US20220348889A1 - Protective enzymes - Google Patents

Protective enzymes Download PDF

Info

Publication number
US20220348889A1
US20220348889A1 US17/744,578 US202217744578A US2022348889A1 US 20220348889 A1 US20220348889 A1 US 20220348889A1 US 202217744578 A US202217744578 A US 202217744578A US 2022348889 A1 US2022348889 A1 US 2022348889A1
Authority
US
United States
Prior art keywords
enzyme
enzymes
lipoxygenase
host cell
lox
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
US17/744,578
Inventor
Patrick Magannig Boyle
Jeffery Ian Boucher
Michael Gregory Napolitano
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Ginkgo Bioworks Inc
Original Assignee
Ginkgo Bioworks Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Ginkgo Bioworks Inc filed Critical Ginkgo Bioworks Inc
Priority to US17/744,578 priority Critical patent/US20220348889A1/en
Assigned to GINKGO BIOWORKS, INC. reassignment GINKGO BIOWORKS, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: BOUCHER, Jeffrey Ian, NAPOLITANO, Michael G., BOYLE, PATRICK
Publication of US20220348889A1 publication Critical patent/US20220348889A1/en
Pending legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004Oxidoreductases (1.)
    • C12N9/0069Oxidoreductases (1.) acting on single donors with incorporation of molecular oxygen, i.e. oxygenases (1.13)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/44Oxidoreductases (1)

Definitions

  • Polymeric materials may be vulnerable to degradation from contaminants.
  • the present disclosure encompasses the recognition that certain enzymes and polypeptides may be useful to neutralize (e.g., prevent or mitigate) damage to polymeric compositions caused by lipids. Exposure to certain secreted biological fluids containing lipids (e.g., human sweat and skin oils) can cause some polymers to swell and degrade. In some embodiments, an enzyme of the present disclosure facilitates degradation of a lipid, and thereby prevents damage to a polymeric structure. In some embodiments, an enzyme useful in the context of the present disclosure facilitates degradation of harmful lipids such as fatty acids.
  • lipids e.g., human sweat and skin oils
  • the present disclosure provides methods and compositions that protect components of a composition (e.g., polymers) from damage by lipids (e.g., fatty acids) and/or other compounds that may cause damage.
  • lipids e.g., fatty acids
  • a lipid and/or other compound that may cause damage is present in a biological fluid.
  • methods and compositions are provided that include protective enzymes useful for breakdown of components in biological fluids that may cause damage to a polymer.
  • methods and compositions are provided where one or more protective enzymes are embedded within a composition.
  • methods and compositions are provided where one or more protective enzyme are applied to the surface of a composition (e.g., as a coating).
  • methods for promoting breakdown of one or more lipids (e.g., fatty acids) in a biological fluid, the method comprising contacting the biological fluid with an enzyme.
  • a method for promoting breakdown of one or more lipids in a biological fluid comprises contacting the biological fluid with a plurality of enzymes.
  • methods are provided for inhibiting swelling of a polymer caused by exposure to a fatty acid, the methods comprising contacting the polymer with an enzyme.
  • methods comprise contacting the polymer with a plurality of enzymes.
  • methods comprise embedding a plurality of enzymes within a polymer.
  • methods comprise coating a polymeric composition with a plurality of enzymes.
  • methods are provided for inhibiting swelling of a polymer caused by exposure to a fatty acid.
  • the methods comprise contacting the polymer with a polypeptide that binds the fatty acid.
  • a polypeptide forms a complex with the fatty acid.
  • a polypeptide binding to a fatty acid inhibits reactivity of the fatty acid.
  • a polypeptide binds to a fatty acid, and thereby prevents it from damaging a polymer.
  • a polypeptide inhibits diffusion of the fatty acid.
  • compositions comprising an enzyme embedded in a polymer. In some embodiments, compositions comprise two or more enzymes embedded in a polymer. In some embodiments, compositions comprise a polymer and two or more enzymes that promote breakdown of a fatty acid.
  • compositions comprising a polymer and one or more enzymes that promote breakdown of a fatty acid and one or more polypeptides that form a complex with a fatty acid.
  • a polypeptide binding to a fatty acid inhibits the reactivity of the fatty acid.
  • a polypeptide binds to a fatty acid, and thereby prevents it from damaging a polymer.
  • a polypeptide inhibits diffusion of the fatty acid.
  • topical formulations comprising one or more enzymes that promote breakdown of a fatty acid. In some embodiments, topical formulations are provided comprising one or more polypeptides that form a complex with a fatty acid.
  • compositions comprising one or more enzymes that promote breakdown of a fatty acid and one or more polypeptides that form a complex with a fatty acid.
  • polypeptide binding to a fatty acid inhibits the reactivity of the fatty acid.
  • a polypeptide binds to a fatty acid, thereby prevent it from damaging a polymer.
  • a polypeptide inhibits diffusion of the fatty acid.
  • a biological fluid is secreted by a human.
  • a biological fluid is or comprises human sweat.
  • a biological fluid is or comprises sebum.
  • a lipid in a biologic fluid is an unsaturated fatty acid.
  • unsaturated fatty acids include palmitoleic acid, oleic acid, myristoleic acid, linoleic acid, and/or arachidonic acid.
  • a fatty acid is an oleic acid.
  • a fatty acid is a linoleic acid.
  • a biological fluid comprises a plurality of fatty acids to be neutralized.
  • enzymes for use in a method or composition of the present disclosure include dioxygenases, monooxygenases, heme peroxidases, P450s, and combinations and/or variants thereof.
  • an enzyme is a dioxygenase.
  • an enzyme is a monooxygenase.
  • methods comprise contacting the bodily fluid with a plurality of enzymes.
  • an enzyme is of animal origin. In some embodiments, an enzyme is of plant origin. In some embodiments, an enzyme is of fungal origin. In some embodiments, an enzyme is of bacterial origin. In some embodiments, an enzyme is a cyanobacterial enzyme. In some embodiments, an enzyme is from archaea.
  • an enzyme catalyzes beta or omega oxidation. In some embodiments, an enzyme catalyzes hydroperoxidation at the 10S and/or 12S-carbon of a fatty acid (e.g., an oleic acid). In some embodiments, an enzyme for use in the context of the present disclosure does not require adenosine triphosphate (ATP) for catalytic activity.
  • ATP adenosine triphosphate
  • an enzyme is a lipoxygenase and/or has lipoxygenase activity (e.g., 10S-LOX activity).
  • an enzyme for use in the context of the present disclosure is a cyanobacterial enzyme with LOX activity (e.g., 10S-LOX activity) or variant thereof.
  • a cyanobacterial prostaglandin-endoperoxide synthase enzyme or variant thereof has LOX activity (e.g., 10S-LOX activity).
  • a cyanobacterial heme peroxide synthase enzyme or variant thereof has LOX activity (e.g., 105-LOX activity).
  • an enzyme with LOX (e.g., 10S-LOX activity) catalytic activity comprises an amino acid sequence of any one of SEQ. ID NOs: 13-15.
  • an enzyme with LOX (e.g., 10S-LOX activity) catalytic activity comprises an amino acid sequence that is at least about 50% (e.g., at least about 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) identical to any one of SEQ ID NOs: 13-15.
  • an enzyme is a lipoxygenase.
  • a lipoxygenase has 10S-LOX activity.
  • a 10S-LOX comprises an amino acid sequence of any one of SEQ ID NOs: 1-12.
  • a 10S-LOX enzyme has an amino acid sequence that is at least about 50% (e.g., at least about 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) identical to any one of SEQ ID NOs: 1-12.
  • a 10S-LOX comprises an amino acid sequence of SEQ ID NO: 13.
  • a 10S-LOX comprises an amino acid sequence of SEQ ID NO: 14. In some embodiments, a 10S-LOX comprises an amino acid sequence of SEQ ID NO: 15. In some embodiments, a 10S-LOX enzyme comprises an amino acid sequence that is at least about 50% (e.g., at least about 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) identical to any one of SEQ ID NOs: 13-15. In some embodiments, an enzyme is a lipoxygenase that catalyzes hydroperoxidation at positions 9 and/or 13 of a fatty acid.
  • an enzyme is a lipoxygenase that catalyzes hydroperoxidation at positions 9S and/or 13S of a fatty acid. In some embodiments, an enzyme is a lipoxygenase that catalyzes hydroperoxidation at positions 9R and/or 13R of a fatty acid.
  • an enzyme is embedded in a polymer. In some embodiments, an enzyme is applied to the surface of a polymer. In some embodiments, a polymer is a component of a device. In some embodiments, a device is an electronic device.
  • FIG. 1 depicts the chemical reaction catalyzed by LOX enzymes and reduction reaction used to generate a product detected during the enzyme assay.
  • FIG. 2 depicts enzyme activity data generated by assaying various LOX enzymes for activity on oleic acid and detecting the 10-HOME product shown in FIG. 1 .
  • FIG. 3 depicts swelling of a representative adhesive upon exposure to an exemplary fatty acid, oleic acid.
  • X-axis indicates the number of hours post-exposure;
  • Y-axis indicates the relative area of an adhesive disk.
  • FIG. 4 depicts swelling of a representative adhesive upon exposure to an exemplary fatty acid, oleic acid, using a second assay.
  • X-axis indicates the number of hours post-exposure;
  • Y-axis indicates the relative area of an adhesive disk.
  • FIG. 5 is a schematic illustrating relatedness of certain enzymes for 10S-LOX activity.
  • Comparable refers to two or more agents, entities, situations, sets of conditions, etc., that may not be identical to one another but that are sufficiently similar to permit comparison there between so that one skilled in the art will appreciate that conclusions may reasonably be drawn based on differences or similarities observed.
  • comparable sets of conditions, circumstances, individuals, or populations are characterized by a plurality of substantially identical features and one or a small number of varied features.
  • the term “designed” refers to an agent (i) whose structure is or was selected by the hand of man; (ii) that is produced by a process requiring the hand of man; and/or (iii) that is distinct from natural substances and other known agents.
  • Engineered refers to the aspect of having been manipulated by the hand of man.
  • a polynucleotide is considered to be “engineered” when two or more sequences, that are not linked together in that order in nature, are manipulated by the hand of man to be directly linked to one another in the engineered polynucleotide.
  • a cell or organism is considered to be “engineered” if it has been manipulated so that its genetic information is altered (e.g., new genetic material not previously present has been introduced, for example by transformation, mating, somatic hybridization, transfection, transduction, or other mechanism, or previously present genetic material is altered or removed, for example by substitution or deletion mutation, or by mating protocols).
  • progeny of an engineered polynucleotide or cell are typically still referred to as “engineered” even though the actual manipulation was performed on a prior entity.
  • an “enzyme” is a molecule that catalyzes one or more biochemical reactions.
  • an enzyme is or comprises a polypeptide and/or RNA.
  • an enzyme is a polypeptide.
  • an enzyme is a polypeptide and that ranges from about 50 amino acid residues to 2,500 amino acid residues. Enzymes can be classified according to the reaction they catalyze.
  • enzymes include oxidoreductases (e.g., catalyze oxidation/reduction reactions), transferases (e.g., transfer a functional group, such as, for example, a methyl or phosphate group), hydrolases (e.g., catalyze hydrolysis of various bonds), lyases (e.g., cleave various bonds by means other than hydrolysis and oxidation), isomerases (e.g., catalyze isomerization changes within a single molecule) and ligases (e.g., join two molecules with covalent bonds).
  • oxidoreductases e.g., catalyze oxidation/reduction reactions
  • transferases e.g., transfer a functional group, such as, for example, a methyl or phosphate group
  • hydrolases e.g., catalyze hydrolysis of various bonds
  • lyases e.g., cleave various bonds by means other than hydrolysis and oxid
  • a member of an enzyme class or family shows significant sequence homology or identity with, shares a common sequence motif (e.g., a characteristic sequence element) with, and/or shares a common activity (in some embodiments at a comparable level or within a designated range) with a reference enzyme of the class; in some embodiments with all enzymes within the class).
  • a common sequence motif e.g., a characteristic sequence element
  • shares a common activity in some embodiments at a comparable level or within a designated range
  • a member enzyme shows an overall degree of sequence homology or identity with a reference enzyme that is at least about 30-40%, and is often greater than about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more and/or includes at least one region (e.g., a conserved region that may in some embodiments be or comprise a characteristic sequence element) that shows very high sequence identity, often greater than 90% or even 95%, 96%, 97%, 98%, or 99%.
