1-amino-2,2-difluoroethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound (88% yield) was prepared as described for the synthesis of Intermediate 9 using tert-butyl ((S)-(7-((S)-1-(((R)-tert-butylsulfinyl)amino)-2,2-difluoroethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step A) in place of tert-butyl ((R)-1-(7-((S*)-1-(((R)-tert-butylsulfinyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate.
- Step C: tert-Butyl ((S)-(4,4-difluorocyclohexyl)(7-((S)-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)-2,2-difluoroethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate. The title compound (59% yield) was prepared as described for the synthesis of Intermediate 2 Step A using tert-butyl ((S)-(7-((S)-1-amino-2,2-difluoroethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step B) in place of tert-butyl ((S)-(7-((R)-amino(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step D: tert-Butyl ((S)-(7-((S)-1-((3-amino-2,2-difluoropropyl)amino)-2,2-difluoroethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound was prepared as described for the synthesis of Intermediate 2 Step B tert-butyl ((S)-(4,4-difluorocyclohexyl)(7-((S)-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)-2,2-difluoroethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate (Step C) in place of tert-butyl ((S)-(7-((R)-cyclopropyl((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate and was used without further purification.
- Step E: tert-Butyl ((S)-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2,2-difluoroethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound (60% yield over Step D and Step E) was prepared as described for the synthesis of Intermediate 2, Step C, using tert-butyl ((S)-(7-((S)-1-((3-amino-2,2-difluoropropyl)amino)-2,2-difluoroethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step D) in place of tert-butyl ((S)-(7-((R)-((3-amino-2,2-difluoropropyl)amino)(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step F: 1-((S)-1-(2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2,2-difluoroethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. The title compound (100% yield) was prepared as described for the synthesis of Intermediate 2 Step D tert-butyl ((S)-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2,2-difluoroethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step E) in place of tert-butyl ((S)-(7-((R)-cyclopropyl(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate and adding DCM (2 mL) as a co-solvent.
-
- The title compound (68% yield) was prepared in a manner analogous to Intermediate 55 Step B using 2-[1-(trifluoromethyl)cyclopropoxy]propanoic acid in place of 2-cyclopropoxypropanoic acid.
-
- Step A: (S)—N-((1R*)-1-(7-((S)-1-(5,5-Difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(1-(trifluoromethyl)cyclopropoxy)propyl)-2,4,6-trimethylbenzenesulfinamide.
- The title compound (32% yield) was prepared in a manner analogous to Intermediate 57 Step A using 1,3-dioxoisoindolin-2-yl 2-(1-(trifluoromethyl)cyclopropoxy)propanoate (Intermediate 88) in place of 1,3-dioxoisoindolin-2-yl 2-cyclopropoxypropanoate.
- Step B: 1-((1S)-1-(2-((1R*)-1-Amino-2-(1-(trifluoromethyl)cyclopropoxy)propyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. The title compound (100% yield) was prepared in a manner analogous to Intermediate 57 Step B using (S)—N-((1R*)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(1-(trifluoromethyl)cyclopropoxy)propyl)-2,4,6-trimethylbenzenesulfinamide (Step A) in place of (S)—N-((1R*)-2-cyclopropoxy-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)propyl)-2,4,6-trimethylbenzenesulfinamide.
-
- Step A: tert-Butyl ((S)-(7-((S*)-1-(((S)-tert-butylsulfinyl)amino)ethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. To a stirred solution of tert-butyl ((S)-(7-((E)-(((S)-tert-butylsulfinyl)imino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (6.07 g, 12.2 mmol) in THE (165 mL) was added methylmagnesium bromide (3 M in THF, 9.36 mL, 28.1 mmol) at −78° C. After 3 h, the reaction was quenched by addition of saturated aqueous NH4Cl (100 mL) at −78° C. and allowed to slowly warm to rt over time. The reaction mixture was diluted with water (100 mL) and EtOAc (150 mL) and transferred to a separatory funnel where the layers were separated. The aqueous layer was washed with EtOAc (3×100 mL), and the combined organic layers were washed with brine, dried over anhydrous MgSO4, filtered and concentrated to dryness. The material was initially purified by silica gel chromatography (10-70% acetone/hexanes) and then further purified by chiral SFC (Whelk O1 SS 5 μm, 250×21 mm, Mobile phase: 25% methanol, 75% CO2) to afford the title compound in 33% yield.
- Step B: tert-Butyl ((S)-(7-((S*)-1-aminoethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound (82% yield) was prepared as described for the synthesis of Intermediate 9 using tert-butyl ((S)-(7-((S*)-1-(((S)-tert-butylsulfinyl)amino)ethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step A) in place of tert-butyl ((R)-1-(7-((S*)-1-(((R)-tert-butylsulfinyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate.
- Step C: tert-Butyl ((S)-(4,4-difluorocyclohexyl)(7-((S*)-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)ethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate. The title compound (95% yield) was prepared as described for the synthesis of Intermediate 2 Step A using tert-butyl ((S)-(7-((S*)-1-aminoethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step B) in place of tert-butyl ((S)-(7-((R)-amino(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step D: tert-Butyl ((S)-(7-((S*)-1-((3-amino-2,2-difluoropropyl)amino)ethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound was prepared as described for the synthesis of Intermediate 2 Step B using tert-butyl ((S)-(4,4-difluorocyclohexyl)(7-((S*)-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)ethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate (Step C) in place of tert-butyl ((S)-(7-((R)-cyclopropyl((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate and was used without further purification.
- Step E: tert-Butyl ((S)-(7-((S*)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound was prepared as described for the synthesis of Intermediate 2 Step C using tert-butyl ((S)-(7-((S*)-1-((3-amino-2,2-difluoropropyl)amino)ethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step D) in place of tert-butyl ((S)-(7-((R)-((3-amino-2,2-difluoropropyl)amino)(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate and was used without further purification.
- Step F: 1-((S*)-1-(2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)ethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. The title compound (84% yield over Steps D-F) was prepared as described for the synthesis of Intermediate 2 Step D using tert-butyl ((S)-(7-((S*)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step E) in place of tert-butyl ((S)-(7-((R)-cyclopropyl(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate and adding DCM (2 mL) as a co-solvent.
-
- Step A: tert-Butyl ((1S)-(7-(((4-(((benzyloxy)carbonyl)amino)pentyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 20 Step A using benzyl (5-aminopentan-2-yl)carbamate in place of 2,2-difluoropropane-1,3-diamine dihydrochloride and was used without further purification.
- Step B: tert-Butyl ((1S)-(4,4-difluorocyclohexyl)(7-((4-methyl-2-oxo-1,3-diazepan-1-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate. The title compound (59% yield over two steps) was synthesized in a manner analogous to Intermediate 21 Step B using ((1S)-(7-(((4-(((benzyloxy)carbonyl)amino)pentyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step A) in place of tert-butyl ((1S)-(7-(((3-((tert-butoxycarbonyl)amino)-2-methylpropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step C: 1-((2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-4-methyl-1,3-diazepan-2-one. The title compound (77% yield) was prepared as described for the synthesis of Intermediate 20 Step C using tert-butyl ((1S)-(4,4-difluorocyclohexyl)(7-((4-methyl-2-oxo-1,3-diazepan-1-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate (Step B) in place of tert-butyl (S)-((7-((5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
-
- Step A: Diastereomeric mixture of tert-butyl ((S)-(7-(((((1S,3R)-3-(aminomethyl)-2,2-difluorocyclopropyl)methyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate and tert-butyl ((S)-(7-(((((1R,3S)-3-(aminomethyl)-2,2-difluorocyclopropyl)methyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compounds were synthesized in a manner analogous to Intermediate 20 Step A using ((1S,2R)-3,3-difluorocyclopropane-1,2-diyl)dimethanamine dihydrochloride in place of 2,2-difluoropropane-1,3-diamine dihydrochloride and were used without further purification.
- Step B: Diastereomeric mixture of tert-butyl ((S)-(7-(((1S,7R)-8,8-difluoro-4-oxo-3,5-diazabicyclo[5.1.0]octan-3-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate and tert-butyl ((S)-(7-(((1R,7S)-8,8-difluoro-4-oxo-3,5-diazabicyclo[5.1.0]octan-3-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compounds (62% yield over two steps) were synthesized in a manner analogous to Intermediate 20 Step B using the diastereomeric mixture made in Step A in place of tert-butyl (S)-((7-(((3-amino-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step C: Diastereomeric mixture of (1R,7S)-3-((2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-8,8-difluoro-3,5-diazabicyclo[5.1.0]octan-4-one and (1S,7R)-3-((2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-8,8-difluoro-3,5-diazabicyclo[5.1.0]octan-4-one. The title compounds (100% yield) were prepared as described for the synthesis of Intermediate 20 Step C using the diastereomeric mixture made in Step B in place of tert-butyl (S)-((7-((5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
-
- Step A: (2-Methoxyethene-1,1-diyl)dicyclopropane. To a solution of methoxymethyl)triphenylphosphonium (67.0 g, 218 mmol) in THE (100 mL) that had been cooled to 0° C. was added lithium bis(trimethylsilyl)amide (218 mL, 218 mmol, 1 M in THF) dropwise while stirring for 45 min at 0° C. Then a solution of dicyclopropylmethanone (20.0 g, 182 mmol) in THE (100 mL) was added dropwise over 10 min to the reaction mixture. The resulting mixture was stirred for 3 h at rt. The reaction mixture was diluted with n-hexane (100 mL) and then filtered to remove the precipitate. The filtrate was diluted with H2O (200 mL) and extracted with EtOAc (200 mL×3). The organic extracts were dried over anhydrous Na2SO4, filtered, and concentrated to dryness to give the title compound as a light-yellow oil (100% yield) that was used without further purification.
- Step B: 2,2-Dicyclopropylacetaldehyde. To a solution of (2-methoxyethene-1,1-diyl)dicyclopropane (25.0 g, 181 mmol, Step A) in anhydrous THE (150 mL) was added HCl (150 mL, 10% in water) and the resulting mixture was heated for 16 h at 75° C. The mixture was diluted with H2O (100 mL) and extracted with EtOAc (100 mL×3). The combined organic layers were dried over anhydrous Na2SO4, filtered, and concentrated to dryness to give the title compound (98% yield) as a light-yellow oil, which was used without further purification.
- Step C: (S,E)-N-(2,2-Dicyclopropylethylidene)-2-methylpropane-2-sulfinamide. To a solution of 2,2-dicyclopropylacetaldehyde (22.0 g, 177 mmol, Step B) in anhydrous DCM (300 mL) were added (S)-2-methylpropane-2-sulfinamide (25.8 g, 213 mmol), anhydrous CuSO4 (113 g, 709 mmol) and PPTS (6.68 g, 26.6 mmol) and the resulting mixture was stirred at rt for 16 h. The reaction mixture was filtered and the filtrate was washed with H2O (100 mL×2) and brine (100 mL). The organic layer was dried over anhydrous Na2SO4, filtered, and concentrated to dryness to give a light-yellow oil that was purified by silica gel chromatography (0-10% EtOAc/petroleum ether) to give the title compound as a light-yellow oil (62% yield).
- Step D: (S)—N—((S)-1-Cyano-2,2-dicyclopropylethyl)-2-methylpropane-2-sulfinamide. To a solution of (S,E)-N-(2,2-dicyclopropylethylidene)-2-methylpropane-2-sulfinamide (25.0 g, 110 mmol, Step C) in anhydrous DCM (300 mL) were added TMSCN (29.5 mL, 220 mmol), Sc(OTf)3 (10.8 g, 22.0 mmol) and 4 Å molecular sieves (20 g). The resulting mixture was stirred for 16 h at rt. The reaction mixture was filtered and the filtrate was concentrated to dryness to give a light-yellow oil that was purified by silica gel chromatography (0-60% EtOAc/petroleum ether) to give the title compound as a light-yellow oil (44% yield).
- Step E: Methyl (S)-2-amino-3,3-dicyclopropylpropanoate. To MeOH (50 mL) cooled to 0° C. was added MeCOCl (37.7 mL, 531 mmol) dropwise via syringe over 40 min. The reaction mixture was stirred for 30 min at 0° C. Then, a solution of (S)—N—((S)-1-cyano-2,2-dicyclopropylethyl)-2-methylpropane-2-sulfinamide (5.00 g, 19.7 mmol, Step D) in MeOH (50 mL) was added and the resulting mixture was heated for 22 h at 65° C. After that time, the mixture was cooled to 0° C. and another portion of MeCOCl (25.2 mL, 353 mmol) was added dropwise via syringe over 40 min. The mixture was stirred for 30 min at 0° C. The reaction mixture was heated for 16 h at 65° C. and then the mixture was cooled to 0° C. and MeCOCl (12.6 mL, 177 mmol) was added dropwise via syringe over 40 min. The reaction mixture was stirred for 30 min at 0° C. Then the reaction mixture was heated for 16 h at 65° C. After that time, the mixture was cooled to rt and concentrated to dryness to give the title compound as a light-yellow oil (92% yield) that was used without further purification.
- Step F: Methyl (S)-2-((tert-butoxycarbonyl)amino)-3,3-dicyclopropylpropanoate. To a solution of methyl (S)-2-amino-3,3-dicyclopropylpropanoate (6.60 g, 30.0 mmol, Step E) in THE (150 mL) were added K2CO3 (16.6 g, 120 mmol) and H2O (50 mL) and the resulting mixture was stirred for 30 min followed by the addition of (Boc)2O (6.98 mL, 30.0 mmol) in one portion. The reaction mixture was stirred for 2 h at rt. The reaction mixture was then poured into water (200 mL) and extracted with EtOAc (200 mL×3). The combined organic layers were dried over anhydrous Na2SO4, filtered, and concentrated to dryness to give a yellow oil that was purified by silica gel chromatography (0-10% EtOAc/petroleum ether) to give the title compound as a light-yellow oil (47% yield).
- Step G: (S)-2-((tert-Butoxycarbonyl)amino)-3,3-dicyclopropylpropanoic acid. To a solution of methyl (S)-2-((tert-butoxycarbonyl)amino)-3,3-dicyclopropylpropanoate (4.00 g, 14.1 mmol, Step F) in MeOH (15 mL) were added H2O (5 mL) and LiOH.H2O (2.96 g, 70.6 mmol) and the resulting mixture was heated for 16 h at 60° C. After that time, the mixture was concentrated to dryness to give a light-yellow solid that was poured into H2O (50 mL) and washed with EtOAc (50 mL×2). The organic and aqueous layers were separated and the pH of the aqueous solution was adjusted to pH 5-6 by the addition of saturated aqueous KHSO4. Then, the aqueous portion was extracted with EtOAc (50 mL×3) and the organic and aqueous layers were separated. The combined organic layers were dried over anhydrous Na2SO4, filtered, and concentrated to dryness to give the title compound as a light-yellow solid (100% yield) that was used without further purification.
- Step H: tert-Butyl (S)-(1,1-dicyclopropyl-4-(dimethyl(oxo)-λ6-sulfaneylidene)-3-oxobutan-2-yl)carbamate. To a solution of (S)-2-((tert-butoxycarbonyl)amino)-3,3-dicyclopropylpropanoic acid (10.0 g, 37.1 mmol, Step G) in anhydrous THE (50 mL) was added CDI (7.22 g, 44.6 mmol) and the resulting mixture was stirred for 2 h at 0° C. to form a yellow liquid designated mixture A. In a separate vessel, to a solution of Me3SOI (13.1 g, 59.4 mmol) in anhydrous THE (50 mL) was added t-BuOK (55.7 mL, 55.7 mmol) and this mixture, designated mixture B, was stirred for 2 h at rt. Then mixture A was added to mixture B by syringe over 2 min at rt. The culminating mixture was stirred for 2 h at 25° C., then diluted with H2O (200 mL) and extracted with EtOAc (200 mL×2). The combined organic layers were washed with brine (100 mL), dried over anhydrous Na2SO4, filtered, and concentrated to dryness to give a yellow solid that was initially purified by silica gel chromatography (0-100% EtOAc/petroleum ether) to give the title compound as a light-yellow oil. This oil was further purified by chiral SFC (DAICEL CHIRALPAK IG column, 10 μm, 250×50 mm; 35-35% (v/v) EtOH (containing 0.1% of 25% aqueous NH3)/CO2)) to give the title compound as an off-white solid (24% yield).
- Step I. tert-Butyl ((S)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2,2-dicyclopropylethyl)carbamate. To a vial were added (S)-1-(1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (150 mg, 0.466 mmol, Intermediate 35), tert-butyl (S)-(1,1-dicyclopropyl-4-(dimethyl(oxo)-λ6-sulfaneylidene)-3-oxobutan-2-yl)carbamate (192 mg, 0.560 mmol, Step H), RuCl(Cp)(PPh3)2 (16.9 mg, 0.0233 mmol), sodium trifluoromethanesulfonate (4.0 mg, 0.023 mol), dried 3 Å molecular sieves (121 mg) and toluene (1.5 mL) under an atmosphere of N2 and the resulting brown mixture was heated at 85° C. for 2 h. The reaction mixture was filtered through diatomaceous earth (e.g., Celite®) and washed with EtOAc (3×5 mL). Concentration of the filtrate gave a brown gel that was purified by silica gel chromatography (0-100% EtOAc/DCM) to give a brown gel that was further purified by preparative HPLC (20 mM NH4OH in H2O/CH3CN) to provide the title compound as a white gel (59% yield). SFC analysis was performed by SFC (Stationary phase: Whelk O1 SS, 3 μm, 50×3.0 mm, Mobile phase: gradient 5% to 60% methanol, 40% CO2), showing 88.9% of tert-butyl ((S)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2,2-dicyclopropylethyl)carbamate and 11.1% of a diastereomeric product.
- Step J: tert-Butyl ((S)-2,2-dicyclopropyl-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)ethyl)carbamate. To a solution of tert-butyl ((S)-1-(6-chloro-7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2,2-dicyclopropylethyl)carbamate (an 88.9/11.1 diastereomeric mixture, 104 mg, 0.183 mmol, Step I) in MeOH (9.6 mL) were added Pd/C (10%, 78 mg, 0.073 mmol) and Hunig's base (63.0 mL, 0.366 mmol). The reaction vessel was evacuated and H2 was bubbled through the solution three times. The reaction mixture was stirred under an atmosphere of H2 at rt for 40 min. Then the reaction mixture was filtered through diatomaceous earth (e.g., Celite®), the solids were rinsed with MeOH and the filtrate was concentrated under reduced pressure to give a colorless gel. This colorless gel was subjected to SFC (Stationary phase: Whelk O1 SS 5 mm, 250×30 mm, Mobile phase: 25% methanol, 75% CO2) to afford two diastereomers. The first eluting isomer was the title compound, which was isolated as a colorless gel (75%, >99% ee).
- Step K: 1-((S)-1-(2-((S)-1-Amino-2,2-dicyclopropylethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. To a solution of tert-butyl ((S)-2,2-dicyclopropyl-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)ethyl)carbamate (106 mg, 0.197 mmol, Step J, first eluting isomer) in DCM (1.9 mL) cooled to 0° C. was added TFA (0.48 mL, 6.2 mmol) and the resulting solution was stirred at 0° C. for 1.5 h. Then the mixture was concentrated and to it was added 2 M NH3 in MeOH (1.0 mL, 2.0 mmol) at 0° C. to adjust the pH to pH 9. Then H2O (5 mL) was added and the mixture was extracted with DCM/IPA (4/1, 3×5 mL). The combined organic layers were dried over anhydrous Na2SO4, filtered, and concentrated to dryness to give the title compound as a colorless film (100% yield) that was used without further purification.
-
- Step A: Diastereomeric mixture of ((1S*,3R*)-3-(aminomethyl)-2,2-difluorocyclopropyl)methanol and ((1R*,3S*)-3-(aminomethyl)-2,2-difluorocyclopropyl)methanol. To a stirred solution of a diastereomeric mixture of methyl (1S*,3R*)-3-(aminomethyl)-2,2-difluorocyclopropane-1-carboxylate hydrochloride and methyl (1R*,3S*)-3-(aminomethyl)-2,2-difluorocyclopropane-1-carboxylate hydrochloride (293 mg, 1.45 mmol) in THE (7.26 mL) at 0° C. was added lithium borohydride (316.4 mg, 14.5 mmol) portionwise. The reaction mixture was then warmed to 65° C. and allowed to stir for 30 min at which point the reaction vessel was cooled to 0° C. and MeOH (4.78 mL) was added slowly. The reaction mixture was then warmed to 65° C. for 30 min. The mixture was allowed to cool to rt and then concentrated. To the residue was added 1 M aqueous HCl (10 mL) and the solution was allowed to stir at rt for 2 h. The pH of the solution was adjusted to pH 10.0 by the addition of 3 M aqueous NaOH. The aqueous solution was transferred to a separatory funnel and extracted with DCM (4×50 mL), and chloroform:IPA (3:1, 3×50 mL). The combined organic layers were dried with anhydrous MgSO4, filtered, and concentrated to give the title compounds in 78% yield.
- Step B: Diastereomeric mixture of 2-(((1R*,3S*)-2,2-difluoro-3-(hydroxymethyl)cyclopropyl)methyl)isoindoline-1,3-dione and 2-(((1S*,3R*)-2,2-difluoro-3-(hydroxymethyl)cyclopropyl)methyl)isoindoline-1,3-dione. To a stirred solution of the diastereomeric mixture made in Step A (156 mg, 1.14 mmol) in THE (3.79 mL) at rt was added DIPEA (0.78 mL, 4.55 mmol) and the mixture was allowed to stir for 5 min. Then, N-carbethoxyphthalimide (287 mg, 1.31 mmol) was added, a reflux condenser was attached to the flask and the resulting mixture was heated at 75° C. for 16 h. The mixture was concentrated to approximately one-third of the reaction volume and transferred to a separatory funnel containing EtOAc and water. The layers were separated and the mixture further extracted with EtOAc (2×100 mL). The combined organic layers were then washed with water (50 mL) and brine (50 mL), dried over anhydrous MgSO4, filtered, and concentrated to give an oil. This oil was purified by silica gel chromatography (10-90% EtOAc/hexanes) to afford the title compounds in 61% yield.
- Step C: Diastereomeric mixture of ((1S*,3R*)-3-((1,3-dioxoisoindolin-2-yl)methyl)-2,2-difluorocyclopropyl)methyl trifluoromethanesulfonate and ((1R*,3S*)-3-((1,3-dioxoisoindolin-2-yl)methyl)-2,2-difluorocyclopropyl)methyl trifluoromethanesulfonate. To a stirred solution of the diastereomeric mixture made in Step B (93.3 mg, 0.35 mmol) in DCM (1.2 mL) at 0° C. was added pyridine (31.1 μL, 0.38 mmol) and the mixture was allowed to stir for 5 min before the dropwise addition of trifluoromethanesulfonic anhydride (62.1 μL, 0.367 mmol). The resulting mixture was stirred at 0° C. for 1 h. The reaction was quenched by the addition of water (5 mL) then diluted with DCM (10 mL). The layers were separated and the aqueous layer was extracted with DCM (2×20 mL). The combined organic layers were washed with brine (20 mL), dried over anhydrous MgSO4, filtered, and concentrated to afford the title compounds in quantitative yield.
-
- Step A: Diastereomeric mixture of tert-butyl ((S)-(4,4-difluorocyclohexyl)(7-((S)-1-((((1R*,3S*)-3-((1,3-dioxoisoindolin-2-yl)methyl)-2,2-difluorocyclopropyl)methyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate and tert-butyl ((S)-(4,4-difluorocyclohexyl)(7-((S)-1-((((1S*,3R*)-3-((1,3-dioxoisoindolin-2-yl)methyl)-2,2-difluorocyclopropyl)methyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate. The title compounds (38% yield) were prepared as described for the synthesis of Intermediate 2 Step A using tert-butyl ((S)-(7-((S)-1-amino-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Intermediate 3 Step B) in place of tert-butyl ((S)-(7-((R)-amino(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate and the diastereomeric mixture made in Intermediate 94 in place of 3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl trifluoromethanesulfonate.
- Step B: Diastereomeric mixture of tert-butyl ((S)-(7-((S)-1-((((1S*,3R*)-3-(aminomethyl)-2,2-difluorocyclopropyl)methyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate and tert-butyl ((S)-(7-((S)-1-((((1R*,3S*)-3-(aminomethyl)-2,2-difluorocyclopropyl)methyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compounds (60% yield) were prepared as described for the synthesis of Intermediate 2 Step B using the diastereomeric mixture made in Step A in place of tert-butyl ((S)-(7-((R)-cyclopropyl((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step C: Diastereomeric mixture of tert-butyl ((S)-(7-((S)-1-((1S*,7R*)-8,8-difluoro-4-oxo-3,5-diazabicyclo[5.1.0]octan-3-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate and tert-butyl ((S)-(7-((S)-1-((1R*,7S*)-8,8-difluoro-4-oxo-3,5-diazabicyclo[5.1.0]octan-3-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compounds (22% yield) were prepared as described for Intermediate 15 Step C using the diastereomeric mixture made in Step B in place of tert-butyl ((S)-(7-((S)-1-((3-amino-2,2-difluoropropyl)amino)-2-cyclopropoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step D: Diastereomeric mixture of (1S*,7R*)-3-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-8,8-difluoro-3,5-diazabicyclo[5.1.0]octan-4-one and (1R*,7S*)-3-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-8,8-difluoro-3,5-diazabicyclo[5.1.0]octan-4-one. The title compounds (100% yield) were prepared as described for the synthesis of Intermediate 2 Step D using the diastereomeric mixture made in Step C in place of tert-butyl ((S)-(7-((R)-cyclopropyl(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
-
- Step A: tert-Butyl (S)-(1-(7-chloroimidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate. 5-Chloropyridazin-3-amine (1.00 g, 7.72 mmol) and tert-butyl (S)-(1-(dimethyl(oxo)-λ6-sulfaneylidene)-7,7,7-trifluoro-6,6-dimethyl-2-oxoheptan-3-yl)carbamate (3.29 g, 8.49 mmol, Intermediate 45) were dissolved in toluene (21 mL). 4 Å Molecular sieves (2.00 g), NaOTf (66.4 mg, 0.386 mmol), and chloro(cyclopentadienyl)bis(triphenylphosphine)ruthenium(II) (141 mg, 0.193 mmol) were added sequentially, and the resulting mixture was heated at 85° C. for 16 h. The reaction mixture was concentrated onto diatomaceous earth (e.g., Celite®), and purified by silica gel chromatography (0-100% EtOAc/hexanes) to afford the title compound in 30% yield.
- Step B: tert-Butyl (S)-(5,5,5-trifluoro-4,4-dimethyl-1-(7-vinylimidazo[1,2-b]pyridazin-2-yl)pentyl)carbamate. tert-Butyl (S)-(1-(7-chloroimidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate (0.960 mg, 2.28 mmol, Step A), potassium trifluoro(vinyl)borate (0.460 g, 3.43 mmol), and K3PO4 (1.46 g, 6.90 mmol) were added under a positive pressure of nitrogen gas to a reactor containing 1,4-dioxane and water (24 mL, 5:1 v/v, sparged with N2 before use). The mixture was heated at reflux temperature (85° C.), and then RuPhos Pd G3 (49.7 mg, 60.0 mmol) was added. The resulting mixture was stirred at 85° C. for 6 h. After this time, the mixture was allowed to cool to rt and then concentrated to remove most of the 1,4-dioxane. The residue was then diluted with EtOAc and water, the layers were separated, and the aqueous layer was extracted twice with EtOAc. The organic layers were combined, washed with brine, dried over anhydrous MgSO4, filtered, and concentrated to dryness to afford the title compound as a brown foam, which was used without further purification.
- Step C: tert-Butyl (S)-(5,5,5-trifluoro-1-(7-formylimidazo[1,2-b]pyridazin-2-yl)-4,4-dimethylpentyl)carbamate. A solution of NaIO4 (2.43 g, 11.4 mmol) in water (55 mL) was added to a solution of tert-butyl (S)-(5,5,5-trifluoro-4,4-dimethyl-1-(7-vinylimidazo[1,2-b]pyridazin-2-yl)pentyl)carbamate (8.81 g, 22.5 mmol, Step B) in 1,4-dioxane (55 mL). The resulting mixture was then cooled with an ice bath to just above freezing and K2OsO4.2H2O (42.0 mg, 0.114 mmol) was added. The reaction mixture was then removed from the ice bath and stirred for 1 h. The resulting thick suspension was diluted with water and the solution was extracted with EtOAc (4×). The combined organic layers were washed with brine, dried over anhydrous Na2SO4, filtered, concentrated onto diatomaceous earth (e.g., Celite®), and purified by silica gel chromatography (0-50% acetone/hexanes) to afford the title compound in 64% yield.
-
- Step A: tert-Butyl (S)-(1-(7-(((3-amino-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 20 Step A using tert-butyl (S)-(5,5,5-trifluoro-1-(7-formylimidazo[1,2-b]pyridazin-2-yl)-4,4-dimethylpentyl)carbamate (Intermediate 96) in place of tert-butyl (S)-((4,4-difluorocyclohexyl)(7-formylimidazo[1,2-b]pyridazin-2-yl)methyl)carbamate and was used without further purification.
- Step B: tert-Butyl (S)-(1-(7-((5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate. The title compound was synthesized in a manner analogous to Intermediate 20 Step B using tert-butyl (S)-(1-(7-(((3-amino-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate (Step A) in place of tert-butyl (S)-((7-(((3-amino-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The material was purified by silica gel chromatography (0-100% acetone/hexanes) to afford the title compound in 37% yield over steps A and B.
- Step C: (S)-1-((2-(1-Amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. The title compound was synthesized in a manner analogous to Intermediate 20 Step C using tert-butyl (S)-(1-(7-((5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentyl)carbamate (Step B) in place of tert-butyl (S)-((7-((5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate and was used without further purification.
-
- The title compounds were synthesized in a manner analogous to Intermediate 20 Steps A, B and C using tert-butyl (S)-(5,5,5-trifluoro-1-(7-formylimidazo[1,2-b]pyridazin-2-yl)-4,4-dimethylpentyl)carbamate (Intermediate 96) in place of tert-butyl (S)-((4,4-difluorocyclohexyl)(7-formylimidazo[1,2-b]pyridazin-2-yl)methyl)carbamate and ((1S,2R)-3,3-difluorocyclopropane-1,2-diyl)dimethanamine dihydrochloride in place of 2,2-difluoropropane-1,3-diamine dihydrochloride in Step A. In Step B, the residue was purified by silica gel chromatography (0-100% acetone/hexanes).
-
- Step A: 4-(Benzyloxy)-2,2,3,3-tetrafluorobutan-1-ol. 2,2,3,3-Tetrafluorobutane-1,4-diol (5.00 g, 30.8 mmol), K2CO3 (8.53 g, 61.7 mmol) and MeCN (60 mL) were added to a three-neck round-bottomed flask, and a solution of BnBr (5.28 g, 30.8 mmol) in MeCN (10 mL) in one portion was added. The resulting mixture was stirred at 85° C. for 16 h. The reaction mixture was cooled to rt, filtered through a pad of diatomaceous earth (e.g., Celite®), and the pad was rinsed with MeCN. The combined filtrates were concentrated to dryness to give an oil that was subjected to silica gel chromatography (0-19% EtOAc/petroleum ether) to provide the title compound as a colorless oil (95% yield).
- Step B: 4-(Benzyloxy)-2,2,3,3-tetrafluorobutyl trifluoromethanesulfonate. A round-bottom flask was charged with 4-(benzyloxy)-2,2,3,3-tetrafluorobutan-1-ol (8.00 g, 31.7 mmol, Step A) followed by the dropwise addition of DCM (10 mL) and pyridine (5.04 mL, 62.6 mmol). The resulting mixture was stirred at 25° C. for 5 min, then trifluoromethanesulfonic anhydride (5.34 mL, 31.7 mmol) was added to the mixture dropwise. The resulting mixture was stirred at 25° C. for 3 h. The reaction mixture was then partitioned between DCM (20 mL) and water (20 mL), and the aqueous layer further extracted with DCM (2×20 mL). The organic layers were combined, washed with H2O (20 mL), and brine (20 mL), dried over anhydrous Na2SO4, filtered, and concentrated to dryness to give a liquid. The liquid was then subjected to silica gel chromatography (0-9% EtOAc/petroleum ether) to afford the title compound as a colorless liquid (97% yield).