  • a conserved region that may in some embodiments be or comprise a characteristic sequence element
  • Such a conserved region usually encompasses at least 3-4 and often up to 20 or more amino acids; in some embodiments, a conserved region encompasses at least one stretch of at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or more contiguous amino acids.
  • an enzyme suitable for use in the context of the present disclosure is of animal origin. In some embodiments, an enzyme suitable for use in the context of the present disclosure is of plant origin. In some embodiments, an enzyme suitable for use in the context of the present disclosure is of fungal origin. In some embodiments, an enzyme suitable for use in the context of the present disclosure is of bacterial origin.
  • a “functional” biological molecule is a biological molecule in a form in which it exhibits a property and/or activity by which it is characterized.
  • homology refers to the overall relatedness between polymeric molecules, e.g., between nucleic acid molecules (e.g., DNA molecules and/or RNA molecules) and/or between polypeptide molecules.
  • polymeric molecules are considered to be “homologous” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical.
  • polymeric molecules are considered to be “homologous” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% similar (e.g., containing residues with related chemical properties at corresponding positions).
  • a human is an embryo, a fetus, an infant, a child, a teenager, an adult, or a senior citizen.
  • identity refers to the overall relatedness between polymeric molecules, e.g., between nucleic acid molecules (e.g., DNA molecules and/or RNA molecules) and/or between polypeptide molecules.
  • polymeric molecules are considered to be “substantially identical” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical.
  • Calculation of the percent identity of two nucleic acid or polypeptide sequences can be performed by aligning the two sequences for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second sequences for optimal alignment and non-identical sequences can be disregarded for comparison purposes).
  • the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or substantially 100% of the length of a reference sequence. The nucleotides at corresponding positions are then compared.
  • the molecules are identical at that position.
  • the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences.
  • the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
  • Polypeptide As used herein refers to any polymeric chain of amino acids.
  • a polypeptide has an amino acid sequence that occurs in nature.
  • a polypeptide has an amino acid sequence that does not occur in nature.
  • a polypeptide has an amino acid sequence that is engineered in that it is designed and/or produced through action of the hand of man.
  • a polypeptide may comprise or consist of natural amino acids, non-natural amino acids, or both.
  • a polypeptide may comprise D-amino acids, L-amino acids, or both.
  • a polypeptide may include one or more pendant groups or other modifications, e.g., modifying or attached to one or more amino acid side chains, at the polypeptide's N-terminus, at the polypeptide's C-terminus, or any combination thereof.
  • pendant groups or modifications may be selected from the group consisting of acetylation, amidation, lipidation, methylation, pegylation, etc., including combinations thereof.
  • a useful polypeptide may comprise or consist of a fragment of a parent polypeptide.
  • the term “peptide” is generally used to refer to a polypeptide having a length of less than about 100 amino acids, less than about 50 amino acids, less than 20 amino acids, or less than 10 amino acids.
  • Recombinant As used herein, is intended to refer to polypeptides that are designed, engineered, prepared, expressed, created, manufactured, and/or or isolated by recombinant means, such as polypeptides expressed using a recombinant expression vector transfected into a host cell; polypeptides isolated from a recombinant, combinatorial human polypeptide library; polypeptides isolated from an animal (e.g., a mouse, rabbit, sheep, fish, etc.) that is transgenic for or otherwise has been manipulated to express a gene or genes, or gene components that encode and/or direct expression of the polypeptide or one or more component(s), portion(s), element(s), or domain(s) thereof; and/or polypeptides prepared, expressed, created or isolated by any other means that involves splicing or ligating selected nucleic acid sequence elements to one another, chemically synthesizing selected sequence elements, and/or otherwise generating a nucleic acid that encodes and/or directs expression of the polypeptide
  • one or more of such selected sequence elements is designed in silico. In some embodiments, one or more such selected sequence elements results from mutagenesis (e.g., in vivo or in vitro) of a known sequence element, e.g., from a natural or synthetic source.
  • compositions that protect components of a composition (e.g., polymers) from damage by lipids (e.g., fatty acids) and/or other compounds that may cause damage.
  • lipids e.g., fatty acids
  • compositions, methods, systems, and kits that include a polypeptide and/or an enzyme that catalyzes, degrades, modifies and/or sequesters a lipid.
  • enzymes useful for breakdown of compounds e.g., fatty acids
  • a composition e.g., polymers
  • enzymes for use in the context of the present disclosure include dioxygenases, monooxygenases, heme peroxidases, P450s, and combinations and/or variants thereof
  • each of the enzymes can degrade an unsaturated fatty acid.
  • an enzyme specifically degrades one or more unsaturated fatty acids.
  • compositions and methods of the present disclosure comprise two or more enzymes that promote breakdown of compounds that cause damage. In some embodiments, two or more enzymes each promote breakdown of unsaturated fatty acids.
  • compositions and methods of the present disclosure comprise a plurality of enzymes.
  • each of the enzymes can degrade an unsaturated fatty acid.
  • each of the plurality of enzymes exhibit different substrate specificity for one or more unsaturated fatty acids.
  • an enzyme is of animal origin. In some embodiments, an enzyme is of plant origin. In some embodiments, an enzyme is of fungal origin. In some embodiments, an enzyme is of bacterial origin. In some embodiments, an enzyme is a cyanobacterial enzyme. In some embodiments, an enzyme is from archaea.
  • an enzyme catalyzes beta or omega oxidation. In some embodiments, an enzyme catalyzes beta or omega oxidation of fatty acids. In some embodiments, an enzyme has activity at the 5, 8, 9, 10, 11, 12, 13 or 15-carbon of a fatty acid. In some embodiments, an enzyme has activity at a 5R, 5S, 8R, 8S, 9R, 9S, 10S, 11R, 11S, 12R, 12S, 13R, 13S and/or 15S position of a fatty acid. In some embodiments, an enzyme has activity at the 10S and/or 12S-carbon of a fatty acid (e.g., an oleic acid). In some embodiments, an enzyme for use in the context of the present disclosure does not require adenosine triphosphate (ATP) for catalytic activity.
  • ATP adenosine triphosphate
  • a polymeric composition comprises an enzyme within a range from about 0.0001% to about 20% on w/w basis. In some embodiments, a polymeric composition comprises an enzyme within a range bounded by a lower limit and an upper limit, the upper limit being larger than the lower limit.
  • the lower limit may be about 0.0001% , 0.0002%, 0.0005%, 0.001%, 0.002%, 0.005%, 0.01%, 0.02%, 0.05%, 0.1%, 0.2%, 0.5%, 1%, 2%, 5%, or 10%.
  • the upper limit may be about 0.0005%, 0.001%, 0.002%, 0.005%, 0.01%, 0.02%, 0.05%, 0.1%, 0.2%, 0.5%, 1%, 2%, 5%, 10%, or 20%.
  • an enzyme for use in the context of the present disclosure is a lipoxygenase.
  • Lipoxygenase (LOX) enzymes catalyze oxygen-dependent oxidation of fatty acid substrates (for example, linoleic acid and arachidonic acid) to form hydroperoxy-fatty acid products.
  • LOX enzymes are categorized as dioxygenases. Certain LOX enzymes have been purified from diverse organisms that display a broad range of substrate specificity and product specificity (e.g., site of oxidation within a fatty acid). LOX enzymes are widely expressed in animals, plants, and fungi, and cyanobacteria.
  • lipoxygenases are a suitable class of enzymes for the degradation of unsaturated fatty acids (UFA) such as, for example, oleic acid.
  • UFA unsaturated fatty acids
  • LOX enzymes may convert unsaturated fatty acids to hydroperoxides, which can spontaneously degrade at the site of the double bond if not stabilized.
  • lipoxygenases may utilize either iron or manganese in their active sites.
  • a LOX does not require ATP or other cofactors for catalytic activity.
  • the present disclosure encompasses the recognition that activity independent of ATP or other cofactors is a desirable characteristic for certain applications.
  • a lipoxygenase suitable for use in the context of the present disclosure is of animal origin. In some embodiments, a lipoxygenase suitable for use in the context of the present disclosure is of plant origin. In some embodiments, a lipoxygenase suitable for use in the context of the present disclosure is of fungal origin. In some embodiments, a lipoxygenase suitable for use in the context of the present disclosure is of bacterial origin. In some embodiments, a lipoxygenase suitable for use in the context of the present disclosure is of cyanobacterial origin. In some embodiments, a lipoxygenase suitable for use in the context of the present disclosure is from archaea.
  • a LOX can catalyze hydroperoxidation of a fatty acid substrate.
  • a fatty acid substrate is an unsaturated fatty acid.
  • a LOX facilitates catalysis of palmitoleic acid, oleic acid, myristoleic acid, linoleic acid, and/or arachidonic acid.
  • a LOX facilitates partial or complete degradation of one or more unsaturated fatty acids. In some embodiments, a LOX facilitates partial or complete degradation of palmitoleic acid, oleic acid, myristoleic acid, linoleic acid, and/or arachidonic acid.
  • a LOX has activity (i.e., can catalyze hydroperoxidation) at the 5, 8, 9, 10, 11, 12, 13 or 15-carbon of a fatty acid. In some embodiments, a LOX has activity (i.e., can catalyze hydroperoxidation) at a 5R, 5S, 8R, 8S, 9R, 9S, 10S, 11R, 11S, 12R, 12S, 13R, 13S and/or 15S position of a fatty acid.
  • a lipoxygenase catalyzes hydroperoxidation at the 10-carbon position of a fatty acid.
  • a lipoxygenase catalyzes hydroperoxidation at the 12- carbon position of a fatty acid.
  • a LOX catalyzes hydroperoxidation at the 10S and/or 12S-carbon of a fatty acid (i.e., has 10S-LOX or 12S-LOX activity).
  • a lipoxygenase has 10S-LOX activity.
  • a lipoxygenase is a 10S-LOX from a plant, fungus, bacteria, or archaea.
  • a 10S-LOX facilitates catalysis of oleic acid.
  • a 10S-LOX is from cyanobacteria.
  • a 10S-LOX is from cyanobacteria and facilitates catalysis of oleic acid.
  • a common source of LOX is from plants (for example soybean), with specificity for an unsaturated fatty acid in which LOX activity occurs at the 9- or 13-carbon.
  • a lipoxygenase is a 9/13-LOX, for example a 9/13-LOX from plants, bacteria, archaea, or fungi.
  • a 10S-LOX is or comprises a sequence any one of SEQ ID NOs: 1 to 12.
  • a 10S-LOX enzyme has a sequence that is at least about 50% (e.g., at least about 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 1 to 12.
  • circular permutated variants of any enzyme or polypeptide described herein are redefined by genetic engineering. Circular permutation methods have been described in the art. For example, Graf and Schachmann, (Proc. Natl. Acad. Sci. USA (1996) 93, 11591-11596), provide an overview of enzymes and other proteins with which circular permutation methods have been carried out. Methods for engineering circular permutated polypeptide (e.g., enzyme) variants are known in the art, see, e.g., US Pat. Publ. No. 2010/0196991. In some embodiments, a circular permutation variant includes a linker.
  • an enzyme for use in the context of the present disclosure is a cyanobacterial enzyme with LOX activity (e.g., 10S-LOX activity) or variant thereof.
  • a cyanobacterial prostaglandin-endoperoxide synthase enzyme or variant thereof has LOX activity (e.g., 10S-LOX activity).
  • an enzyme with LOX catalytic activity (e.g., 10S-LOX activity) comprises an amino acid sequence of SEQ ID NO: 13 and/or a circular permutation thereof.
  • a cyanobacterial heme peroxide synthase enzyme or variant thereof has LOX activity (e.g., 10S-LOX activity).
  • an enzyme with LOX (e.g., 10S-LOX activity) catalytic activity comprises an amino acid sequence of SEQ ID NO: 14 and/or a circular permutation thereof.
  • an enzyme with LOX (e.g., 10S-LOX activity) catalytic activity comprises an amino acid sequence of SEQ ID NO: 15 and/or a circular permutation thereof.
  • a sequence similarity network of LOX enzymes is tested for activity on oleic acid and depicted in FIG. 5 .
  • Gray nodes indicate 10S-LOX activity. These sequences are distinct from 9/13-LOX from plants, bacteria, and fungi, and are sometimes annotated as heme peroxidases.
  • the cluster contains primarily cyanobacterial enzymes contains the 10S-LOXs that are active on oleic acid.
  • a fatty acid to be degraded is oleic acid
  • a LOX enzyme specific for action on the 10S- or 12S-carbon of oleic acid is employed in a composition or method of the present disclosure.
  • dioxygenases other than LOX as well as monooxygenases, are suitable for use in the context of the present disclosure.
  • an enzyme is a dioxygenase.
  • an enzyme is a monooxygenase.
  • a dioxygenase catalyzes oxidation of a fatty acid substrate.
  • a fatty acid substrate is an unsaturated fatty acid.
  • a dioxygenase catalyzes oxidation of palmitoleic acid, oleic acid, myristoleic acid, linoleic acid, and/or arachidonic acid.
  • a dioxygenase catalyzes the partial or complete degradation of one or more unsaturated fatty acids. In some embodiments, a dioxygenase facilitates partial or complete degradation of palmitoleic acid, oleic acid, myristoleic acid, linoleic acid, and/or arachidonic acid.
  • a monooxygenase catalyzes oxidation of a fatty acid substrate.
  • a fatty acid substrate is an unsaturated fatty acid.
  • a monooxygenase catalyzes oxidation of palmitoleic acid, oleic acid, myristoleic acid, linoleic acid, and/or arachidonic acid.
  • a monooxygenase catalyzes the partial or complete degradation of one or more unsaturated fatty acids. In some embodiments, a monooxygenase facilitates partial or complete degradation palmitoleic acid, oleic acid, myristoleic acid, linoleic acid, and/or arachidonic acid.
  • a dioxygenase and/or a monooxygenase is from a plant, bacteria, archaea, or fungus. In some embodiments, a dioxygenase and/or a monooxygenase facilitates catalysis of oleic acid. In some embodiments, a dioxygenase and/or a monooxygenase is from cyanobacteria. In some embodiments, a dioxygenase and/or a monooxygenase is from cyanobacteria and facilitates catalysis of oleic acid.
  • an enzyme catalyzes beta or omega oxidation. In some embodiments, an enzyme catalyzes oxidation or hydroperoxidation at the 5, 8, 9, 10, 11, 12, 13 or 15-carbon of a fatty acid. In some embodiments, an enzyme catalyzes oxidation or hydroperoxidation ata 5R, 5S, 8R, 8S, 9R, 9S, 10S, 11R, 11S, 12R, 12S, 13R, 13S and/or 15S position of a fatty acid. In some embodiments, an enzyme catalyzes oxidation or hydroperoxidation of the 10S and/or 12S-carbon of a fatty acid (e.g., an oleic acid). In some embodiments, an enzyme for use in the context of the present disclosure does not require adenosine triphosphate (ATP) for catalytic activity.
  • ATP adenosine triphosphate
  • a monooxygenase and/or dioxygenase in the context of the present disclosure can catalyze partial or complete degradation of a fatty acid (e.g., an unsaturated fatty acid).
  • activity of a monooxygenase and/or dioxygenase may be independent of cofactors (e.g., ATP).
  • activity of a monooxygenase and/or dioxygenase may require a cofactor (e.g., ATP).
  • compositions and methods of the present disclosure comprise a LOX and one or more other dioxygenases that promote breakdown of compounds that cause damage to polymers. In some embodiments, compositions and methods of the present disclosure comprise a LOX and one or more monooxygenases that promote breakdown of compounds that cause damage to polymers. In some embodiments, compositions and methods of the present disclosure comprise a plurality of enzymes. In some embodiments, each of the enzymes can degrade an unsaturated fatty acid. In some embodiments, each of the plurality of enzymes exhibit different substrate specificity for one or more unsaturated fatty acids.
  • an enzyme suitable for use in the context of the present disclosure is a P450.
  • Cytochrome P450 enzymes form a superfamily of hemoproteins found in bacteria, archaea and eukaryotes.
  • cytochrome P450 acts as a monooxygenase, by inserting one oxygen atom of molecular oxygen into a substrate molecule, while the other oxygen atom is reduced to water.
  • a P450 catalytic reaction may require two electrons for the activation of molecular oxygen.
  • P450s from eukaryotes use NADPH as the external reductant and source of electrons. Each electron may be transferred one at a time to a cytochrome P450 active site.
  • an electron transfer may be donated by an electron donor protein, e.g., a cytochrome P450 reductase (CPR).
  • CPR cytochrome P450 reductase
  • a CPR may be an electron donor protein for several different P450s from the same or from different organisms.
  • P450s can also be coupled to a cytochrome b5 protein that can act as the electron donor protein or can improve the efficiency of the electron transfer from the CPR to the P450.
  • cytochrome b5 protein can act as the electron donor protein or can improve the efficiency of the electron transfer from the CPR to the P450.
  • P450s and CPRs are generally membrane-bound proteins and are associated with the endoplasmic reticulum. These proteins may be anchored to the membrane by an N-terminal trans-membrane helix.
  • P450s have low substrate specificity and are therefore able to catalyze the oxidation of many diverse structures. Many P450s have a particular region and stereo-selectivity with a given substrate; however they produce a mixture of several products from a particular substrate. In some embodiments, a P450 is involved in breakdown and detoxification of molecules (e.g., xenobiotics). In some embodiments, a P450 is involved in a biosynthetic pathway. P450s involved in a biosynthetic pathway may exhibit specificity for certain types of substrates and region and stereo-selectivity. In some embodiments, a P450 is from a plant, bacteria, or fungus.
  • P450s can be found in nature and particularly in plants.
  • One plant genome can contain several hundreds of genes encoding for P450s.
  • a P450 is active on one or more unsaturated fatty acids. In some embodiments, a P450 facilitates catalysis of palmitoleic acid, oleic acid, myristoleic acid, linoleic acid, and/or arachidonic acid. In some embodiments, a P450 facilitates catalysis of oleic acid.
  • compositions and methods of the present disclosure comprise a P450 and another enzyme (e.g., a dioxygenase, monooxygenase, heme peroxidase) that promote breakdown of compounds that cause damage.
  • compositions and methods of the present disclosure comprise a plurality of enzymes.
  • each of the enzymes can act on an unsaturated fatty acid.
  • each of the enzymes can degrade an unsaturated fatty acid.
  • each of the plurality of enzymes exhibit different substrate specificity for one or more unsaturated fatty acids.
  • an enzyme for use in the context of the present disclosure is a heme peroxidase.
  • a heme peroxidase has a ferriprotoporphyrin IX prosthetic group located at the active site.
  • the plant enzymes horseradish peroxidase (HRP) and plant soyabean peroxidase (SBP) are examples of plant heme peroxidases.
  • a heme peroxidase facilitates catalysis of one or more unsaturated fatty acids. In some embodiments, a heme peroxidase facilitates catalysis of palmitoleic acid, oleic acid, myristoleic acid, linoleic acid, and/or arachidonic acid. In some embodiments, a heme peroxidase facilitates catalysis of oleic acid.
  • compositions and methods of the present disclosure comprise a heme peroxidase and another enzyme (e.g., a dioxygenase, monooxygenase, P450) that promotes breakdown of compounds that cause damage to polymers.
  • compositions and methods of the present disclosure comprise a plurality of enzymes.
  • each of the enzymes facilitates catalysis of an unsaturated fatty acid.
  • each of the enzymes can degrade an unsaturated fatty acid.
  • each of the plurality of enzymes exhibit different substrate specificity for one or more unsaturated fatty acids.
  • protection of materials from damaging lipids is additionally or alternatively performed via non-catalytic binding of a protein to a lipid.
  • binding to a lipid results in formation of a protein-lipid complex that would be less able to diffuse into the material being protected.
  • Binding of a lipid could also limit or prevent it from reacting with other materials, such as a polymeric material or other material to be protected.
  • compositions comprising one or more enzymes that promote breakdown of a fatty acid and one or more polypeptides that form a complex with a fatty acid.
  • Enzymes and polypeptides as described herein may be produced from nucleic acid molecules using molecular biological methods known to the art. Nucleic acid molecules are inserted into a vector that is able to express the polypeptide when introduced into an appropriate host cell. Appropriate host cells include, but are not limited to, bacterial, yeast, insect, and mammalian cells. Any of the methods known to one skilled in the art for the insertion of DNA fragments into a vector may be used to construct expression vectors encoding the enzymes of the present disclosure under control of transcriptional/translational control signals.
  • nucleic acid molecules in accordance with the present disclosure may be regulated by a second nucleic acid sequence so that the molecule is expressed in a host transformed with the recombinant DNA molecule.
  • expression of the nucleic acid molecules of the present disclosure may be controlled by promoter and/or enhancer elements, which are known in the art.
  • Nucleic acid constructs of the present disclosure may be inserted into an expression vector or viral vector by methods known to the art, and nucleic acid molecules operatively linked to an expression control sequence.
  • nucleic acid sequences that encode enzyme as described herein may be modified to include codons that are optimized for expression in a particular cell type or organism.
  • Codon optimized sequences are synthetic sequences, and preferably encode the identical polypeptide (or a biologically active fragment of a full length polypeptide which has substantially the same activity as the full length polypeptide) encoded by the non-codon optimized parent polynucleotide.
  • the coding region of the genetic material encoding antibody components in whole or in part, may include an altered sequence to optimize codon usage for a particular cell type (e.g., a eukaryotic or prokaryotic cell).
  • the coding sequence for an enzyme as described herein may be optimized for expression in bacterial cells, fungal cells, plant cells, mammalian cells, etc. Such a sequence may be described as a codon-optimized sequence.
  • An expression vector containing a nucleic acid molecule is transformed into a suitable host cell to allow for production of the protein encoded by the nucleic acid constructs.
  • exemplary host cells include prokaryotes (e.g., E. coli ) and eukaryotes (e.g., yeast cells or mammalian cells).
  • Host cells transformed with an expression vector are grown under conditions permitting production of an enzyme of the present disclosure followed by recovery of the enzyme or polypeptide.
  • Enzyme and polypeptides of the present disclosure may be purified by any technique, which allows for the subsequent formation of a stable enzyme.
  • enzymes may be recovered from cells either as soluble polypeptides or as inclusion bodies, from which they may be extracted quantitatively by 8 M guanidinium hydrochloride and dialysis.
  • conventional ion exchange chromatography, hydrophobic interaction chromatography, reverse phase chromatography or gel filtration may be used.
  • Enzymes of the present invention may also be recovered from conditioned media following secretion from eukaryotic or prokaryotic cells.
  • Biological fluids may include components that can damage polymers.
  • fatty acids e.g., unsaturated fatty acids or other fatty acids
  • reactive compounds such as peroxide that can damage polymers.
  • the present invention encompasses the recognition that protective enzymes may be incorporated into a polymer to prevent, mitigate or lessen damage to a polymer and/or a device containing the polymer.
  • the protective enzymes may include any enzymes described herein suitable to protect against biological substances (e.g., fatty acids) that may degrade or otherwise damage polymeric materials.
  • polymers suitable for use in the context of the present disclosure may include polyamides, polyesters, polyaryletherketones, polyimides, polyetherimides, polyamideimide, liquid crystalline polymers, polycarbonates, polyolefins, polyphenylene oxide, polysulfones, polyacrylates, acrylonitrile butadiene styrene polymer, polyoxymethylene, polystyrene, polyarylene sulfide, polyvinylidene fluoride, polytetrafluoroethylene, polyvinylidene chloride, polyvinyl chloride, and any other suitable polymer.
  • a polymer is or comprises a silicone resin, epoxy resin, polyvinyl butyral resin, cellulose acetate, ethylene-vinyl acetate copolymer (EVA) or an ionomer.
  • a polymer is or comprises an acrylic-based polymer.
  • a polymer is or comprises a silicon-based polymer.
  • a protective enzyme or polypeptide is embedded within a polymeric composition.
  • a polymeric composition comprises a protective enzyme or polypeptide within a range from about 0.0001% to about 20% on w/w basis.
  • a polymeric composition comprises two or more protective enzymes, each present within a range from about 0.0001% to about 20% on w/w basis.