- Step C: 2-(4-(Benzyloxy)-2,2,3,3-tetrafluorobutyl)isoindoline-1,3-dione. A mixture of 4-(benzyloxy)-2,2,3,3-tetrafluorobutyl trifluoromethanesulfonate (5.00 g, 13.0 mmol, Step B) and potassium 1,3-dioxoisoindolin-2-ide (4.82 g, 26.0 mmol) in DMF (32 mL) was heated at 85° C. overnight under nitrogen. The reaction mixture was cooled to rt then partitioned between EtOAc (50 mL) and water (50 mL), and the aqueous layer was further extracted with EtOAc (50 mL×2). The organic layers were combined, washed with water (50 mL×3), and brine (50 mL), dried over anhydrous Na2SO4, filtered, and concentrated to dryness to give a colorless oil. The oil was subjected to silica gel chromatography (0-20% EtOAc/petroleum ether) to afford the title compound as a white solid (89% yield).
- Step D: 2-(2,2,3,3-Tetrafluoro-4-hydroxybutyl)isoindoline-1,3-dione. To a mixture of 2-(4-(benzyloxy)-2,2,3,3-tetrafluorobutyl)isoindoline-1,3-dione (2.80 g, 7.34 mmol, Step C) in DCM (5 mL) at −78° C. was added BCl3 (18.4 mL, 1.0 M in DCM, 18.4 mmol) dropwise over 20 min. The reaction mixture was allowed to warm gradually to 20° C., and then stirred at 20° C. for an additional 2 h. The reaction mixture was quenched with saturated aqueous NaHCO3 (10 mL) and extracted with EtOAc (3×10 mL). The combined organic layers were dried over anhydrous Na2SO4, filtered, and concentrated to dryness to give a yellow solid. The yellow solid was purified by silica gel chromatography (0-25% EtOAc/petroleum ether) to afford the title compound as a white solid, which was used without further purification.
- Step E: 4-(1,3-Dioxoisoindolin-2-yl)-2,2,3,3-tetrafluorobutyl trifluoromethanesulfonate. A round-bottom flask was charged with 2-(2,2,3,3-tetrafluoro-4-hydroxybutyl)isoindoline-1,3-dione (10.0 g, 34.3 mmol, Step D), DCM (100 mL) and pyridine (5.46 mL, 67.8 mmol) and the resulting mixture was stirred at 25° C. for 5 min. Then, trifluoromethanesulfonic anhydride (5.78 mL, 34.3 mmol) was added dropwise over 10 min and the resulting mixture was stirred at 25° C. for 3 h. The reaction mixture was then partitioned between DCM (100 mL) and water (100 mL), and the aqueous layer further extracted with DCM (2×100 mL). The organic layers were combined, washed with H2O (100 mL), and brine (100 mL), dried over anhydrous Na2SO4, filtered, and concentrated to dryness to give a yellow solid. The yellow solid was triturated with 100 mL of n-hexanes to afford the title compound as a pink solid (15% yield over Steps D and E).
-
- Step A: tert-Butyl ((S)-(4,4-difluorocyclohexyl)(7-((S)-1-((4-(1,3-dioxoisoindolin-2-yl)-2,2,3,3-tetrafluorobutyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate. The title compound (84% yield) was prepared as described for the synthesis of Intermediate 2 Step A using tert-butyl ((S)-(7-((S)-1-amino-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Intermediate 3 Step B) in place of tert-butyl ((S)-(7-((R)-amino(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate and 4-(1,3-dioxoisoindolin-2-yl)-2,2,3,3-tetrafluorobutyl trifluoromethanesulfonate (Intermediate 99) in place of 3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl trifluoromethanesulfonate.
- Step B: tert-Butyl ((S)-(7-((S)-1-((4-amino-2,2,3,3-tetrafluorobutyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound (73% yield) was prepared as described for the synthesis of Intermediate 2 Step B using tert-butyl ((S)-(4,4-difluorocyclohexyl)(7-((S)-1-((4-(1,3-dioxoisoindolin-2-yl)-2,2,3,3-tetrafluorobutyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate (Step A) in place of tert-butyl ((S)-(7-((R)-cyclopropyl((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step C: tert-Butyl ((S)-(4,4-difluorocyclohexyl)(7-((S)-2-methoxy-1-(5,5,6,6-tetrafluoro-2-oxo-1,3-diazepan-1-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate. The title compound (41% yield) was prepared as described for the synthesis of Intermediate 2 Step C using tert-butyl ((S)-(7-((S)-1-((4-amino-2,2,3,3-tetrafluorobutyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step B) in place of tert-butyl ((S)-(7-((R)-((3-amino-2,2-difluoropropyl)amino)(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
- Step D: 1-((S)-1-(2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5,6,6-tetrafluoro-1,3-diazepan-2-one. The title compound (99% yield) was prepared as described for the synthesis of Intermediate 2 Step D using tert-butyl ((S)-(4,4-difluorocyclohexyl)(7-((S)-2-methoxy-1-(5,5,6,6-tetrafluoro-2-oxo-1,3-diazepan-1-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate (Step C) in place of tert-butyl ((S)-(7-((R)-cyclopropyl(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate.
-
- Step A: (S)—N-((E)-(7-((S)-1-(5,5-Difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methylene)-2-methylpropane-2-sulfinamide. A mixture of (S)-(−)-2-methyl-2-propanesulfinamide (0.51 g, 4.2 mmol), (S)-7-(1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazine-2-carbaldehyde (1.50 g, 4.42 mmol, Intermediate 56 Step C) and CuSO4 (2.16 g, 13.3 mmol) in DCM (15 mL) was stirred at rt for 2 h. The reaction mixture was then filtered through a pad of diatomaceous earth (e.g., Celite®), which was rinsed with DCM. The filtrate was concentrated to dryness and purified via silica gel chromatography (0-100% acetone/hexanes) to afford the title compound in 77% yield.
- Step B: (2S*,3S*)-3-(((S)-tert-Butylsulfinyl)amino)-3-(7-((R)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1-(trifluoromethyl)cyclopropyl)methyl)propanoic acid. To a solution of DIPA (0.70 mL, 5.0 mmol) in THE (10 mL) at 0° C. was added n-BuLi (2 mL, 2.5 M in hexanes, 5 mmol). After stirring for 30 min at 0° C., the solution was cooled to −78° C. and then 3-[1-(trifluoromethyl)cyclopropyl]propanoic acid (455 mg, 2.50 mmol) was added dropwise. The resulting mixture was stirred at −78° C. for 1 h, then a solution of (S)—N-((E)-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methylene)-2-methylpropane-2-sulfinamide (443 mg, 1.00 mmol, Step A) in THE (20 mL) was added via cannula. The reaction mixture was stirred at −78° C. for 30 min and then allowed to warm to 0° C. and stirred at 0° C. for 30 min. The reaction mixture was then quenched with distilled water (60 mL) and washed with EtOAc (20 mL). The pH of the aqueous layer was adjusted to pH ˜1 by the addition of 1 M aqueous KHSO4 and then the aqueous layer was extracted with DCM (2×30 mL). The combined organic layers were dried over anhydrous MgSO4, filtered, and concentrated to dryness to afford the title compound that was used without further purification.
- Step C: 1,3-Dioxoisoindolin-2-yl (2S*,3S*)-3-(((S)-tert-butylsulfinyl)amino)-3-(7-((R)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1-(trifluoromethyl)cyclopropyl)methyl)propanoate. To a solution of (2S*,3S*)-3-(((S)-tert-butylsulfinyl)amino)-3-(7-((R)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1-(trifluoromethyl)cyclopropyl)methyl)propanoic acid (540 mg, 0.865 mmol, Step B) in DCM (12.9 mL) at 0° C. were added N-hydroxyphthalimide (262 mg, 1.56 mmol), DMAP (10.6 mg, 0.087 mmol) and DCC (321 mg, 1.56 mmol). The resulting mixture was allowed to warm to rt and stir for 18 h. Then, the reaction mixture was cooled to 0° C., filtered through a pad of diatomaceous earth (e.g., Celite®), and the pad rinsed with cold DCM. The combined filtrate was concentrated to dryness and subjected to silica gel chromatography (50-100% acetone/hexanes) to afford the title compound that was used without further purification.
- Step D: (S)—N—((S*)-1-(7-((S)-1-(5,5-Difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-3-(1-(trifluoromethyl)cyclopropyl)propyl)-2-methylpropane-2-sulfinamide. To a solution of 1,3-dioxoisoindolin-2-yl (2S*,3S*)-3-(((S)-tert-butylsulfinyl)amino)-3-(7-((R)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1-(trifluoromethyl)cyclopropyl)methyl)propanoate (80.7 mg, 0.105 mmol, Step C) and Hantzsch ester (19.9 mg, 0.079 mmol) in DMSO (0.78 mL) under N2 was added DIPEA (0.054 mL, 0.32 mmol and the resulting mixture was irradiated with 450 nm light (max rpm fan, 40% LED intensity) for 1 h. The reaction mixture was then diluted with EtOAc (50 mL) and washed with brine (3×30 mL). The organic layer was dried over anhydrous MgSO4, filtered and concentrated to dryness. The material was purified via silica gel chromatography (50-100% acetone/hexanes) to afford the title compound in 5% yield over steps B, C, and D.
- Step E: 1-((S)-1-(2-((S*)-1-Amino-3-(1-(trifluoromethyl)cyclopropyl)propyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. To a solution of (S)—N—((S*)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-3-(1-(trifluoromethyl)cyclopropyl)propyl)-2-methylpropane-2-sulfinamide (30 mg, 0.052 mmol, Step D) in 1,4-dioxane (0.52 mL) and MeOH (0.26 mL) was added HCl (0.82 mL, 3.27 mmol, 4 M in 1,4-dioxane) and the resulting mixture was stirred at rt for 30 min. Then, the reaction mixture was diluted with water and washed with hexanes. The pH of the aqueous layer was adjusted to pH 10 by the addition of 10% aqueous K2CO3 solution. The aqueous layer was extracted with EtOAc (5×20 mL). The combined organic layers were washed with brine, dried over anhydrous MgSO4, filtered, and concentrated to dryness to afford the title compound that was used without further purification.
-
- Step A: Methyl 5,5,5-trifluoro-2-(hydroxyimino)-3-oxopentanoate. A solution of sodium nitrite (6.75 g, 97.8 mmol) in water (27 mL) was added dropwise to a solution of methyl 5,5,5-trifluoro-3-oxopentanoate (15.0 g, 81.5 mmol) in AcOH (36 mL) that had been cooled to 0° C., and the resulting mixture was allowed to slowly warm to rt and then stirred at rt for 3 h. The reaction mixture was quenched with water (100 mL) and extracted with Et2O (2×100 mL). The combined organic layers were washed with brine, dried over anhydrous Na2SO4, filtered, and concentrated to dryness to afford the title compound in 69% yield as a yellow oil.
- Step B: Methyl 5,5,5-trifluoro-2,3-bis(hydroxyimino)pentanoate. Hydroxylamine hydrochloride (10.2 g, 146 mmol) and NaOAc (8.31 g, 101 mmol) were added to a solution of methyl 5,5,5-trifluoro-2-(hydroxyimino)-3-oxopentanoate (12.0 g, 56.3 mmol, Step A) in EtOH (240 mL). The resulting mixture was heated at 80° C. for 5 h. The mixture was cooled to rt, filtered, and the filtrate was concentrated to dryness. The residue was purified by silica gel chromatography (0-10% EtOAc/petroleum ether) to afford the title compound in 78% yield.
- Step C: Methyl 4-(2,2,2-trifluoroethyl)-1,2,5-oxadiazole-3-carboxylate. To a solution of methyl 5,5,5-trifluoro-2,3-bis(hydroxyimino)pentanoate (10.0 g, 43.8 mmol, Step B) in THE (100 mL) at 0° C. was added CDI (10.7 g, 65.8 mmol) in portions and the resulting mixture was stirred at 0° C. for 1 h. After that time, the mixture was heated at 45° C. for 16 h then cooled to rt and quenched by the addition of water (100 mL). The mixture was extracted with Et2O (2×100 mL) and the combined organic layers were washed with brine, dried over anhydrous Na2SO4, filtered, and concentrated to dryness. The residue was purified by silica gel chromatography (0-10% EtOAc/petroleum ether) to afford the title compound in 34% yield as a light-yellow oil.
- Step D: 4-(2,2,2-Trifluoroethyl)-1,2,5-oxadiazole-3-carboxylic acid. To a solution of methyl 4-(2,2,2-trifluoroethyl)-1,2,5-oxadiazole-3-carboxylate (500 mg, 2.38 mmol, Step C) in THE (7.9 mL) was added LiOH (1.19 mL, 2 M in H2O, 2.38 mmol). The resulting mixture was stirred at rt for 1 h, then was diluted with water (10 mL) and extracted with EtOAc. The organic layer was discarded, and the pH of the aqueous layer was adjusted to pH 1 by the addition of 6 N aqueous HCl and then extracted with EtOAc (3×). The combined organic layers were washed with brine, dried over anhydrous MgSO4, filtered, and concentrated to dryness to afford the title compound that was used without further purification.
-
- Step A: 2-((S*)—(((S)-tert-Butylsulfinyl)amino)(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-5,5-difluoro-4,4-dimethylhexanoic acid. The title compound was synthesized in a manner analogous to Intermediate 101 Step B using 5,5-difluoro-4,4-dimethylhexanoic acid in place of 3-(1-(trifluoromethyl)cyclopropyl)propanoic acid and was used without further purification.
- Step B: 1,3-Dioxoisoindolin-2-yl 2-((S*)—(((S)-tert-butylsulfinyl)amino)(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-5,5-difluoro-4,4-dimethylhexanoate. The title compound (8% yield over Steps A and B) was synthesized in a manner analogous to Intermediate 101 Step C using 2-((S*)—(((S)-tert-butylsulfinyl)amino)(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-5,5-difluoro-4,4-dimethylhexanoic acid (Step A) in place of (2S*,3S*)-3-(((S)-tert-butylsulfinyl)amino)-3-(7-((R)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1-(trifluoromethyl)cyclopropyl)methyl)propanoic acid.
- Step C: (S)—N—((S*)-1-(7-((S)-1-(5,5-Difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5-difluoro-4,4-dimethylhexyl)-2-methylpropane-2-sulfinamide. The title compound (89% yield) was synthesized in a manner analogous to Intermediate 101 Step D using 1,3-dioxoisoindolin-2-yl 2-((S*)—(((S)-tert-butylsulfinyl)amino)(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-5,5-difluoro-4,4-dimethylhexanoate (Step B) in place of 1,3-dioxoisoindolin-2-yl 3-(((S)-tert-butylsulfinyl)amino)-3-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1-(trifluoromethyl)cyclopropyl)methyl)propanoate.
- Step D: 1-((S)-1-(2-((S*)-1-Amino-5,5-difluoro-4,4-dimethylhexyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. The title compound was synthesized in a manner analogous to Intermediate 101 Step E using (S)—N—((S*)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5-difluoro-4,4-dimethylhexyl)-2-methylpropane-2-sulfinamide (Step C) in place of (S)—N-(1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-3-(1-(trifluoromethyl)cyclopropyl)propyl)-2-methylpropane-2-sulfinamide and was used without further purification.
-
-
- Step A: tert-Butyl ((1S)-(7-(((3-amino-2-fluoro-2-methylpropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. tert-Butyl (S)-((4,4-difluorocyclohexyl)(7-formylimidazo[1,2-b]pyridazin-2-yl)methyl)carbamate (500 mg, 1.27 mmol), 2-fluoro-2-methylpropane-1,3-diamine dihydrochloride (454 mg, 2.54 mmol, Intermediate 1), DCM (50 mL) and TEA (1.06 mL, 7.61 mmol) were added to a 100 mL three-neck round-bottomed flask. The resulting mixture was stirred for 16 h at 30° C. before it was treated with NaBH3CN (239 mg, 3.80 mmol), methanol (10 mL) and AcOH (10 mL) in one portion. The resulting mixture stirred for another 16 h at 30° C. The reaction mixture was then poured into water (100 mL) and the pH was adjusted to pH 8 by the addition of saturated aqueous NaHCO3, The resulting solution was extracted with DCM (50 mL×2). The combined organic extracts were washed with brine (50 mL), dried over anhydrous MgSO4, filtered, and concentrated to dryness under reduced pressure to provide tert-butyl ((1S)-(7-(((3-amino-2-fluoro-2-methylpropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate as a brown solid, which was used without further purification.
- Step B: tert-Butyl ((1S)-(4,4-difluorocyclohexyl)(7-((5-fluoro-5-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate. tert-Butyl ((1S)-(7-(((3-amino-2-fluoro-2-methylpropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (500 mg, 1.03 mmol, Step A), THE (50 mL) and CDI (334 mg, 2.06 mmol) were added to a 100 mL three-neck round-bottomed flask equipped with a condenser and a thermometer, and the resulting mixture was stirred for 4 h at 70° C. The reaction mixture was then concentrated to dryness to give a brown solid. The solid was initially purified by silica gel chromatography (0-100% EtOAc/petroleum ether followed by 0-20% MeOH/EtOAc). The resulting material was further purified by subjecting it to an additional silica gel chromatography using the same conditions to provide tert-butyl ((1S)-(4,4-difluorocyclohexyl)(7-((5-fluoro-5-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate as a white solid that was used without further purification.
- Step C: 1-((2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5-fluoro-5-methyltetrahydropyrimidin-2(1H)-one. tert-Butyl ((1S)-(4,4-difluorocyclohexyl)(7-((5-fluoro-5-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate (400 mg, Step B) and HCl (12 mL, 4 M in MeOH) were added to a 50 mL round-bottomed flask, and the resulting mixture was stirred for 1 h at rt. The reaction mixture was then concentrated to dryness to afford a brown solid. The solid was then purified by preparative HPLC (Boston Green C18 column, 5 μm, 150×30 mm; 8-18% (v/v) H2O (0.225% HCOOH)/CH3CN) to provide, after lyophilization, 1-((2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5-fluoro-5-methyltetrahydropyrimidin-2(1H)-one (62% yield) as a white solid.
- Step D: 4-Cyclopropyl-N-((1S)-(4,4-difluorocyclohexyl)(7-((5-fluoro-5-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1,2,5-oxadiazole-3-carboxamide. 4-Cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid (75.1 mg, 0.487 mmol), 1-((2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5-fluoro-5-methyltetrahydropyrimidin-2(1H)-one (200 mg, 0.487 mmol, Step C), TEA (0.260 mL, 1.46 mmol), 2-chloro-1-methylpyridinium iodide (373 mg, 0.731 mmol) and THE (40 mL) were added to a 100 mL round-bottomed flask, and the resulting mixture was stirred for 1 h at 30° C. The reaction mixture was then concentrated to dryness and partitioned between DCM (50 mL) and water (20 mL). The organic layer was dried over anhydrous MgSO4, filtered, and concentrated to dryness to afford a white solid. The solid was initially purified by silica gel chromatography using (0-100% EtOAc/petroleum ether followed by second silica gel chromatography using 0-20% MeOH/EtOAc) to provide 4-cyclopropyl-N-((1S)-(4,4-difluorocyclohexyl)(7-((5-fluoro-5-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1,2,5-oxadiazole-3-carboxamide (68% yield) as a white solid.
- Step E: 4-Cyclopropyl-N—((S)-(4,4-difluorocyclohexyl)(7-(((R*)-5-fluoro-5-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1,2,5-oxadiazole-3-carboxamide. The solid, 4-cyclopropyl-N-((1S)-(4,4-difluorocyclohexyl)(7-((5-fluoro-5-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1,2,5-oxadiazole-3-carboxamide, from Step D was purified by chiral SFC (DAICEL CHIRALPAK IC column, 10 μm, 250×50 mm; 45% (v/v) EtOH (containing 0.1% of 25% aqueous NH3)/CO2) to afford two diastereomers. The first eluting isomer was designated as the (R*) isomer (Example 1) and the second eluting isomer was designated as the (S*) isomer (Example 2). The first eluting isomer, Example 1, was further purified by preparative HPLC (Phenomenex Gemini-NX C18 column, 3 μm, 75×30 mm; 35-65% (v/v) H2O (0.05% aqueous NH3 with 10 mM NH4HCO3)/CH3CN) to provide, after lyophillization, 4-cyclopropyl-N—((S)-(4,4-difluorocyclohexyl)(7-(((R*)-5-fluoro-5-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1,2,5-oxadiazole-3-carboxamide (Example 1, 13% yield) as a white solid. Example 1: 1H NMR (400 MHz, DMSO-d6) δ 9.51 (d, J=8.8 Hz, 1H), 8.40 (d, J=2.0 Hz, 1H), 8.23 (s, 1H), 7.86 (s, 1H), 6.63 (d, J=4.4 Hz, 1H), 5.19 (t, J=8.8 Hz, 1H), 4.62-4.38 (m, 2H), 3.60-3.38 (m, 1H), 3.33-3.13 (m, 3H), 2.32-2.24 (m, 1H), 2.23-2.12 (m, 1H), 2.10-1.94 (m, 2H), 1.93-1.68 (m, 3H), 1.67-1.55 (m, 1H), 1.46-1.20 (m, 5H), 1.18-1.07 (m, 2H), 1.00-0.91 (m, 2H). MS (ESI) m/z: [M+H]+ Found 547.3.
- The second eluting isomer (Example 2) was further purified by preparative HPLC (Phenomenex Gemini-NX C18 column, 3 μm, 75×30 mm; 34-64% (v/v) H2O (0.05% aqueous NH3 with 10 mM NH4HCO3)/CH3CN) to provide, after lyophillization, 4-cyclopropyl-N—((S)-(4,4-difluorocyclohexyl)(7-(((S*)-5-fluoro-5-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1,2,5-oxadiazole-3-carboxamide (Example 2, 16% yield) as a white solid. Example 2: 1H NMR (400 MHz, DMSO-d6) δ 9.52 (d, J=9.2 Hz, 1H), 8.40 (d, J=1.6 Hz, 1H), 8.23 (s, 1H), 7.85 (s, 1H), 6.63 (d, J=4.0 Hz, 1H), 5.18 (t, J=8.4 Hz, 1H), 4.61-4.52 (m, 1H), 4.47-4.39 (m, 1H), 3.57-3.42 (m, 1H), 3.32-3.10 (m, 3H), 2.32-2.23 (m, 1H), 2.23-2.12 (m, 1H), 2.11-1.96 (m, 2H), 1.94-1.69 (m, 3H), 1.67-1.56 (m, 1H), 1.46-1.23 (m, 5H), 1.18-1.08 (m, 2H), 1.00-0.92 (m, 2H). MS (ESI) m/z: [M+H]+ Found 547.3.
-
- Step A: Diastereomeric mixture of tert-butyl ((S)-(7-(((((1R,3S)-3-(aminomethyl)-2,2-difluorocyclopropyl)methyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate and tert-butyl ((S)-(7-(((((1S,3R)-3-(aminomethyl)-2,2-difluorocyclopropyl)methyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. tert-Butyl (S)-((4,4-difluorocyclohexyl)(7-formylimidazo[1,2-b]pyridazin-2-yl)methyl)carbamate (200 mg, 0.510 mmol), ((1R,2S)-3,3-difluorocyclopropane-1,2-diyl) dimethanamine (159 mg, 0.760 mmol), TEA (0.4 mL, 3.0 mmol) and anhydrous DCM (20 mL) were added to a 100 mL three-neck round-bottomed flask. The resulting mixture was stirred for 16 h at 30° C. before treating with NaBH3CN (96 mg, 1.5 mmol), methanol (4 mL) and AcOH (4 mL) in one portion. The resulting mixture stirred for another 2 h at 30° C. The reaction mixture was then poured into water (30 mL) and extracted with DCM (30 mL). The pH of the aqueous layer was adjusted to pH 8 by the addition of saturated aqueous NaHCO3 and then extracted with DCM (40 mL×3). The combined organic extracts were washed with brine (2×30 mL), dried over anhydrous Na2SO4, filtered, and concentrated to dryness under reduced pressure to provide the title compounds as a yellow oil, which were used without further purification.
- Step B: Diastereomeric mixture of tert-butyl ((S)-(7-(((1R,7S)-8,8-difluoro-4-oxo-3,5-diazabicyclo[5.1.0]octan-3-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate and tert-butyl ((S)-(7-(((1S,7R)-8,8-difluoro-4-oxo-3,5-diazabicyclo[5.1.0]octan-3-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The diastereomeric mixture made in Step A (201 mg, 0.390 mmol), THE (40 mL) and CDI (127 mg, 0.780 mmol) were added to a 100 mL round-bottomed flask and the resulting mixture was stirred for 2 h at 70° C. The reaction mixture was then concentrated to dryness to give a colorless oil. This oil was then purified by preparative HPLC (Welch Xtimate C18 column, 5 μm, 150×25 mm; 36-66% (v/v) H2O (0.225% HCOOH)/CH3CN) to provide the title compounds (8% yield) as a white solid after lyophilization.
- Step C: Diastereomeric mixture of (1R,7S)-3-((2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-8,8-difluoro-3,5-diazabicyclo[5.1.0]octan-4-one dihydrochloride and (1S,7R)-3-((2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-8,8-difluoro-3,5-diazabicyclo[5.1.0]octan-4-one dihydrochloride. The title compounds were prepared as described for the synthesis of Example 1 Step C using the diastereomeric mixture made in Step B in place of tert-butyl ((1S)-(4,4-difluorocyclohexyl)(7-((5-fluoro-5-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate to provide the title compounds as a brown solid, which were used without further purification.
- Step D: Diastereomeric mixture of 4-cyclopropyl-N—((S)-(7-(((1R,7S)-8,8-difluoro-4-oxo-3,5-diazabicyclo[5.1.0]octan-3-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)-1,2,5-oxadiazole-3-carboxamide and 4-cyclopropyl-N—((S)-(7-(((1S,7R)-8,8-difluoro-4-oxo-3,5-diazabicyclo[5.1.0]octan-3-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)-1,2,5-oxadiazole-3-carboxamide. The title compounds were prepared as described for the synthesis of Example 1 Step D using the diastereomeric mixture made in Step C in place of 1-((2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5-fluoro-5-methyltetrahydropyrimidin-2(1H)-one. After stirring at 30° C. for 1 h, the reaction mixture was concentrated to dryness and the residue purified by preparative TLC (5% MeOH/DCM) to provide a white solid (36% yield). The diastereomeric mixture made in Step D was separated by chiral SFC (DAICEL CHIRALCEL OD-H column, 5 m, 250×30 mm; 45% (v/v) EtOH (containing 0.1% of 25% aqueous NH3)/CO2). The first eluting isomer was designated as isomer 1 (Example 3) and the second eluting isomer was designated as isomer 2 (Example 4). The first eluting isomer (Example 3, 13% yield) was isolated as a white solid after lyophilization. Example 3: 1H NMR (400 MHz, DMSO-d6) δ 9.50 (d, J=8.8 Hz, 1H), 8.43 (d, J=1.6 Hz, 1H), 8.22 (s, 1H), 7.92 (s, 1H), 6.59 (d, J=7.6 Hz, 1H), 5.19 (t, J=8.4 Hz, 1H), 4.63 (d, J=15.6 Hz, 1H), 4.40 (d, J=15.6 Hz, 1H), 3.99-3.86 (m, 1H), 3.69-3.55 (m, 1H), 3.45-3.38 (m, 1H), 3.19-3.05 (m, 1H), 2.32-2.24 (m, 2H), 2.23-2.13 (m, 1H), 2.11-1.96 (m, 2H), 1.93-1.72 (m, 3H), 1.67-1.50 (m, 1H), 1.43-1.35 (m, 1H), 1.35-1.23 (m, 2H), 1.15-1.06 (m, 2H), 1.00-0.93 (m, 2H). MS (ESI) m/z: [M+H]+ Found 577.3.
- The second eluting isomer (Example 4, 9.8% yield) was isolated as a white solid after lyophilization. Example 4: 1H NMR (400 MHz, DMSO-d6) δ 9.51 (d, J=9.2 Hz, 1H), 8.44 (d, J=2.0 Hz, 1H), 8.22 (s, 1H), 7.93 (s, 1H), 6.59 (d, J=4.8 Hz, 1H), 5.19 (t, J=8.4 Hz, 1H), 4.64 (d, J=15.6 Hz, 1H), 4.40 (d, J=15.6 Hz, 1H), 4.00-3.89 (m, 1H), 3.68-3.55 (m, 1H), 3.48-3.38 (m, 1H), 3.18-3.01 (m, 1H), 2.34-2.25 (m, 2H), 2.24-2.13 (m, 1H), 2.11-1.96 (m, 2H), 1.93-1.72 (m, 3H), 1.68-1.51 (m, 1H), 1.46-1.20 (m, 3H), 1.15-1.08 (m, 2H), 1.00-0.93 (m, 2H). MS (ESI) m/z: [M+H]+ Found 577.3.
-
-
- Step A: tert-Butyl ((1S)-(7-(((2-(((tert-butoxycarbonyl)amino)methyl)-3,3,3-trifluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. tert-Butyl (S)-((4,4-difluorocyclohexyl)(7-formylimidazo[1,2-b]pyridazin-2-yl)methyl)carbamate (500 mg, 1.27 mmol), tert-butyl (2-(aminomethyl)-3,3,3-trifluoropropyl) carbamate (461 mg, 1.90 mmol), TEA (1.06 mL, 7.61 mmol) and DCE (15 mL) were added to a 50 mL three-necked round-bottomed flask. The resulting mixture was stirred at 80° C. for 16 h. The reaction vessel was removed from the oil bath and allowed to gradually cool to rt. Then a mixture of NaBH3CN (239 mg, 3.80 mmol), methanol (10 mL) and AcOH (2.5 mL) was added in one portion. The resulting mixture stirred for 2 h at rt. After that time, the reaction mixture was poured into water (20 mL) and extracted with CH2Cl2 (80 mL×2). The combined organic layers were washed with brine (50 mL), dried over anhydrous Na2SO4, filtered and concentrated to dryness to afford a yellow oil. This material was purified by silica gel chromatography (10-30% EtOAc/petroleum ether) to provide tert-butyl ((1S)-(7-(((2-(((tert-butoxycarbonyl)amino)methyl)-3,3,3-trifluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (76% yield) as a yellow oil.
- Step B: N1-((2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-2-(trifluoromethyl)propane-1,3-diamine. tert-Butyl ((1S)-(7-(((2-(((tert-butoxycarbonyl)amino)methyl)-3,3,3-trifluoropropyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (60 mg, 0.097 mmol, Step A) and anhydrous CH2Cl2 (1.5 mL) were added to a 10 mL round-bottomed flask. HCl (1.5 mL, 4 M in MeOH) was added in one portion at rt. The resulting mixture was stirred at rt for 2 h, after which it was concentrated to dryness to afford a colorless oil. The pH of this oil was adjusted to pH ˜9-10 by the addition of 2 N aqueous NaOH (8 mL) dropwise, and then this mixture was extracted with EtOAc (20 mL×3). The combined organic extracts were washed with brine (50 mL), dried over anhydrous Na2SO4, filtered and concentrated to dryness to provide N1-((2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-2-(trifluoromethyl)propane-1,3-diamine (98% yield) as colorless oil.
- Step C: 1-((2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5-(trifluoromethyl)tetrahydropyrimidin-2(1H)-one. N1-((2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-2-(trifluoromethyl)propane-1,3-diamine (40 mg, 0.10 mmol, Step B) and anhydrous THE (11 mL) were combined and stirred at 65° for 5 min. Then, CDI (23 mg, 0.14 mmol) was added in one portion and the resulting mixture was stirred at 65° C. for 45 min. After that time, the mixture was treated with 2 N aqueous NaOH (3 mL) dropwise until the pH of the solution was pH 9-10 and then the resulting solution was extracted with EtOAc (20 mL×3). The combined organic extracts were washed with brine (30 mL), dried over anhydrous Na2SO4, filtered, and concentrated to dryness to afford a colorless oil. This oil was purified by preparative HPLC (Welch Xtimate C18 column, 5 μm, 150×25 mm, 13-43% (v/v) water (0.225% formic acid)/CH3CN) to provide, after lyophilization, 1-((2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5-(trifluoromethyl)tetrahydropyrimidin-2(1H)-one (57% yield) as a white solid.
- Step D: 4-Cyclopropyl-N-((1S)-(4,4-difluorocyclohexyl)(7-((2-oxo-5-(trifluoromethyl)tetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1,2,5-oxadiazole-3-carboxamide. 1-((2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5-(trifluoromethyl)tetrahydropyrimidin-2(1H)-one (24 mg, 0.050 mmol, Step C), 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid (12 mg, 0.080 mmol), HOBt (11 mg, 0.080 mmol), DIPEA (21 mg, 0.16 mmol) and CH3CN (4 mL) were added to a 10 mL single-necked round-bottomed flask at rt. The mixture was stirred at 45° for 5 min, after which the mixture became homogeneous. Then, EDCI (15.5 mg, 0.080 mmol) was added in one portion and the resulting mixture was stirred at 50° C. for 2 h. The reaction was concentrated to dryness to afford a colorless oil, which was purified by preparative TLC (9% MeOH/DCM) to afford 4-cyclopropyl-N-((1S)-(4,4-difluorocyclohexyl)(7-((2-oxo-5-(trifluoromethyl)tetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1,2,5-oxadiazole-3-carboxamide (96% yield) as colorless oil.
- Step E: 4-Cyclopropyl-N—((S)-(4,4-difluorocyclohexyl)(7-(((S*)-2-oxo-5-(trifluoromethyl)tetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1,2,5-oxadiazole-3-carboxamide. The colorless oil, 4-cyclopropyl-N-((1S)-(4,4-difluorocyclohexyl)(7-((2-oxo-5-(trifluoromethyl)tetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1,2,5-oxadiazole-3-carboxamide, from Step D, was purified by chiral SFC (DAICEL CHIRALPAK AD column, 10 μm, 250×30 mm; 50% (v/v) EtOH (containing 0.1% of 25% aqueous NH3)/CO2) to afford two diastereomers. The first eluting isomer was designated as the (S*) isomer (Example 5) and the second eluting isomer was designated as the (R*) isomer (Example 6). The first eluting isomer was 4-cyclopropyl-N—((S)-(4,4-difluorocyclohexyl)(7-(((S*)-2-oxo-5-(trifluoromethyl)tetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1,2,5-oxadiazole-3-carboxamide (Example 5, 8% yield) that was isolated as a white solid after lyophilization. Example 5: 1H NMR (400 MHz, DMSO-d6) δ 9.50 (d, J=8.8 Hz, 1H), 8.42 (d, J=1.6 Hz, 1H), 8.23 (s, 1H), 7.93 (s, 1H), 6.73 (s, 1H), 5.19 (t, J=8.4 Hz, 1H), 4.57-4.45 (m, 2H), 3.56-3.48 (m, 1H), 3.42-3.39 (m, 1H), 3.29-3.25 (m, 1H), 3.20-3.12 (m, 1H), 2.31-2.23 (m, 1H), 2.23-2.13 (m, 1H), 2.08-1.95 (m, 2H), 1.92-1.70 (m, 3H), 1.66-1.57 (m, 1H), 1.44-1.22 (m, 3H), 1.14-1.06 (m, 2H), 1.00-0.91 (m, 2H). MS (ESI) m/z: [M+H]+ Found 583.3.
- The second eluting isomer was 4-cyclopropyl-N—((S)-(4,4-difluorocyclohexyl)(7-(((R*)-2-oxo-5-(trifluoromethyl)tetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1,2,5-oxadiazole-3-carboxamide (Example 6, 7% yield) that was isolated as a white solid after lyophilization. Example 6: 1H NMR (400 MHz, DMSO-d6) δ 9.50 (d, J=8.8 Hz, 1H), 8.42 (d, J=1.6 Hz, 1H), 8.23 (s, 1H), 7.93 (s, 1H), 6.73 (s, 1H), 5.19 (t, J=8.4 Hz, 1H), 4.57-4.49 (m, 2H), 3.55-3.48 (m, 1H), 3.42-3.39 (m, 1H), 3.29-3.24 (m, 1H), 3.20-3.12 (m, 1H), 2.31-2.24 (m, 1H), 2.23-2.13 (m, 1H), 2.08-1.95 (m, 2H), 1.92-1.69 (m, 3H), 1.67-1.57 (m, 1H), 1.51-1.19 (m, 3H), 1.16-1.08 (m, 2H), 0.99-0.92 (m, 4.8 Hz, 2H). MS (ESI) m/z: [M+H]+ Found 583.3.
-
- A vial was charged with 1-((R)-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)(cyclopropyl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (53 mg, 0.12 mmol, Intermediate 2), 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid (20 mg, 0.13 mmol), MeCN (1.5 mL), HOBt (22 mg, 0.16 mmol), and Hunig's base (31 μL, 0.18 mmol). The solution was heated to 40° C. and stirred for 5 min. To the solution was added EDCI (30 mg 0.16 mmol) and the reaction was further stirred for 18 h at 40° C. Then the reaction mixture was diluted with MeCN and the material was purified directly by reverse phase basic HPLC (X-Bridge Prep C18 5 μm column 50×100 mm, 0-100% acetonitrile/water (with 20 nM NH4OH). The purified fractions were concentrated to dryness to give the title compound as a white foam (74% yield). 1H NMR (400 MHz, DMSO-d6) δ 9.47 (d, J=9.0 Hz, 1H), 8.38 (d, J=2.1 Hz, 1H), 8.24 (s, 1H), 8.07-7.93 (m, 1H), 6.91 (s, 1H), 5.26-5.13 (m, 1H), 4.60 (d, J=10.3 Hz, 1H), 3.92-3.74 (m, 1H), 3.67-3.45 (m, 3H), 2.37-2.13 (m, 2H), 2.13-1.47 (m, 7H), 1.47-1.20 (m, 2H), 1.19-1.07 (m, 2H), 1.01-0.93 (m, 2H), 0.86-0.73 (m, 1H), 0.72-0.59 (m, 1H), 0.59-0.48 (m, 1H), 0.46-0.33 (m, 1H). MS (ESI) m/z: [M+H]+ Found 591.3.
-
- The title compound was prepared as described for the synthesis of Example 7, using 4-methyl-1,2,5-oxadiazole-3-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid to afford the title compound as a white solid (70% yield). 1H NMR (400 MHz, DMSO-d6) δ 9.40 (d, J=8.9 Hz, 1H), 8.38 (d, J=2.1 Hz, 1H), 8.25 (s, 1H), 8.07-8.00 (m, 1H), 6.91 (s, 1H), 5.23-5.13 (m, 1H), 4.64-4.54 (m, 1H), 3.92-3.75 (m, 1H), 3.68-3.46 (m, 3H), 2.48 (s, 3H), 2.29-2.14 (m, 1H), 2.12-1.69 (m, 5H), 1.69-1.47 (m, 2H), 1.47-1.20 (m, 2H), 0.86-0.74 (m, 1H), 0.72-0.60 (m, 1H), 0.59-0.48 (m, 1H), 0.45-0.33 (m, 1H). MS (ESI) m/z: [M+H]+ Found 565.3.
-
- The title compound was prepared as described for the synthesis of Example 7, using 1-(ethyl-d5)-1H-pyrazole-5-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid to afford the title compound as a white solid (50% yield). 1H NMR (400 MHz, DMSO-d6) δ 8.72 (d, J=9.0 Hz, 1H), 8.37 (d, J=2.1 Hz, 1H), 8.22 (s, 1H), 8.04-7.98 (m, 1H), 7.47 (d, J=2.0 Hz, 1H), 6.99 (d, J=2.0 Hz, 1H), 6.91 (s, 1H), 5.21-5.12 (m, 1H), 4.64-4.55 (m, 1H), 3.93-3.76 (m, 1H), 3.65-3.46 (m, 3H), 2.26-2.13 (m, 1H), 2.12-1.58 (m, 6H), 1.58-1.47 (m, 1H), 1.46-1.20 (m, 2H), 0.85-0.75 (m, 1H), 0.69-0.60 (m, 1H), 0.58-0.49 (m, 1H), 0.44-0.33 (m, 1H). MS (ESI) m/z: [M+H]+ Found 582.3.
-
- The title compound was prepared as described for the synthesis of Example 7, using 1-(propan-2-yl)-1H-pyrazole-5-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid to afford the title compound as a white solid (47% yield). 1H NMR (400 MHz, DMSO-d6) δ 8.71 (d, J=9.0 Hz, 1H), 8.37 (d, J=2.1 Hz, 1H), 8.22 (s, 1H), 8.04-7.97 (m, 1H), 7.49 (d, J 2.0 Hz, 1H), 6.94-6.85 (m, 2H), 5.44-5.33 (m, 1H), 5.21-5.13 (m, 1H), 4.63-4.56 (m, 1H), 3.90-3.77 (m, 1H), 3.65-3.46 (m, 3H), 2.25-2.13 (m, 1H), 2.14-1.60 (m, 6H), 1.60-1.47 (m, 1H), 1.46-1.21 (m, 8H), 0.84-0.75 (m, 1H), 0.69-0.59 (m, 1H), 0.59-0.49 (m, 1H), 0.45-0.33 (m, 1H). MS (ESI) m/z: [M+H]+ Found 591.3.
-
- The title compound was prepared as described for the synthesis of Example 7, using 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 3) in place of 1-((R)-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)(cyclopropyl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one and purification by preparative acidic HPLC (SunFire Prep C18 5 μm column 30×250 mm, 0-100% acetonitrile (0.05% TFA)/water (0.05% TFA)) followed by silica gel chromatography (0-100% (10% 2 M NH3/MeOH in DCM)/DCM) afforded the title compound as a white foam (81% yield). 1H NMR (400 MHz, DMSO-d6) δ 9.48 (d, J=9.0 Hz, 1H), 8.39 (d, J=2.1 Hz, 1H), 8.25 (s, 1H), 7.96-7.91 (m, 1H), 6.96 (s, 1H), 5.61-5.54 (m, 1H), 5.24-5.16 (m, 1H), 3.96-3.86 (m, 2H), 3.77-3.63 (m, 1H), 3.62-3.47 (m, 3H), 3.35 (s, 3H), 2.33-2.25 (m, 1H), 2.25-2.13 (m, 1H), 2.12-1.69 (m, 5H), 1.68-1.58 (m, 1H), 1.47-1.26 (m, 2H), 1.17-1.09 (m, 2H), 0.99-0.93 (m, 2H). MS (ESI) m/z: [M+H]+ Found 595.2.
-
- The title compound was prepared as described for the synthesis of Example 7, using 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 3) in place of 1-((R)-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)(cyclopropyl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one and using 4-methyl-1,2,5-oxadiazole-3-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid to give the title compound as a white foam (79% yield). 1H NMR (400 MHz, DMSO-d6) δ 9.50 (d, J=9.0 Hz, 1H), 8.47 (d, J=2.1 Hz, 1H), 8.34 (s, 1H), 8.03-7.98 (m, 1H), 7.05 (s, 1H), 5.70-5.62 (m, 1H), 5.33-5.20 (m, 1H), 4.04-3.92 (m, 2H), 3.85-3.71 (m, 1H), 3.71-3.52 (m, 3H), 3.43 (s, 3H), 2.56 (s, 3H), 2.36-2.21 (m, 1H), 2.21-1.76 (m, 5H), 1.76-1.65 (m, 1H), 1.56-1.29 (m, 2H). MS (ESI) m/z: [M+H]+ Found 569.2.
-
- The title compound was prepared as described for the synthesis of Example 7, using 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 3) in place of 1-((R)-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)(cyclopropyl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one and 1-(ethyl-d5)-1H-pyrazole-5-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid. Additional purifications by preparative acidic HPLC (SunFire Prep C18 5 μm column 30×250 mm, 0-100% acetonitrile (0.05% TFA)/water (0.05% TFA)) and by silica gel chromatography (0 to 100% (10% 2 M NH3/MeOH in DCM)/DCM) were necessary to provide the title compound as a white foam (59% yield). 1H NMR (400 MHz, DMSO-d6) δ 8.73 (d, J=9.0 Hz, 1H), 8.38 (d, J=2.1 Hz, 1H), 8.23 (s, 1H), 7.98-7.86 (m, 1H), 7.47 (d, J=2.0 Hz, 1H), 7.06-6.87 (m, 2H), 5.63-5.53 (m, 1H), 5.22-5.11 (m, 1H), 3.96-3.86 (m, 2H), 3.77-3.64 (m, 1H), 3.64-3.47 (m, 3H), 3.34 (s, 3H), 2.26-2.13 (m, 1H), 2.13-1.68 (m, 5H), 1.68-1.58 (m, 1H), 1.47-1.19 (m, 2H). MS (ESI) m/z: [M+H]+ Found 586.3.
-
- The title compound was prepared as described for the synthesis of Example 7, using 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 3) in place of 1-((R)-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)(cyclopropyl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one and 1-(propan-2-yl)-1H-pyrazole-5-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid. Additional purifications by preparative acidic HPLC (SunFire Prep C18 5 μm column 30×250 mm, 0-100% acetonitrile (0.05% TFA)/water (0.05% TFA)) and by silica gel chromatography (0 to 100% (10% 2 M NH3/MeOH in DCM)/DCM) provided the title compound (67% yield). 1H NMR (400 MHz, DMSO-d6) δ 8.72 (d, J=9.1 Hz, 1H), 8.38 (d, J=2.1 Hz, 1H), 8.22 (s, 1H), 7.92-7.89 (m, 1H), 7.49 (d, J=2.0 Hz, 1H), 6.95 (d, J=2.9 Hz, 1H), 6.92 (d, J=2.0 Hz, 1H), 5.62-5.55 (m, 1H), 5.42-5.33 (m, 1H), 5.20-5.13 (m, 1H), 3.95-3.86 (m, 2H), 3.76-3.64 (m, 1H), 3.61-3.45 (m, 3H), 3.34 (s, 3H), 2.24-2.13 (m, 1H), 2.10-1.94 (m, 2H), 1.93-1.69 (m, 3H), 1.67-1.59 (m, 1H), 1.44-1.22 (m, 8H). MS (ESI) m/z: [M+H]+ Found 595.3.
-
- To a mixture of 1-((S*)-1-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride (73 mg, 0.15 mmol, Intermediate 11) and 4-methyl-1,2,5-oxadiazole-3-carboxylic acid (29 mg, 0.23 mmol) in CH2Cl2 (1.5 mL) was added DIPEA (0.13 mL, 0.76 mmol) then T3P (0.14 mL, 0.23 mmol, 50% in EtOAc). The reaction mixture was stirred at rt for 1 h then DIPEA (0.13 mL, 0.76 mmol) and T3P (0.14 mL, 0.23 mmol, 50% in EtOAc) were added. The reaction was stirred at rt for 1 h then concentrated under reduced pressure. Purification by silica gel chromatography (10-100% (10% MeOH in EtOAc)/hexanes) followed by SFC using a chiral stationary phase (Stationary phase: Chiralcel OD3 5 μm, 250×21 mm, Mobile phase: 20% Methanol, 80% CO2) provided the title compound in 9% yield. 1H NMR (500 MHz, DMSO-d6) δ 9.43 (d, J=8.5 Hz, 1H), 8.39 (d, J=2.0 Hz, 1H), 8.23 (s, 1H), 7.95 (s, 1H), 6.99-6.92 (m, 1H), 5.64-5.53 (m, 1H), 5.46-5.34 (m, 1H), 4.04-4.01 (m, 1H), 3.99-3.87 (m, 3H), 3.76-3.63 (m, 1H), 3.61-3.48 (m, 3H), 3.35 (br s, 3H), 2.51 (s, 3H), 1.39-1.32 (m, 6H). MS (ESI) m/z: [M+H]+ Found 591.4.
-
- To a mixture of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride (120 mg, 0.23 mmol, Intermediate 16) and 2,5-dioxopyrrolidin-1-yl 4-methyl-1,2,5-oxadiazole-3-carboxylate (78 mg, 0.35 mmol) in MeCN (2 mL) was added DIPLA (160 μL, 0.92 mmol). The reaction was stirred at rt for 10 min then quenched with H2O. The resulting mixture was diluted with EtOAc then washed with saturated aqueous NaHCO3, dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure. Purification by silica gel chromatography (10-60% (10% MeOH in EtOAc)/hexanes) followed by SFC using a chiral stationary phase (Stationary phase: Whelk O1 SS 5 μm, 250×21 mm, Mobile phase: 25% Methanol, 75% CO2) provided the title compound in 23% yield. 1H NMR (400 MHz, DMSO-d6) δ 9.41 (d, J=9.0 Hz, 1H), 8.37 (d, J=2.0 Hz, 1H), 8.25 (s, 1H), 7.97-7.90 (m, 1H), 6.98-6.90 (m, 1H), 5.63-5.48 (m, 1H), 5.26-5.11 (m, 1H), 4.06-3.92 (m, 2H), 3.76-3.61 (m, 1H), 3.60-3.45 (m, 3H), 3.44-3.38 (m, 1H), 2.47 (s, 3H), 2.26-2.12 (m, 1H), 2.11-1.87 (m, 3H), 1.86-1.67 (m, 2H), 1.67-1.54 (m, 1H), 1.48-1.21 (m, 2H), 0.61-0.40 (m, 4H). MS (ESI) m/z: [M+H]+ Found 595.3.
-
- To a flask containing (R)-1-((2-(1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (52.0 mg, 0.119 mmol, Intermediate 19) in EtOAc (1.5 mL) was added 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid (35.9 mg, 0.233 mmol), DIPEA (0.041 mL, 0.233 mmol) and HOBt (17.3 mg, 0.128 mmol). The mixture was stirred for 5 min and then EDCI (24.5 mg, 0.128 mmol) was added. The resulting mixture was stirred at 45° C. for 1.5 h. The reaction was then diluted with EtOAc and washed with saturated aqueous NH4Cl followed by saturated aqueous NaHCO3. The organic layer was washed with brine, dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure. Purification by silica gel chromatography (10-100% (10% MeOH in EtOAc)/hexanes) provided the title compound in 28% yield. 1H NMR (500 MHz, DMSO-d6) δ 9.51-9.45 (m, 1H), 8.45-8.40 (m, 1H), 8.23-8.19 (m, 1H), 7.92-7.88 (m, 1H), 6.97-6.92 (m, 1H), 5.45-5.38 (m, 1H), 4.52-4.48 (m, 2H), 4.05-3.91 (m, 2H), 3.76-3.67 (m, 2H), 3.60-3.50 (m, 2H), 2.39-2.31 (m, 1H), 1.36-1.33 (m, 6H), 1.17-1.11 (m, 2H), 1.02-0.97 (m, 2H). MS (ESI) m/z: [M+H]+ Found 573.2.
-
- To a stirred solution of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid (261 mg, 1.70 mmol) and 1-propanephosphonic anhydride (0.909 mL, 1.53 mmol, 50% in EtOAc) in EtOAc (4.24 mL) was added N,N-diisopropylethylamine (0.581 mL, 3.39 mmol). After 5 min, (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one (321 mg, 0.339 mmol, Intermediate 24) in DCM (3 mL) was added. After 12 h at rt, the reaction was diluted with aqueous HCl (15 mL, 0.05 M) and the aqueous layer was extracted with EtOAc (3×5 mL). The combined organic fractions were washed with saturated aqueous NaHCO3 (10 mL), dried over anhydrous Na2SO4, filtered and concentrated to dryness. The residue was dissolved in DMSO and purified by preparative HPLC (C18, 5 μm, 50×250 mm, 10-100% MeCN/water (20 mM NH4OH)) to give the title compound as a white solid (2.2% yield). 1H NMR (500 MHz, DMSO-d6) δ 9.47 (d, J=9.0 Hz, 1H), 8.41 (d, J=2.0 Hz, 1H), 8.22 (s, 1H), 7.84 (d, J=1.3 Hz, 1H), 6.43 (s, 1H), 5.19 (t, J=8.6 Hz, 1H), 4.47 (s, 2H), 3.23 (t, J=5.8 Hz, 2H), 3.13 (dt, J=2.5, 5.6 Hz, 2H), 2.27 (tt, J=5.0, 8.4 Hz, 1H), 2.22-2.13 (m, 1H), 2.10-1.94 (m, 2H), 1.89 (d, J=13.3 Hz, 1H), 1.86-1.70 (m, 4H), 1.62 (d, J=13.1 Hz, 1H), 1.44-1.34 (m, 1H), 1.33-1.22 (m, 1H), 1.15-1.08 (m, 2H), 0.99-0.92 (m, 2H). MS (ESI) m/z: [M+H]+ Found 515.2.
-
- The title compound was synthesized in a manner analogous to Example 18 using 1-isopropyl-1H-pyrazole-5-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid to provide the title compound as a white solid (2.9% yield). 1H NMR (500 MHz, DMSO-d6) δ 8.71 (d, J=9.1 Hz, 1H), 8.40 (d, J=1.6 Hz, 1H), 8.19 (s, 1H), 7.82 (s, 1H), 7.49 (d, J=1.8 Hz, 1H), 6.91 (d, J=1.4 Hz, 1H), 6.43 (br s, 1H), 5.40-5.35 (m, 1H), 5.18-5.11 (m, 1H), 4.47 (s, 2H), 3.25-3.20 (m, 1H), 3.13 (d, J=2.5 Hz, 2H), 2.22-2.12 (m, 1H), 2.09-1.92 (m, 2H), 1.90-1.84 (m, 1H), 1.84-1.68 (m, 4H), 1.66-1.56 (m, 1H), 1.38 (s, 1H), 1.36 (d, J=6.5 Hz, 3H), 1.33 (d, J=6.6 Hz, 3H), 1.29-1.22 (m, 2H). MS (ESI) m/z: [M+H]+ Found 515.3.
-
- The title compound was synthesized in a manner analogous to Example 18 using (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 20) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one to provide the title compound as a white solid (39.8% yield). 1H NMR (500 MHz, DMSO-d6) δ 9.48 (d, J=8.9 Hz, 1H), 8.41 (d, J=2.0 Hz, 1H), 8.23 (s, 1H), 7.88 (d, J=1.1 Hz, 1H), 6.94 (br s, 1H), 5.19 (t, J=8.4 Hz, 1H), 4.50 (s, 2H), 3.72 (t, J=12.3 Hz, 2H), 3.54 (t, J=12.6 Hz, 2H), 2.33-2.23 (m, 1H), 2.22-2.13 (m, 1H), 2.09-1.94 (m, 2H), 1.90 (d, J=12.8 Hz, 1H), 1.85-1.69 (m, 2H), 1.62 (d, J=12.8 Hz, 1H), 1.45-1.34 (m, 1H), 1.33-1.24 (m, 1H), 1.16-1.05 (m, 2H), 1.00-0.92 (m, 2H). MS (ESI) m/z: [M+H]+ Found 551.2.
-
- The title compound was synthesized in a manner analogous to Example 18 using (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 20) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 1-isopropyl-1H-pyrazole-5-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid to provide the title compound as a white solid (37.1% yield). 1H NMR (500 MHz, DMSO-d6) δ 8.72 (d, J=9.1 Hz, 1H), 8.40 (d, J=2.1 Hz, 1H), 8.21 (s, 1H), 7.88-7.84 (m, 1H), 7.48 (d, J=1.9 Hz, 1H), 6.94 (br s, 1H), 6.91 (d, J=2.0 Hz, 1H), 5.37 (spt, J=6.6 Hz, 1H), 5.15 (t, J=8.6 Hz, 1H), 4.49 (s, 2H), 3.72 (t, J=12.3 Hz, 2H), 3.54 (t, J=12.7 Hz, 2H), 2.24-2.12 (m, 1H), 2.10-1.93 (m, 2H), 1.91-1.69 (m, 3H), 1.62 (d, J=13.5 Hz, 1H), 1.43-1.38 (m, 1H), 1.36 (d, J=6.6 Hz, 3H), 1.33 (d, J=6.6 Hz, 3H), 1.30-1.21 (m, 1H). MS (ESI) m/z: [M+H]+ Found 551.2.
-
- The title compound was synthesized in a manner analogous to Example 18 using (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 20) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 3-((difluoromethoxy)methyl)isoxazole-4-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid to provide the title compound as a white solid (40.3% yield). 1H NMR (500 MHz, DMSO-d6) δ 9.55 (s, 1H), 8.84 (d, J=9.0 Hz, 1H), 8.40 (d, J=2.0 Hz, 1H), 8.22 (s, 1H), 7.86 (d, J=1.1 Hz, 1H), 6.96-6.60 (m, 2H), 5.23-5.13 (m, 3H), 4.49 (s, 2H), 3.72 (t, J=12.2 Hz, 2H), 3.54 (t, J=12.7 Hz, 2H), 2.20-2.10 (m, 1H), 2.08-1.92 (m, 2H), 1.90-1.68 (m, 3H), 1.60 (d, J=12.4 Hz, 1H), 1.43-1.33 (m, 1H), 1.32-1.22 (m, 1H). MS (ESI) m/z: [M+H]+ Found 589.7.
-
- The title compound was synthesized in a manner analogous to Example 18 using (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 20) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 1-isopropyl-1H-1,2,4-triazole-5-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid to provide the title compound as a white solid (16.2% yield). 1H NMR (500 MHz, DMSO-d6) δ 8.95-8.79 (m, 1H), 8.41 (br s, 1H), 8.27 (d, J=3.0 Hz, 1H), 8.14-8.04 (m, 1H), 7.90 (br s, 1H), 6.93 (br s, 1H), 5.64-5.45 (m, 1H), 5.22-5.04 (m, 1H), 4.49 (d, J=1.9 Hz, 2H), 3.79-3.65 (m, 2H), 3.55 (d, J=10.6 Hz, 2H), 2.15 (d, J=2.6 Hz, 1H), 2.08-1.84 (m, 3H), 1.84-1.67 (m, 2H), 1.66-1.54 (m, 1H), 1.48-1.30 (m, 7H), 1.25 (d, J=8.9 Hz, 1H). MS (ESI) m/z: [M+H]+ Found 551.8.
-
- The title compound was synthesized in a manner analogous to Example 18 using (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 20) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 2-(cyclopropylmethyl)-2H-1,2,3-triazole-4-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid to provide the title compound as a white solid (30.2% yield). 1H NMR (500 MHz, DMSO-d6) δ 8.49 (d, J=9.1 Hz, 1H), 8.40 (d, J=2.0 Hz, 1H), 8.25 (s, 1H), 8.18 (s, 1H), 7.88 (d, J=1.0 Hz, 1H), 6.93 (br s, 1H), 5.18 (t, J=8.8 Hz, 1H), 4.49 (s, 2H), 4.35 (d, J=7.4 Hz, 2H), 3.72 (t, J=12.3 Hz, 2H), 3.54 (t, J=12.6 Hz, 2H), 2.20-2.10 (m, 1H), 2.08-1.92 (m, 2H), 1.89 (d, J=12.4 Hz, 1H), 1.85-1.66 (m, 2H), 1.58 (d, J=12.8 Hz, 1H), 1.40-1.30 (m, 2H), 1.29-1.18 (m, 1H), 0.58-0.52 (m, 2H), 0.45-0.39 (m, 2H). MS (ESI) m/z: [M+H]+ Found 563.8.
-
- The title compound was synthesized in a manner analogous to Example 18 using (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 20) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 1-(ethyl-d5)-1H-pyrazole-5-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid to provide the title compound as a white solid (38.1% yield). 1H NMR (500 MHz, DMSO-d6) δ 8.72 (d, J=9.1 Hz, 1H), 8.40 (d, J=2.0 Hz, 1H), 8.21 (s, 1H), 7.88-7.85 (m, 1H), 7.46 (d, J=2.0 Hz, 1H), 6.97 (d, J=2.0 Hz, 1H), 6.93 (br s, 1H), 5.16 (t, J=8.8 Hz, 1H), 4.49 (s, 2H), 3.71 (t, J=12.3 Hz, 2H), 3.54 (t, J=12.7 Hz, 2H), 2.23-2.14 (m, 1H), 2.10-1.93 (m, 2H), 1.92-1.68 (m, 3H), 1.61 (d, J=12.6 Hz, 1H), 1.43-1.19 (m, 2H). MS (ESI) m/z: [M+H]+ Found 541.8.
-
- The title compound was synthesized in a manner analogous to Example 18 using (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 20) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 4-(2,2-difluoroethoxy)-1,2,5-oxadiazole-3-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid to provide the title compound as a white solid (36.0% yield). 1H NMR (500 MHz, DMSO-d6) δ 9.36 (d, J=9.0 Hz, 1H), 8.41 (d, J=2.0 Hz, 1H), 8.20 (s, 1H), 7.87 (d, J=1.3 Hz, 1H), 6.94 (br s, 1H), 6.42 (tt, J=3.1, 53.6 Hz, 1H), 5.16 (t, J=8.3 Hz, 1H), 4.75-4.65 (m, 2H), 4.50 (s, 2H), 3.72 (t, J=12.3 Hz, 2H), 3.54 (t, J=12.6 Hz, 2H), 2.20-2.10 (m, 1H), 2.08-1.93 (m, 2H), 1.91-1.68 (m, 3H), 1.61 (d, J=13.1 Hz, 1H), 1.43-1.21 (m, 2H). MS (ESI) m/z: [M+H]+ Found 590.8.
-
- The title compound was synthesized in a manner analogous to Example 18 using (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 20) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 2-(3,3,3-trifluoropropyl)-2H-1,2,3-triazole-4-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid to provide the title compound as a white solid (31.9% yield). 1H NMR (500 MHz, DMSO-d6) δ 8.55 (d, J=9.1 Hz, 1H), 8.40 (d, J=2.0 Hz, 1H), 8.25 (s, 1H), 8.23 (s, 1H), 7.88 (d, J=1.3 Hz, 1H), 6.93 (br s, 1H), 5.18 (t, J=8.8 Hz, 1H), 4.76 (t, J=6.7 Hz, 2H), 4.49 (s, 2H), 3.72 (t, J=12.4 Hz, 2H), 3.54 (t, J=12.7 Hz, 2H), 3.09-2.98 (m, 2H), 2.21-2.11 (m, 1H), 2.06-1.92 (m, 2H), 1.89 (d, J=13.3 Hz, 1H), 1.85-1.67 (m, 2H), 1.58 (d, J=12.0 Hz, 1H), 1.40-1.29 (m, 1H), 1.29-1.19 (m, 1H). MS (ESI) m/z: [M+H]+ Found 605.8.
-
-
- The title compounds were synthesized in a manner analogous to Example 18 using 1-((2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5-methyltetrahydropyrimidin-2(1H)-one (Intermediate 21) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one. The resulting mixture was purified by chiral SFC (DAICEL CHIRALPAK IB N3 column, 10 μm, 250×50 mm; 40% ACN:MeOH (9:1) 60% CO2) to afford two diastereomers. The first eluting isomer was designated as the (S*) isomer (Example 28) and the second eluting isomer was designated as the (R*) isomer (Example 29). The first eluting isomer, 4-cyclopropyl-N—((S)-(4,4-difluorocyclohexyl)(7-(((S*)-5-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1,2,5-oxadiazole-3-carboxamide, was isolated as a white solid (Example 28, 6.2% yield). The second eluting isomer, 4-cyclopropyl-N—((S)-(4,4-difluorocyclohexyl)(7-(((R*)-5-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1,2,5-oxadiazole-3-carboxamide, was isolated as a white solid (Example 29, 6.0% yield). 4-Cyclopropyl-N—((S)-(4,4-difluorocyclohexyl)(7-(((S*)-5-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1,2,5-oxadiazole-3-carboxamide. Example 28: 1H NMR (500 MHz, DMSO-d6) δ 9.47 (d, J=9.0 Hz, 1H), 8.40 (d, J=2.1 Hz, 1H), 8.22 (s, 1H), 7.85 (d, J=1.1 Hz, 1H), 6.44 (d, J=2.8 Hz, 1H), 5.19 (t, J=8.5 Hz, 1H), 4.51-4.40 (m, 2H), 3.25-3.15 (m, 1H), 3.15-3.05 (m, 1H), 2.91 (dd, J=9.5, 11.4 Hz, 1H), 2.85-2.77 (m, 1H), 2.32-2.23 (m, 1H), 2.22-2.13 (m, 1H), 2.09-1.95 (m, 3H), 1.90 (d, J=11.0 Hz, 1H), 1.85-1.70 (m, 2H), 1.62 (d, J=12.1 Hz, 1H), 1.45-1.35 (m, 1H), 1.33-1.24 (m, 1H), 1.15-1.08 (m, 2H), 0.99-0.92 (m, 2H), 0.88 (d, J=6.6 Hz, 3H). MS (ESI) m/z: [M+H]+ Found 529.2. 4-Cyclopropyl-N—((S)-(4,4-difluorocyclohexyl)(7-(((R*)-5-methyl-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1,2,5-oxadiazole-3-carboxamide Example 29: 1H NMR (500 MHz, DMSO-d6) δ 9.47 (d, J=4.3 Hz, 1H), 8.40 (d, J=1.9 Hz, 1H), 8.27-8.15 (m, 1H), 7.85 (br s, 1H), 6.44 (br s, 1H), 5.26-5.10 (m, 1H), 4.46 (br s, 2H), 3.23 (br s, 1H), 3.12 (br s, 1H), 2.99-2.87 (m, 1H), 2.81 (d, J=1.5 Hz, 1H), 2.30-2.12 (m, 2H), 2.10-1.56 (m, 7H), 1.45-1.21 (m, 2H), 1.11 (d, J=3.1 Hz, 2H), 0.96 (br s, 2H), 0.88 (br s, 3H). MS (ESI) m/z: [M+H]+ Found 529.2.