  • a polymeric composition comprises a protective enzyme or polypeptide within a range bounded by a lower limit and an upper limit, the upper limit being larger than the lower limit.
  • the lower limit may be about 0.0001% , 0.0002%, 0.0005%, 0.001%, 0.002%, 0.005%, 0.01%, 0.02%, 0.05%, 0.1%, 0.2%, 0.5%, 1%, 2%, 5%, or 10%.
  • the upper limit may be about 0.0005%, 0.001%, 0.002%, 0.005%, 0.01%, 0.02%, 0.05%, 0.1%, 0.2%, 0.5%, 1%, 2%, 5%, 10%, or 20%.
  • a protective enzyme is applied to the surface of a polymeric composition. In some embodiments, a polymeric composition is coated with a protective enzyme.
  • Electronic devices may be exposed to the bodily fluids of users such as sweat and sebum. These bodily fluids may contain fatty acids that degrade polymers in electronic devices.
  • protective enzymes may be incorporated into one or more components of electronic device.
  • Protective enzymes may include, for example, one or more enzymes from the lipoxygenase (LOX) enzyme family, or other suitable enzymes that degrade harmful substances such as fatty acids.
  • LOX lipoxygenase
  • Protective enzymes such as lipoxygenase enzymes can degrade these reactive compounds (e.g., peroxide) and thereby reduce the ability of a fatty acid (e.g., oleic acid, etc.) to degrade polymers and damage electronic devices.
  • Protective enzymes may neutralize the destructive activity of the fatty acids and thereby help enhance robustness of polymer structures for electronic devices.
  • a polymer with a protective enzyme may be part of an adhesive, gasket, tape, button, or other structure that may be vulnerable to damage by exposure to biological lipids (e.g., fatty acids).
  • a protective enzyme may be incorporated into a coating, an adhesive, a gasket, or other structures in an electronic device. When fatty acids come into contact with a protective enzyme in a coating, adhesive, gasket, or other structure, the fatty acids in the structures are neutralized.
  • any suitable components in an electronic device may include one or more protective enzymes (e.g., dioxygenases, monooxygenases, heme peroxidases, P450s, and/or lipoxygenases).
  • a protective enzyme may be incorporated into plastic portions of housings, gaskets, adhesive layers, tape layers, coatings, gap filling sealant and other sealants, liquid polymers that are dispensed as coatings, room temperature adhesives, fluoropolymer coatings and/or other hydrophobic coatings, liquid polymer materials that serve as carrier fluids for enzyme dispensing without serving as structural adhesive, and/or other materials (e.g., polymers) in an electronic device.
  • a protective enzyme and/or polypeptide may be used as part of a topical formulation for application to the skin of a mammal (e.g., a human). In some embodiments, a protective enzyme and/or polypeptide may be used as part of a topical formulation for application to a polymer. In some embodiments, the polymer is a component of a device. In some embodiments, a protective enzyme and/or polypeptide may be used as part of a topical formulation for application to a device that comprises a polymer. Without wishing to be bound by theory, it is envisioned that inclusion of a protective enzyme and/or polypeptide may prevent degradation of other components of a topical formulation.
  • two or more protective enzymes may be used a part of a topical formulation for application to the skin of a mammal (e.g., a human).
  • a mixture of enzymes may be used as part of a topical formulation.
  • single enzymes or mixtures could be employed to target oleic acid or multiple unsaturated fatty acids in products applied to the skin.
  • a topical formulation comprising a protective enzyme and/or polypeptide is an emulsion, gel, ointment, or lotion.
  • Topical formulations may be prepared using methods known in the art, for example, as provided by reference texts such as, REMINGTON: THE SCIENCE AND PRACTICE OF PHARMACY 1577-1591, 1672-1673, 866-885; (Alfonso R. Gennaro ed. 19th ed. 1995); Ghosh, T. K.; et al. TRANSDERMAL AND TOPICAL DRUG DELIVERY SYSTEMS (1997), both of which are hereby incorporated herein by reference.
  • a protective enzyme and/or polypeptide may be useful for compositions comprising a medicament for topical formulation.
  • a protective enzyme and/or polypeptide is a component of a topical sunscreen formulation.
  • a topical formulation comprises a protective enzyme or polypeptide within a range from about 0.0001% to about 20% on w/w basis.
  • a polymeric composition comprises two or more protective enzymes, each present within a range from about 0.0001% to about 20% on w/w basis.
  • a topical formulation comprises a protective enzyme or polypeptide within a range bounded by a lower limit and an upper limit, the upper limit being larger than the lower limit.
  • the lower limit may be about 0.0001% , 0.0002%, 0.0005%, 0.001%, 0.002%, 0.005%, 0.01%, 0.02%, 0.05%, 0.1%, 0.2%, 0.5%, 1%, 2%, 5%, or 10%.
  • the upper limit may be about 0.0005%, 0.001%, 0.002%, 0.005%, 0.01%, 0.02%, 0.05%, 0.1%, 0.2%, 0.5%, 1%, 2%, 5%, or 10%.
  • Example 1 An Exemplary Protective Enzyme Prevents Fatty Acid Induced Polymer Swelling
  • This example shows the enzymatic activity of a series of LOX enzymes that were assayed for activity on oleic acid.
  • the chemical activity of the enzymes that is measured is shown in FIG. 1 .
  • the assay detects the 10-HOME product derived from treatment of the unstable peroxide produced by the LOX enzyme with the reducing agent DTT.
  • Enzymes were tested in the context of E. coli cell lysate. E. coli overexpressing the LOX enzyme were induced, then cells were lysed enzymatically using lysozyme.
  • the lysate was added to the reaction containing oleic acid, dodecyl maltoside as a surfactant and Tris buffer pH 7.6 and the reaction was run at room temperature for 15 minutes.
  • the reaction product was reduced using DTT and quenched in a methanol/acetonitrile mixture.and 10-HOME product was quantified using LC-MS. Resulting activity is shown in FIG. 2 .
  • This example demonstrates the efficacy of an exemplary protective enzyme (e.g., a lipoxygenase).
  • an exemplary protective enzyme e.g., a lipoxygenase
  • a polymer composition comprising an exemplary protective enzyme (e.g., a lipoxygenase) is able to prevent polymer swelling induced by treatment with a fatty acid.
  • An acrylic foam pressure sensitive adhesive tape (3MTM VHBTM Tape 4914-015) was used as a representative composition to assess the efficacy protective enzymes to prevent polymeric swelling.
  • This representative adhesive was exposed to an exemplary unsaturated fatty acid (oleic acid), and polymer swelling was assessed over time for both lipoxygenase treated (treated) and untreated samples, FIG. 3 .
  • Y-axis indicates the amount of swelling by area
  • X-axis indicates the number of hours post-exposure. As can be seen in FIG. 3 , beginning at approximately 40 hours, the untreated samples show an increase in swelling greater than that of the treated samples. Thus, treatment with a lipoxygenase protected the representative adhesive from fatty acid induced damage over time.
  • Example 3 An Exemplary of an alternative assay demonstrating Protective Enzyme Efficacy
  • This example provides additional evidence of the protective effect of a protective enzyme on the swelling induced in an adhesive by fatty acids.
  • An acrylic foam pressure sensitive adhesive tape (3MTM VHBTM Tape 4914-015) was used as a representative composition to assess the efficacy protective enzymes to prevent polymeric swelling.
  • This representative adhesive was first treated with either lipoxygenase or left untreated and then exposed to an exemplary unsaturated fatty acid (oleic acid). Polymer swelling was assessed over time for both lipoxygenase treated (treated) and untreated samples, FIG. 4 .
  • Y-axis indicates the amount of swelling by area
  • X-axis indicates the number of hours post-exposure.
  • the untreated samples show an increase in swelling greater than that of the treated samples.
  • pre-treatment with a lipoxygenase protected the representative adhesive from fatty acid induced damage over time.
  • This example describes assessment of a network of LOX enzymes for catalytic activity on an exemplary fatty acid substrate (e.g., oleic acid). Homologs of extant lipoxygenases were identified via bioinformatics methods, based on sequence and structural similarity. Each node represents a candidate LOX enzyme, with each enzyme clustered by pairwise similarity to the other enzymes in the library. Gray nodes were shown to have 10S-LOX activity on oleic acid. These 10S-LOX enzymes are distantly related to the more well-described 9S/13S-LOX enzymes described for plants and bacteria.
  • the above example demonstrates that lipoxygenases are a class of enzyme that can degrade an exemplary fatty acid, oleic acid. Moreover, it is determined that other enzymes, such as dioxygenases, monooxygenases, heme peroxidases, P450s, and others could also catalyze the degradation of lipids such as fatty acids.
  • Enzyme family networks are depicted in FIG. 5 , with gray nodes indicating possession 10S-LOX activity.
  • 10S-LOX activity possess 10S-LOX activity.
  • These sequences are distinct from 9/13-LOX from plants, bacteria, and fungi.
  • the cluster contains primarily cyanobacterial enzymes was found to contain 10S-LOXs that are active on the specific exemplary fatty acid (oleic acid).
  • the assays described herein can be used to characterize the ability of enzymes to protect from damage induced by lipids (e.g., specific fatty acids and/or combinations of fatty acids).
  • a method for promoting the breakdown of one or more fatty acids in bodily fluid secreted from a human comprising contacting the bodily fluid with an enzyme.
  • a method for inhibiting swelling of a polymer caused by exposure to a fatty acid comprising contacting the polymer with an enzyme.
  • a method for inhibiting swelling of a polymer caused by exposure to a fatty acid comprising contacting the polymer with a polypeptide that binds a fatty acid.
  • the plurality of enzymes comprises a dioxygenase, monooxygenase, heme peroxidases, and/or P450s.
  • a composition comprising a polymer and one or more enzymes that promote breakdown of a fatty acid.
  • composition comprising a polymer and one or more polypeptides that bind to a fatty acid.
  • ATP adenosine triphosphate
  • composition according to any one of embodiments 22, or 24-31 comprising a plurality of enzymes.
  • composition according to embodiment 32 wherein the plurality of enzymes comprises a dioxygenase, monooxygenase, heme peroxidase, and/or P450.
  • composition according to embodiment 23 wherein the polypeptide forms a complex with the fatty acid
  • composition according to embodiment 23 wherein the polypeptide inhibits reactivity of the fatty acid is a composition according to embodiment 23 wherein the polypeptide inhibits reactivity of the fatty acid.
  • composition according to embodiment 23 wherein the polypeptide inhibits diffusion of the fatty acid inhibits diffusion of the fatty acid.
  • composition comprising one or more enzymes according to any one of embodiments 22, or 25-33 and one or more polypeptides according to any one of embodiments 23, or 37-39.

Abstract

The present invention relates to methods and compositions that include enzymes and/or binding polypeptides useful for protecting polymers from damage caused by fatty acids from secreted biological fluids such as sebum or sweat.

Description

    CROSS REFERENCE TO RELATED APPLICATIONS
  • The present application claims priority to U.S. Provisional Application No. 62/557,544, filed Sep. 12, 2017, the content of which is herein incorporated by reference in its entirety.
  • SEQUENCE LISTING
  • The present specification makes reference to a Sequence Listing (submitted electronically as a .txt file named “Sequence Listing 0174”. The .txt file was generated on Sep. 12, 2018, and is 73,728 bytes in size. The entire content of the Sequence Listing is herein incorporated by reference.
  • BACKGROUND
  • Polymeric materials may be vulnerable to degradation from contaminants.
  • SUMMARY
  • The present disclosure encompasses the recognition that certain enzymes and polypeptides may be useful to neutralize (e.g., prevent or mitigate) damage to polymeric compositions caused by lipids. Exposure to certain secreted biological fluids containing lipids (e.g., human sweat and skin oils) can cause some polymers to swell and degrade. In some embodiments, an enzyme of the present disclosure facilitates degradation of a lipid, and thereby prevents damage to a polymeric structure. In some embodiments, an enzyme useful in the context of the present disclosure facilitates degradation of harmful lipids such as fatty acids.
  • The present disclosure provides methods and compositions that protect components of a composition (e.g., polymers) from damage by lipids (e.g., fatty acids) and/or other compounds that may cause damage. In some embodiments, a lipid and/or other compound that may cause damage is present in a biological fluid. In some embodiments methods and compositions are provided that include protective enzymes useful for breakdown of components in biological fluids that may cause damage to a polymer. In some embodiments, methods and compositions are provided where one or more protective enzymes are embedded within a composition. In some embodiments, methods and compositions are provided where one or more protective enzyme are applied to the surface of a composition (e.g., as a coating).