-
- The title compound was synthesized in a manner analogous to Example 18 using (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-1,3-diazepan-2-one (Intermediate 22) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one to provide the title compound as a white solid (3.8% yield). 1H NMR (500 MHz, DMSO-d6) δ 9.48 (d, J=8.9 Hz, 1H), 8.51 (d, J=1.9 Hz, 1H), 8.22 (s, 1H), 7.92 (br s, 1H), 6.23 (d, J=4.1 Hz, 1H), 5.25-5.11 (m, 1H), 4.41 (s, 2H), 3.14 (d, J=3.3 Hz, 2H), 2.99 (br s, 2H), 2.32-2.23 (m, 1H), 2.22-2.11 (m, 1H), 2.09-1.94 (m, 2H), 1.90 (d, J=12.4 Hz, 1H), 1.85-1.67 (m, 2H), 1.62 (d, J=11.6 Hz, 1H), 1.55 (br s, 4H), 1.45-1.34 (m, 1H), 1.33-1.22 (m, 1H), 1.14-1.06 (m, 2H), 1.00-0.91 (m, 2H). MS (ESI) m/z: [M+H]+ Found 529.2.
-
- The title compound was synthesized in a manner analogous to Example 18 using (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-1,3-diazepan-2-one (Intermediate 22) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 1-isopropyl-1H-pyrazole-5-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid to provide the title compound as a white solid (4.1% yield). 1H NMR (500 MHz, DMSO-d6) δ 8.71 (d, J=9.0 Hz, 1H), 8.49 (d, J=2.0 Hz, 1H), 8.19 (s, 1H), 7.91 (d, J=1.1 Hz, 1H), 7.48 (d, J=2.0 Hz, 1H), 6.91 (d, J=2.0 Hz, 1H), 6.22 (t, J=4.4 Hz, 1H), 5.37 (spt, J=6.6 Hz, 1H), 5.15 (t, J=8.6 Hz, 1H), 4.40 (s, 2H), 3.14 (d, J=5.8 Hz, 2H), 3.02-2.94 (m, 2H), 2.22-2.12 (m, 1H), 2.08-1.93 (m, 2H), 1.90-1.68 (m, 3H), 1.62 (d, J=12.0 Hz, 1H), 1.54 (br s, 4H), 1.43-1.38 (m, 1H), 1.36 (d, J=6.6 Hz, 3H), 1.33 (d, J=6.6 Hz, 3H), 1.30-1.22 (m, 1H). MS (ESI) m/z: [M+H]+ Found 529.2.
-
- The title compound was synthesized in a manner analogous to Example 18 using (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-dimethyltetrahydropyrimidin-2(1H)-one (Intermediate 23) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 4-methyl-1,2,5-oxadiazole-3-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid to provide the title compound as a white solid (39.6% yield). 1H NMR (500 MHz, DMSO-d6) δ 9.35 (d, J=9.0 Hz, 1H), 8.34 (d, J=2.0 Hz, 1H), 8.16 (s, 1H), 7.80 (d, J=1.1 Hz, 1H), 6.40 (t, J=2.4 Hz, 1H), 5.10 (t, J=8.6 Hz, 1H), 4.39 (s, 2H), 2.87 (s, 2H), 2.76 (d, J=1.5 Hz, 2H), 2.40 (s, 3H), 2.16-2.06 (m, 1H), 2.03-1.87 (m, 2H), 1.83 (d, J=12.9 Hz, 1H), 1.79-1.62 (m, 2H), 1.54 (d, J=12.1 Hz, 1H), 1.37-1.26 (m, 1H), 1.25-1.16 (m, 1H), 0.85 (s, 6H). MS (ESI) m/z: [M+H]+ Found 516.8.
-
- The title compound was synthesized in a manner analogous to Example 18 using (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-dimethyltetrahydropyrimidin-2(1H)-one (Intermediate 23) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one to provide the title compound as a white solid (22.7% yield). 1H NMR (500 MHz, DMSO-d6) δ 9.48 (d, J=9.0 Hz, 1H), 8.41 (d, J=2.0 Hz, 1H), 8.22 (s, 1H), 7.87 (d, J=1.3 Hz, 1H), 6.46 (t, J=2.4 Hz, 1H), 5.19 (t, J=8.5 Hz, 1H), 4.46 (s, 2H), 2.94 (s, 2H), 2.83 (d, J=1.5 Hz, 2H), 2.32-2.23 (m, 1H), 2.22-2.13 (m, 1H), 2.10-1.94 (m, 2H), 1.90 (d, J=12.6 Hz, 1H), 1.86-1.69 (m, 2H), 1.62 (d, J=13.0 Hz, 1H), 1.44-1.34 (m, 1H), 1.33-1.23 (m, 1H), 1.14-1.08 (m, 2H), 0.98-0.93 (m, 2H), 0.92 (s, 6H). MS (ESI) m/z: [M+H]+ Found 542.8.
-
- The title compound was synthesized in a manner analogous to Example 18 using (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-dimethyltetrahydropyrimidin-2(1H)-one (Intermediate 23) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 1-isopropyl-1H-pyrazole-5-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid to provide the title compound as a white solid (30.9% yield). 1H NMR (500 MHz, DMSO-d6) δ 8.72 (d, J=8.9 Hz, 1H), 8.40 (d, J=1.6 Hz, 1H), 8.20 (s, 1H), 7.86 (br s, 1H), 7.49 (d, J=1.9 Hz, 1H), 6.91 (d, J=1.9 Hz, 1H), 6.46 (br s, 1H), 5.41-5.29 (m, 1H), 5.17-5.09 (m, 1H), 4.46 (s, 2H), 2.93 (br s, 2H), 2.83 (br s, 2H), 2.16 (br s, 1H), 2.09-1.92 (m, 2H), 1.90-1.66 (m, 3H), 1.65-1.54 (m, 1H), 1.35 (dd, J=6.6, 16.3 Hz, 6H), 1.29-1.20 (m, 2H), 0.92 (s, 6H). MS (ESI) m/z: [M+H]+ Found 542.9.
-
- The title compound was prepared as described for the synthesis of Example 16, using 1-((S*)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-ethoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride (Intermediate 25) in place of 1-((S)-1-(2-((S*)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. Purification by silica gel chromatography (10-60% (10% MeOH in EtOAc)/hexanes) followed by SFC using a chiral stationary phase (Stationary phase: Whelk O1 SS 5 μm, 250×21 mm, Mobile phase: 30% Methanol, 70% CO2) provided the title compound in 45% yield. 1H NMR (500 MHz, DMSO-d6) δ 9.45-9.37 (m, 1H), 8.41-8.36 (m, 1H), 8.27-8.22 (m, 1H), 7.96-7.92 (m, 1H), 7.00-6.92 (m, 1H), 5.58-5.50 (m, 1H), 5.24-5.13 (m, 1H), 4.02-3.85 (m, 2H), 3.78-3.65 (m, 1H), 3.63-3.46 (m, 5H), 2.48-2.46 (m, 3H), 2.26-2.13 (m, 1H), 2.11-1.95 (m, 2H), 1.94-1.87 (m, 1H), 1.86-1.68 (m, 2H), 1.67-1.57 (m, 1H), 1.46-1.34 (m, 1H), 1.33-1.22 (m, 1H), 1.16-1.11 (m, 3H). MS (ESI) m/z: [M+H]+ Found 583.2.
-
- The title compound was prepared as described for the synthesis of Example 16, using 1-((S*)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-ethoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride (Intermediate 25) in place of 1-((S)-1-(2-((S*)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride) and 2,5-dioxopyrrolidin-1-yl 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylate (Intermediate 31) in place of 2,5-dioxopyrrolidin-1-yl 4-methyl-1,2,5-oxadiazole-3-carboxylate. Purification by silica gel chromatography (10-60% (10% MeOH in EtOAc)/hexanes) followed by SFC using a chiral stationary phase (Stationary phase: Whelk O1 SS 5 pam, 250×21 mm, Mobile phase: 30% Methanol, 70% CO2) provided the title compound in 45% yield. 1H NMR (500 MHz, DMSO-d6) δ 9.54-9.42 (m, 1H), 8.42-8.36 (m, 1H), 8.26-8.22 (m, 1H), 7.96-7.92 (m, 1H), 6.98-6.92 (m, 1H), 5.57-5.50 (m, 1H), 5.24-5.16 (m, 1H), 4.00-3.87 (m, 2H), 3.77-3.65 (m, 1H), 3.62-3.47 (m, 5H), 2.32-2.25 (m, 1H), 2.24-2.14 (m, 1H), 2.12-1.94 (m, 2H), 1.94-1.87 (m, 1H), 1.86-1.69 (m, 2H), 1.67-1.58 (m, 1H), 1.46-1.35 (m, 1H), 1.34-1.22 (m, 1H), 1.16-1.09 (m, 5H), 1.00-0.93 (m, 2H). MS (ESI) m/z: [M+H]+ Found 609.3.
-
- The title compound was prepared in a manner analogous to the synthesis of Example 16, using 2,5-dioxopyrrolidin-1-yl 1-isopropyl-1H-pyrazole-5-carboxylate (Intermediate 26) in place of 2,5-dioxopyrrolidin-1-yl 4-methyl-1,2,5-oxadiazole-3-carboxylate. In the course of the synthesis, Intermediate 15 was further purified by SFC using a chiral stationary phase (Stationary phase: Whelk O1 SS 5 μm 250×21 mm, Mobile phase: 30% methanol, 70% CO2). Purification by silica gel chromatography (20-100% (10% MeOH in EtOAc)/DCM) provided the title compound in 61% yield. 1H NMR (500 MHz, DMSO-d6) δ 8.72 (d, J=9.0 Hz, 1H), 8.40-8.34 (m, 1H), 8.22 (s, 1H), 7.94-7.89 (m, 1H), 7.49 (d, J=1.9 Hz, 1H), 6.96-6.93 (m, 1H), 6.91 (d, J=2.0 Hz, 1H), 5.56 (t, J=6.8 Hz, 1H), 5.37 (spt, J=6.6 Hz, 1H), 5.16 (t, J=8.6 Hz, 1H), 4.05-3.95 (m, 2H), 3.73-3.62 (m, 1H), 3.60-3.44 (m, 3H), 3.43-3.38 (m, 1H), 2.24-2.12 (m, 1H), 2.09-1.93 (m, 2H), 1.88 (br d, J=12.4 Hz, 1H), 1.84-1.68 (m, 2H), 1.62 (br d, J=12.4 Hz, 1H), 1.44-1.21 (m, 8H), 0.59-0.41 (m, 4H). MS (ESI) m/z: [M+H]+ Found 621.3.
-
- The title compound was prepared in a manner analogous to the synthesis of Example 17, using 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride (Intermediate 16) in place of (R)-1-((2-(1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one and 3-methylisoxazole-4-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid. In the course of the synthesis, Intermediate 15 was further purified by SFC using a chiral stationary phase (Stationary phase: Whelk O1 SS 5 μm 250×21 mm, Mobile phase: 30% methanol, 70% CO2). Purification by silica gel chromatography (0-100% (10% MeOH in EtOAc)/DCM) provided the title compound in 62% yield. 1H NMR (500 MHz, DMSO-d6) δ 9.41 (d, J=0.6 Hz, 1H), 8.66 (d, J=9.0 Hz, 1H), 8.38 (d, J=2.1 Hz, 1H), 8.22 (s, 1H), 7.92-7.88 (m, 1H), 6.95 (br s, 1H), 5.55 (t, J=6.8 Hz, 1H), 5.20-5.12 (m, 1H), 4.07-3.93 (m, 2H), 3.75-3.62 (m, 1H), 3.61-3.45 (m, 3H), 3.44-3.38 (m, 1H), 2.36 (s, 3H), 2.19-2.10 (m, 1H), 2.09-1.93 (m, 2H), 1.91-1.69 (m, 3H), 1.66-1.57 (m, 1H), 1.38 (qd, J=12.4, 3.5 Hz, 1H), 1.32-1.21 (m, 1H), 0.57-0.42 (m, 4H). MS (ESI) m/z: [M+H]+ Found 594.3.
-
- A vial was charged with 1-((5)-1-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 (90 mg, 0.19 mmol, Intermediate 28), MeCN (3 mL), 2,5-dioxopyrrolidin-1-yl 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylate (47 mg, 0.19 mmol, Intermediate 31), and DIPEA (42 μL, 0.24 mmol). The reaction was stirred for 15 min at rt, then poured over water and extracted with ethyl acetate (3×5 mL). The combined organic layers were washed with brine, dried over anhydrous MgSO4, filtered, and condensed. The isolated material was purified by silica gel chromatography (0-100% ethyl acetate (w/10% MeOH) Hexane). The isolated material was further purified by SFC using a chiral stationary phase ((Stationary phase: Whelk O1 SS 5 μm 250×21 mm, Mobile phase: 35% methanol, 65% CO2). The first eluting peak was lyophilized to yield the title compound as a white solid. 1H NMR (500 MHz, DMSO-d6) δ 9.54-9.45 (m, 1H), 8.39 (d, J=2.1 Hz, 1H), 8.23 (s, 1H), 7.98-7.93 (m, 1H), 6.97-6.91 (m, 1H), 5.61-5.55 (m, 1H), 5.46-5.39 (m, 1H), 4.06-4.01 (m, 1H), 3.98-3.87 (m, 3H), 3.35 (s, 3H), 2.40-2.32 (m, 1H), 1.38-1.34 (m, 6H), 1.18-1.12 (m, 2H), 1.04-0.98 (m, 2H). MS (ESI) m/z: [M+H]+ Found 621.20.
-
- The title compound was prepared as described for Example 16 using 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 (Intermediate 30) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. The minor diastereomer was removed by SFC with a chiral stationary phase (Stationary phase: Whelk O1 SS 5 μm 250×21 mm, Mobile phase: 35% methanol, 65% CO2). The first eluting was lyophilized to afford the title compound as a white solid. 1H NMR (500 MHz, DMSO-d6) δ 9.42 (d, J=8.9 Hz, 1H), 8.38 (d, J=2.0 Hz, 1H), 8.25 (s, 1H), 7.96-7.92 (m, 1H), 6.93 (s, 1H), 5.59-5.54 (m, 1H), 5.21-5.15 (m, 1H), 4.06-3.94 (m, 2H), 3.44-3.39 (m, 1H), 2.48 (s, 3H), 2.24-2.15 (m, 1H), 2.11-1.95 (m, 2H), 1.94-1.88 (m, 1H), 1.86-1.70 (m, 2H), 1.66-1.58 (m, 1H), 1.44-1.23 (m, 2H), 0.57-0.43 (m, 4H). MS (ESI) m/z: [M+H]+ Found 599.3.
-
- To a stirred solution of 1-((S)-1-(2-((S)-1-amino-4,4,4-trifluoro-3,3-dimethylbutyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 44, 42 mg, 0.09 mmol) in ACN (2.5 mL) was added DIPEA (234 uL, 1.36 mmol) and 2,5-dioxopyrrolidin-1-yl 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylate (39 mg, 0.15 mmol, Intermediate 31). After 2 h, the reaction mixture was filtered and purified by reverse phase basic HPLC (X-Bridge Prep C18 5 μm column 50×250 mm, 5-100% acetonitrile/water (with 20 nM NH4OH). The product containing fractions were lyophilized to give the title compound as a white solid (55% yield). 1H NMR (600 MHz, DMSO-d6) δ 9.73 (d, J=8.8 Hz, 1H), 8.36 (d, J=2.1 Hz, 1H), 8.20 (s, 1H), 7.98-7.94 (m, 1H), 6.95 (br. s, 1H), 5.58 (t, J=6.8 Hz, 1H), 5.47 (dt, J=3.2, 9.0 Hz, 1H), 3.93-3.86 (m, 2H), 3.72-3.63 (m, 1H), 3.58-3.45 (m, 3H), 3.34 (s, 3H), 2.42-2.33 (m, 2H), 2.27 (dd, J=9.4, 14.6 Hz, 1H), 1.20 (s, 3H), 1.19 (s, 3H), 1.16-1.12 (m, 2H), 1.03-0.95 (m, 2H). MS (APCI/ESI) m/z: [M+H]+ Found 601.3.
-
- The title compound was prepared as described for the synthesis of Example 16, using 2,5-dioxopyrrolidin-1-yl 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylate (Intermediate 31) in place of 2,5-dioxopyrrolidin-1-yl 4-methyl-1,2,5-oxadiazole-3-carboxylate and (1R,2R)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propan-1-aminium trifluoroacetate (Intermediate 41) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. The reaction was concentrated under reduced pressure and directly purified by preparative HPLC (XBridge Prep C18, 5 μm, 30×100 mm; 10-100% MeCN/water (20 mM NH4OH) to afford the title compound as an amorphous solid. 1H NMR (600 MHz, DMSO-d6) δ 9.42 (d, J=9.2 Hz, 1H), 8.40 (d, J=2.1 Hz, 1H), 8.29-8.23 (m, 1H), 7.97-7.89 (m, 1H), 7.00-6.88 (m, 1H), 5.62-5.55 (m, 1H), 5.29 (dd, J=9.2, 6.9 Hz, 1H), 4.31-4.22 (m, 2H), 3.96-3.87 (m, 2H), 3.76-3.63 (m, 1H), 3.62-3.43 (m, 3H), 3.34 (s, 3H), 2.35-2.26 (m, 1H), 1.18-1.08 (m, 8H), 1.04-0.88 (m, 2H). MS (ESI) m/z: [M+H]+ Found 617.3.
-
- The title compound was prepared as described for the synthesis of Example 16, using 2,5-dioxopyrrolidin-1-yl 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylate (Intermediate 31) in place of 2,5-dioxopyrrolidin-1-yl 4-methyl-1,2,5-oxadiazole-3-carboxylate and (1R,2R)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((S)-1,1,1-trifluoropropan-2-yl)oxy)propan-1-aminium trifluoroacetate (Intermediate 42) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. The reaction was purified by preparative HPLC (XBridge Prep C18, 5 μm, 30×100 mm; 10-100% MeCN/water (20 mM NH4OH) to afford the title compound as an amorphous solid. 1H NMR (600 MHz, DMSO-d6) δ 9.22 (d, J=9.1 Hz, 1H), 8.39 (d, J=2.1 Hz, 1H), 8.23 (s, 1H), 7.96-7.90 (m, 1H), 6.99-6.90 (m, 1H), 5.58 (t, J=6.8 Hz, 1H), 5.31 (dd, J=9.0, 6.7 Hz, 1H), 4.36-4.27 (m, 1H), 4.27-4.21 (m, 1H), 3.95-3.83 (m, 2H), 3.78-3.64 (m, 1H), 3.60-3.46 (m, 3H), 3.34 (s, 3H), 2.35-2.28 (m, 1H), 1.25 (d, J=6.5 Hz, 3H), 1.15-1.10 (m, 5H), 1.00-0.93 (m, 2H). MS (ESI) m/z: [M+H]+ Found 617.3.
-
- The title compound was prepared as described for the synthesis of Example 16, using 2,5-dioxopyrrolidin-1-yl 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylate (Intermediate 31) in place of 2,5-dioxopyrrolidin-1-yl 4-methyl-1,2,5-oxadiazole-3-carboxylate and (S)-1-(7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-4,4,4-trifluoro-3,3-dimethylbutan-1-aminium trifluoroacetate (Intermediate 43) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. The reaction was purified by preparative HPLC (XBridge Prep C18, 5 μm, 30×100 mm; 10-100% MeCN/water (20 mM NH4OH) to afford the title compound as an amorphous solid. 1H NMR (500 MHz, DMSO-d6) δ 9.74 (d, J=8.7 Hz, 1H), 8.36 (d, J=2.1 Hz, 1H), 8.20 (s, 1H), 7.99-7.92 (m, 1H), 6.99-6.90 (m, 1H), 5.57 (t, J=6.9 Hz, 1H), 5.47 (td, J=9.1, 3.4 Hz, 1H), 4.06-3.90 (m, 2H), 3.73-3.61 (m, 1H), 3.60-3.45 (m, 3H), 3.45-3.38 (m, 1H), 2.43-2.31 (m, 2H), 2.27 (dd, J=14.6, 9.4 Hz, 1H), 1.20 (s, 3H), 1.19 (s, 3H), 1.17-1.11 (m, 2H), 1.05-0.93 (m, 2H), 0.58-0.42 (m, 4H). MS (ESI) m/z: [M+H]+ Found 627.3.
-
- The title compound was synthesized in a manner analogous to Example 41 using 1-((S)-1-(2-((S*)-1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 47) in place of 1-((S)-1-(2-((S)-1-amino-4,4,4-trifluoro-3,3-dimethylbutyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one and 2,5-dioxopyrrolidin-1-yl 4-methyl-1,2,5-oxadiazole-3-carboxylate in place of 2,5-dioxopyrrolidin-1-yl 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylate to provide the title compound as a white solid (21% yield). 1H NMR (600 MHz, DMSO-d6) δ 9.50 (d, J=8.4 Hz, 1H), 8.37 (d, J=2.1 Hz, 1H), 8.19 (s, 1H), 7.96-7.94 (m, 1H), 6.95 (br s, 1H), 5.58 (t, J=6.8 Hz, 1H), 5.24-5.19 (m, 1H), 3.94-3.87 (m, 2H), 3.73-3.65 (m, 1H), 3.60-3.47 (m, 3H), 3.35 (s, 3H), 2.50 (s, 3H), 2.16-2.09 (m, 1H), 2.03-1.95 (m, 1H), 1.66 (dt, J=4.5, 13.2 Hz, 1H), 1.54 (dt, J=4.5, 13.1 Hz, 1H), 1.10 (m, 6H). MS (APCI/ESI) m/z: [M+H]+ Found 589.2.
-
- The title compound was synthesized in a manner analogous to Example 41 using 1-((S)-1-(2-((S*)-1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 47) in place of 1-((S)-1-(2-((S)-1-amino-4,4,4-trifluoro-3,3-dimethylbutyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one to provide the title compound as a white solid (39% yield). 1H NMR (600 MHz, DMSO-d6) δ 9.54 (d, J=8.6 Hz, 1H), 8.39-8.36 (m, 1H), 8.19 (s, 1H), 7.96-7.92 (m, 1H), 6.95 (br s, 1H), 5.58 (t, J=6.9 Hz, 1H), 5.26-5.19 (m, 1H), 3.93-3.85 (m, 2H), 3.73-3.63 (m, 1H), 3.58-3.45 (m, 3H), 3.34 (s, 3H), 2.37-2.29 (m, 1H), 2.15-2.07 (m, 1H), 2.03-1.94 (m, 1H), 1.68-1.62 (m, 1H), 1.57-1.50 (m, 1H), 1.15-1.12 (m, 2H), 1.09 (s, 3H), 1.09 (s, 3H), 1.00-0.96 (m, 2H). MS (APCI/ESI) m/z: [M+H]+ Found 614.8.
-
- Step A. tert-Butyl ((S)-(7-((R)-cyclopropyl((2-(1-(1,3-dioxoisoindolin-2-yl)cyclopropyl)ethyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. To a mixture of 2-(1-(1,3-dioxoisoindolin-2-yl)cyclopropyl)acetaldehyde (342 mg, 1.49 mmol, Intermediate 49), tert-butyl ((S)-(7-((R)-amino(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (500 mg, 1.15 mmol), tetraethoxytitanium (524 mg, 2.3 mmol) and anhydrous MeOH (10 mL) was added NaBH3CN (361 mg, 5.74 mmol) and the resulting mixture was stirred at rt for 1 h. The mixture was then diluted with water (20 mL) and extracted with EtOAc (3×50 mL). The organic layers were combined, washed with water (2×50 mL) and brine (50 mL), dried over anhydrous Na2SO4, filtered, and concentrated to dryness to give a light-yellow oil. The oil was purified by silica gel chromatography (0-80% EtOAc/petroleum ether) to provide the title compound as a light-yellow oil (30% yield).
- Step B. tert-Butyl ((S)-(7-((R)-((2-(1-aminocyclopropyl)ethyl)amino)(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. A mixture of tert-butyl ((S)-(7-((R)-cyclopropyl((2-(1-(1,3-dioxoisoindolin-2-yl)cyclopropyl)ethyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (450 mg, 0.69 mmol, Step A), hydrazine monohydrate (366 mg, 6.94 mmol) and anhydrous MeOH (5 mL) was stirred at rt for 1 h. The mixture was then filtered and concentrated to dryness to give a light-yellow oil. The oil was purified by silica gel chromatography (0-10% MeOH/DCM) to provide the title compound as a light-yellow oil (83% yield).
- Step C. tert-Butyl ((S)-(7-((R)-cyclopropyl(5-oxo-4,6-diazaspiro[2.5]octan-6-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. A mixture of tert-butyl ((S)-(7-((R)-((2-(1-aminocyclopropyl)ethyl)amino)(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (300 mg, 0.58 mmol, Step B), CDI (281 mg, 1.74 mmol) and anhydrous THE (2 mL) was heated at 65° C. for 2 h. After that time, the mixture was diluted with water (50 mL) and extracted with EtOAc (2×50 mL). The combined organic layers were washed with water (2×50 mL) and brine (50 mL), dried over anhydrous Na2SO4, filtered, and concentrated to dryness to give a light-yellow oil. The oil was purified by silica gel chromatography (0-80% EtOAc/petroleum ether) to provide the title compound as a light-yellow oil (63% yield).
- Step D. 6-((R)-(2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)(cyclopropyl)methyl)-4,6-diazaspiro[2.5]octan-5-one hydrochloride. A mixture of tert-butyl ((S)-(7-((R)-cyclopropyl(5-oxo-4,6-diazaspiro[2.5]octan-6-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (200 mg, 0.37 mmol, Step C) and 4 M HCl in 1,4-dioxane (0.73 mL, 2.94 mmol) was stirred at rt for 90 min. After that time, the mixture was concentrated to dryness and lyophilized to provide the title compound as a yellow oil (86% yield).
- Step E. N—[(S)-[7-[(R)-Cyclopropyl-(7-oxo-6,8-diazaspiro[2.5]octan-6-yl)methyl]imidazo[1,2-b]pyridazin-2-yl]-(4,4-difluorocyclohexyl)methyl]-4-methyl-1,2,5-oxadiazole-3-carboxamide. A mixture of 6-((R)-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)(cyclopropyl)methyl)-4,6-diazaspiro[2.5]octan-5-one hydrochloride (140 mg, 0.31 mmol, Step D), 2,5-dioxopyrrolidin-1-yl 4-methyl-1,2,5-oxadiazole-3-carboxylate (106 mg, 0.47 mmol), TEA (0.22 mL, 1.57 mmol) and anhydrous DCM (2 mL) was stirred at rt for 6 h. The mixture was diluted with water (30 mL) and extracted with EtOAc (2×30 mL). The organic layers were combined, washed with water (2×50 mL) and brine (50 mL), dried over anhydrous Na2SO4, filtered, and concentrated to dryness to give a light-yellow oil. The oil was purified by silica gel chromatography (0-70% EtOAc/petroleum ether) and lyophilized to provide the title compound as a white solid (13% yield). 1H NMR (400 MHz, DMSO-d6) δ 9.41 (d, J=9.2 Hz, 1H), 8.35 (d, J=2.0 Hz, 1H), 8.23 (s, 1H), 8.00 (s, 1H), 6.58 (s, 1H), 5.16 (s, 1H), 4.67 (d, J=9.6 Hz, 1H), 3.15-3.05 (m, 1H), 2.46 (s, 3H), 2.22-2.13 (m, 1H), 2.11-1.86 (m, 4H), 1.84-1.67 (m, 3H), 1.65-1.48 (m, 3H), 1.41-1.31 (m, 1H), 1.30-1.25 (m, 1H), 0.83-0.77 (m, 1H), 0.73-0.67 (m, 1H), 0.67-0.59 (m, 2H), 0.57-0.50 (m, 2H), 0.49-0.42 (m, 1H), 0.41-0.31 (m, 1H). MS (ESI) m/z: [M+H]+ Found 555.0.
-
-
- Step A. tert-Butyl ((1S)-(7-((1R)-cyclopropyl((3-(1,3-dioxoisoindolin-2-yl)-4,4,4-trifluorobutyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. A mixture of 3-(1,3-dioxoisoindolin-2-yl)-4,4,4-trifluorobutanal (330 mg, 1.22 mmol, Intermediate 50), tert-butyl ((S)-(7-((R)-amino(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (407 mg, 0.93 mmol), Ti(OiPr)4 (532 mg, 1.87 mmol) and anhydrous MeOH (8 mL) was stirred at rt for 1 h, followed by the addition of NaBH3CN (294 mg, 4.68 mmol). The resulting mixture was stirred at rt for 12 h. After that time, water (2 mL) was added and the mixture was extracted with EtOAc (2×40 mL). The organic layers were combined, washed with brine (30 mL), dried over anhydrous Na2SO4, filtered, and concentrated to dryness to give a yellow oil that was used without further purification (71% yield).
- Step B. tert-Butyl ((1S)-(7-((1R)-((3-amino-4,4,4-trifluorobutyl)amino)(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound was prepared in a manner analogous to Intermediate 10 Step B using tert-butyl ((1S)-(7-((1R)-cyclopropyl((3-(1,3-dioxoisoindolin-2-yl)-4,4,4-trifluorobutyl)amino)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate in place of tert-butyl ((R)-1-(7-((S*)-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate, and the mixture was heated at 70° C. for 4 h instead of 50° C. for 2 h. The yellow oil obtained was purified by preparative HPLC (Phenomenex C18, 3 μm, 30×75 mm, 43-73% MeCN/water (NH4OH+NH4HCO3)) followed by lyophilization to provide the title compound as a yellow oil (53% yield).
- Step C. tert-Butyl ((1S)-(7-((1R)-cyclopropyl(2-oxo-4-(trifluoromethyl)tetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. A stirred solution of tert-butyl ((1S)-(7-((1R)-((3-amino-4,4,4-trifluorobutyl)amino)(cyclopropyl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (260 mg, 0.46 mmol, Step B) and DIPEA (0.48 mL, 2.78 mmol) in CH2Cl2 (5 mL) was cooled to 0° C., then triphosgene (100 mg, 0.34 mmol) was added. The resulting mixture was stirred for 30 min at 0° C. then quenched with saturated aqueous NaHCO3 (10 mL) and extracted with DCM (2×10 mL). The organic layers were combined, dried over anhydrous Na2SO4, filtered, and concentrated to dryness to afford a yellow oil. The oil was purified by silica gel chromatography (10-12% MeOH/DCM) to provide the title compound as a yellow oil (92% yield).
- Step D. 1-((R)-(2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)(cyclopropyl)methyl)-4-(trifluoromethyl)tetrahydropyrimidin-2(1H)-one. A mixture of tert-butyl ((1S)-(7-((1R)-cyclopropyl(2-oxo-4-(trifluoromethyl)tetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (240 mg, 0.41 mmol, Step C) and 4 M HCl in 1,4-dioxane (3 mL, 12 mmol) was stirred at rt for 60 min. After that time, the pH of the mixture was adjusted by the addition of saturated aqueous NaHCO3 (20 mL), and then extracted with EtOAc (3×30 mL). The organic layers were combined, washed with brine (20 mL), dried over anhydrous Na2SO4, filtered, and concentrated to dryness to provide the title compound as a yellow oil, which was used without further purification (100% yield).