  • In some embodiments, methods are provided for promoting breakdown of one or more lipids (e.g., fatty acids) in a biological fluid, the method comprising contacting the biological fluid with an enzyme. In some embodiments, a method for promoting breakdown of one or more lipids in a biological fluid comprises contacting the biological fluid with a plurality of enzymes.
  • In some embodiments, methods are provided for inhibiting swelling of a polymer caused by exposure to a fatty acid, the methods comprising contacting the polymer with an enzyme. In some embodiments, methods comprise contacting the polymer with a plurality of enzymes. In some embodiments, methods comprise embedding a plurality of enzymes within a polymer. In some embodiments, methods comprise coating a polymeric composition with a plurality of enzymes.
  • In some embodiments, methods are provided for inhibiting swelling of a polymer caused by exposure to a fatty acid. The methods comprise contacting the polymer with a polypeptide that binds the fatty acid. In some embodiments, a polypeptide forms a complex with the fatty acid. In some embodiments, a polypeptide binding to a fatty acid inhibits reactivity of the fatty acid. In some embodiments, a polypeptide binds to a fatty acid, and thereby prevents it from damaging a polymer. In some embodiments, a polypeptide inhibits diffusion of the fatty acid.
  • In some embodiments, compositions are provided comprising an enzyme embedded in a polymer. In some embodiments, compositions comprise two or more enzymes embedded in a polymer. In some embodiments, compositions comprise a polymer and two or more enzymes that promote breakdown of a fatty acid.
  • In some embodiments, compositions are provided comprising a polymer and one or more enzymes that promote breakdown of a fatty acid and one or more polypeptides that form a complex with a fatty acid. In some embodiments, a polypeptide binding to a fatty acid inhibits the reactivity of the fatty acid. In some embodiments, a polypeptide binds to a fatty acid, and thereby prevents it from damaging a polymer. In some embodiments, a polypeptide inhibits diffusion of the fatty acid.
  • In some embodiments, topical formulations are provided comprising one or more enzymes that promote breakdown of a fatty acid. In some embodiments, topical formulations are provided comprising one or more polypeptides that form a complex with a fatty acid.
  • In some embodiments, compositions are provided comprising one or more enzymes that promote breakdown of a fatty acid and one or more polypeptides that form a complex with a fatty acid. In some embodiments, polypeptide binding to a fatty acid inhibits the reactivity of the fatty acid. In some embodiments, a polypeptide binds to a fatty acid, thereby prevent it from damaging a polymer. In some embodiments, a polypeptide inhibits diffusion of the fatty acid.
  • In some embodiments, a biological fluid is secreted by a human. In some embodiments, a biological fluid is or comprises human sweat. In some embodiments, a biological fluid is or comprises sebum. In some embodiments, a lipid in a biologic fluid is an unsaturated fatty acid. In some embodiments, unsaturated fatty acids include palmitoleic acid, oleic acid, myristoleic acid, linoleic acid, and/or arachidonic acid. In some embodiments, a fatty acid is an oleic acid. In some embodiments, a fatty acid is a linoleic acid. In some embodiments, a biological fluid comprises a plurality of fatty acids to be neutralized.
  • In some embodiments, enzymes for use in a method or composition of the present disclosure include dioxygenases, monooxygenases, heme peroxidases, P450s, and combinations and/or variants thereof. In some embodiments, an enzyme is a dioxygenase. In some embodiments, an enzyme is a monooxygenase. In some embodiments, methods comprise contacting the bodily fluid with a plurality of enzymes.
  • In some embodiments, an enzyme is of animal origin. In some embodiments, an enzyme is of plant origin. In some embodiments, an enzyme is of fungal origin. In some embodiments, an enzyme is of bacterial origin. In some embodiments, an enzyme is a cyanobacterial enzyme. In some embodiments, an enzyme is from archaea.
  • In some embodiments, an enzyme catalyzes beta or omega oxidation. In some embodiments, an enzyme catalyzes hydroperoxidation at the 10S and/or 12S-carbon of a fatty acid (e.g., an oleic acid). In some embodiments, an enzyme for use in the context of the present disclosure does not require adenosine triphosphate (ATP) for catalytic activity.
  • In some embodiments, an enzyme is a lipoxygenase and/or has lipoxygenase activity (e.g., 10S-LOX activity). In some embodiments, an enzyme for use in the context of the present disclosure is a cyanobacterial enzyme with LOX activity (e.g., 10S-LOX activity) or variant thereof. In some embodiments, a cyanobacterial prostaglandin-endoperoxide synthase enzyme or variant thereof has LOX activity (e.g., 10S-LOX activity). In some embodiments, a cyanobacterial heme peroxide synthase enzyme or variant thereof has LOX activity (e.g., 105-LOX activity). In some embodiments, an enzyme with LOX (e.g., 10S-LOX activity) catalytic activity comprises an amino acid sequence of any one of SEQ. ID NOs: 13-15. In some embodiments, an enzyme with LOX (e.g., 10S-LOX activity) catalytic activity comprises an amino acid sequence that is at least about 50% (e.g., at least about 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) identical to any one of SEQ ID NOs: 13-15.
  • In some embodiments, an enzyme is a lipoxygenase. In some embodiments, a lipoxygenase has 10S-LOX activity. In some embodiments, a 10S-LOX comprises an amino acid sequence of any one of SEQ ID NOs: 1-12. In some embodiments, a 10S-LOX enzyme has an amino acid sequence that is at least about 50% (e.g., at least about 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) identical to any one of SEQ ID NOs: 1-12. In some embodiments, a 10S-LOX comprises an amino acid sequence of SEQ ID NO: 13. In some embodiments, a 10S-LOX comprises an amino acid sequence of SEQ ID NO: 14. In some embodiments, a 10S-LOX comprises an amino acid sequence of SEQ ID NO: 15. In some embodiments, a 10S-LOX enzyme comprises an amino acid sequence that is at least about 50% (e.g., at least about 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) identical to any one of SEQ ID NOs: 13-15. In some embodiments, an enzyme is a lipoxygenase that catalyzes hydroperoxidation at positions 9 and/or 13 of a fatty acid. In some embodiments, an enzyme is a lipoxygenase that catalyzes hydroperoxidation at positions 9S and/or 13S of a fatty acid. In some embodiments, an enzyme is a lipoxygenase that catalyzes hydroperoxidation at positions 9R and/or 13R of a fatty acid.
  • In some embodiments, an enzyme is embedded in a polymer. In some embodiments, an enzyme is applied to the surface of a polymer. In some embodiments, a polymer is a component of a device. In some embodiments, a device is an electronic device.
  • BRIEF DESCRIPTION OF THE DRAWINGS
  • The Drawings included herein, composed of the following Figures, are for illustration purposes only and not for limitation.
  • FIG. 1 depicts the chemical reaction catalyzed by LOX enzymes and reduction reaction used to generate a product detected during the enzyme assay.
  • FIG. 2 depicts enzyme activity data generated by assaying various LOX enzymes for activity on oleic acid and detecting the 10-HOME product shown in FIG. 1.
  • FIG. 3 depicts swelling of a representative adhesive upon exposure to an exemplary fatty acid, oleic acid. X-axis indicates the number of hours post-exposure; Y-axis indicates the relative area of an adhesive disk.
  • FIG. 4 depicts swelling of a representative adhesive upon exposure to an exemplary fatty acid, oleic acid, using a second assay. X-axis indicates the number of hours post-exposure; Y-axis indicates the relative area of an adhesive disk.
  • FIG. 5 is a schematic illustrating relatedness of certain enzymes for 10S-LOX activity.
  • CERTAIN DEFINITIONS
  • In order that the present invention may be more readily understood, certain terms are first defined below. Additional definitions for the following terms and other terms are set forth throughout the specification.
  • About: The term “about”, when used herein in reference to a value, refers to a value that is similar, in context to the referenced value. In general, those skilled in the art, familiar with the context, will appreciate the relevant degree of variance encompassed by “about” in that context. For example, in some embodiments, the term “about” may encompass a range of values that within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less of the referred value.
  • Comparable: As used herein, the term “comparable” refers to two or more agents, entities, situations, sets of conditions, etc., that may not be identical to one another but that are sufficiently similar to permit comparison there between so that one skilled in the art will appreciate that conclusions may reasonably be drawn based on differences or similarities observed. In some embodiments, comparable sets of conditions, circumstances, individuals, or populations are characterized by a plurality of substantially identical features and one or a small number of varied features. Those of ordinary skill in the art will understand, in context, what degree of identity is required in any given circumstance for two or more such agents, entities, situations, sets of conditions, etc. to be considered comparable. For example, those of ordinary skill in the art will appreciate that sets of circumstances, individuals, or populations are comparable to one another when characterized by a sufficient number and type of substantially identical features to warrant a reasonable conclusion that differences in results obtained or phenomena observed under or with different sets of circumstances, individuals, or populations are caused by or indicative of the variation in those features that are varied.
  • Designed: As used herein, the term “designed” refers to an agent (i) whose structure is or was selected by the hand of man; (ii) that is produced by a process requiring the hand of man; and/or (iii) that is distinct from natural substances and other known agents.
  • Engineered: In general, the term “engineered” refers to the aspect of having been manipulated by the hand of man. For example, a polynucleotide is considered to be “engineered” when two or more sequences, that are not linked together in that order in nature, are manipulated by the hand of man to be directly linked to one another in the engineered polynucleotide. Comparably, a cell or organism is considered to be “engineered” if it has been manipulated so that its genetic information is altered (e.g., new genetic material not previously present has been introduced, for example by transformation, mating, somatic hybridization, transfection, transduction, or other mechanism, or previously present genetic material is altered or removed, for example by substitution or deletion mutation, or by mating protocols). As is common practice and is understood by those in the art, progeny of an engineered polynucleotide or cell are typically still referred to as “engineered” even though the actual manipulation was performed on a prior entity.
  • Enzyme: As used herein, an “enzyme” is a molecule that catalyzes one or more biochemical reactions. In some embodiments, an enzyme is or comprises a polypeptide and/or RNA. In some embodiments, an enzyme is a polypeptide. In some embodiments, an enzyme is a polypeptide and that ranges from about 50 amino acid residues to 2,500 amino acid residues. Enzymes can be classified according to the reaction they catalyze. In some embodiments, enzymes include oxidoreductases (e.g., catalyze oxidation/reduction reactions), transferases (e.g., transfer a functional group, such as, for example, a methyl or phosphate group), hydrolases (e.g., catalyze hydrolysis of various bonds), lyases (e.g., cleave various bonds by means other than hydrolysis and oxidation), isomerases (e.g., catalyze isomerization changes within a single molecule) and ligases (e.g., join two molecules with covalent bonds). In some embodiments, a member of an enzyme class or family shows significant sequence homology or identity with, shares a common sequence motif (e.g., a characteristic sequence element) with, and/or shares a common activity (in some embodiments at a comparable level or within a designated range) with a reference enzyme of the class; in some embodiments with all enzymes within the class). For example, in some embodiments, a member enzyme shows an overall degree of sequence homology or identity with a reference enzyme that is at least about 30-40%, and is often greater than about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more and/or includes at least one region (e.g., a conserved region that may in some embodiments be or comprise a characteristic sequence element) that shows very high sequence identity, often greater than 90% or even 95%, 96%, 97%, 98%, or 99%. Such a conserved region usually encompasses at least 3-4 and often up to 20 or more amino acids; in some embodiments, a conserved region encompasses at least one stretch of at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or more contiguous amino acids. In some embodiments, an enzyme suitable for use in the context of the present disclosure is of animal origin. In some embodiments, an enzyme suitable for use in the context of the present disclosure is of plant origin. In some embodiments, an enzyme suitable for use in the context of the present disclosure is of fungal origin. In some embodiments, an enzyme suitable for use in the context of the present disclosure is of bacterial origin.
  • Functional: As used herein, a “functional” biological molecule is a biological molecule in a form in which it exhibits a property and/or activity by which it is characterized.
  • Homology: As used herein, the term “homology” refers to the overall relatedness between polymeric molecules, e.g., between nucleic acid molecules (e.g., DNA molecules and/or RNA molecules) and/or between polypeptide molecules. In some embodiments, polymeric molecules are considered to be “homologous” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical. In some embodiments, polymeric molecules are considered to be “homologous” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% similar (e.g., containing residues with related chemical properties at corresponding positions).
  • Human: In some embodiments, a human is an embryo, a fetus, an infant, a child, a teenager, an adult, or a senior citizen.
  • Identity: As used herein, the term “identity” refers to the overall relatedness between polymeric molecules, e.g., between nucleic acid molecules (e.g., DNA molecules and/or RNA molecules) and/or between polypeptide molecules. In some embodiments, polymeric molecules are considered to be “substantially identical” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical. Calculation of the percent identity of two nucleic acid or polypeptide sequences, for example, can be performed by aligning the two sequences for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second sequences for optimal alignment and non-identical sequences can be disregarded for comparison purposes). In certain embodiments, the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or substantially 100% of the length of a reference sequence. The nucleotides at corresponding positions are then compared. When a position in the first sequence is occupied by the same residue (e.g., nucleotide or amino acid) as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
  • Polypeptide: As used herein refers to any polymeric chain of amino acids. In some embodiments, a polypeptide has an amino acid sequence that occurs in nature. In some embodiments, a polypeptide has an amino acid sequence that does not occur in nature. In some embodiments, a polypeptide has an amino acid sequence that is engineered in that it is designed and/or produced through action of the hand of man. In some embodiments, a polypeptide may comprise or consist of natural amino acids, non-natural amino acids, or both. In some embodiments, a polypeptide may comprise D-amino acids, L-amino acids, or both. In some embodiments, a polypeptide may include one or more pendant groups or other modifications, e.g., modifying or attached to one or more amino acid side chains, at the polypeptide's N-terminus, at the polypeptide's C-terminus, or any combination thereof. In some embodiments, such pendant groups or modifications may be selected from the group consisting of acetylation, amidation, lipidation, methylation, pegylation, etc., including combinations thereof. In some embodiments, a useful polypeptide may comprise or consist of a fragment of a parent polypeptide. The term “peptide” is generally used to refer to a polypeptide having a length of less than about 100 amino acids, less than about 50 amino acids, less than 20 amino acids, or less than 10 amino acids.
  • Recombinant: As used herein, is intended to refer to polypeptides that are designed, engineered, prepared, expressed, created, manufactured, and/or or isolated by recombinant means, such as polypeptides expressed using a recombinant expression vector transfected into a host cell; polypeptides isolated from a recombinant, combinatorial human polypeptide library; polypeptides isolated from an animal (e.g., a mouse, rabbit, sheep, fish, etc.) that is transgenic for or otherwise has been manipulated to express a gene or genes, or gene components that encode and/or direct expression of the polypeptide or one or more component(s), portion(s), element(s), or domain(s) thereof; and/or polypeptides prepared, expressed, created or isolated by any other means that involves splicing or ligating selected nucleic acid sequence elements to one another, chemically synthesizing selected sequence elements, and/or otherwise generating a nucleic acid that encodes and/or directs expression of the polypeptide or one or more component(s), portion(s), element(s), or domain(s) thereof In some embodiments, one or more of such selected sequence elements is found in nature. In some embodiments, one or more of such selected sequence elements is designed in silico. In some embodiments, one or more such selected sequence elements results from mutagenesis (e.g., in vivo or in vitro) of a known sequence element, e.g., from a natural or synthetic source.
  • DETAILED DESCRIPTION
  • The present disclosure provides methods and compositions that protect components of a composition (e.g., polymers) from damage by lipids (e.g., fatty acids) and/or other compounds that may cause damage. Also provided herein are compositions, methods, systems, and kits that include a polypeptide and/or an enzyme that catalyzes, degrades, modifies and/or sequesters a lipid.
  • Enzymes
  • In some embodiments, provided herein are enzymes useful for breakdown of compounds (e.g., fatty acids) that may cause damage to components of a composition (e.g., polymers). In some embodiments, enzymes for use in the context of the present disclosure include dioxygenases, monooxygenases, heme peroxidases, P450s, and combinations and/or variants thereof In some embodiments, each of the enzymes can degrade an unsaturated fatty acid. In some embodiments, an enzyme specifically degrades one or more unsaturated fatty acids.
  • In some embodiments, compositions and methods of the present disclosure comprise two or more enzymes that promote breakdown of compounds that cause damage. In some embodiments, two or more enzymes each promote breakdown of unsaturated fatty acids.
  • In some embodiments, compositions and methods of the present disclosure comprise a plurality of enzymes. In some embodiments, each of the enzymes can degrade an unsaturated fatty acid. In some embodiments, each of the plurality of enzymes exhibit different substrate specificity for one or more unsaturated fatty acids.
  • In some embodiments, an enzyme is of animal origin. In some embodiments, an enzyme is of plant origin. In some embodiments, an enzyme is of fungal origin. In some embodiments, an enzyme is of bacterial origin. In some embodiments, an enzyme is a cyanobacterial enzyme. In some embodiments, an enzyme is from archaea.
  • In some embodiments, an enzyme catalyzes beta or omega oxidation. In some embodiments, an enzyme catalyzes beta or omega oxidation of fatty acids. In some embodiments, an enzyme has activity at the 5, 8, 9, 10, 11, 12, 13 or 15-carbon of a fatty acid. In some embodiments, an enzyme has activity at a 5R, 5S, 8R, 8S, 9R, 9S, 10S, 11R, 11S, 12R, 12S, 13R, 13S and/or 15S position of a fatty acid. In some embodiments, an enzyme has activity at the 10S and/or 12S-carbon of a fatty acid (e.g., an oleic acid). In some embodiments, an enzyme for use in the context of the present disclosure does not require adenosine triphosphate (ATP) for catalytic activity.
  • In some embodiments, a polymeric composition comprises an enzyme within a range from about 0.0001% to about 20% on w/w basis. In some embodiments, a polymeric composition comprises an enzyme within a range bounded by a lower limit and an upper limit, the upper limit being larger than the lower limit. In some embodiments, the lower limit may be about 0.0001% , 0.0002%, 0.0005%, 0.001%, 0.002%, 0.005%, 0.01%, 0.02%, 0.05%, 0.1%, 0.2%, 0.5%, 1%, 2%, 5%, or 10%. In some embodiments, the upper limit may be about 0.0005%, 0.001%, 0.002%, 0.005%, 0.01%, 0.02%, 0.05%, 0.1%, 0.2%, 0.5%, 1%, 2%, 5%, 10%, or 20%.
  • Lipoxygenases
  • In some embodiments, an enzyme for use in the context of the present disclosure is a lipoxygenase. Lipoxygenase (LOX) enzymes catalyze oxygen-dependent oxidation of fatty acid substrates (for example, linoleic acid and arachidonic acid) to form hydroperoxy-fatty acid products. LOX enzymes are categorized as dioxygenases. Certain LOX enzymes have been purified from diverse organisms that display a broad range of substrate specificity and product specificity (e.g., site of oxidation within a fatty acid). LOX enzymes are widely expressed in animals, plants, and fungi, and cyanobacteria.
  • The present disclosure encompasses the recognition that lipoxygenases are a suitable class of enzymes for the degradation of unsaturated fatty acids (UFA) such as, for example, oleic acid. Without wishing to be bound by theory, LOX enzymes may convert unsaturated fatty acids to hydroperoxides, which can spontaneously degrade at the site of the double bond if not stabilized. In some embodiments, lipoxygenases may utilize either iron or manganese in their active sites.
  • In some embodiments, a LOX does not require ATP or other cofactors for catalytic activity. The present disclosure encompasses the recognition that activity independent of ATP or other cofactors is a desirable characteristic for certain applications.
  • In some embodiments, a lipoxygenase suitable for use in the context of the present disclosure is of animal origin. In some embodiments, a lipoxygenase suitable for use in the context of the present disclosure is of plant origin. In some embodiments, a lipoxygenase suitable for use in the context of the present disclosure is of fungal origin. In some embodiments, a lipoxygenase suitable for use in the context of the present disclosure is of bacterial origin. In some embodiments, a lipoxygenase suitable for use in the context of the present disclosure is of cyanobacterial origin. In some embodiments, a lipoxygenase suitable for use in the context of the present disclosure is from archaea.
  • In some embodiments, a LOX can catalyze hydroperoxidation of a fatty acid substrate. In some embodiments, a fatty acid substrate is an unsaturated fatty acid. In some embodiments, a LOX facilitates catalysis of palmitoleic acid, oleic acid, myristoleic acid, linoleic acid, and/or arachidonic acid.
  • In some embodiments, a LOX facilitates partial or complete degradation of one or more unsaturated fatty acids. In some embodiments, a LOX facilitates partial or complete degradation of palmitoleic acid, oleic acid, myristoleic acid, linoleic acid, and/or arachidonic acid.
  • In some embodiments, a LOX has activity (i.e., can catalyze hydroperoxidation) at the 5, 8, 9, 10, 11, 12, 13 or 15-carbon of a fatty acid. In some embodiments, a LOX has activity (i.e., can catalyze hydroperoxidation) at a 5R, 5S, 8R, 8S, 9R, 9S, 10S, 11R, 11S, 12R, 12S, 13R, 13S and/or 15S position of a fatty acid.
  • Bioprospecting identified LOX enzymes which act on oleic acid with a 10- or 12-carbon LOX preference. In some embodiments, a lipoxygenase catalyzes hydroperoxidation at the 10-carbon position of a fatty acid. In some embodiments, a lipoxygenase catalyzes hydroperoxidation at the 12- carbon position of a fatty acid. In some embodiments, a LOX catalyzes hydroperoxidation at the 10S and/or 12S-carbon of a fatty acid (i.e., has 10S-LOX or 12S-LOX activity).
  • In some embodiments, a lipoxygenase has 10S-LOX activity. In some embodiments, a lipoxygenase is a 10S-LOX from a plant, fungus, bacteria, or archaea. In some embodiments, a 10S-LOX facilitates catalysis of oleic acid. In some embodiments, a 10S-LOX is from cyanobacteria. In some embodiments, a 10S-LOX is from cyanobacteria and facilitates catalysis of oleic acid.
  • A common source of LOX is from plants (for example soybean), with specificity for an unsaturated fatty acid in which LOX activity occurs at the 9- or 13-carbon. In some embodiments, a lipoxygenase is a 9/13-LOX, for example a 9/13-LOX from plants, bacteria, archaea, or fungi.
  • The following sequences are representative of LOX enzymes that were characterized to have 10S-LOX activity.
  • In some embodiments, a 10S-LOX is or comprises a sequence any one of SEQ ID NOs: 1 to 12. In some embodiments, a 10S-LOX enzyme has a sequence that is at least about 50% (e.g., at least about 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 1 to 12.