- Step E. N-((1S)-(7-((1R)-Cyclopropyl(2-oxo-4-(trifluoromethyl)tetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)-4-methyl-1,2,5-oxadiazole-3-carboxamide. A mixture of 1-((R)-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)(cyclopropyl)methyl)-4-(trifluoromethyl)tetrahydropyrimidin-2(1H)-one (150 mg, 0.31 mmol, Step D), 2,5-dioxopyrrolidin-1-yl 4-methyl-1,2,5-oxadiazole-3-carboxylate (139 mg, 0.62 mmol), TEA (0.21 mL, 1.54 mmol) and anhydrous DCM (3 mL) was stirred at rt for 1 h. After that time, the reaction mixture was concentrated to dryness and the resulting oil purified by silica gel chromatography (5-9% MeOH/DCM) to provide two diastereomers of the title compound as a yellow oil (92% yield).
- Step F. N—((S)-(7-((R)-Cyclopropyl((S*)-2-oxo-4-(trifluoromethyl)tetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)-4-methyl-1,2,5-oxadiazole-3-carboxamide. The two diastereomers of N-((1S)-(7-((1R)-cyclopropyl(2-oxo-4-(trifluoromethyl)tetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)-4-methyl-1,2,5-oxadiazole-3-carboxamide, from Step E, were separated by chiral SFC (DAICEL CHIRALCEL OD column, 10 μm, 250×30 mm; 35% (v/v) EtOH (containing 0.1% aqueous NH3)/CO2). The first eluting isomer was designated as the (S*) isomer (Example 48) and the second eluting isomer was designated as the (R*) isomer (Example 49). The first eluting isomer, N—((S)-(7-((R)-cyclopropyl((S*)-2-oxo-4-(trifluoromethyl)tetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)-4-methyl-1,2,5-oxadiazole-3-carboxamide, (Example 48, 32% yield) was isolated as a white solid after lyophilization. Example 48: 1H NMR (400 MHz, DMSO-d6) δ 9.42 (d, J=8.8 Hz, 1H), 8.31-8.27 (m, 1H), 8.24 (s, 1H), 8.00 (s, 1H), 7.24 (d, J=3.2 Hz, 1H), 5.19-5.14 (m, 1H), 4.65-4.61 (m, 1H), 4.10 (s, 1H), 3.49-3.41 (m, 2H), 3.09-3.00 (m, 1H), 2.47 (s, 3H), 2.35-2.28 (m, 1H), 2.13-1.87 (m, 4H), 1.86-1.71 (m, 2H), 1.65-1.53 (m, 2H), 1.39-1.24 (m, 2H), 0.82-0.73 (m, 1H), 0.65-0.56 (m, 1H), 0.50-0.44 (m, 1H), 0.43-0.34 (m, 1H). MS (ESI) m/z: [M+H]+ Found 597.3.
- The second eluting isomer, N—((S)-(7-((R)-cyclopropyl((R*)-2-oxo-4-(trifluoromethyl)tetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)-4-methyl-1,2,5-oxadiazole-3-carboxamide, (Example 49, 26% yield) was isolated as a white solid after lyophilization. Example 49: 1H NMR (400 MHz, DMSO-d6) δ 9.42 (d, J=9.2 Hz, 1H), 8.38-8.34 (m, 1H), 8.24 (s, 1H), 8.02 (s, 1H), 7.26 (d, J=4.4 Hz, 1H), 5.20-5.12 (m, 1H), 4.68-4.61 (m, 1H), 4.06 (s, 1H), 3.52-3.43 (m, 2H), 3.18-3.06 (m, 1H), 2.47 (s, 3H), 2.31-2.24 (m, 1H), 2.12-1.90 (m, 4H), 1.87-1.68 (m, 2H), 1.66-1.44 (m, 2H), 1.41-1.21 (m, 2H), 0.85-0.77 (m, 1H), 0.65-0.56 (m, 1H), 0.53-0.49 (m, 1H), 0.35-0.21 (m, 1H). MS (ESI) m/z: [M+H]+ Found 597.3.
-
- The title compound was synthesized in a manner analogous to Example 16 using (S)-1-(7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-4,4,4-trifluoro-3,3-dimethylbutan-1-aminium trifluoroacetate (Intermediate 43) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. The material was purified by preparative HPLC (XBridge Prep C18, 5 μm, 30×100 mm; 10-100% MeCN/water (20 mM NH4OH)) to afford the title compound as an amorphous solid in 31% yield. 1H NMR (500 MHz, DMSO-d6) δ 9.70 (d, J=8.7 Hz, 1H), 8.36 (d, J=2.1 Hz, 1H), 8.26-8.13 (m, 1H), 8.02-7.91 (m, 1H), 7.04-6.80 (m, 1H), 5.65-5.51 (m, 1H), 5.50-5.38 (m, 1H), 4.06-3.93 (m, 2H), 3.73-3.61 (m, 1H), 3.59-3.46 (m, 3H), 3.44-3.38 (m, 1H), 2.50 (s, 3H), 2.40 (dd, J=14.7, 3.4 Hz, 1H), 2.27 (dd, J=14.7, 9.5 Hz, 1H), 1.20 (s, 3H), 1.19 (s, 3H), 0.59-0.44 (m, 4H). MS (ESI) m/z: [M+H]+ Found 601.3.
-
- The title compound was synthesized in a manner analogous to Example 16 using 2,5-dioxopyrrolidin-1-yl 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylate (Intermediate 31) in place of 2,5-dioxopyrrolidin-1-yl 4-methyl-1,2,5-oxadiazole-3-carboxylate and (S*)-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)((1R,5S,6r)-3,3-difluorobicyclo[3.1.0]hexan-6-yl)methanaminium 2,2,2-trifluoroacetate (Intermediate 51) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. The material was purified by preparative HPLC (XBridge Prep C18, 5 μm, 30×100 mm; 10-100% MeCN/water (20 mM NH4OH)) to afford the title compound as an amorphous solid in 65% yield. 1H NMR (600 MHz, DMSO-d6) δ 9.70 (d, J=8.2 Hz, 1H), 8.37 (d, J=2.1 Hz, 1H), 8.27-8.15 (m, 1H), 8.03-7.85 (m, 1H), 6.95 (s, 1H), 5.58 (t, J=6.8 Hz, 1H), 4.72 (t, J=8.7 Hz, 1H), 3.94-3.83 (m, 2H), 3.75-3.62 (m, 1H), 3.60-3.46 (m, 3H), 3.34 (s, 3H), 2.47-2.31 (m, 3H), 2.23-2.11 (m, 2H), 1.66-1.56 (m, 2H), 1.47-1.39 (m, 1H), 1.17-1.10 (m, 2H), 1.03-0.95 (m, 2H). MS (ESI) m/z: [M+H]+ Found 593.3.
-
- The title compound was synthesized in a manner analogous to Example 16 using 2,5-dioxopyrrolidin-1-yl 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylate (Intermediate 31) in place of 2,5-dioxopyrrolidin-1-yl 4-methyl-1,2,5-oxadiazole-3-carboxylate and (R*)-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)((R*)-3,3-difluorocyclopentyl)methanaminium 2,2,2-trifluoroacetate (Intermediate 54) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. The material was purified by preparative HPLC (XBridge Prep C18, 5 μm, 30×100 mm; 10-100% MeCN/water (20 mM NH4OH)) to afford the title compound as an amorphous solid in 42% yield. 1H NMR (600 MHz, DMSO-d6) δ 9.58 (d, J=8.7 Hz, 1H), 8.38 (d, J=2.1 Hz, 1H), 8.25 (s, 1H), 7.97-7.83 (m, 1H), 6.97-6.89 (m, 1H), 5.57 (t, J=6.8 Hz, 1H), 5.24 (t, J=8.9 Hz, 1H), 3.95-3.83 (m, 2H), 3.75-3.63 (m, 1H), 3.61-3.46 (m, 3H), 3.34 (s, 3H), 2.98-2.88 (m, 1H), 2.37-2.27 (m, 2H), 2.21-1.98 (m, 3H), 1.78-1.68 (m, 1H), 1.66-1.55 (m, 1H), 1.16-1.09 (m, 2H), 1.01-0.92 (m, 2H). MS (ESI) m/z: [M+H]+ Found 581.3.
-
- The title compound was synthesized in a manner analogous to Example 16 using (1R,2R)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(((R)-1,1,1-trifluoropropan-2-yl)oxy)propan-1-aminium trifluoroacetate (Intermediate 41) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. The material was purified by preparative HPLC (XBridge Prep C18, 5 μm, 30×100 mm; 10-100% MeCN/water (20 mM NH4OH)) to afford the title compound as an amorphous solid in 48% yield. 1H NMR (600 MHz, DMSO-d6) δ 9.34 (d, J=9.2 Hz, 1H), 8.39 (d, J=2.1 Hz, 1H), 8.26 (s, 1H), 7.99-7.84 (m, 1H), 7.03-6.90 (m, 1H), 5.57 (t, J=6.8 Hz, 1H), 5.27 (dd, J=9.1, 7.0 Hz, 1H), 4.35-4.22 (m, 2H), 3.96-3.83 (m, 2H), 3.77-3.65 (m, 1H), 3.64-3.45 (m, 3H), 3.34 (s, 3H), 2.48 (s, 3H), 1.11 (d, J=6.3 Hz, 3H), 1.09 (d, J=6.5 Hz, 3H). MS (ESI) m/z: [M+H]+ Found 591.2.
-
-
- The title compounds were synthesized in a manner analogous to Example 16 using 2,5-dioxopyrrolidin-1-yl 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylate (Intermediate 31) in place of 2,5-dioxopyrrolidin-1-yl 4-methyl-1,2,5-oxadiazole-3-carboxylate and 1-((1S)-1-(2-((1R*)-1-amino-2-cyclopropoxypropyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 57) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. The material was purified by silica gel chromatography (0-100% (10% MeOH) EtOAc/hexanes) to afford two diastereomers (Example 54 and Example 55). These diastereomers were separated by chiral SFC (Stationary phase: Lux Cellulose 1, 5 μm, 250×21 mm, Mobile phase: 25% IPA (0.2% i-PrNH2), 75% CO2) to afford Example 54 (18% yield) as the first eluting compound and Example 55 (14% yield) as the second eluting compound. Example 54: 1H NMR (600 MHz, DMSO-d6) δ 9.23 (d, J=9.0 Hz, 1H), 8.39 (d, J=2.1 Hz, 1H), 8.20 (s, 1H), 7.93 (dt, J=2.0, 0.9 Hz, 1H), 6.95 (s, 1H), 5.57 (t, J=6.8 Hz, 1H), 5.27 (dd, J=9.0, 6.0 Hz, 1H), 4.13 (p, J=6.3 Hz, 1H), 3.96-3.86 (m, 2H), 3.74-3.65 (m, 1H), 3.60-3.45 (m, 3H), 3.39-3.33 (m, 1H), 3.34 (s, 3H), 2.28 (tt, J=8.4, 5.0 Hz, 1H), 1.19-1.12 (m, 5H), 1.03-0.93 (m, 2H), 0.48-0.41 (m, 2H), 0.41-0.30 (m, 2H). MS (ESI) m/z: [M+H]+ Found 561.3. Example 55: 1H NMR (600 MHz, DMSO-d6) δ 9.32 (d, J=9.2 Hz, 1H), 8.38 (d, J=2.1 Hz, 1H), 8.19 (s, 1H), 7.95-7.92 (m, 1H), 6.95 (s, 1H), 5.58 (t, J=6.8 Hz, 1H), 5.50 (dd, J=9.2, 5.2 Hz, 1H), 4.18-4.10 (m, 1H), 3.96-3.86 (m, 2H), 3.69 (ddd, J=19.5, 12.6, 7.1 Hz, 1H), 3.57-3.45 (m, 3H), 3.42 (tt, J=6.0, 3.2 Hz, 1H), 3.34 (s, 3H), 2.29 (tt, J=8.4, 5.0 Hz, 1H), 1.17-1.12 (m, 5H), 0.99 (dd, J=5.0, 2.5 Hz, 2H), 0.51-0.36 (m, 4H). MS (ESI) m/z: [M+H]+ Found 561.3.
-
- The title compound was synthesized in a manner analogous to Example 16 using (S)-1-(7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentan-1-aminium 2,2,2-trifluoroacetate (Intermediate 58) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. The material was purified by preparative HPLC (XBridge Prep C18, 5 μm, 30×100 mm; 10-100% MeCN/water (20 mM NH4OH)) to afford the title compound as an amorphous solid in 64% yield. 1H NMR (500 MHz, DMSO-d6) δ 9.50 (d, J=8.5 Hz, 1H), 8.36 (d, J=2.1 Hz, 1H), 8.19 (s, 1H), 8.01-7.83 (m, 1H), 6.94 (s, 1H), 5.56 (t, J=6.9 Hz, 1H), 5.31-5.10 (m, 1H), 4.11-3.92 (m, 2H), 3.73-3.59 (m, 1H), 3.59-3.45 (m, 3H), 3.44-3.36 (m, 1H), 2.49 (s, 3H), 2.16-2.07 (m, 1H), 2.03-1.94 (m, 1H), 1.69-1.60 (m, 1H), 1.58-1.48 (m, 1H), 1.09 (s, 6H), 0.58-0.41 (m, 4H). MS (ESI) m/z: [M+H]+ Found 615.3.
-
- The title compound (23% yield) was synthesized in a manner analogous to Example 16 using 1-((S*)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclobutoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 61) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. 1H NMR (500 MHz, DMSO-d6) δ 9.41 (d, J=9.0 Hz, 1H), 8.38 (d, J=2.1 Hz, 1H), 8.24 (s, 1H), 7.98-7.90 (m, 1H), 6.97-6.90 (m, 1H), 5.54-5.46 (m, 1H), 5.21-5.14 (m, 1H), 4.06-3.97 (m, 1H), 3.92-3.85 (m, 1H), 3.84-3.78 (m, 1H), 3.76-3.66 (m, 1H), 3.62-3.44 (m, 3H), 2.47 (s, 3H), 2.25-2.12 (m, 3H), 2.11-1.94 (m, 2H), 1.93-1.70 (m, 5H), 1.67-1.58 (m, 2H), 1.52-1.33 (m, 2H), 1.33-1.23 (m, 1H). MS (ESI) m/z: [M+H]+ Found 609.3.
-
- The title compound (23% yield) was synthesized in a manner analogous to Example 16, using 1-((S*)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-isopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 62) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. 1H NMR (500 MHz, DMSO-d6) δ 9.41 (d, J=9.0 Hz, 1H), 8.38 (d, J=2.1 Hz, 1H), 8.24 (s, 1H), 7.98-7.90 (m, 1H), 6.97-6.90 (m, 1H), 5.54-5.46 (m, 1H), 5.21-5.14 (m, 1H), 4.06-3.97 (m, 1H), 3.92-3.85 (m, 1H), 3.84-3.78 (m, 1H), 3.76-3.66 (m, 1H), 3.62-3.44 (m, 3H), 2.47 (s, 3H), 2.25-2.12 (m, 3H), 2.11-1.94 (m, 2H), 1.93-1.70 (m, 5H), 1.67-1.58 (m, 2H), 1.52-1.33 (m, 2H), 1.33-1.23 (m, 1H). MS (ESI) m/z: [M+H]+ Found 597.3.
-
- To a solution of 1-((R*)-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)(tetrahydro-2H-pyran-4-yl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (45 mg, 0.09 mmol, Intermediate 63) and 2,5-dioxopyrrolidin-1-yl 4-methyl-1,2,5-oxadiazole-3-carboxylate (24 mg, 0.11 mmol) in MeCN (1 mL) was added DIPEA (0.037 mL, 0.22 mmol). The reaction was stirred at rt for 20 min then diluted with saturated aqueous NaHCO3. The mixture was extracted three times with EtOAc. The combined organics were concentrated under reduced pressure and purification by silica gel chromatography (20-100% (10% MeOH in EtOAc)/(0.1% TEA in hexanes)) afforded the title compound in 61% yield. 1H NMR (500 MHz, DMSO-d6) δ 9.40 (d, J=9.0 Hz, 1H), 8.41 (d, J=2.0 Hz, 1H), 8.25 (s, 1H), 8.08 (d, J=1.9 Hz, 1H), 6.87-6.81 (m, 1H), 5.21-5.13 (m, 2H), 3.97-3.89 (m, 1H), 3.81-3.73 (m, 1H), 3.73-3.63 (m, 1H), 3.47-3.38 (m, 2H), 3.38-3.32 (m, 2H), 3.30-3.27 (m, 1H), 2.62-2.53 (m, 1H), 2.47 (s, 3H), 2.25-2.13 (m, 1H), 2.10-1.95 (m, 2H), 1.95-1.88 (m, 1H), 1.86-1.67 (m, 3H), 1.66-1.56 (m, 1H), 1.44-1.33 (m, 1H), 1.33-1.21 (m, 3H), 1.20-1.09 (m, 1H). MS (ESI) m/z: [M+H]+ Found 609.3.
-
-
- The title compounds were synthesized in a manner analogous to Example 16 using 1-((1S)-1-(2-((1R*)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)propyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 65) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. The reaction mixture was concentrated to dryness to afford two diastereomers (Example 60 and Example 61). Purification and separation of the two diastereomers was performed via chiral SFC (Stationary phase: Chiralpak IC 5 μm, 250×21 mm, Mobile phase: 20% MeOH, 80% CO2) to afford Example 60 as the first eluting compound (10% yield) and Example 61 as the second eluting compound (17% yield). Example 60: 1H NMR (400 MHz, DMSO-d6) δ 9.05-9.00 (m, 1H), 8.41-8.38 (m, 1H), 8.27-8.25 (m, 1H), 7.97-7.94 (m, 1H), 6.98-6.94 (m, 1H), 5.61-5.56 (m, 1H), 5.31-5.25 (m, 1H), 4.42-4.35 (m, 1H), 3.93-3.88 (m, 2H), 3.76-3.65 (m, 1H), 3.59-3.47 (m, 3H), 3.34-3.34 (m, 2H), 3.29-3.28 (m, 2H), 3.13-3.08 (m, 1H), 1.34-1.31 (m, 3H), 1.27-1.23 (m, 3H), 1.20-1.17 (m, 1H), 1.11-1.08 (m, 3H). MS (ESI) m/z: [M+H]+ Found 604.9. Example 61: 1H NMR (400 MHz, DMSO-d6) δ 9.32-9.29 (m, 1H), 8.37-8.36 (m, 1H), 8.22-8.21 (m, 1H), 7.95-7.94 (m, 1H), 6.96-6.93 (m, 1H), 5.59-5.55 (m, 1H), 5.44-5.40 (m, 1H), 4.49-4.45 (m, 1H), 3.92-3.88 (m, 2H), 3.74-3.64 (m, 1H), 3.59-3.46 (m, 4H), 3.34-3.33 (m, 3H), 3.28-3.27 (m, 1H), 1.36-1.35 (m, 3H), 1.24-1.23 (m, 3H), 1.12-1.10 (m, 3H), 0.94-0.93 (m, 1H). MS (ESI) m/z: [M+H]+ Found 605.2.
-
- The title compound (19% yield) was synthesized in a manner analogous to Example 16 using 1-((R)-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)(cyclopropyl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 66) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. 1H NMR (600 MHz, DMSO-d6) δ 9.41 (d, J=8.6 Hz, 1H), 8.39-8.36 (m, 1H), 8.21 (s, 1H), 8.06-8.02 (m, 1H), 6.90 (br s, 1H), 5.40 (dt, J=4.9, 8.4 Hz, 1H), 4.60 (d, J=10.3 Hz, 1H), 4.06-4.00 (m, 1H), 3.98-3.92 (m, 1H), 3.87-3.78 (m, 1H), 3.62-3.50 (m, 4H), 1.57-1.47 (m, 1H), 1.36 (s, 4H), 1.35 (s, 4H), 0.82-0.76 (m, 1H), 0.67-0.60 (m, 1H), 0.56-0.48 (m, 1H), 0.42-0.34 (m, 1H). MS (APCI/ESI) m/z: [M+H]+ Found 587.2.
-
- The title compound (16% yield) was synthesized in a manner analogous to Example 16 using 1-((R)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)ethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 67) in place of 1-((S)-1-(2-((S*)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride and 2,5-dioxopyrrolidin-1-yl 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylate (Intermediate 31) in place of 2,5-dioxopyrrolidin-1-yl 4-methyl-1,2,5-oxadiazole-3-carboxylate). 1H NMR (600 MHz, DMSO-d6) δ 9.46 (d, J=9.0 Hz, 1H), 8.35 (d, J=2.1 Hz, 1H), 8.22 (s, 1H), 7.91 (s, 1H), 6.91 (br s, 1H), 5.60 (q, J=6.9 Hz, 1H), 5.19 (t, J=8.6 Hz, 1H), 3.70-3.61 (m, 1H), 3.57-3.43 (m, 2H), 3.38-3.32 (m, 1H), 2.31-2.24 (m, 1H), 2.23-2.13 (m, 1H), 2.11-1.96 (m, 2H), 1.90 (d, J=12.2 Hz, 1H), 1.84-1.71 (m, 2H), 1.63 (d, J=13.2 Hz, 1H), 1.51 (d, J=7.1 Hz, 3H), 1.42-1.35 (m, 1H), 1.33-1.25 (m, 1H), 1.15-1.09 (m, 2H), 0.99-0.93 (m, 2H). MS (APCI/ESI) m/z: [M+H]+ Found 565.2.
-
- The title compound (47% yield) was synthesized in a manner analogous to Example 16 using 1-((S)-1-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 68) in place of 1-((S)-1-(2-((S*)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride and 2,5-dioxopyrrolidin-1-yl 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylate (Intermediate 31) in place of 2,5-dioxopyrrolidin-1-yl 4-methyl-1,2,5-oxadiazole-3-carboxylate). 1H NMR (600 MHz, DMSO-d6) δ 9.48 (d, J=8.6 Hz, 1H), 8.38 (d, J=2.1 Hz, 1H), 8.22 (s, 1H), 7.96-7.93 (m, 1H), 6.95 (br s, 1H), 5.58 (t, J=6.8 Hz, 1H), 5.44-5.39 (m, 1H), 4.04-4.00 (m, 1H), 3.94 (t, J=9.1 Hz, 1H), 3.92-3.86 (m, 2H), 3.74-3.64 (m, 1H), 3.59-3.45 (m, 3H), 3.34 (s, 3H), 2.39-2.33 (m, 1H), 1.35 (s, 3H), 1.34 (s, 3H), 1.17-1.12 (m, 2H), 1.02-0.97 (m, 2H). MS (APCI/ESI) m/z: [M+H]+ Found 617.2.
-
- The title compound (56% yield) was synthesized in a manner analogous to Example 16 using 1-((S)-1-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 68) in place of 1-((S)-1-(2-((S*)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride and 2,5-dioxopyrrolidin-1-yl 1-isopropyl-1H-pyrazole-5-carboxylate (Intermediate 26) in place of 2,5-dioxopyrrolidin-1-yl 4-methyl-1,2,5-oxadiazole-3-carboxylate. 1H NMR (600 MHz, DMSO-d6) δ 8.74 (d, J=8.6 Hz, 1H), 8.37 (d, J=2.1 Hz, 1H), 8.18 (s, 1H), 7.94-7.91 (m, 1H), 7.49 (d, J=1.9 Hz, 1H), 6.95 (br s, 1H), 6.85 (d, J=1.9 Hz, 1H), 5.58 (t, J=6.8 Hz, 1H), 5.44-5.35 (m, 2H), 4.03-3.99 (m, 1H), 3.93-3.86 (m, 3H), 3.73-3.64 (m, 1H), 3.59-3.45 (m, 3H), 3.34 (s, 3H), 1.38-1.36 (m, 6H), 1.35 (s, 3H), 1.34 (s, 3H). MS (APCI/ESI) m/z: [M+H]+ Found 617.2.
-
- The title compound (73% yield) was synthesized in a manner analogous to Example 16 using 1-((S)-1-(2-((S)-1-amino-4,4,4-trifluoro-3,3-dimethylbutyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 44) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. 1H NMR (600 MHz, DMSO-d6) δ 9.69 (d, J=8.8 Hz, 1H), 8.35 (d, J=2.1 Hz, 1H), 8.20 (s, 1H), 7.97-7.95 (m, 1H), 6.95 (br s, 1H), 5.58 (t, J=6.8 Hz, 1H), 5.47-5.42 (m, 1H), 3.93-3.85 (m, 2H), 3.72-3.63 (m, 1H), 3.60-3.45 (m, 3H), 3.34 (s, 3H), 2.50 (s, 3H), 2.43-2.39 (m, 1H), 2.30-2.24 (m, 1H), 1.20 (s, 3H), 1.19 (s, 3H). MS (APCI/ESI) m/z: [M+H]+ Found 575.2.
-
- The title compound (12% yield) was synthesized in a manner analogous to Example 16 using 1-((S)-1-(2-((R)-1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 71) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. 1H NMR (600 MHz, DMSO-d6) δ 9.51 (d, J=8.4 Hz, 1H), 8.37 (d, J=2.3 Hz, 1H), 8.20 (s, 1H), 7.96-7.93 (m, 1H), 6.95 (br s, 1H), 5.58 (t, J=6.8 Hz, 1H), 5.21 (dt, J=5.3, 8.8 Hz, 1H), 3.94-3.86 (m, 2H), 3.74-3.64 (m, 1H), 3.60-3.47 (m, 3H), 3.34 (s, 3H), 2.50 (s, 3H), 2.16-2.06 (m, 1H), 2.03-1.95 (m, 1H), 1.66 (dt, J=4.4, 13.2 Hz, 1H), 1.54 (dt, J=4.4, 13.1 Hz, 1H), 1.10 (s, 6H). MS (APCI/ESI) m/z: [M+H]+ Found 589.3.
-
- Step A: N—((S*)-1-(7-((S)-1-(5,5-Difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-4,4-difluoro-3,3-dimethylpentyl)-2,4,6-trimethylbenzenesulfinamide. A mixture of (S)—N-((E)-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methylene)-2,4,6-trimethylbenzenesulfinamide (192 mg, 381 mmol, Intermediate 56), 1,3-dioxoisoindolin-2-yl 4,4-difluoro-3,3-dimethylpentanoate (474 mg, 1.52 mmol, Intermediate 72), zinc powder (149 mg, 2.3 mmol) and nickel (II) chloride ethylene glycol dimethyl ether complex (42 mg, 0.19 mmol) was sparged with N2 and then DMF (1.1 mL) was added. The resulting mixture was heated at 40° C. for 8 h, then partitioned between brine (20 mL), saturated aqueous NaHCO3 (15 mL) and EtOAc (20 mL). The aqueous layer was further extracted with EtOAc (4×20 mL). The organic layers were combined, dried over anhydrous Na2SO4, filtered through diatomaceous earth (e.g., Celite®), and the filtrate was concentrated to dryness. The residue was purified by silica gel chromatography (0-50% (25% EtOH in EtOAc)/EtOAc) to provide the title compound in 5% yield.
- Step B: 1-((S)-1-(2-((S*)-1-Amino-4,4-difluoro-3,3-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. To a solution of N—((S*)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-4,4-difluoro-3,3-dimethylpentyl)-2,4,6-trimethylbenzenesulfinamide (12.8 mg, 0.02 mmol, Step A) in 1,4-dioxane (3 mL) and MeOH (1 mL) was added HCl (0.1 mL, 0.41 mmol, 4 M in 1,4-dioxane) and the resulting mixture was heated at 55° C. for 75 min. The reaction was cooled to rt and concentrated to dryness. The residue was partitioned between water (4 mL) and hexanes (4 mL). The aqueous layer was then diluted with saturated aqueous NaHCO3 (10 mL) and brine (10 mL) and extracted with DCM (4×4 mL). The DCM layers were combined, dried over anhydrous Na2SO4, filtered, and concentrated to dryness to provide the title compound (100% yield) that was used without further purification.
- Step C: 4-Cyclopropyl-N—((S*)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-4,4-difluoro-3,3-dimethylpentyl)-1,2,5-oxadiazole-3-carboxamide. The title compound (22% yield) was synthesized in a manner analogous to Example 16 using 1-((S)-1-(2-((S*)-1-amino-4,4-difluoro-3,3-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Step B) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride and 2,5-dioxopyrrolidin-1-yl 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylate (Intermediate 31) in place of 2,5-dioxopyrrolidin-1-yl 4-methyl-1,2,5-oxadiazole-3-carboxylate. 1H NMR (600 MHz, DMSO-d6) δ 9.66 (d, J=8.6 Hz, 1H), 8.39-8.35 (m, 1H), 8.18 (s, 1H), 7.96 (d, J=1.0 Hz, 1H), 6.95 (s, 1H), 5.58 (t, J=6.8 Hz, 1H), 5.44 (dt, J=3.3, 8.9 Hz, 1H), 3.93-3.85 (m, 3H), 3.71-3.64 (m, 1H), 3.53-3.46 (m, 2H), 3.34 (s, 3H), 2.38-2.32 (m, 1H), 2.29-2.24 (m, 1H), 2.16 (dd, J=9.3, 14.6 Hz, 1H), 1.61 (t, J(H-F)=19.6 Hz, 3H), 1.16-1.12 (m, 2H), 1.08 (s, 3H), 1.08 (s, 3H), 1.03-0.94 (m, 2H). MS (APCI/ESI) m/z: [M+H]+ Found 597.3.
-
- The title compound (57% yield) was synthesized in a manner analogous to Example 18 using 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 (Intermediate 30) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 4-methoxy-1,2,5-oxadiazole-3-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid. 1H NMR (500 MHz, DMSO-d6) δ 9.28 (d, J=9.1 Hz, 1H), 8.39 (d, J=2.1 Hz, 1H), 8.21 (s, 1H), 7.95-7.91 (m, 1H), 6.92 (s, 1H), 5.55 (t, J=6.8 Hz, 1H), 5.16 (t, J=8.4 Hz, 1H), 4.08 (s, 3H), 4.05-3.93 (m, 2H), 3.44-3.38 (m, 1H), 2.20-2.10 (m, 1H), 2.08-1.91 (m, 2H), 1.90-1.68 (m, 3H), 1.60 (d, J=12.5 Hz, 1H), 1.43-1.21 (m, 2H), 0.58-0.43 (m, 4H). MS (APCI/ESI) m/z: [M+H]+ Found 615.3.
-
- The title compound (46% yield) was synthesized in a manner analogous to Example 18 using 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 (Intermediate 30) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 4-ethyl-1,2,5-oxadiazole-3-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid. 1H NMR (500 MHz, DMSO-d6) δ 9.44 (d, J=9.0 Hz, 1H), 8.38 (d, J=2.1 Hz, 1H), 8.24 (s, 1H), 7.95-7.92 (m, 1H), 6.92 (s, 1H), 5.55 (t, J=6.8 Hz, 1H), 5.18 (t, J=8.6 Hz, 1H), 4.04-3.93 (m, 2H), 3.44-3.38 (m, 1H), 2.93-2.86 (m, 2H), 2.23-2.13 (m, 1H), 2.08-1.93 (m, 2H), 1.89 (d, J=12.5 Hz, 1H), 1.85-1.69 (m, 2H), 1.62 (d, J=12.8 Hz, 1H), 1.43-1.25 (m, 2H), 1.22 (t, J=7.5 Hz, 3H), 0.57-0.42 (m, 4H). MS (APCI/ESI) m/z: [M+H]+ Found 613.3.
-
- The title compound (51% yield) was synthesized in a manner analogous to Example 18 using 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 (Intermediate 30) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 1-isopropyl-1H-pyrazole-5-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid. 1H NMR (500 MHz, DMSO-d6) δ 8.71 (d, J=9.1 Hz, 1H), 8.37 (d, J=2.1 Hz, 1H), 8.21 (s, 1H), 7.92-7.90 (m, 1H), 7.48 (d, J=1.9 Hz, 1H), 6.92 (br s, 1H), 6.91 (d, J=2.0 Hz, 1H), 5.55 (t, J=6.8 Hz, 1H), 5.41-5.32 (m, 1H), 5.16 (t, J=8.6 Hz, 1H), 4.04-3.93 (m, 2H), 3.43-3.38 (m, 1H), 2.22-2.13 (m, 1H), 2.08-1.93 (m, 2H), 1.88 (d, J=12.9 Hz, 1H), 1.84-1.68 (m, 2H), 1.62 (d, J=12.4 Hz, 1H), 1.39 (br s, 1H), 1.36 (d, J=6.6 Hz, 3H), 1.33 (d, J=6.6 Hz, 3H), 1.31-1.21 (m, 1H), 0.57-0.42 (m, 4H). MS (APCI/ESI) m/z: [M+H]+ Found 625.3.