  • (SEQ ID NO: 1)
    TRDTSRDGFSNKALAYTLTHFKPIWNLVQSYEPLKRKLNKFFLNSIIYKLPT
    RPLPYSLMGLDPKIPGTDIPKKTDTYISWDSLTDKTYTGRHLPPDPEFNKEG
    NLPPLDKVKTLFQKRDGKTIYSEKSTLLFPYWVQWFTDSFLRIDQENRFKN
    TSNHQIDMCNVYGLTRKQTNMLRAFKDGKFKTQKLKRKDGVEEEYPLFY
    YADPEQGIIDPQFEGLHAPLNDEKRQPPEKKSKLFAMGVERANVQIGYVML
    NTLCIREHNRICDVLSKSYPEWDDERLFQTARNILMVIVLNIIMEEYIFHITPY
    NFRFFADPEAFTKESWYRENWMAIEFSFVYRWHSAIPETFIYDGKEQSMYD
    SLWNNQMLIDKGLGALMEETCSQPGTRIGLFNTPDFKIAGTPYTFIDATELA
    SVKLGRQAQLASYNDYREMCGYPRVTDFNQITGDEYAQQKLKELYGHVD
    KIELFVGLYAEDVRKNSAIPPLVARIIGIDAFSQALTNPLLSPKVFNKETFSEV
    GWEIIQNTKTVSDLVNRNVPPSDPKYKVSFEL
    (SEQ ID NO: 2)
    RDTSKDGFRNKLETYALTHFKPIWNLIQSNDTLKKKVNKFLVNNAIYKVPT
    RPYPFSTMSPYTSWDSLSDRTYSGLHLPPLDWQPLTNENHLKLKLADTKDF
    EKKLPAIEDLRGLYRKSGETKYSPKSTLIFPYFVQWFTDSFLRTDRHNHRKN
    TSNHQIDLCTVYGLNAKITHLLRSYQGGKLKSQIINGEEYPPFYYDEKGEAK
    KEFIGLPHQLDNDGNPKADTFPLDKKQKLFAMGVEVERSNVQIGYVMLNV
    LALREHNRLCELLAKTYPSWDDERLFQTARNILIVEVLRIVVEDYVNHITPY
    HFQFITDPLTFSNEKWYRQNWMTVEFTLVYRWHSMLPDTLIYNGQKIPTYE
    TQWNNEMIIKQGLGALFEESCSQPCAQLSLFNTPEFLIPVELASVRFGREVK
    LRSYNDYRQLCKYPRVTDFDQISSDKNIQKELQRLYGHVDNIELYVGIYAE
    DLRENSALPSLVGRLIGIDAFSQVLTNPLLAESVFHPETFSPVGWEEIQNTKT
    LSQLLHRNLPPSDKKYRVSFDRAST
    (SEQ ID NO: 3)
    AGKRDTSKDGFDNKVQTFLLTNFKGIWEIVQSNEFLKRKVNKTLINSLIYKI
    PTRPNPYSMMTLDEYIPDTKIPKKTDTYTSWELLNDRTYIGRHLPPDPKFNS
    EGNLPKVEDLAVLFRKRDGKTIYSPKSTMLFPYWVQWFTDSFLRIDHTKEK
    KLKNTSNHEIDLCNVYGLNRKRTHLLRTFKGGKFKTQKLKRQDGIEEEYPL
    FYYADPAQGIVDPQFDGLYEPINDEKRLPADKKQYLFAMGVERANVQIGY
    VMLNTLCIREHNRLCDELASNYPDWDDERLFQTSRNILMAIILNIIMEEYINH
    ITPYHFKLFADPAAFVKESWYRPNWMTIEFDFVYRWHSAIPETFIYDGQPTD
    IAASLWNNKMFIDKGLGALMEETCSQPGTRIGLFNTPDILVELTELPSIRLGR
    QLQLASYNDYREMCGFPRVTKFEQITGDEFAQEKLKELYGHVDNIEFYVGL
    YAEEVRKNSTIPPLVARLIGIDAFSEALNNPLLSPTIFNKDTFSPVGWEIIQNT
    KTVSDLINRNVPPSDKKYKVTFDL
    (SEQ ID NO: 4)
    TRDTSRDGFSNKALAYTLTHFKPIWNLVQSYEPLKRKLNKFFLNSIIYKLPT
    RPLPYSLMGLDPKIPGTDIPKKTDTYISWDSLTDKTYTGRHLPPDPEFNKEG
    NLPPLDKVKTLFQKRDGKTIYSEKSTLLFPYWVQWFTDSFLRIDQENRFKN
    TSNHQIDMCNVYGLTRKQTNMLRAFKDGKFKTQKLKRKDGVEEEYPLFY
    YADPEQGIIDPQFEGLHAPLNDEKRQPPEKKSKLFAMGVERANVQIGYVML
    NTLCIREHNRICDVLSKSYPEWDDERLFQTARNILMVIVLNIIMEEYIFHITPY
    NFRFFADPEAFTKESWYRENWMAIEFSFVYRWHSAIPETFIYDGKEQSMYD
    SLWNNQMLIDKGLGALMEETCSQPGTRIGLFNTPDFKIAGTPYTFIDATELA
    SVKLGRQAQLASYNDYREMCGYPRVTDFNQITGDEYAQQKLKELYGHVD
    KIELFVGLYAEDVRKNSAIPPLVARIIGIDAFSQALTNPLLSPKVFNKETFSEV
    GWEIIQNTKTVSDLVNRNVPPSDPKYKVSFEE
    (SEQ ID NO: 5)
    RDTSKDGFRNKLETYALTHFKPIWNLIQSNDTLKKKVNKFLVNNAIYKVPT
    RPYPFSTMSPYTSWDSLSDRTYSGLHLPPLDWQPLTNENHLKLKLADTKDF
    EKKLPAIEDLRGLYRKSGETKYSPKSTLIFPYFVQWFTDSFLRTDRHNHRKN
    TSNHQIDLCTVYGLNAKITHLLRSYQGGKLKSQIINGEEYPPFYYDEKGEAK
    KEFIGLPHQLDNDGNPKADTFPLDKKQKLFAMGVEVERSNVQIGYVMLNV
    LALREHNRLCELLAKTYPSWDDERLFQTARNILIVEVLRIVVEDYVNHITPY
    HFQFITDPLTFSNEKWYRQNWMTVEFTLVYRWHSMLPDTLIYNGQKIPTYE
    TQWNNEMIIKQGLGALFEESCSQPCAQLSLFNTPEFLIPVELASVRFGREVK
    LRSYNDYRQLCKYPRVTDFDQISSDKNIQKELQRLYGHVDNIELYVGIYAE
    DLRENSALPSLVGRLIGIDAFSQVLTNPLLAESVFHPETFSPVGWEEIQNTKT
    LSQLLHRNLPPSDKKYRVSFDRASE
    (SEQ ID NO: 6)
    AGKRDTSKDGFDNKVQTFLLTNFKGIWEIVQSNEFLKRKVNKTLINSLIYKI
    PTRPNPYSMMTLDEYIPDTKIPKKTDTYTSWELLNDRTYIGRHLPPDPKFNS
    EGNLPKVEDLAVLFRKRDGKTIYSPKSTMLFPYWVQWFTDSFLRIDHTKEK
    KLKNTSNHEIDLCNVYGLNRKRTHLLRTFKGGKFKTQKLKRQDGIEEEYPL
    FYYADPAQGIVDPQFDGLYEPINDEKRLPADKKQYLFAMGVERANVQIGY
    VMLNTLCIREHNRLCDELASNYPDWDDERLFQTSRNILMAIILNIIMEEYINH
    ITPYHFKLFADPAAFVKESWYRPNWMTIEFDFVYRWHSAIPETFIYDGQPTD
    IAASLWNNKMFIDKGLGALMEETCSQPGTRIGLFNTPDILVELTELPSIRLGR
    QLQLASYNDYREMCGFPRVTKFEQITGDEFAQEKLKELYGHVDNIEFYVGL
    YAEEVRKNSTIPPLVARLIGIDAFSEALNNPLLSPTIFNKDTFSPVGWEIIQNT
    KTVSDLINRNVPPSDKKYKVTFDE
    (SEQ ID NO: 7)
    TRDTSRDGFSNKALAYTLTHFKPIWNLVQSYEPLKRKLNKFFLNSIIYKLPT
    RPLPYSLMGLDPKIPGTDIPKKTDTYISWDSLTDKTYTGRHLPPDPEFNKEG
    NLPPLDKVKTLFQKRDGKTIYSEKSTLLFPYWVQWFTDSFLRIDQENRFKN
    TSNHQIDMCNVYGLTRKQTNMLRAFKDGKFKTQKLKRKDGVEEEYPLFY
    YADPEQGIIDPQFEGLHAPLNDEKRQPPEKKSKLFAMGVERANVQIGYVML
    NTLCIREHNRICDVLSKSYPEWDDERLFQTARNILMVIVLNIIMEEYIFHITPY
    NFRFFADPEAFTKESWYRENWMAIEFSFVYRWHSAIPETFIYDGKEQSMYD
    SLWNNQMLIDKGLGALMEETCSQPGTRIGLFNTPDFKIAGTPYTFIDATELA
    SVKLGRQAQLASYNDYREMCGYPRVTDFNQITGDEYAQQKLKELYGHVD
    KIELFVGLYAEDVRKNSAIPPLVARIIGIDAFSQALTNPLLSPKVFNKETFSEV
    GWEIIQNTKTVSDLVNRNVPPSDPKYKVSFED
    (SEQ ID NO: 8)
    RDTSKDGFRNKLETYALTHFKPIWNLIQSNDTLKKKVNKFLVNNAIYKVPT
    RPYPFSTMSPYTSWDSLSDRTYSGLHLPPLDWQPLTNENHLKLKLADTKDF
    EKKLPAIEDLRGLYRKSGETKYSPKSTLIFPYFVQWFTDSFLRTDRHNHRKN
    TSNHQIDLCTVYGLNAKITHLLRSYQGGKLKSQIINGEEYPPFYYDEKGEAK
    KEFIGLPHQLDNDGNPKADTFPLDKKQKLFAMGVEVERSNVQIGYVMLNV
    LALREHNRLCELLAKTYPSWDDERLFQTARNILIVEVLRIVVEDYVNHITPY
    HFQFITDPLTFSNEKWYRQNWMTVEFTLVYRWHSMLPDTLIYNGQKIPTYE
    TQWNNEMIIKQGLGALFEESCSQPCAQLSLFNTPEFLIPVELASVRFGREVK
    LRSYNDYRQLCKYPRVTDFDQISSDKNIQKELQRLYGHVDNIELYVGIYAE
    DLRENSALPSLVGRLIGIDAFSQVLTNPLLAESVFHPETFSPVGWEEIQNTKT
    LSQLLHRNLPPSDKKYRVSFDRASD
    (SEQ ID NO: 9)
    AGKRDTSKDGFDNKVQTFLLTNFKGIWEIVQSNEFLKRKVNKTLINSLIYKI
    PTRPNPYSMMTLDEYIPDTKIPKKTDTYTSWELLNDRTYIGRHLPPDPKFNS
    EGNLPKVEDLAVLFRKRDGKTIYSPKSTMLFPYWVQWFTDSFLRIDHTKEK
    KLKNTSNHEIDLCNVYGLNRKRTHLLRTFKGGKFKTQKLKRQDGIEEEYPL
    FYYADPAQGIVDPQFDGLYEPINDEKRLPADKKQYLFAMGVERANVQIGY
    VMLNTLCIREHNRLCDELASNYPDWDDERLFQTSRNILMAIILNIIMEEYINH
    ITPYHFKLFADPAAFVKESWYRPNWMTIEFDFVYRWHSAIPETFIYDGQPTD
    IAASLWNNKMFIDKGLGALMEETCSQPGTRIGLFNTPDILVELTELPSIRLGR
    QLQLASYNDYREMCGFPRVTKFEQITGDEFAQEKLKELYGHVDNIEFYVGL
    YAEEVRKNSTIPPLVARLIGIDAFSEALNNPLLSPTIFNKDTFSPVGWEIIQNT
    KTVSDLINRNVPPSDKKYKVTFDD
    (SEQ ID NO: 10)
    TRDTSRDGFSNKALAYTLTHFKPIWNLVQSYEPLKRKLNKFFLNSIIYKLPT
    RPLPYSLMGLDPKIPGTDIPKKTDTYISWDSLTDKTYTGRHLPPDPEFNKEG
    NLPPLDKVKTLFQKRDGKTIYSEKSTLLFPYWVQWFTDSFLRIDQENRFKN
    TSNHQIDMCNVYGLTRKQTNMLRAFKDGKFKTQKLKRKDGVEEEYPLFY
    YADPEQGIIDPQFEGLHAPLNDEKRQPPEKKSKLFAMGVERANVQIGYVML
    NTLCIREHNRICDVLSKSYPEWDDERLFQTARNILMVIVLNIIMEEYIFHITPY
    NFRFFADPEAFTKESWYRENWMAIEFSFVYRWHSAIPETFIYDGKEQSMYD
    SLWNNQMLIDKGLGALMEETCSQPGTRIGLFNTPDFKIAGTPYTFIDATELA
    SVKLGRQAQLASYNDYREMCGYPRVTDFNQITGDEYAQQKLKELYGHVD
    KIELFVGLYAEDVRKNSAIPPLVARIIGIDAFSQALTNPLLSPKVFNKETFSEV
    GWEIIQNTKTVSDLVNRNVPPSDPKYKVSFET
    (SEQ ID NO: 11)
    RDTSKDGFRNKLETYALTHFKPIWNLIQSNDTLKKKVNKFLVNNAIYKVPT
    RPYPFSTMSPYTSWDSLSDRTYSGLHLPPLDWQPLTNENHLKLKLADTKDF
    EKKLPAIEDLRGLYRKSGETKYSPKSTLIFPYFVQWFTDSFLRTDRHNHRKN
    TSNHQIDLCTVYGLNAKITHLLRSYQGGKLKSQIINGEEYPPFYYDEKGEAK
    KEFIGLPHQLDNDGNPKADTFPLDKKQKLFAMGVEVERSNVQIGYVMLNV
    LALREHNRLCELLAKTYPSWDDERLFQTARNILIVEVLRIVVEDYVNHITPY
    HFQFITDPLTFSNEKWYRQNWMTVEFTLVYRWHSMLPDTLIYNGQKIPTYE
    TQWNNEMIIKQGLGALFEESCSQPCAQLSLFNTPEFLIPVELASVRFGREVK
    LRSYNDYRQLCKYPRVTDFDQISSDKNIQKELQRLYGHVDNIELYVGIYAE
    DLRENSALPSLVGRLIGIDAFSQVLTNPLLAESVFHPETFSPVGWEEIQNTKT
    LSQLLHRNLPPSDKKYRVSFDRASL
    (SEQ ID NO: 12)
    AGKRDTSKDGFDNKVQTFLLTNFKGIWEIVQSNEFLKRKVNKTLINSLIYKIPTR
    PNPYSMMTLDEYIPDTKIPKKTDTYTSWELLNDRTYIGRHLPPDPKFNSEGNLPKVEDLA
    VLFRKRDGKTIYSPKSTMLFPYWVQWFTDSFLRIDHTKEKKLKNTSNHEIDLCNVYGLN
    RKRTHLLRTFKGGKFKTQKLKRQDGIEEEYPLFYYADPAQGIVDPQFDGLYEPINDEKRL
    PADKKQYLFAMGVERANVQIGYVMLNTLCIREHNRLCDELASNYPDWDDERLFQTSRN
    ILMAIILNIIMEEYINHITPYHFKLFADPAAFVKESWYRPNWMTIEFDFVYRWHSAIPETFI
    YDGQPTDIAASLWNNKMFIDKGLGALMEETCSQPGTRIGLFNTPDILVELTELPSIRLGR
    QLQLASYNDYREMCGFPRVTKFEQITGDEFAQEKLKELYGHVDNIEFYVGLYAEEVRK
    NSTIPPLVARLIGIDAFSEALNNPLLSPTIFNKDTFSPVGWEIIQNTKTVSDLINRNVPPSDK
    KYKVTFDT
  • Also provided are herein are circular permutated variants of any enzyme or polypeptide described herein. In circular permutation methods, the N- and C-terminus of the mutated protein are redefined by genetic engineering. Circular permutation methods have been described in the art. For example, Graf and Schachmann, (Proc. Natl. Acad. Sci. USA (1996) 93, 11591-11596), provide an overview of enzymes and other proteins with which circular permutation methods have been carried out. Methods for engineering circular permutated polypeptide (e.g., enzyme) variants are known in the art, see, e.g., US Pat. Publ. No. 2010/0196991. In some embodiments, a circular permutation variant includes a linker.