-
- Step A: tert-Butyl ((S)-(4,4-difluorocyclohexyl)(7-((S)-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl-1,1,3,3-d4)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate. The title compound was prepared as described in Intermediate 28 Step A using tert-butyl ((S)-(7-((S)-1-amino-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Intermediate 3, Step B) in place of tert-butyl ((R)-1-(7-((S)-1-amino-2-methoxyethyl)-6-chloroimidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate. The reaction was heated at 55° C. for 29 h instead of 60° C. for 48 h, then concentrated to dryness and purified by silica gel chromatography (10-60% acetone/hexanes (with 0.1% TEA)) to provide the title compound in 82% yield.
- Step B: tert-Butyl ((S)-(7-((S)-1-((3-amino-2,2-difluoropropyl-1,1,3,3-d4)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. A flask was charged with tert-butyl ((S)-(4,4-difluorocyclohexyl)(7-((S)-1-((3-(1,3-dioxoisoindolin-2-yl)-2,2-difluoropropyl-1,1,3,3-d4)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)carbamate (967 mg, 1.45 mmol, Step A), ethanol (5.8 mL), and hydrazine monohydrate (0.22 mL, 4.4 mmol), and the resulting mixture stirred at rt for 3.5 h. The reaction mixture was then heated at 35° C. for 2 h. After that time, the mixture was cooled to 0° C., filtered and washed with ice cold EtOH (2×5 mL). The filtrate was concentrated to dryness to provide the title compound in 90% yield.
- Step C: tert-Butyl ((S)-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl-4,4,6,6-d4)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate. The title compound was prepared as described in Intermediate 35 Step E using tert-butyl ((S)-(7-((S)-1-((3-amino-2,2-difluoropropyl-1,1,3,3-d4)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step B) in place of (S)—N1-(1-(6-amino-3-chloropyridazin-4-yl)-2-methoxyethyl)-2,2-difluoropropane-1,3-diamine. The reaction was stirred at rt for 2 h and then heated at 55° C. for 2.5 h instead of rt for 12 h and 60° C. for 6 h. The residue was purified by silica gel chromatography (10-65% acetone/hexanes (with 0.1% TEA)) to provide the title compound in 61% yield.
- Step D: 1-((S)-1-(2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4. The title compound (100% yield) was synthesized in a manner analogous to Intermediate 20 Step C using tert-butyl ((S)-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl-4,4,6,6-d4)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate (Step C) in place of tert-butyl (S)-((7-((5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)carbamate and was used without further purification.
- Step E: 4-Cyclopropyl-N—((S)-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl-4,4,6,6-d4)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)-1,2,5-oxadiazole-3-carboxamide. The title compound (89% yield) was synthesized in a manner analogous to Example 18 using 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 (Step D) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one. 1H NMR (500 MHz, DMSO-d6) δ 9.47 (d, J=9.0 Hz, 1H), 8.38 (d, J=2.1 Hz, 1H), 8.24 (s, 1H), 7.94-7.90 (m, 1H), 6.93 (s, 1H), 5.57 (t, J=6.8 Hz, 1H), 5.19 (t, J=8.5 Hz, 1H), 3.95-3.85 (m, 2H), 3.34 (s, 3H), 2.32-2.25 (m, 1H), 2.23-2.13 (m, 1H), 2.10-1.94 (m, 2H), 1.90 (d, J=12.4 Hz, 1H), 1.86-1.68 (m, 2H), 1.62 (d, J=12.5 Hz, 1H), 1.44-1.34 (m, 1H), 1.34-1.24 (m, 1H), 1.14-1.09 (m, 2H), 0.98-0.94 (m, 2H). MS (APCI/ESI) m/z: [M+H]+ Found 599.3.
-
- The title compound (65% yield) was synthesized in a manner analogous to Example 18 using 1-((S)-1-(2-((S)-1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 (Intermediate 73) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 4-methoxy-1,2,5-oxadiazole-3-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid. 1H NMR (500 MHz, DMSO-d6) δ 9.36 (d, J=8.5 Hz, 1H), 8.37 (d, J=2.0 Hz, 1H), 8.16 (s, 1H), 7.94 (d, J=0.9 Hz, 1H), 6.93 (s, 1H), 5.57 (t, J=6.8 Hz, 1H), 5.21-5.15 (m, 1H), 4.09 (s, 3H), 3.93-3.86 (m, 2H), 3.34 (s, 3H), 2.13-2.04 (m, 1H), 1.99-1.89 (m, 1H), 1.67-1.59 (m, 1H), 1.55-1.47 (m, 1H), 1.08 (s, 6H). MS (APCI/ESI) m/z: [M+H]+ Found 609.3.
-
- The title compound (78% yield) was synthesized in a manner analogous to Example 18 using 1-((S)-1-(2-((S)-1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 (Intermediate 73) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 4-methyl-1,2,5-oxadiazole-3-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid. 1H NMR (500 MHz, DMSO-d6) δ 9.50 (d, J=8.6 Hz, 1H), 8.36 (d, J=2.1 Hz, 1H), 8.19 (s, 1H), 7.94 (s, 1H), 6.93 (s, 1H), 5.57 (t, J=6.8 Hz, 1H), 5.24-5.17 (m, 1H), 3.93-3.85 (m, 2H), 3.34 (s, 3H), 2.49 (s, 3H), 2.16-2.06 (m, 1H), 2.04-1.92 (m, 1H), 1.69-1.61 (m, 1H), 1.57-1.49 (m, 1H), 1.09 (s, 6H). MS (APCI/ESI) m/z: [M+H]+ Found 593.3.
-
- The title compound (69% yield) was synthesized in a manner analogous to Example 18 using 1-((S)-1-(2-((S)-1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 (Intermediate 74) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 4-methoxy-1,2,5-oxadiazole-3-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid. 1H NMR (500 MHz, DMSO-d6) δ 9.37 (d, J=8.5 Hz, 1H), 8.38 (d, J=2.1 Hz, 1H), 8.16 (s, 1H), 7.97-7.93 (m, 1H), 6.92 (s, 1H), 5.56 (t, J=6.9 Hz, 1H), 5.22-5.14 (m, 1H), 4.09 (s, 3H), 4.04-3.95 (m, 2H), 3.44-3.38 (m, 1H), 2.13-2.03 (m, 1H), 1.99-1.89 (m, 1H), 1.68-1.58 (m, 1H), 1.56-1.47 (m, 1H), 1.08 (s, 6H), 0.57-0.42 (m, 4H). MS (APCI/ESI) m/z: [M+H]+ Found 635.3.
-
- The title compound (69% yield) was synthesized in a manner analogous to Example 18 using 1-((S)-1-(2-((S)-1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 (Intermediate 74) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 4-methyl-1,2,5-oxadiazole-3-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid. 1H NMR (500 MHz, DMSO-d6) δ 9.51 (d, J=8.6 Hz, 1H), 8.36 (d, J=2.1 Hz, 1H), 8.19 (s, 1H), 7.97-7.93 (m, 1H), 6.92 (s, 1H), 5.56 (t, J=6.9 Hz, 1H), 5.24-5.17 (m, 1H), 4.04-3.94 (m, 2H), 3.44-3.39 (m, 1H), 2.49 (s, 3H), 2.16-2.07 (m, 1H), 2.03-1.94 (m, 1H), 1.69-1.61 (m, 1H), 1.57-1.49 (m, 1H), 1.09 (s, 6H), 0.58-0.42 (m, 4H). MS (APCI/ESI) m/z: [M+H]+ Found 619.3.
-
- The title compound (79% yield) was synthesized in a manner analogous to Example 18 using 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 16A) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 4-methoxy-1,2,5-oxadiazole-3-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid. 1H NMR (500 MHz, DMSO-d6) δ 9.29 (d, J=9.0 Hz, 1H), 8.38 (d, J=2.1 Hz, 1H), 8.21 (s, 1H), 7.94-7.92 (m, 1H), 6.95 (br s, 1H), 5.56 (t, J=6.9 Hz, 1H), 5.16 (t, J=8.4 Hz, 1H), 4.08 (s, 3H), 4.04-3.94 (m, 2H), 3.73-3.63 (m, 1H), 3.60-3.45 (m, 3H), 3.44-3.38 (m, 1H), 2.20-2.10 (m, 1H), 2.09-1.93 (m, 2H), 1.90-1.69 (m, 3H), 1.60 (d, J=12.9 Hz, 1H), 1.42-1.23 (m, 2H), 0.57-0.42 (m, 4H). MS (APCI/ESI) m/z: [M+H]+ Found 611.3.
-
- To a vial was added 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (52 mg, 0.107 mmol, Intermediate 16A), ethyl 4-(difluoromethyl)-1,2,5-oxadiazole-3-carboxylate (62.0 mg, 0.322 mmol, Intermediate 75), and acetonitrile (0.14 mL). The vial was sparged with nitrogen gas for 1 min, sealed, and heated to 92° C. for 16 h. The reaction mixture was cooled to rt, diluted with DMSO, and purified by preparative HPLC (C18, 5 μm, 50×250 mm, 10-100% MeCN/water (20 mM NH4OH)) to give the title compound as a white solid (35% yield). 1H NMR (500 MHz, DMSO-d6) δ 9.70 (d, J=9.0 Hz, 1H), 8.38 (d, J=2.1 Hz, 1H), 8.24 (s, 1H), 7.95-7.91 (m, 1H), 7.48 (t, J=52.2 Hz, 1H), 6.94 (br s, 1H), 5.55 (t, J=6.9 Hz, 1H), 5.17 (t, J=8.6 Hz, 1H), 4.05-3.94 (m, 2H), 3.73-3.63 (m, 1H), 3.59-3.44 (m, 3H), 3.44-3.38 (m, 1H), 2.25-2.15 (m, 1H), 2.09-1.94 (m, 2H), 1.91 (d, J=13.0 Hz, 1H), 1.85-1.70 (m, 2H), 1.61 (d, J=13.4 Hz, 1H), 1.43-1.34 (m, 1H), 1.33-1.23 (m, 1H), 0.57-0.43 (m, 4H). MS (APCI/ESI) m/z: [M+H]+ Found 631.2.
-
- The title compound (23% yield) was prepared as described for the synthesis of Example 18 using 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 3) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 4-(difluoromethyl)-1,2,5-oxadiazole-3-carboxylic acid (Intermediate 76) in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid. 1H NMR (500 MHz, DMSO-d6) δ 9.70 (d, J=8.9 Hz, 1H), 8.38 (d, J=2.0 Hz, 1H), 8.24 (s, 1H), 7.94-7.90 (m, 1H), 7.48 (t, J=52.1 Hz, 1H), 6.95 (br s, 1H), 5.56 (t, J=6.8 Hz, 1H), 5.17 (t, J=8.6 Hz, 1H), 3.94-3.85 (m, 2H), 3.75-3.63 (m, 1H), 3.60-3.45 (m, 3H), 3.34 (s, 3H), 2.26-2.16 (m, 1H), 2.09-1.86 (m, 3H), 1.85-1.68 (m, 2H), 1.61 (d, J=13.4 Hz, 1H), 1.44-1.24 (m, 2H). MS (APCI/ESI) m/z: [M+H]+ Found 605.2.
-
- The title compound (44% yield) was prepared as described for the synthesis of Example 18 using 1-((S)-1-(2-((S)-1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 (Intermediate 73) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one. 1H NMR (500 MHz, DMSO-d6) δ 9.55 (d, J=8.5 Hz, 1H), 8.37 (d, J=2.1 Hz, 1H), 8.19 (s, 1H), 7.96-7.92 (m, 1H), 6.93 (s, 1H), 5.57 (t, J=6.8 Hz, 1H), 5.26-5.18 (m, 1H), 3.94-3.85 (m, 2H), 3.34 (s, 3H), 2.37-2.30 (m, 1H), 2.16-2.06 (m, 1H), 2.03-1.92 (m, 1H), 1.67-1.60 (m, 1H), 1.58-1.49 (m, 1H), 1.16-1.11 (m, 2H), 1.09 (s, 3H), 1.09 (s, 3H), 1.01-0.94 (m, 2H). MS (APCI/ESI) m/z: [M+H]+ Found 619.3.
-
- The title compound (20% yield) was prepared as described for the synthesis of Example 78 using 1-((S)-1-(2-((S)-1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 (Intermediate 73) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. 1H NMR (500 MHz, DMSO-d6) δ 9.79 (d, J=8.5 Hz, 1H), 8.37 (d, J=2.1 Hz, 1H), 8.19 (s, 1H), 7.94 (s, 1H), 7.50 (t, J=52.1 Hz, 1H), 6.93 (s, 1H), 5.57 (t, J=6.8 Hz, 1H), 5.24-5.15 (m, 1H), 3.94-3.85 (m, 2H), 3.34 (s, 3H), 2.18-2.08 (m, 1H), 2.05-1.94 (m, 1H), 1.70-1.62 (m, 1H), 1.58-1.49 (m, 1H), 1.09 (s, 3H), 1.09 (s, 3H). MS (APCI/ESI) m/z: [M+H]+ Found 629.3.
-
- The title compound (23% yield) was prepared as described for the synthesis of Example 78 using 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 (Intermediate 30) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. 1H NMR (500 MHz, DMSO-d6) δ 9.64 (d, J=8.9 Hz, 1H), 8.31 (d, J=2.1 Hz, 1H), 8.17 (s, 1H), 7.86 (d, J=1.0 Hz, 1H), 7.42 (t, J=52.1 Hz, 1H), 6.85 (s, 1H), 5.48 (t, J=6.8 Hz, 1H), 5.10 (t, J=8.6 Hz, 1H), 3.97-3.87 (m, 2H), 3.37-3.31 (m, 1H), 2.19-2.09 (m, 1H), 2.03-1.80 (m, 3H), 1.79-1.62 (m, 2H), 1.54 (d, J=12.4 Hz, 1H), 1.37-1.15 (m, 2H), 0.50-0.34 (m, 4H). MS (APCI/ESI) m/z: [M+H]+ Found 635.3.
-
- The title compound (23% yield) was prepared as described for the synthesis of Example 78 using 1-((S)-1-(2-((S)-1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 (Intermediate 73) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one and ethyl 4-(trifluoromethyl)-1,2,5-oxadiazole-3-carboxylate (Intermediate 77) in place of ethyl 4-(difluoromethyl)-1,2,5-oxadiazole-3-carboxylate. 1H NMR (500 MHz, DMSO-d6) δ 9.82 (d, J=8.5 Hz, 1H), 8.38 (d, J=2.1 Hz, 1H), 8.20 (s, 1H), 7.95-7.93 (m, 1H), 6.93 (s, 1H), 5.57 (t, J=6.8 Hz, 1H), 5.27-5.19 (m, 1H), 3.94-3.85 (m, 2H), 3.34 (s, 3H), 2.16-2.07 (m, 1H), 2.04-1.94 (m, 1H), 1.69-1.60 (m, 1H), 1.58-1.49 (m, 1H), 1.09 (s, 3H), 1.08 (s, 3H). MS (APCI/ESI) m/z: [M+H]+ Found 647.3.
-
- The title compound (22% yield) was prepared as described for the synthesis of Example 78 using 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 3) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one and ethyl 4-(trifluoromethyl)-1,2,5-oxadiazole-3-carboxylate (Intermediate 77) in place of ethyl 4-(difluoromethyl)-1,2,5-oxadiazole-3-carboxylate. 1H NMR (500 MHz, DMSO-d6) δ 9.75 (d, J=8.9 Hz, 1H), 8.39 (d, J=2.0 Hz, 1H), 8.24 (s, 1H), 7.92 (s, 1H), 6.95 (br s, 1H), 5.57 (t, J=6.8 Hz, 1H), 5.20 (t, J=8.5 Hz, 1H), 3.94-3.85 (m, 2H), 3.75-3.64 (m, 1H), 3.61-3.45 (m, 3H), 3.34 (s, 3H), 2.25-2.14 (m, 1H), 2.10-1.94 (m, 2H), 1.89 (d, J=12.1 Hz, 1H), 1.86-1.70 (m, 2H), 1.62 (d, J=12.4 Hz, 1H), 1.43-1.21 (m, 2H). MS (APCI/ESI) m/z: [M+H]+ Found 623.3.
-
- The title compound (21% yield) was prepared as described for Example 41 using 1-((S)-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)methyl)cyclobutane-1-carbonitrile hydrochloride (Intermediate 80) in place of 1-((S)-1-(2-((S)-1-amino-4,4,4-trifluoro-3,3-dimethylbutyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. 1H NMR (500 MHz, DMSO-d6) δ 9.50 (d, J=9.0 Hz, 1H), 8.30 (s, 1H), 8.23 (d, J=2.3 Hz, 1H), 7.88-7.85 (m, 1H), 7.23 (s, 1H), 6.06-6.02 (m, 1H), 5.24-5.18 (m, 1H), 3.79-3.68 (m, 1H), 3.67-3.44 (m, 2H), 2.72-2.65 (m, 1H), 2.32-2.25 (m, 1H), 2.25-2.15 (m, 2H), 2.10-1.89 (m, 5H), 1.87-1.70 (m, 3H), 1.64 (d, J=13.6 Hz, 1H), 1.45-1.22 (m, 4H), 1.13-1.09 (m, 2H), 0.98-0.93 (m, 2H). MS (ESI) m/z: [M+H]+ Found 630.3.
-
- The title compound (30% yield) was prepared as described for Example 41 using (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5,6,6-tetrafluoro-1,3-diazepan-2-one (Intermediate 81) in place of 1-((S)-1-(2-((S)-1-amino-4,4,4-trifluoro-3,3-dimethylbutyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. 1H NMR (500 MHz, DMSO-d6) δ 9.48 (d, J=9.0 Hz, 1H), 8.54 (d, J=2.0 Hz, 1H), 8.23 (s, 1H), 8.04-8.02 (m, 1H), 6.87 (t, J=4.7 Hz, 1H), 5.19 (t, J=8.5 Hz, 1H), 4.46 (s, 2H), 3.83-3.74 (m, 2H), 3.55-3.45 (m, 2H), 2.31-2.25 (m, 1H), 2.23-2.14 (m, 1H), 2.09-1.95 (m, 2H), 1.94-1.86 (m, 1H), 1.86-1.71 (m, 2H), 1.66-1.59 (m, 1H), 1.45-1.22 (m, 2H), 1.14-1.09 (m, 2H), 0.98-0.93 (m, 2H). MS (ESI) m/z: [M+H]+ Found 601.2.
-
- The title compound (30% yield) was prepared as described for Example 41 using 1-((R)-1-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)ethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 85) in place of 1-((S)-1-(2-((S)-1-amino-4,4,4-trifluoro-3,3-dimethylbutyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. 1H NMR (500 MHz, DMSO-d6) δ 9.48 (d, J=8.6 Hz, 1H), 8.35 (d, J=2.1 Hz, 1H), 8.21-8.19 (m, 1H), 7.93-7.95 (m, 1H), 6.93-6.90 (m, 1H), 5.65-5.57 (m, 1H), 5.45-5.38 (m, 1H), 4.05-4.00 (m, 1H), 3.97-3.91 (m, 1H), 3.70-3.60 (m, 1H), 3.58-3.42 (m, 2H), 3.36-3.26 (m, 1H, masked by H2O peak), 2.39-2.32 (m, 1H), 1.51 (d, J=7.1 Hz, 3H), 1.35 (d, J=3.9 Hz, 6H), 1.17-1.12 (m, 2H), 1.02-0.98 (m, 2H). MS (ESI) m/z: [M+H]+ Found 587.2.
-
- The title compound (37% yield) was prepared as described for Example 41 using 1-((R)-1-(2-((S)-1-amino-4,4,4-trifluoro-3,3-dimethylbutyl)imidazo[1,2-b]pyridazin-7-yl)ethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 86) in place of 1-((S)-1-(2-((S)-1-amino-4,4,4-trifluoro-3,3-dimethylbutyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. 1H NMR (500 MHz, DMSO-d6) δ 9.73 (d, J=8.7 Hz, 1H), 8.33 (d, J=2.1 Hz, 1H), 8.18 (s, 1H), 7.97-7.95 (m, 1H), 6.94-6.88 (m, 1H), 5.64-5.58 (m, 1H), 5.49-5.43 (m, 1H), 3.70-3.58 (m, 1H), 3.57-3.42 (m, 2H), 3.36-3.26 (m, 1H, masked by H2O peak), 2.43-2.33 (m, 2H), 2.30-2.23 (m, 1H), 1.50 (d, J=7.1 Hz, 3H), 1.20 (d, J=6.5 Hz, 6H), 1.16-1.12 (m, 2H), 1.04-0.93 (m, 2H). MS (ESI) m/z: [M+H]+ Found 571.2.
-
- The title compound (14% yield) was prepared as described for Example 41 using 1-((S)-1-(2-((S)-Amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2,2-difluoroethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 87) in place of 1-((S)-1-(2-((S)-1-amino-4,4,4-trifluoro-3,3-dimethylbutyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. 1H NMR (500 MHz, DMSO-d6) δ 9.51 (d, J=9.0 Hz, 1H), 8.45 (d, J=2.1 Hz, 1H), 8.32 (s, 1H), 8.14-8.11 (m, 1H), 7.17 (m, 1H), 7.03-6.77 (m, 1H), 5.63-5.54 (m, 1H), 5.21 (t, J=8.5 Hz, 1H), 3.89-3.79 (m, 1H), 3.71-3.46 (m, 3H), 2.31-2.25 (m, 1H), 2.24-2.14 (m, 1H), 2.07-1.95 (m, 2H), 1.95-1.87 (m, 1H), 1.87-1.70 (m, 2H), 1.66-1.58 (m, 1H), 1.45-1.35 (m, 1H), 1.35-1.25 (m, 1H), 1.14-1.09 (m, 2H), 0.98-0.94 (m, 2H). MS (ESI) m/z: [M+H]+ Found 601.3.
-
-
- The title compounds were prepared as described for Example 39, using 1-((1S)-1-(2-((1R*)-1-amino-2-(1-(trifluoromethyl)cyclopropoxy)propyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 89) in place of 1-((S)-1-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 to afford two diastereomers. The first eluting isomer was designated as the (1R*,2R*) isomer (Example 90) and the second eluting isomer was designated the (1R*,2S*) isomer (Example 91). 4-Cyclopropyl-N-((1R*,2R*)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(1-(trifluoromethyl)cyclopropoxy)propyl)-1,2,5-oxadiazole-3-carboxamide (Example 90, 10% yield) was isolated as a white solid after lyophilization. Example 90: 1H NMR (500 MHz, DMSO-d6) δ 9.27 (d, J=9.1 Hz, 1H), 8.41 (d, J=2.1 Hz, 1H), 8.25 (s, 1H), 7.96-7.95 (m, 1H), 6.96 (s, 1H), 5.60-5.56 (m, 1H), 5.30-5.25 (m, 1H), 4.30-4.23 (m, 1H), 3.93-3.89 (m, 2H), 3.75-3.65 (m, 1H), 3.60-3.45 (m, 3H), 3.34 (s, 3H), 2.32-2.26 (m, 1H), 1.21 (d, J=6.3 Hz, 3H), 1.15-1.11 (m, 2H), 1.00-0.94 (m, 6H). MS (ESI) m/z: [M+H]+ Found 629.3. 4-Cyclopropyl-N-((1R*,2S*)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-(1-(trifluoromethyl)cyclopropoxy)propyl)-1,2,5-oxadiazole-3-carboxamide (Example 91, 13% yield) was isolated as a white solid after lyophilization. Example 91: 1H NMR (500 MHz, DMSO-d6) δ 9.43 (d, J=9.3 Hz, 1H), 8.39 (d, J=2.1 Hz, 1H), 8.22 (d, J=0.7 Hz, 1H), 7.97-7.96 (m, 1H), 6.96 (s, 1H), 5.60-5.56 (m, 1H), 5.46-5.40 (m, 1H), 4.41-4.35 (m, 1H), 3.90 (dd, J=6.8, 3.1 Hz, 2H), 3.74-3.64 (m, 1H), 3.60-3.47 (m, 3H), 2.33-2.26 (m, 1H), 1.19 (d, J=6.4 Hz, 3H), 1.16-1.11 (m, 3H), 1.03-0.96 (m, 6H). MS (ESI) m/z: [M+H]+ Found 629.2.
-
- The title compound (58% yield) was prepared as described for Example 15 using 1-((S*)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)ethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 90) in place of 1-((S*)-1-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride and 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid in place of 4-methyl-1,2,5-oxadiazole-3-carboxylic acid. 1H NMR (600 MHz, DMSO-d6) δ 9.47 (d, J=8.9 Hz, 1H), 8.35 (d, J=2.1 Hz, 1H), 8.23 (s, 1H), 7.91 (dd, J=2.2, 1.1 Hz, 1H), 6.91 (d, J=3.0 Hz, 1H), 5.62-5.57 (m, 1H), 5.22-5.16 (m, 1H), 3.69-3.61 (m, 1H), 3.57-3.44 (m, 2H), 3.37-3.28 (m, 1H, masked by H2O peak), 2.30-2.25 (m, 1H), 2.24-2.14 (m, 1H), 2.10-1.95 (m, 2H), 1.94-1.87 (m, 1H), 1.85-1.70 (m, 2H), 1.67-1.59 (m, 1H), 1.51 (d, J=7.2 Hz, 3H), 1.43-1.35 (m, 1H), 1.34-1.23 (m, 1H), 1.17-1.08 (m, 2H), 0.99-0.93 (m, 2H). MS (ESI) m/z: [M+H]+ Found 565.3.
-
- The title compound (52% yield) was prepared as described for Example 15 using 1-((S*)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)ethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 90) in place of 1-((S*)-1-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. 1H NMR (600 MHz, DMSO-d6) δ 9.41 (d, J=9.0 Hz, 1H), 8.35 (d, J=2.1 Hz, 1H), 8.23 (s, 1H), 7.92-7.90 (m, 1H), 6.93-6.90 (m, 1H), 5.63-5.57 (m, 1H), 5.19-5.15 (m, 1H), 3.67-3.62 (m, 1H), 3.38-3.28 (m, 1H, masked by H2O peak), 3.58-3.44 (m, 2H), 2.46 (s, 3H), 2.22-2.14 (m, 1H), 2.07-1.95 (m, 2H), 1.94-1.88 (m, 1H), 1.84-1.70 (m, 2H), 1.65-1.58 (m, 1H), 1.51 (d, J=7.1 Hz, 3H), 1.43-1.35 (m, 1H), 1.32-1.23 (m, 1H). MS (ESI) m/z: [M+H]+ Found 539.2.
-
-
- The title compounds were prepared as described for Example 15 using 1-((2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-4-methyl-1,3-diazepan-2-one (Intermediate 91) in place of 1-((S)-1-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 and 1-isopropyl-1H-pyrazole-5-carboxylic acid in place of 4-methyl-1,2,5-oxadiazole-3-carboxylic acid to afford two diastereomers, that were separated via SFC (Chiralpak IH Sum 250×21 mm, Mobile phase: 25% methanol:isopropanol (1:1) with 0.2% isopropylamine, 75% CO2). During the separation of these diastereomers, a small amount of hexylene glycol was inadvertently introduced and may be seen in the 1H NMR spectra of the diastereomers. The first eluting isomer was designated as the (R*) isomer (Example 94) and the second eluting isomer was designated the (S*) isomer (Example 95). N—((S)-(4,4-Difluorocyclohexyl)(7-(((R*)-4-methyl-2-oxo-1,3-diazepan-1-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1-isopropyl-1H-pyrazole-5-carboxamide (12% yield) was isolated as a white solid after lyophilization. Example 94: 1H NMR (600 MHz, DMSO-d6) δ 8.71 (d, J=9.1 Hz, 1H), 8.48 (d, J=2.0 Hz, 1H), 7.91-7.89 (m, 1H), 7.48 (d, J=1.9 Hz, 1H), 6.91 (d, J=2.0 Hz, 1H), 5.81 (d, J=2.2 Hz, 1H), 5.40-5.34 (m, 1H), 5.18-5.12 (m, 1H), 4.62 (d, J=3.5 Hz, 1H), 4.56 (s, 1H), 4.46-4.35 (m, 2H), 3.95-3.89 (m, 1H), 3.30-3.23 (m, 3H), 3.06-3.00 (m, 1H), 2.21-2.13 (m, 1H), 2.08-1.93 (m, 2H), 1.91-1.84 (m, 1H), 1.84-1.59 (m, 6H), 1.51-1.38 (m, 3H), 1.36 (d, J=6.6 Hz, 4H), 1.33 (d, J=6.6 Hz, 3H), 1.31-1.22 (m, 2H), 1.14 (s, 2H), 1.12-1.10 (m, 6H), 1.05 (d, J=6.2 Hz, 2H). MS (ESI) m/z: [M+H]+ Found 543.3.
- N—((S)-(4,4-Difluorocyclohexyl)(7-(((S*)-4-methyl-2-oxo-1,3-diazepan-1-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1-isopropyl-1H-pyrazole-5-carboxamide (14% yield) was isolated as a white solid after lyophilization. Example 95: 1H NMR (600 MHz, DMSO-d6) δ 8.71 (d, J=9.1 Hz, 1H), 8.48 (d, J=2.0 Hz, 1H), 8.19 (s, 1H), 7.91-7.89 (m, 1H), 7.48 (d, J=1.9 Hz, 1H), 6.91 (d, J=2.0 Hz, 1H), 5.81 (d, J=2.3 Hz, 1H), 5.41-5.34 (m, 1H), 5.17-5.13 (m, 1H), 4.56 (s, 1H), 4.46-4.35 (m, 2H), 3.95-3.89 (m, 1H), 3.31-3.23 (m, 3H), 3.07-3.01 (m, 1H), 2.21-2.12 (m, 1H), 2.09-1.93 (m, 2H), 1.90-1.84 (m, 1H), 1.84-1.58 (m, 5H), 1.51-1.37 (m, 3H), 1.36 (d, J=6.6 Hz, 3H), 1.33 (d, J=6.6 Hz, 3H), 1.31-1.20 (m, 2H), 1.14 (s, 2H), 1.12-1.10 (m, 5H), 1.05 (d, J=6.2 Hz, 2H). MS (ESI) m/z: [M+H]+ Found 543.3.
-
-
- The title compounds were prepared as described for Example 15 using 1-((2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-4-methyl-1,3-diazepan-2-one (Intermediate 91) in place of 1-((S)-1-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 and 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid in place of 4-methyl-1,2,5-oxadiazole-3-carboxylic acid to afford two diastereomers that were separated via SFC (Chiralpak IH 5 um 250×21 mm, Mobile phase: 25% methanol:isopropanol (1:1) with 0.2% isopropylamine, 75% CO2). During the separation of these diastereomers, a small amount of hexylene glycol was inadvertently introduced and may be seen in the 1H NMR spectra of the diastereomers. The first eluting isomer was designated as the (R*) isomer (Example 96) and the second eluting isomer was designated the (S*) isomer (Example 97). 4-Cyclopropyl-N—((S)-(4,4-difluorocyclohexyl)(7-(((R*)-4-methyl-2-oxo-1,3-diazepan-1-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1,2,5-oxadiazole-3-carboxamide (10% yield) was isolated as a white solid after lyophilization. Example 96: 1H NMR (600 MHz, DMSO-d6) δ 9.47 (d, J=9.0 Hz, 1H), 8.50 (d, J=2.0 Hz, 1H), 8.22 (s, 1H), 7.92-7.91 (m, 1H), 5.81 (d, J=2.2 Hz, 1H), 5.21-5.17 (m, 1H), 4.62 (d, J=3.6 Hz, 1H), 4.56 (s, 1H), 4.48-4.35 (m, 2H), 3.96-3.89 (m, 1H), 3.30-3.23 (m, 2H), 3.07-3.02 (m, 1H), 2.31-2.25 (m, 1H), 2.22-2.14 (m, 1H), 2.09-1.95 (m, 2H), 1.93-1.86 (m, 1H), 1.85-1.59 (m, 6H), 1.52-1.37 (m, 4H), 1.33-1.24 (m, 2H), 1.14 (s, 2H), 1.11 (d, J=6.0 Hz, 8H), 1.05 (d, J=6.1 Hz, 2H), 0.97-0.95 (m, 2H). MS (ESI) m/z: [M+H]+ Found 543.3.