  • In some embodiments, an enzyme for use in the context of the present disclosure is a cyanobacterial enzyme with LOX activity (e.g., 10S-LOX activity) or variant thereof. In some embodiments, a cyanobacterial prostaglandin-endoperoxide synthase enzyme or variant thereof has LOX activity (e.g., 10S-LOX activity). In some embodiments, an enzyme with LOX catalytic activity (e.g., 10S-LOX activity) comprises an amino acid sequence of SEQ ID NO: 13 and/or a circular permutation thereof.
  • (SEQ ID NO: 13)
    TRDTSRDGFSNKALAYTLTHFKPIWNLVQSYEPLKRKLNKFFLNSIIYKL
    PTRPLPYSLMGLDPKIPGTDIPKKTDTYISWDSLTDKTYTGRHLPPDPEF
    NKEGNLPPLDKVKTLFQKRDGKTIYSEKSTLLFPYWVQWFTDSFLRIDQE
    NRFKNTSNHQIDMCNVYGLTRKQTNMLRAFKDGKFKTQKLKRKDGVEEEY
    PLFYYADPEQGIIDPQFEGLHAPLNDEKRQPPEKKSKLFAMGVERANVQI
    GYVMLNTLCIREHNRICDVLSKSYPEWDDERLFQTARNILMVIVLNIIME
    EYIFHITPYNFRFFADPEAFTKESWYRENWMAIEFSFVYRWHSAIPETFI
    YDGKEQSMYDSLWNNQMLIDKGLGALMEETCSQPGTRIGLFNTPDFKIAG
    TPYTFIDATELASVKLGRQAQLASYNDYREMCGYPRVTDFNQITGDEYAQ
    QKLKELYGHVDKIELFVGLYAEDVRKNSAIPPLVARIIGIDAFSQALTNP
    LLSPKVFNKETFSEVGWEIIQNTKTVSDLVNRNVPPSDPKYKVSFEX,
    where X is any amino acid.
  • In some embodiments, a cyanobacterial heme peroxide synthase enzyme or variant thereof has LOX activity (e.g., 10S-LOX activity). In some embodiments, an enzyme with LOX (e.g., 10S-LOX activity) catalytic activity comprises an amino acid sequence of SEQ ID NO: 14 and/or a circular permutation thereof. In some embodiments, an enzyme with LOX (e.g., 10S-LOX activity) catalytic activity comprises an amino acid sequence of SEQ ID NO: 15 and/or a circular permutation thereof.
  • (SEQ ID NO: 14)
    RDTSKDGFRNKLETYALTHFKPIWNLIQSNDTLKKKVNKFLVNNAIYKVP
    TRPYPFSTMSPYTSWDSLSDRTYSGLHLPPLDWQPLTNENHLKLKLADTK
    DFEKKLPAIEDLRGLYRKSGETKYSPKSTLIFPYFVQWFTDSFLRTDRHN
    HRKNTSNHQIDLCTVYGLNAKITHLLRSYQGGKLKSQIINGEEYPPFYYD
    EKGEAKKEFIGLPHQLDNDGNPKADTFPLDKKQKLFAMGVEVERSNVQIG
    YVMLNVLALREHNRLCELLAKTYPSWDDERLFQTARNILIVEVLRIVVED
    YVNHITPYHFQFITDPLTFSNEKWYRQNWMTVEFTLVYRWHSMLPDTLIY
    NGQKIPTYETQWNNEMIIKQGLGALFEESCSQPCAQLSLFNTPEFLIPVE
    LASVRFGREVKLRSYNDYRQLCKYPRVTDFDQISSDKNIQKELQRLYGHV
    DNIELYVGIYAEDLRENSALPSLVGRLIGIDAFSQVLTNPLLAESVFHPE
    TFSPVGWEEIQNTKTLSQLLHRNLPPSDKKYRVSFDRASX, where
    X is any amino acid.
    (SEQ ID NO: 15)
    AGKRDTSKDGFDNKVQTFLLTNFKGIWEIVQSNEFLKRKVNKTLINSLIY
    KIPTRPNPYSMMTLDEYIPDTKIPKKTDTYTSWELLNDRTYIGRHLPPDP
    KFNSEGNLPKVEDLAVLFRKRDGKTIYSPKSTMLFPYWVQWFTDSFLRID
    HTKEKKLKNTSNHEIDLCNVYGLNRKRTHLLRTFKGGKFKTQKLKRQDGI
    EEEYPLFYYADPAQGIVDPQFDGLYEPINDEKRLPADKKQYLFAMGVERA
    NVQIGYVMLNTLCIREHNRLCDELASNYPDWDDERLFQTSRNILMAIILN
    IIMEEYINHITPYHFKLFADPAAFVKESWYRPNWMTIEFDFVYRWHSAIP
    ETFIYDGQPTDIAASLWNNKMFIDKGLGALMEETCSQPGTRIGLFNTPDI
    LVELTELPSIRLGRQLQLASYNDYREMCGFPRVTKFEQITGDEFAQEKLK
    ELYGHVDNIEFYVGLYAEEVRKNSTIPPLVARLIGIDAFSEALNNPLLSP
    TIFNKDTFSPVGWEIIQNTKTVSDLINRNVPPSDKKYKVTFDLX,
    where X is any amino acid.
  • A sequence similarity network of LOX enzymes is tested for activity on oleic acid and depicted in FIG. 5. Gray nodes indicate 10S-LOX activity. These sequences are distinct from 9/13-LOX from plants, bacteria, and fungi, and are sometimes annotated as heme peroxidases. In particular, the cluster contains primarily cyanobacterial enzymes contains the 10S-LOXs that are active on oleic acid.
  • In some embodiments, a fatty acid to be degraded is oleic acid, and a LOX enzyme specific for action on the 10S- or 12S-carbon of oleic acid is employed in a composition or method of the present disclosure.
  • Dioxygenases and Monooxygenases
  • In some embodiments, dioxygenases other than LOX, as well as monooxygenases, are suitable for use in the context of the present disclosure. In some embodiments, an enzyme is a dioxygenase. In some embodiments, an enzyme is a monooxygenase.
  • In some embodiments, a dioxygenase catalyzes oxidation of a fatty acid substrate. In some embodiments, a fatty acid substrate is an unsaturated fatty acid. In some embodiments, a dioxygenase catalyzes oxidation of palmitoleic acid, oleic acid, myristoleic acid, linoleic acid, and/or arachidonic acid.
  • In some embodiments, a dioxygenase catalyzes the partial or complete degradation of one or more unsaturated fatty acids. In some embodiments, a dioxygenase facilitates partial or complete degradation of palmitoleic acid, oleic acid, myristoleic acid, linoleic acid, and/or arachidonic acid.
  • In some embodiments, a monooxygenase catalyzes oxidation of a fatty acid substrate. In some embodiments, a fatty acid substrate is an unsaturated fatty acid. In some embodiments, a monooxygenase catalyzes oxidation of palmitoleic acid, oleic acid, myristoleic acid, linoleic acid, and/or arachidonic acid.
  • In some embodiments, a monooxygenase catalyzes the partial or complete degradation of one or more unsaturated fatty acids. In some embodiments, a monooxygenase facilitates partial or complete degradation palmitoleic acid, oleic acid, myristoleic acid, linoleic acid, and/or arachidonic acid.
  • In some embodiments, a dioxygenase and/or a monooxygenase is from a plant, bacteria, archaea, or fungus. In some embodiments, a dioxygenase and/or a monooxygenase facilitates catalysis of oleic acid. In some embodiments, a dioxygenase and/or a monooxygenase is from cyanobacteria. In some embodiments, a dioxygenase and/or a monooxygenase is from cyanobacteria and facilitates catalysis of oleic acid.
  • In some embodiments, an enzyme catalyzes beta or omega oxidation. In some embodiments, an enzyme catalyzes oxidation or hydroperoxidation at the 5, 8, 9, 10, 11, 12, 13 or 15-carbon of a fatty acid. In some embodiments, an enzyme catalyzes oxidation or hydroperoxidation ata 5R, 5S, 8R, 8S, 9R, 9S, 10S, 11R, 11S, 12R, 12S, 13R, 13S and/or 15S position of a fatty acid. In some embodiments, an enzyme catalyzes oxidation or hydroperoxidation of the 10S and/or 12S-carbon of a fatty acid (e.g., an oleic acid). In some embodiments, an enzyme for use in the context of the present disclosure does not require adenosine triphosphate (ATP) for catalytic activity.
  • In some embodiments, a monooxygenase and/or dioxygenase in the context of the present disclosure can catalyze partial or complete degradation of a fatty acid (e.g., an unsaturated fatty acid). In some embodiments, activity of a monooxygenase and/or dioxygenase may be independent of cofactors (e.g., ATP). In some embodiments, activity of a monooxygenase and/or dioxygenase may require a cofactor (e.g., ATP).
  • In some embodiments, compositions and methods of the present disclosure comprise a LOX and one or more other dioxygenases that promote breakdown of compounds that cause damage to polymers. In some embodiments, compositions and methods of the present disclosure comprise a LOX and one or more monooxygenases that promote breakdown of compounds that cause damage to polymers. In some embodiments, compositions and methods of the present disclosure comprise