- 4-Cyclopropyl-N—((S)-(4,4-difluorocyclohexyl)(7-(((S*)-4-methyl-2-oxo-1,3-diazepan-1-yl)methyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-1,2,5-oxadiazole-3-carboxamide (15% yield) was isolated as a white solid after lyophilization. Example 97: 1H NMR (600 MHz, DMSO-d6) δ 9.47 (d, J=9.0 Hz, 1H), 8.50 (d, J=2.0 Hz, 1H), 8.22 (s, 1H), 7.92-7.91 (m, 1H), 5.81 (d, J=2.3 Hz, 1H), 5.21-5.17 (m, 1H), 4.62 (d, J=3.5 Hz, 1H), 4.56 (s, 1H), 4.47-4.36 (m, 2H), 3.95-3.89 (m, 1H), 3.30-3.24 (m, 3H), 3.08-3.02 (m, 1H), 2.30-2.24 (m, 1H), 2.22-2.14 (m, 1H), 2.09-1.93 (m, 2H), 1.93-1.87 (m, 1H), 1.86-1.59 (m, 5H), 1.53-1.35 (m, 4H), 1.33-1.24 (m, 2H), 1.14 (s, 2H), 1.13-1.10 (m, 7H), 1.05 (d, J=6.1 Hz, 2H), 0.97-0.94 (m, 2H). MS (ESI) m/z: [M+H]+ Found 543.3.
-
- The title compounds were prepared as described for the synthesis of Example 15 using the diastereomeric mixture made in Intermediate 92 in place of 1-((S)-1-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 and 1-isopropyl-1H-pyrazole-5-carboxylic acid in place of 4-methyl-1,2,5-oxadiazole-3-carboxylic acid to afford two diastereomers. The diastereomeric mixture was separated via SFC (Chiralpak IB N3 5 μm, 250×21 mm, Mobile phase: 25% methanol:isopropanol (1:1) with 0.2% isopropylamine, 75% CO2). During the separation of these diastereomers, a small amount of hexylene glycol was inadvertently introduced and may be seen in the 1H NMR spectra of the diastereomers. The first eluting isomer was designated as isomer 1 (Example 98) and the second eluting isomer was designated as isomer 2 (Example 99). The first eluting isomer (3% yield) was isolated as a white solid after lyophilization. Example 98: 1H NMR (600 MHz, DMSO-d6) δ 8.70 (d, J=9.1 Hz, 1H), 8.42 (d, J=2.0 Hz, 1H), 8.18 (s, 1H), 7.91-7.89 (m, 1H), 7.48 (d, J=1.9 Hz, 1H), 6.90 (d, J=2.1 Hz, 1H), 6.58-6.54 (m, 1H), 5.40-5.33 (m, 1H), 5.17-5.13 (m, 1H), 4.65-4.60 (m, 2H), 4.41-4.38 (m, 1H), 3.96-3.88 (m, 2H), 3.64-3.56 (m, 1H), 3.44-3.38 (m, 1H), 3.15-3.07 (m, 1H), 2.37-2.28 (m, 2H), 2.21-2.13 (m, 1H), 2.09-1.94 (m, 2H), 1.90-1.84 (m, 1H), 1.84-1.70 (m, 2H), 1.66-1.59 (m, 1H), 1.47-1.38 (m, 2H), 1.36 (d, J=6.6 Hz, 3H), 1.33 (d, J=6.6 Hz, 3H), 1.14 (s, 3H), 1.11 (s, 3H), 1.05 (d, J=6.1 Hz, 3H). MS (ESI) m/z: [M+H]+ Found 577.3.
- The second eluting isomer (3% yield) was isolated as a white solid after lyophilization. Example 99: 1H NMR (600 MHz, DMSO-d6) δ 8.70 (d, J=9.1 Hz, 1H), 8.42 (d, J=2.0 Hz, 1H), 8.18 (s, 1H), 7.91-7.89 (m, 1H), 7.48 (d, J=1.9 Hz, 1H), 6.91 (d, J=2.1 Hz, 1H), 6.58-6.55 (m, 1H), 5.40-5.33 (m, 1H), 5.17-5.13 (m, 1H), 4.64-4.60 (m, 2H), 4.42-4.38 (m, 1H), 3.95-3.88 (m, 2H), 3.64-3.56 (m, 1H), 3.44-3.38 (m, 1H), 3.15-3.07 (m, 1H), 2.36-2.28 (m, 2H), 2.21-2.13 (m, 1H), 2.09-1.94 (m, 2H), 1.90-1.84 (m, 1H), 1.84-1.70 (m, 2H), 1.66-1.59 (m, 1H), 1.47-1.38 (m, 2H), 1.36 (d, J=6.6 Hz, 3H), 1.33 (d, J=6.6 Hz, 3H), 1.14 (s, 3H), 1.11 (s, 3H), 1.05 (d, J=6.1 Hz, 3H). MS (ESI) m/z: [M+H]+ Found 577.3.
-
- The title compounds were prepared as described for the synthesis of Example 15 using the diastereomeric mixture made in Intermediate 92 in place of 1-((S)-1-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 to afford two diastereomers. The diastereomeric mixture was separated via SFC (Chiralpak IB N3 5 μm, 250×21 mm, Mobile phase: 40% methanol:isopropanol (1:1) with 0.2% isopropylamine, 60% CO2). During the separation of these diastereomers, a small amount of hexylene glycol was inadvertently introduced and may be seen in the 1H NMR spectra of the diastereomers. The first eluting isomer was designated as isomer 1 (Example 100) and the second eluting isomer was designated as isomer 2 (Example 101). The first eluting isomer (Example 100, 4% yield) was isolated as a white solid after lyophilization. Example 100: 1H NMR (600 MHz, DMSO-d6) δ 9.39 (d, J=9.0 Hz, 1H), 8.43 (d, J=2.0 Hz, 1H), 8.22 (s, 1H), 7.92-7.90 (m, 1H), 6.59-6.54 (m, 1H), 5.20-5.14 (m, 1H), 4.66-4.61 (m, 2H), 4.39 (d, J=15.7 Hz, 1H), 3.96-3.89 (m, 2H), 3.64-3.58 (m, 1H), 3.43-3.38 (m, 1H), 3.15-3.07 (m, 1H), 2.37-2.29 (m, 2H), 2.22-2.14 (m, 1H), 2.08-1.95 (m, 2H), 1.93-1.86 (m, 1H), 1.84-1.70 (m, 2H), 1.65-1.58 (m, 1H), 1.48-1.33 (m, 3H), 1.32-1.22 (m, 1H), 1.14 (s, 2H), 1.11 (s, 2H), 1.05 (d, J=6.1 Hz, 3H). MS (ESI) m/z: [M+H]+ Found 551.2.
- The second eluting isomer (Example 101, 5% yield) was isolated as a white solid after lyophilization. Example 101: 1H NMR (600 MHz, DMSO-d6) δ 9.39 (d, J=9.0 Hz, 1H), 8.43 (d, J=2.1 Hz, 1H), 8.22 (s, 1H), 7.92-7.90 (m, 1H), 6.58-6.55 (m, 1H), 5.20-5.14 (m, 1H), 4.65-4.60 (m, 2H), 4.42-4.38 (m, 1H), 3.96-3.88 (m, 2H), 3.64-3.57 (m, 1H), 3.44-3.38 (m, 1H), 3.15-3.08 (m, 1H), 2.47 (s, 3H), 2.36-2.29 (m, 2H), 2.22-2.13 (m, 1H), 2.08-1.94 (m, 2H), 1.93-1.87 (m, 1H), 1.84-1.77 (m, 2H), 1.65-1.58 (m, 1H), 1.48-1.34 (m, 3H), 1.32-1.22 (m, 1H), 1.14 (s, 2H), 1.11 (s, 2H), 1.05 (d, J=6.1 Hz, 3H). MS (ESI) m/z: [M+H]+ Found 551.2.
-
- The title compound (76% yield) was synthesized in a manner analogous to Example 16 using 1-((S)-1-(2-((S)-1-amino-2,2-dicyclopropylethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 93) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. 1H NMR (500 MHz, Methanol-d4) δ 8.41 (d, J=2.1 Hz, 1H), 8.17 (s, 1H), 8.01-7.86 (m, 1H), 5.78-5.68 (m, 1H), 5.65 (d, J=6.0 Hz, 1H), 4.10-3.97 (m, 2H), 3.89-3.74 (m, 1H), 3.74-3.52 (m, 3H), 3.39 (s, 3H), 2.57 (s, 3H), 1.09-0.95 (m, 1H), 0.87-0.74 (m, 2H), 0.59-0.46 (m, 2H), 0.46-0.35 (m, 2H), 0.35-0.25 (m, 2H), 0.24-0.17 (m, 1H), 0.15-0.05 (m, 1H). MS (APCI/ESI) m/z: [M+H]+ Found 545.4.
-
- The title compound (67% yield) was synthesized in a manner analogous to Example 16 using 1-((S)-1-(2-((S)-1-amino-2,2-dicyclopropylethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 93) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride and 2,5-dioxopyrrolidin-1-yl 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylate (Intermediate 31) in place of 2,5-dioxopyrrolidin-1-yl 4-methyl-1,2,5-oxadiazole-3-carboxylate. 1H NMR (500 MHz, Methanol-d4) δ 8.42 (d, J=2.1 Hz, 1H), 8.17 (d, J=0.6 Hz, 1H), 7.98-7.88 (m, 1H), 5.77-5.69 (m, 1H), 5.67 (d, J=6.0 Hz, 1H), 4.10-3.97 (m, 2H), 3.92-3.75 (m, 1H), 3.75-3.52 (m, 3H), 3.49 (s, 3H), 3.38 (s, 1H), 2.45 (tt, J=8.4, 5.0 Hz, 1H), 1.24-1.12 (m, 2H), 1.12-1.06 (m, 2H), 1.06-0.95 (m, 1H), 0.89-0.74 (m, 2H), 0.60-0.47 (m, 2H), 0.46-0.35 (m, 2H), 0.33-0.26 (m, 2H), 0.26-0.16 (m, 1H), 0.15-0.06 (m, 1H). MS (APCI/ESI) m/z: [M+H]+ Found 571.4.
-
- The title compounds were prepared as described for the synthesis of Example 16 using the diastereomeric mixture made in Intermediate 95 in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. The diastereomeric mixture was separated by SFC (Chiralpak IB N3 5 μm, 250×21 mm, Mobile phase: 30% methanol, 70% CO2). The first-eluting isomer was designated as isomer 1 (Example 104, 39% yield) and the second-eluting isomer was designated as isomer 2 (Example 105, 24% yield). Example 104: 1H NMR (500 MHz, DMSO-d6) δ 9.39 (d, J=9.0 Hz, 1H), 8.38 (d, J=2.1 Hz, 1H), 8.24 (s, 1H), 7.95-7.93 (m, 1H), 6.66-6.59 (m, 1H), 5.68-5.62 (m, 1H), 5.21-5.14 (m, 1H), 3.94-3.88 (m, 1H), 3.86-3.79 (m, 1H), 3.70-3.63 (m, 1H), 3.59-3.50 (m, 1H), 3.33 (s, 3H), 3.32-3.29 (m, 1H, masked by H2O peak) 3.16-3.07 (m, 1H), 2.47 (s, 3H), 2.37-2.26 (m, 1H), 2.23-2.13 (m, 1H), 2.09-1.69 (m, 6H), 1.66-1.58 (m, 1H), 1.44-1.33 (m, 1H), 1.33-1.21 (m, 1H). MS (APCI/ESI) m/z: [M+H]+ Found 595.3. Example 105: 1H NMR (500 MHz, DMSO-d6) δ 9.38 (d, J=9.0 Hz, 1H), 8.38 (d, J=2.1 Hz, 1H), 8.22 (s, 1H), 7.94-7.91 (m, 1H), 6.55-6.50 (m, 1H), 5.76-5.70 (m, 1H), 5.20-5.13 (m, 1H), 3.95-3.90 (m, 2H), 3.74-3.58 (m, 2H), 3.39-3.33 (m, 1H, masked by singlet at 3.36 ppm) 3.36 (s, 3H), 3.16-3.07 (m, 1H), 2.47 (s, 3H), 2.41-2.30 (m, 1H), 2.30-2.13 (m, 2H), 2.10-1.68 (m, 5H), 1.66-1.58 (m, 1H), 1.43-1.33 (m, 1H), 1.33-1.21 (m, 1H). MS (APCI/ESI) m/z: [M+H]+ Found 595.3.
-
- The title compound (59% yield) was synthesized in a manner analogous to Example 15 using 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 3) in place of 1-((S*)-1-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride and 4-(2,2,2-trifluoroethyl)isoxazole-3-carboxylic acid in place of 4-methyl-1,2,5-oxadiazole-3-carboxylic acid. 1H NMR (500 MHz, DMSO-d6) δ 9.17-9.16 (m, 1H), 8.37-8.36 (m, 1H), 8.21-8.20 (m, 1H), 7.94-7.92 (m, 1H), 6.96-6.94 (m, 1H), 5.60-5.55 (m, 1H), 5.20-5.14 (m, 1H), 3.94-3.86 (m, 2H), 3.81-3.64 (m, 3H), 3.60-3.44 (m, 3H), 3.34-3.33 (m, 3H), 3.31-3.30 (m, 1H), 2.21-2.12 (m, 1H), 2.09-1.93 (m, 2H), 1.90-1.68 (m, 3H), 1.67-1.55 (m, 1H), 1.42-1.32 (m, 1H), 1.31-1.22 (m, 1H). MS (ESI) m/z: [M+H]+ Found 636.7.
-
- The title compound (54% yield) was synthesized in a manner analogous to Example 15 using 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 (Intermediate 30) in place of 1-((S*)-1-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride and 4-(2,2,2-trifluoroethyl)isoxazole-3-carboxylic acid in place of 4-methyl-1,2,5-oxadiazole-3-carboxylic acid. 1H NMR (500 MHz, DMSO-d6) δ 9.18-9.14 (m, 2H), 8.37 (d, J=2.1 Hz, 1H), 8.21 (s, 1H), 7.94 (s, 1H), 6.92 (s, 1H), 5.56 (s, 1H), 5.17 (s, 1H), 4.04-3.94 (m, 2H), 3.76 (br dd, J=2.3, 11.1 Hz, 3H), 3.42 (s, 1H), 2.22-2.10 (m, 1H), 2.06-1.94 (m, 2H), 1.90-1.70 (m, 3H), 1.66-1.57 (m, 1H), 1.42-1.31 (m, 1H), 1.30-1.15 (m, 4H). MS (ESI) m/z: [M+H]+ Found 666.4.
-
- The title compound (25% yield) was synthesized in a manner analogous to Example 15 using 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 3) in place of 1-((S*)-1-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride and 4-methoxy-1,2,5-oxadiazole-3-carboxylic acid in place of 4-methyl-1,2,5-oxadiazole-3-carboxylic acid. 1H NMR (500 MHz, DMSO-d6) δ 9.31-9.27 (m, 1H), 8.40-8.38 (m, 1H), 8.22-8.21 (m, 1H), 7.94-7.92 (m, 1H), 6.98-6.95 (m, 1H), 5.60-5.56 (m, 1H), 5.19-5.14 (m, 1H), 4.10-4.08 (m, 3H), 3.94-3.87 (m, 2H), 3.74-3.65 (m, 1H), 3.61-3.47 (m, 3H), 3.35-3.34 (m, 3H), 2.20-2.12 (m, 1H), 2.06-1.96 (m, 2H), 1.90-1.71 (m, 3H), 1.65-1.59 (m, 1H), 1.43-1.24 (m, 2H). MS (ESI) m/z: [M+H]+ Found 585.3.
-
- The title compound (58% yield) was synthesized in a manner analogous to Example 15 using 1-((S)-1-(2-((S)-1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 47) in place of 1-((S*)-1-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride and 4-methoxy-1,2,5-oxadiazole-3-carboxylic acid in place of 4-methyl-1,2,5-oxadiazole-3-carboxylic acid. 1H NMR (500 MHz, DMSO-d6) δ 9.37 (d, J=8.4 Hz, 1H), 8.38 (d, J=2.0 Hz, 1H), 8.17 (s, 1H), 7.94 (s, 1H), 6.96 (br s, 1H), 5.58 (s, 1H), 5.18 (br d, J=5.3 Hz, 1H), 4.09 (s, 3H), 3.90 (dd, J=3.4, 6.9 Hz, 2H), 3.72-3.64 (m, 1H), 3.60-3.46 (m, 3H), 3.35-3.34 (m, 3H), 2.13-2.04 (m, 1H), 2.00-1.89 (m, 1H), 1.68-1.59 (m, 1H), 1.55-1.46 (m, 1H), 1.12-1.07 (m, 6H). MS (ESI) m/z: [M+H]+ Found 605.3.
-
- A mixture of ethyl 4-(difluoromethyl)-1,2,5-oxadiazole-3-carboxylate (161 mg, 0.836 mmol, Intermediate 75) and 1-((S)-1-(2-((S)-1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (160 mg, 0.334 mmol, Intermediate 47) in ACN (0.7 mL) was heated at 92° C. for 4 h. After that time, additional ethyl 4-(difluoromethyl)-1,2,5-oxadiazole-3-carboxylate (30 mg, 0.156 mmol, Intermediate 75) was then added and the mixture heated at 92° C. for 24 h. The mixture was then cooled to rt and allowed to stir for an additional 24 h at rt. The reaction mixture was concentrated to dryness, dissolved in DMF and purified by preparative HPLC (X-Bridge Prep C18 5 μm 50×100 mm, 0-100% acetonitrile/water (with 20 mM NH4OH)) to afford the title compound in 8% yield. 1H NMR (500 MHz, DMSO-d6) δ 9.80 (d, J=8.4 Hz, 1H), 8.37 (d, J=2.1 Hz, 1H), 8.20 (s, 1H), 7.95 (s, 1H), 7.62-7.40 (m, 1H), 6.96 (br s, 1H), 5.58 (s, 1H), 5.24-5.18 (m, 1H), 3.93-3.89 (m, 2H), 3.74-3.66 (m, 1H), 3.58-3.49 (m, 3H), 3.35-3.34 (m, 3H), 2.17-2.10 (m, 1H), 2.04-1.96 (m, 1H), 1.70-1.62 (m, 1H), 1.57-1.49 (m, 1H), 1.10-1.09 (m, 6H). MS (ESI) m/z: [M+H]+ Found 625.2.
-
- A vial was charged with 1-((S)-1-(2-((S)-1-amino-4,4,4-trifluoro-3,3-dimethylbutyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (60 mg, 0.125 mol, Intermediate 44), 1-isopropyl-1H-1,2,4-triazole-5-carboxylic acid (23 mg, 0.15 mmol), DIPEA (0.108 mL, 0.627 mmol), HATU (62 mg, 0.16 mmol) and DMF (1.2 mL). The resulting mixture was stirred at rt for 1 h. After that time, the reaction mixture was filtered and purified by preparative HPLC (X-Bridge Prep C18 column 5 μm, 50×250 mm, 5-100% acetonitrile/water (with 20 mM NH4OH)) to afford the title compound as a white solid (43% yield) after lyophilization. 1H NMR (500 MHz, CDCl3) δ 8.27 (d, J=2.2 Hz, 1H), 8.06 (d, J=8.6 Hz, 1H), 8.00-7.96 (m, 1H), 7.90 (s, 1H), 7.85 (d, J=0.7 Hz, 1H), 5.81-5.75 (m, 2H), 5.36-5.25 (m, 1H), 4.79 (s, 1H), 4.01-3.89 (m, 2H), 3.74-3.52 (m, 3H), 3.45 (d, J=1.0 Hz, 3H), 3.39-3.21 (m, 1H), 2.27-1.95 (m, 2H), 1.67-1.58 (m, 1H), 1.55-1.46 (m, 7H), 1.10 (d, J=11.1 Hz, 6H). MS (ESI) m/z: [M+H]+ Found 616.3.
-
- A mixture of 1-((S)-1-(2-((S)-1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 (55 mg, 0.11 mmol, Intermediate 73), 1-isopropyl-1H-1,2,4-triazole-5-carboxylic acid (23.3 mg, 0.150 mmol), DIPEA (0.108 mL, 0.627 mmol), HATU (62 mg, 0.16 mmol) and DMF (1.2 mL) was stirred at rt for 1 h. Then the reaction mixture was filtered and purified by preparative HPLC (X-Bridge Prep C18 column 5 μm, 50×250 mm, 5-100% acetonitrile/water (with 20 mM NH4OH)) to afford the title compound as a white solid (47% yield) after lyophilization. 1H NMR (500 MHz, CDCl3) δ 8.31 (d, J=2.2 Hz, 1H), 8.13 (d, J=8.7 Hz, 1H), 8.06 (s, 1H), 7.91 (s, 1H), 7.86 (s, 1H), 5.80-5.72 (m, 2H), 5.30 (s, 1H), 4.92 (s, 1H), 4.01-3.90 (m, 2H), 3.45 (s, 3H), 2.22-2.03 (m, 2H), 1.68-1.59 (m, 1H), 1.54-1.46 (m, 7H), 1.10 (d, J=11.0 Hz, 6H). MS (ESI) m/z: [M+H]+ Found 620.3.
-
- The title compound was synthesized in a manner analogous to Example 15 using (S)-1-((2-(1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 97) in place of 1-((S)-1-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 and 4-methoxy-1,2,5-oxadiazole-3-carboxylic acid in place of 4-methyl-1,2,5-oxadiazole-3-carboxylic acid. The material was purified by preparative HPLC (XBridge Prep C18 5 μm OBD 50×100 mm, 10-100% MeCN/water (20 mM NH4OH)) to provide the title compound in 55% yield. 1H NMR (600 MHz, DMSO-d6) δ 9.36 (d, J=8.5 Hz, 1H), 8.41 (d, J=2.0 Hz, 1H), 8.24-8.08 (m, 1H), 7.94-7.83 (m, 1H), 7.00-6.85 (m, 1H), 5.23-5.13 (m, 1H), 4.57-4.44 (m, 2H), 4.09 (s, 3H), 3.77-3.67 (m, 2H), 3.60-3.47 (m, 2H), 2.13-2.03 (m, 1H), 1.99-1.89 (m, 1H), 1.70-1.56 (m, 1H), 1.56-1.44 (m, 1H), 1.08 (s, 6H). MS (ESI) m/z: [M+H]+ Found 561.3.
-
- The title compound was synthesized in a manner analogous to Example 15 using (S)-1-((2-(1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 97) in place of 1-((S)-1-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 and 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid in place of 4-methyl-1,2,5-oxadiazole-3-carboxylic acid. The material was purified by preparative HPLC (XBridge Prep C18 5 μm OBD 50×100 mm, 10-100% MeCN/water (20 mM NH4OH)) to provide the title compound in 57% yield. 1H NMR (600 MHz, DMSO-d6) δ 9.55 (d, J=8.5 Hz, 1H), 8.40 (d, J=2.0 Hz, 1H), 8.26-8.07 (m, 1H), 8.03-7.80 (m, 1H), 7.03-6.87 (m, 1H), 5.27-5.17 (m, 1H), 4.59-4.46 (m, 2H), 3.77-3.61 (m, 2H), 3.61-3.50 (m, 2H), 2.38-2.23 (m, 1H), 2.16-2.05 (m, 1H), 2.04-1.87 (m, 1H), 1.68-1.61 (m, 1H), 1.60-1.46 (m, 1H), 1.16-1.10 (m, 2H), 1.09 (s, 3H), 1.08 (s, 3H), 1.03-0.90 (m, 2H). MS (ESI) m/z: [M+H]+ Found 571.3.
-
- The title compound was synthesized in a manner analogous to Example 16 using (S)-1-((2-(1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 97) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. The material was purified by preparative HPLC (XBridge Prep C18 5 μm OBD 50×100 mm, 10-100% MeCN/water (20 mM NH4OH)) to provide the title compound in 69% yield. 1H NMR (600 MHz, DMSO-d6) δ 9.50 (d, J=8.5 Hz, 1H), 8.40 (d, J=2.0 Hz, 1H), 8.18 (s, 1H), 7.92-7.84 (m, 1H), 7.06-6.84 (m, 1H), 5.42-5.06 (m, 1H), 4.50 (s, 2H), 3.83-3.60 (m, 2H), 3.61-3.47 (m, 2H), 2.49 (s, 3H), 2.18-2.05 (m, 1H), 2.04-1.94 (m, 1H), 1.69-1.59 (m, 1H), 1.57-1.47 (m, 1H), 1.09 (s, 3H), 1.09 (s, 3H). MS (ESI) m/z: [M+H]+ Found 545.2.
-
-
- The title compounds were synthesized in a manner analogous to Example 15 using a diastereomeric mixture of (1S*,7R*)-3-((2-((S)-1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-8,8-difluoro-3,5-diazabicyclo[5.1.0]octan-4-one and (1R*,7S*)-3-((2-((S)-1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-8,8-difluoro-3,5-diazabicyclo[5.1.0]octan-4-one (Intermediate 98) in place of 1-((S)-1-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 and 4-methoxy-1,2,5-oxadiazole-3-carboxylic acid in place of 4-methyl-1,2,5-oxadiazole-3-carboxylic acid. The mixture was purified by silica gel chromatography (0-100% acetone/hexanes) followed by separation of the diastereomers by chiral SFC (Stationary phase: Chiralcel OJ-H 5 μm, 250×21 mm, Mobile phase: 30% methanol with 0.2% triethylamine, 70% CO2). Example 116 was the first eluting isomer (11% yield) and Example 117 was the second eluting isomer (10% yield). Example 116: 1H NMR (600 MHz, DMSO-d6) δ 9.36 (d, J=8.5 Hz, 1H), 8.44 (d, J=2.0 Hz, 1H), 8.26-8.06 (m, 1H), 8.06-7.86 (m, 1H), 6.62-6.49 (m, 1H), 5.25-5.12 (m, 1H), 4.64 (d, J=15.8 Hz, 1H), 4.41 (d, J=15.6, 1.1 Hz, 1H), 4.10 (s, 3H), 4.00-3.89 (m, 1H), 3.67-3.57 (m, 1H), 3.49-3.37 (m, 1H), 3.18-3.05 (m, 1H), 2.38-2.26 (m, 2H), 2.12-2.03 (m, 1H), 2.03-1.89 (m, 1H), 1.68-1.58 (m, 1H), 1.56-1.46 (m, 1H), 1.09 (s, 6H). MS (ESI) m/z: [M+H]+ Found 587.4. Example 117: 1H NMR (600 MHz, DMSO-d6) δ 9.36 (d, J=8.5 Hz, 1H), 8.44 (d, J=2.1 Hz, 1H), 8.14 (s, 1H), 7.96-7.79 (m, 1H), 6.65-6.53 (m, 1H), 5.25-5.13 (m, 1H), 4.67-4.60 (m, 1H), 4.42 (d, J=15.8 Hz, 1H), 4.10 (s, 3H), 3.99-3.90 (m, 1H), 3.67-3.55 (m, 1H), 3.50-3.35 (m, 1H), 3.18-3.02 (m, 1H), 2.38-2.29 (m, 2H), 2.13-2.02 (m, 1H), 2.01-1.86 (m, 1H), 1.68-1.57 (m, 1H), 1.57-1.45 (m, 1H), 1.09 (s, 6H). MS (ESI) m/z: [M+H]+ Found 587.4.
-
-
- The title compounds were synthesized in a manner analogous to Example 15 using a diastereomeric mixture of (1S*,7R*)-3-((2-((S)-1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-8,8-difluoro-3,5-diazabicyclo[5.1.0]octan-4-one and (1R*,7S*)-3-((2-((S)-1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-8,8-difluoro-3,5-diazabicyclo[5.1.0]octan-4-one (Intermediate 98) in place of 1-((S)-1-(2-((R)-1-amino-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 and 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid in place of 4-methyl-1,2,5-oxadiazole-3-carboxylic acid. The mixture was purified by silica gel chromatography (0-100% acetone/hexanes) followed by separation of the diastereomers by chiral SFC (Stationary phase: Chiralcel OJ-H 5 μm, 250×21 mm, Mobile phase: 30% methanol with 0.2% triethylamine, 70% CO2). Example 118 was the first eluting isomer (13% yield) and Example 119 was the second eluting isomer (11% yield). Example 118: 1H NMR (600 MHz, DMSO-d6) δ 9.54 (d, J=8.6 Hz, 1H), 8.44 (d, J=2.0 Hz, 1H), 8.21-8.13 (m, 1H), 7.96-7.92 (m, 1H), 6.61-6.55 (m, 1H), 5.27-5.19 (m, 1H), 4.69-4.60 (m, 1H), 4.45-4.37 (m, 1H), 3.97-3.90 (m, 1H), 3.66-3.57 (m, 1H), 3.46-3.37 (m, 1H), 3.18-3.08 (m, 1H), 2.38-2.29 (m, 3H), 2.16-2.06 (m, 1H), 2.03-1.95 (m, 1H), 1.70-1.59 (m, 1H), 1.60-1.50 (m, 1H), 1.16-1.12 (m, 2H), 1.10 (s, 3H), 1.09 (s, 3H), 1.01-0.97 (m, 2H). MS (ESI) m/z: [M+H]+ Found 597.3. Example 119: 1H NMR (600 MHz, DMSO-d6) δ 9.53 (d, J=8.5 Hz, 1H), 8.43 (d, J=2.0 Hz, 1H), 8.24-8.09 (m, 1H), 7.98-7.82 (m, 1H), 6.69-6.51 (m, 1H), 5.28-5.17 (m, 1H), 4.68-4.58 (m, 1H), 4.46-4.35 (m, 1H), 3.99-3.89 (m, 1H), 3.67-3.56 (m, 1H), 3.50-3.37 (m, 1H), 3.18-3.09 (m, 1H), 2.37-2.25 (m, 3H), 2.14-2.06 (m, 1H), 2.03-1.93 (m, 1H), 1.70-1.59 (m, 1H), 1.58-1.49 (m, 1H), 1.16-1.11 (m, 2H), 1.09 (s, 3H), 1.08 (s, 3H), 1.00-0.95 (m, 2H). MS (ESI) m/z: [M+H]+ Found 597.3.
-
-
- The title compounds were synthesized in a manner analogous to Example 16 using a diastereomeric mixture of (1S*,7R*)-3-((2-((S)-1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-8,8-difluoro-3,5-diazabicyclo[5.1.0]octan-4-one and (1R*,7S*)-3-((2-((S)-1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)methyl)-8,8-difluoro-3,5-diazabicyclo[5.1.0]octan-4-one (Intermediate 98) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. The mixture was purified by silica gel chromatography (0-100% acetone/hexanes) followed by separation of the diastereomers by chiral SFC (Stationary phase: Chiralcel OJ-H 5 μm, 250×21 mm, Mobile phase: 25% methanol with 0.2% triethylamine, 75% CO2). Example 120 was the first eluting isomer (20% yield) and Example 121 was the second eluting isomer (24% yield). Example 120: 1H NMR (600 MHz, DMSO-d6) δ 9.49 (d, J=8.5 Hz, 1H), 8.42 (d, J=2.0 Hz, 1H), 8.22-8.12 (m, 1H), 7.93-7.91 (m, 1H), 6.59-6.54 (m, 1H), 5.23-5.17 (m, 1H), 4.63 (d, J=15.7 Hz, 1H), 4.40 (d, J=15.8 Hz, 1H), 3.97-3.90 (m, 1H), 3.64-3.58 (m, 1H), 3.43-3.37 (m, 1H), 3.16-3.08 (m, 1H), 2.49 (s, 3H), 2.37-2.27 (m, 2H), 2.15-2.07 (m, 1H), 2.04-1.93 (m, 1H), 1.68-1.60 (m, 1H), 1.58-1.49 (m, 1H), 1.09 (s, 3H), 1.09 (s, 3H). MS (ESI) m/z: [M+H]+ Found 571.2. Example 121: 1H NMR (600 MHz, DMSO-d6) δ 9.50 (d, J=8.5 Hz, 1H), 8.43 (d, J=2.0 Hz, 1H), 8.20-8.13 (m, 1H), 7.96-7.89 (m, 1H), 6.62-6.49 (m, 1H), 5.25-5.17 (m, 1H), 4.63 (d, J=15.8 Hz, 1H), 4.49-4.38 (m, 1H), 3.99-3.88 (m, 1H), 3.66-3.57 (m, 1H), 3.45-3.36 (m, 1H), 3.17-3.07 (m, 1H), 2.50 (s, 3H), 2.38-2.27 (m, 2H), 2.16-2.07 (m, 1H), 2.04-1.94 (m, 1H), 1.70-1.60 (m, 1H), 1.60-1.47 (m, 1H), 1.09 (s, 3H), 1.09 (s, 3H). MS (ESI) m/z: [M+H]+ Found 571.2.
-
- The title compound (56% yield) was synthesized in a manner analogous to Example 18 using (S)-1-(7-((S)-2-cyclopropoxy-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)ethyl)imidazo[1,2-b]pyridazin-2-yl)-5,5,5-trifluoro-4,4-dimethylpentan-1-aminium 2,2,2-trifluoroacetate (Intermediate 58) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 4-methoxy-1,2,5-oxadiazole-3-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid. 1H NMR (500 MHz, DMSO-d6) δ 9.37 (d, J=8.5 Hz, 1H), 8.37 (d, J=2.0 Hz, 1H), 8.24-8.07 (m, 1H), 8.02-7.91 (m, 1H), 6.95 (s, 1H), 5.62-5.51 (m, 1H), 5.26-5.11 (m, 1H), 4.15-4.03 (m, 3H), 4.04-3.92 (m, 2H), 3.76-3.62 (m, 1H), 3.60-3.44 (m, 3H), 3.42-3.36 (m, 1H), 2.14-2.04 (m, 1H), 2.02-1.89 (m, 1H), 1.71-1.58 (m, 1H), 1.59-1.46 (m, 1H), 1.08 (s, 6H), 0.59-0.38 (m, 4H). MS (ESI) m/z: [M+H]+ Found 631.3.
-
- The title compound (48% yield) was prepared as described for the synthesis of Example 16 using 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5,6,6-tetrafluoro-1,3-diazepan-2-one (Intermediate 100) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. 1H NMR (500 MHz, DMSO-d6) δ 9.39 (d, J=9.0 Hz, 1H), 8.58 (d, J=2.1 Hz, 1H), 8.24 (s, 1H), 8.15-8.00 (m, 1H), 6.94 (t, J=4.7 Hz, 1H), 5.24-5.12 (m, 2H), 4.08-3.97 (m, 1H), 3.96-3.87 (m, 1H), 3.75-3.56 (m, 2H), 3.56-3.39 (m, 2H), 3.33 (s, 3H), 2.47 (s, 3H), 2.24-2.13 (m, 1H), 2.10-1.94 (m, 2H), 1.94-1.88 (m, 1H), 1.87-1.70 (m, 2H), 1.64-1.55 (m, 1H), 1.48-1.32 (m, 1H), 1.32-1.16 (m, 1H). MS (ESI) m/z: [M+H]+ Found 619.2.
-
- The title compound (53% yield) was synthesized in a manner analogous to Example 18 using 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5,6,6-tetrafluoro-1,3-diazepan-2-one (Intermediate 100) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 4-methoxy-1,2,5-oxadiazole-3-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid. 1H NMR (500 MHz, DMSO-d6) δ 9.21 (d, J=9.0 Hz, 1H), 8.52 (d, J=2.1 Hz, 1H), 8.14 (s, 1H), 8.09-7.89 (m, 1H), 7.00-6.75 (m, 1H), 5.19-4.97 (m, 2H), 4.02 (s, 3H), 3.99-3.91 (m, 1H), 3.89-3.78 (m, 1H), 3.67-3.50 (m, 2H), 3.50-3.31 (m, 2H), 3.26 (s, 3H), 2.18-2.03 (m, 1H), 2.03-1.85 (m, 2H), 1.85-1.61 (m, 3H), 1.60-1.45 (m, 1H), 1.38-1.12 (m, 2H). MS (ESI) m/z: [M+H]+ Found 635.3.
-
-
- The title compounds were prepared as described for the synthesis of Example 16 using 1-((S)-1-(2-((S*)-1-amino-3-(1-(trifluoromethyl)cyclopropyl)propyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 101) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. The resulting mixture was separated by chiral SFC (Whelk O1 SS, 5 μm, 250×30 mm, 25% methanol, 75% CO2) to afford two diastereomers. The first eluting isomer was designated as the (R*) isomer (Example 125) and the second eluting isomer was designated as the (S*) isomer (Example 126).The first eluting isomer, N—((R*)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-3-(1-(trifluoromethyl)cyclopropyl)propyl)-4-methyl-1,2,5-oxadiazole-3-carboxamide (Example 125) was isolated as a white powder (9.9% yield). The second eluting isomer, N—((S*)-1-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-3-(1-(trifluoromethyl)cyclopropyl)propyl)-4-methyl-1,2,5-oxadiazole-3-carboxamide (Example 126), was isolated as a white powder (49.4% yield). Example 125: 1H NMR (500 MHz, DMSO-d6) δ 9.48 (d, J=8.5 Hz, 1H), 8.36 (d, J=2.1 Hz, 1H), 8.16 (s, 1H), 7.99-7.85 (m, 1H), 6.95 (s, 1H), 5.58 (t, J=6.8 Hz, 1H), 5.31-5.12 (m, 1H), 3.97-3.80 (m, 2H), 3.76-3.62 (m, 1H), 3.62-3.44 (m, 3H), 3.34 (s, 3H), 2.49 (s, 3H), 2.27-2.13 (m, 1H), 2.12-1.98 (m, 1H), 1.77-1.59 (m, 2H), 0.96-0.85 (m, 2H), 0.84-0.66 (m, 2H). MS (ESI) m/z: [M+H]+ Found 587.2. Example 126: 1H NMR (500 MHz, DMSO-d6) δ 9.48 (d, J=8.5 Hz, 1H), 8.36 (d, J=2.2 Hz, 1H), 8.25-8.09 (m, 1H), 7.99-7.86 (m, 1H), 6.95 (s, 1H), 5.58 (t, J=6.8 Hz, 1H), 5.26-5.16 (m, 1H), 3.95-3.85 (m, 2H), 3.74-3.61 (m, 1H), 3.60-3.44 (m, 3H), 3.34 (s, 3H), 2.49 (s, 3H), 2.25-2.13 (m, 1H), 2.12-1.96 (m, 1H), 1.76-1.55 (m, 2H), 0.95-0.83 (m, 2H), 0.83-0.68 (m, 2H). MS (ESI) m/z: [M+H]+ Found 587.2.
-
- To a solution of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (119 mg, 0.240 mmol, Intermediate 3) and ethyl 4-(1,1-difluoroethyl)-1,2,5-oxadiazole-3-carboxylate (124 mg, 0.600 mmol) in ACN (0.48 mL) was added TEA (0.037 mL, 0.26 mmol). The mixture was transferred to a sealed pressure tube and heated at 90° C. for 15 h. The reaction mixture was cooled to rt, diluted with DMF, filtered, and purified by preparative HPLC (XBridge Prep C18, 5 μm, 50×150 mm; 10-100% MeCN/water (20 mM NH4OH)) to afford the title compound as a white solid (8% yield). 1H NMR (500 MHz, DMSO-d6) δ 9.69 (d, J=9.0 Hz, 1H), 8.39 (d, J=2.1 Hz, 1H), 8.19 (s, 1H), 8.03-7.77 (m, 1H), 6.95 (s, 1H), 5.68-5.48 (m, 1H), 5.34-5.17 (m, 1H), 3.98-3.85 (m, 2H), 3.76-3.62 (m, 1H), 3.61-3.44 (m, 4H), 3.34 (s, 3H), 2.16 (t, J=19.5 Hz, 3H), 2.08-1.96 (m, 2H), 1.90-1.70 (m, 3H), 1.66-1.57 (m, 1H), 1.45-1.21 (m, 2H). MS (ESI) m/z: [M+H]+ Found 619.2.
-
-
- The title compounds were prepared as described for the synthesis of Example 127 using ethyl 4-(2,2-difluorocyclopropyl)-1,2,5-oxadiazole-3-carboxylate in place of ethyl 4-(1,1-difluoroethyl)-1,2,5-oxadiazole-3-carboxylate. The resulting mixture was separated by chiral SFC (Whelk O1 SS 5 μm, 250×21 mm, Mobile phase: 20% methanol, 80% CO2) to afford two diastereomers. The first eluting isomer was designated as the (R*) isomer (Example 128) and the second eluting isomer was designated as the (S*) isomer (Example 129). The first eluting isomer, N—((S)-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)-4-((R*)-2,2-difluorocyclopropyl)-1,2,5-oxadiazole-3-carboxamide, was isolated as a white solid (Example 128, 2.3% yield). The second eluting isomer, N—((S)-(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2b]pyridazin-2-yl)(4,4-difluorocyclohexyl)methyl)-4-((S*)-2,2-difluorocyclopropyl)-1,2,5-oxadiazole-3-carboxamide, was isolated as a white solid (Example 129, 2.0% yield). Example 128: 1H NMR (500 MHz, DMSO-d6) δ 9.56 (d, J=8.9 Hz, 1H), 8.39 (d, J=2.1 Hz, 1H), 8.26 (s, 1H), 7.99-7.82 (m, 1H), 6.96 (s, 1H), 5.58 (t, J=6.8 Hz, 1H), 5.19 (t, J=8.6 Hz, 1H), 3.98-3.85 (m, 2H), 3.79-3.62 (m, 1H), 3.62-3.47 (m, 3H), 3.35 (s, 3H), 2.36-2.27 (m, 1H), 2.26-2.10 (m, 2H), 2.10-1.88 (m, 3H), 1.87-1.70 (m, 2H), 1.69-1.58 (m, 1H), 1.47-1.34 (m, 1H), 1.34-1.20 (m, 2H). MS (ESI) m/z: [M+H]+ Found 631.2. Example 129: 1H NMR (500 MHz, DMSO-d6) δ 9.58 (d, J=9.0 Hz, 1H), 8.38 (d, J=2.1 Hz, 1H), 8.26 (s, 1H), 7.93 (s, 1H), 6.96 (s, 1H), 5.58 (t, J=6.8 Hz, 1H), 5.19 (t, J=8.6 Hz, 1H), 3.97-3.86 (m, 2H), 3.77-3.63 (m, 1H), 3.60-3.48 (m, 3H), 3.34 (s, 3H), 2.35-2.26 (m, 1H), 2.26-2.17 (m, 1H), 2.17-2.10 (m, 1H), 2.09-1.95 (m, 2H), 1.95-1.88 (m, 1H), 1.87-1.69 (m, 2H), 1.68-1.58 (m, 1H), 1.46-1.35 (m, 1H), 1.33-1.22 (m, 2H). MS (ESI) m/z: [M+H]+ Found 631.2.
-
- The title compound (58% yield) was synthesized in a manner analogous to Example 18 using 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 3 Step F) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 4-(2,2,2-trifluoroethyl)-1,2,5-oxadiazole-3-carboxylic acid (Intermediate 102) in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid. 1H NMR (500 MHz, DMSO-d6) δ 9.63 (d, J=9.0 Hz, 1H), 8.38 (d, J=2.1 Hz, 1H), 8.23 (s, 1H), 8.05-7.79 (m, 1H), 6.95 (s, 1H), 5.70-5.46 (m, 1H), 5.20-5.04 (m, 1H), 4.24 (q, J=10.8 Hz, 2H), 4.04-3.82 (m, 2H), 3.77-3.63 (m, 1H), 3.63-3.43 (m, 3H), 3.34 (s, 3H), 2.28-2.16 (m, 1H), 2.07-1.87 (m, 3H), 1.86-1.68 (m, 2H), 1.63-1.56 (m, 1H), 1.45-1.17 (m, 2H). MS (ESI) m/z: [M+H]+ Found 637.2.
-
- The title compound (24% yield) was synthesized in a manner analogous to Example 18 using 1-((S)-1-(2-((S)-1-amino-5,5,5-trifluoro-4,4-dimethylpentyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one-4,4,6,6-d4 (Intermediate 74) in place of (S)-1-((2-(amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)methyl)tetrahydropyrimidin-2(1H)-one and 1,2,5-oxadiazole-3-carboxylic acid in place of 4-cyclopropyl-1,2,5-oxadiazole-3-carboxylic acid. The material was further purified by preparative acidic HPLC to provide the title compound as a white solid. 1H NMR (500 MHz, DMSO-d6) δ 9.62 (d, J=8.4 Hz, 1H), 9.37-9.29 (m, 1H), 8.46-8.38 (m, 1H), 8.32-8.24 (m, 1H), 7.97 (d, J=0.9 Hz, 1H), 6.94 (s, 1H), 5.56 (t, J=6.8 Hz, 1H), 5.27-5.18 (m, 1H), 4.04-3.95 (m, 2H), 3.46-3.36 (m, 1H), 2.21-2.07 (m, 1H), 2.07-1.92 (m, 1H), 1.69-1.61 (m, 1H), 1.59-1.47 (m, 1H), 1.09 (s, 6H), 0.62-0.37 (m, 4H). MS (ESI) m/z: [M+H]+ Found 605.3.
-
- Step A: 1,3-Dioxoisoindolin-2-yl (1R,5S)-bicyclo[3.2.0]heptane-3-carboxylate. The title compound was synthesized in a manner analogous to Intermediate 55 Step B using bicyclo[3.2.0]heptane-3-carboxylic acid in place of 2-cyclopropoxypropanoic acid. The material was purified by silica gel chromatography (0-60% EtOAc/hexanes) to provide the title compound in 46% yield.
- Step B: (S)—N-((1S*)-((1R,5S)-Bicyclo[3.2.0]heptan-3-yl)(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-2,4,6-trimethylbenzenesulfinamide. The title compound was synthesized in a manner analogous to Intermediate 57 Step A using 1,3-dioxoisoindolin-2-yl (1R,5S)-bicyclo[3.2.0]heptane-3-carboxylate (Step A) in place of 1,3-dioxoisoindolin-2-yl 2-cyclopropoxypropanoate.
- Step C: 1-((1S)-1-(2-((1S*)-Amino((1R,5S)-bicyclo[3.2.0]heptan-3-yl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one. The title compound was synthesized in a manner analogous to Intermediate 9 using (S)—N-((1S*)-((1R,5S)-bicyclo[3.2.0]heptan-3-yl)(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-2,4,6-trimethylbenzenesulfinamide (Step B) in place of tert-butyl ((R)-1-(7-((S*)-1-(((R)-tert-butylsulfinyl)amino)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)-2-((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)ethyl)carbamate.
- Step D: N-((1S*)-((1R,5S)-Bicyclo[3.2.0]heptan-3-yl)(7-((S)-1-(5,5-difluoro-2-oxotetrahydropyrimidin-1(2H)-yl)-2-methoxyethyl)imidazo[1,2-b]pyridazin-2-yl)methyl)-4-methyl-1,2,5-oxadiazole-3-carboxamide. The title compound was synthesized in a manner analogous to Example 16 using 1-((1S)-1-(2-((1S*)-amino((1R,5S)-bicyclo[3.2.0]heptan-3-yl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Step C) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. The material was purified by preparative HPLC (XBridge BEH C18, 5 μm, 30×150 mm; 35-75% MeCN/water (0.16% of 28% aqueous NH4OH)) to provide the title compound in 10% yield over Steps B, C and D. 1H NMR (400 MHz, DMSO-d6) δ 9.43 (d, J=8.8 Hz, 1H), 8.30 (d, J=2.1 Hz, 1H), 8.16 (s, 1H), 7.91-7.81 (m, 1H), 6.88 (s, 1H), 5.51 (t, J=6.8 Hz, 1H), 5.09 (t, J=8.9 Hz, 1H), 3.92-3.74 (m, 2H), 3.69-3.55 (m, 1H), 3.55-3.38 (m, 3H), 3.27 (s, 3H), 3.14-2.99 (m, 1H), 2.75-2.62 (m, 2H), 2.39 (s, 3H), 2.10-1.97 (m, 2H), 1.73-1.62 (m, 1H), 1.50-1.23 (m, 4H), 1.21-1.08 (m, 1H). MS (ESI) m/z: [M+H]+ Found 545.3.
-
- The title compound was synthesized in a manner analogous to Example 16 using 1-((S)-1-(2-((S)-1-amino-5,5-difluoro-4,4-dimethylhexyl)imidazo[1,2-b]pyridazin-7-yl)-2-methoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one (Intermediate 103) in place of 1-((S)-1-(2-((S)-amino(4,4-difluorocyclohexyl)methyl)imidazo[1,2-b]pyridazin-7-yl)-2-cyclopropoxyethyl)-5,5-difluorotetrahydropyrimidin-2(1H)-one hydrochloride. Purification was performed via SFC (Stationary phase: Chiralpak IC 5 μm, 250×30 mm, Mobile phase: 25% methanol, 75% CO2) to afford the title compound in 8% yield. 1H NMR (500 MHz, DMSO-d6) δ 9.47 (d, J=8.6 Hz, 1H), 8.36 (d, J=2.2 Hz, 1H), 8.17 (s, 1H), 7.95-7.91 (m, 1H), 6.95 (s, 1H), 5.58 (t, J=6.8 Hz, 1H), 5.22-5.14 (m, 1H), 3.94-3.85 (m, 2H), 3.68 (m, 1H), 3.52 (m, 3H), 3.34 (s, 3H), 2.49 (s, 3H), 2.08 (m, 1H), 2.01-1.88 (m, 1H), 1.54 (t, J=19.7 Hz, 4H), 1.42 (td, J=13.0, 4.4 Hz, 1H), 0.97 (s, 6H). MS (ESI) m/z: [M+H]+ Found 585.3.
- An antibody directed against the FLAG tag of IL-17A (SEQ ID NO: 1) is labeled with the HTRF donor chromophore (Europium-cryptate). IL-17A is present as a dimer that is “locked into” this quaternary structure due to the formation of loop-spanning intramolecular disulfide bridges. The construct of IL-17RA used in the assay excludes the outer-membrane portion of the receptor and is fused to a C-terminal 10×His tag (SEQ ID NO:2). An antibody directed against the His tag of the IL-17RA chimera is labeled with the HTRF acceptor chromophore (“D2”). The fluorescence-resonance energy transfer (FRET) depends on the vicinity of the donor chromophore to the acceptor, and interruption of the binding between the IL-17A and IL-17RA causes the reduction/loss of FRET. Therefore, this assay allows to evaluate the compound effect on the binding IL-17A and IL-17RA by monitoring the fluorescence intensity of donor vs acceptor. The assay was run using either Protocol 1 or Protocol 2 as described below.
- Protocol 1. 40 nl of 2-fold serial diluted compound solution for total 22 dilution points is added into each well of a 1536-well, white, low-volume, non-binding plate (Greiner #782904), then 2 μl of FLAG tagged IL-17A at 2×final concentration (2.5 nM) in solution of PBS+0.01% Triton-X100 is added to each well. The assay plate is briefly centrifuged then incubated for 1 h at rt. A mixed solution is prepared containing 2×5 nM 10HIS×IL-17RA, 2×2.5 nM Eu-anti-FLAG (CISBIO), 2×5 nM D2-anti-HIS (CISBIO) in PBS+0.01% Triton-X100+200 mM Potassium Fluoride (Sigma 60238) and 2 μl of mix is added to each well of the assay plate. The plate is briefly centrifuged then incubated for 2 h at rt. The HTRF intensities at the wavelength of donor (620 nm) and acceptor (665 nm) are measured using BMG Pherastar. The ratio between intensities at two wavelengths is calculated and plotted against the compound concentration and the data is fitted to a one-site competition model to yield IC50 of the compound.
- Protocol 2. 40 nl of 2-fold serial diluted compound solution for total 22 dilution points is added into each well of a 1536-well, white, low-volume, non-binding plate (Greiner #782904), then 2 μl of FLAG tagged IL-17A at 2×final concentration (1 nM) in solution of PBS+0.01% Triton-X100 is added to each well. The assay plate is briefly centrifuged then incubated for 1 h at rt. A mixed solution is prepared containing 2×5 nM 10HIS×IL-17RA, 2×2.5 nM Eu-anti-FLAG (CISBIO), 2×5 nM D2-anti-HIS (CISBIO) in PBS+0.01% Triton-X100+200 mM Potassium Fluoride (Sigma 60238) and 2 μl of mix is added to each well of the assay plate. The plate is briefly centrifuged then incubated for 2 h at rt. The HTRF intensities at the wavelength of donor (615 nm) and acceptor (665 nm) are measured using BMG Pherastar. The ratio between intensities at two wavelengths is calculated and plotted against the compound concentration and the data is fitted to a one-site competition model to yield IC50 of the compound.
- IL-17A acts directly on keratinocytes through binding to dimeric receptor IL-17RA/RC and drives the production of a number of inflammatory mediators known to be elevated in psoriasis lesional tissue. IL-17A small molecule inhibitors that block the IL-17A to interact with IL-17R would inhibit the IL-17A signaling in its targeted cells such as keratinocytes. The compound functional activity is evaluated for its impact on IL-17A-induced G-CSF production in human normal keratinocyte (NHK).
- Adult normal human keratinocytes are cultured in keratinocyte growth medium (Lonza) in a flask till reaching ˜90% confluence, then cells are transferred to a 384-well plate at density of 3000-4000 cell/well. Recombinant human IL-17A (Gibco PHC9174) is pre-incubated with titrated compound or DMSO for 1 h at rt then added to the cell culture plate. The final concentration of IL-17A is 5 ng/mL and DMSO is 0.2%, in the culture containing 5% FBS. Cells are cultured/treated for 24 h at 37° C. Supernatants are collected and G-CSF production is measured through HTRF technology using Human G-CSF Kit (CisBio). G-CSF concentration was extrapolated from the standard curve and IC50 is determined using GraphPad Prism. Cell viability is also evaluated using CellTiter-Glo kit (Promega) and effect of compound on cell viability is compared to DMSO control.
- In cases where the compound was tested more than once, the IC50 value shown is a simple average of the measured values.
- A: IC50<0.05 μM; B: 0.05 μM≤IC50≤0.1 μM; C: IC50>0.1 μM
—Not available -
TABLE 3 HTRF IC50 HTRF IC50 Example Protocol 1 Protocol 2 NHK IC50 1 A — C 2 B — C 3 A — A 4 B — C 5 A — B 6 C — C 7 A — A 8 A — B 9 A — A 10 B — A 11 A A A 12 A — A 13 B — A 14 B — A 15 A — A 16 A A A 17 A — A 18 C — C 19 C — C 20 A — A 21 C — A 22 B — B 23 C — C 24 C — C 25 B — A 26 A — A 27 C — C 28 A — C 29 C — C 30 B — C 31 C — C 32 C — C 33 B — C 34 C — C 35 — — A 36 — — A 37 — — A 38 — — A 39 — — A 40 — A A 41 — — A 42 — — A 43 — — A 44 — — A 45 — A A 46 — — A 47 — — C 48 — — C 49 — — C 50 — — A 51 — — A 52 — — A 53 — — A 54 — A B 55 — C C 56 — A A 57 — — A 58 — — A 59 — A A 60 — — A 61 — C C 62 — — B 63 — — A 64 — — A 65 — — A 66 — — B 67 — — C 68 — A A 69 — A A 70 — A A 71 — A A 72 — A A 73 — A A 74 — A A 75 — A A 76 — A A 77 — A A 78 — A A 79 — A A 80 — A A 81 — A A 82 — A A 83 — A A 84 — A A 85 A — C 86 A A A 87 — — A 88 — — A 89 — A A 90 — A A 91 — B C 92 C — C 93 C — C 94 C — C 95 C — C 96 A — C 97 B — C 98 — — C 99 C — A 100 C — C 101 A — A 102 — A A 103 — A A 104 — A A 105 — C C 106 — A A 107 — A A 108 — A A 109 — A A 110 — A A 111 — A A 112 — A B 113 — A A 114 — A A 115 — A B 116 — B C 117 — A A 118 — A C 119 — A A 120 — C C 121 — A A 122 — A A 123 — A B 124 — A B 125 — C C 126 — A A 127 — A A 128 — A A 129 — A A 130 — A A 131 — A C 132 — A A 133 — A A
While the foregoing specification teaches the principles of the present invention, with examples provided for the purpose of illustration, it will be understood that the practice of the invention encompasses all of the usual variations, adaptations and/or modifications as come within the scope of the following claims and their equivalents.
All documents cited herein are incorporated by reference. -
Name: IL-17A-Flag SEQ ID NO: 1 MATGSRTSLLLAFGLLCLPWLQEGSAGSDYKDDDDKGSGSGSLEVLFQGP GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSP WNLHRNEDPERYPSVIWEAQCRHLGCINADGNVDYHMNSVPIQQEILVLR REPPHCPNSFRLEKILVSVGCTCVTPIVHHVQ Name: IL-17RA SEQ ID NO: 2 MKFLVNVALVFMVVYISYIYALRLLDHRALVCSQPGLNCTVKNSTCLDDS WIHPRNLTPSSPKDLQIQLHFAHTQQGDLFPVAHIEWTLQTDASILYLEG AELSVLQLNTNERLCVRFEFLSKLRHHHRRWRFTFSHFVVDPDQEYEVTV HHLPKPIPDGDPNHQSKNFLVPDCEHARMKVTTPCMSSGSLWDPNITVET LEAHQLRVSFTLWNESTHYQILLTSFPHMENHSCFEHMHHIPAPRPEEFH QRSNVTLTLRNLKGCCRHQVQIQPFFSSCLNDCLRHSATVSCPEMPDTPE PIPDYMPLWGSGGHHHHHHHHHH*
Claims (37)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/935,360 US20230143050A1 (en) | 2021-09-27 | 2022-09-26 | Imidazopyridazine il-17 inhibitor compounds |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202163248566P | 2021-09-27 | 2021-09-27 | |
US202163273422P | 2021-10-29 | 2021-10-29 | |
US202263367546P | 2022-07-01 | 2022-07-01 | |
US17/935,360 US20230143050A1 (en) | 2021-09-27 | 2022-09-26 | Imidazopyridazine il-17 inhibitor compounds |
Publications (1)
Publication Number | Publication Date |
---|---|
US20230143050A1 true US20230143050A1 (en) | 2023-05-11 |
Family
ID=83692741
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US17/935,360 Pending US20230143050A1 (en) | 2021-09-27 | 2022-09-26 | Imidazopyridazine il-17 inhibitor compounds |
Country Status (9)
Country | Link |
---|---|
US (1) | US20230143050A1 (en) |
KR (1) | KR20240082369A (en) |
AU (1) | AU2022349687A1 (en) |
CA (1) | CA3233408A1 (en) |
CO (1) | CO2024003723A2 (en) |
IL (1) | IL311751A (en) |
PE (1) | PE20240935A1 (en) |
TW (1) | TW202330530A (en) |
WO (1) | WO2023049887A1 (en) |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2024115662A1 (en) | 2022-12-02 | 2024-06-06 | Leo Pharma A/S | Small molecule modulators of il-17 |
Family Cites Families (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
TWI752400B (en) * | 2019-01-07 | 2022-01-11 | 美商美國禮來大藥廠 | Il-17a inhibitors |
GB201909190D0 (en) * | 2019-06-26 | 2019-08-07 | Ucb Biopharma Sprl | Therapeutic agents |
-
2022
- 2022-09-26 AU AU2022349687A patent/AU2022349687A1/en active Pending
- 2022-09-26 IL IL311751A patent/IL311751A/en unknown
- 2022-09-26 PE PE2024000594A patent/PE20240935A1/en unknown
- 2022-09-26 KR KR1020247013352A patent/KR20240082369A/en unknown
- 2022-09-26 CA CA3233408A patent/CA3233408A1/en active Pending
- 2022-09-26 US US17/935,360 patent/US20230143050A1/en active Pending
- 2022-09-26 TW TW111136301A patent/TW202330530A/en unknown
- 2022-09-26 WO PCT/US2022/077001 patent/WO2023049887A1/en active Application Filing
-
2024
- 2024-03-22 CO CONC2024/0003723A patent/CO2024003723A2/en unknown
Non-Patent Citations (1)
Title |
---|
Branisteanu. Experimental and Therapeutic Medicine 23: 201, 2022, Pg. 1-13 (Year: 2022) * |
Also Published As
Publication number | Publication date |
---|---|
KR20240082369A (en) | 2024-06-10 |
WO2023049887A1 (en) | 2023-03-30 |
AU2022349687A1 (en) | 2024-05-16 |
PE20240935A1 (en) | 2024-04-30 |
CA3233408A1 (en) | 2023-03-30 |
CO2024003723A2 (en) | 2024-04-18 |
IL311751A (en) | 2024-05-01 |
TW202330530A (en) | 2023-08-01 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN107949559B (en) | Bicyclic fused heteroaryl or aryl compounds as IRAK4 modulators | |
US10442776B2 (en) | 3-alkyl-4-amido-bicyclic [4,5,0] hydroxamic acids as HDAC inhibitors | |
US20200291039A1 (en) | 4,6-SUBSTITUTED-PYRAZOLO[1,5-a]PYRAZINES AS JANUS KINASE INHIBITORS | |
US11702422B2 (en) | Imidazopyridazines as modulators of IL-17 | |
US10947252B2 (en) | Inhibitors of KEAP1-Nrf2 protein-protein interaction | |
US10975037B2 (en) | Phenyl substituted pyrazoles as modulators of RORγt | |
US11292791B2 (en) | Tetrahydro-imidazo quinoline compositions as CBP/P300 inhibitors | |
US10851116B2 (en) | Bicyclic amines as novel JAK kinase inhibitors | |
US10975057B2 (en) | 6-aminopyridin-3-yl pyrazoles as modulators of RORgT | |
US20210040127A1 (en) | Arginase inhibitors and methods of use | |
US20200079769A1 (en) | Thiadiazole irak4 compounds | |
US20230143050A1 (en) | Imidazopyridazine il-17 inhibitor compounds | |
US20240025917A1 (en) | Plasma kallikrein inhibitors | |
RU2761626C2 (en) | 5-(7H-PYRROLO[2,3-d]PYRIMIDINE-4-YL)-5-AZASPIRO[2.5]OCTANE-8-CARBOXYLIC ACID DERIVATIVES AS NEW JAK-KINASE INHIBITORS | |
US20230147458A1 (en) | Imidazopyridazine il-17 inhibitor compounds | |
US20140024646A1 (en) | Octahydro-cyclopentapyrrolyl antagonists of ccr2 | |
US20240124439A1 (en) | Pyrido[2,3-D]Imidazole Derivatives and Their Use As Inhibitors of ITK for the Treatment of Skin Disease | |
US20230067159A1 (en) | Ror-gamma-t inhibitor, preparation method thereof and use thereof | |
US12024524B2 (en) | Imidazopyridazines as modulators of IL-17 | |
CN118317962A (en) | Imidazopyridazine IL-17 inhibitor compounds | |
US20230348428A1 (en) | Plasma kallikrein inhibitors | |
US20240208994A1 (en) | Plasma kallikrein inhibitors | |
TW202333734A (en) | Use of pyrazolopyrimidine derivatives for the treatment of pi3kδ related disorders |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
AS | Assignment |
Owner name: JANSSEN PHARMACEUTICA NV, BELGIUM Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:JANSSEN RESEARCH & DEVELOPMENT, LLC;REEL/FRAME:063521/0283 Effective date: 20230501 Owner name: JANSSEN PHARMACEUTICA NV, BELGIUM Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:CILAG AG;REEL/FRAME:063521/0258 Effective date: 20230502 Owner name: CILAG AG, SWITZERLAND Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:XUE, XIAOHUA;REEL/FRAME:063521/0206 Effective date: 20230223 Owner name: JANSSEN RESEARCH & DEVELOPMENT, LLC, NEW JERSEY Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:BEHENNA, DOUGLAS C.;GOLDBERG, STEVEN D.;GORDON, DEANE;AND OTHERS;SIGNING DATES FROM 20221115 TO 20230427;REEL/FRAME:063528/0460 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |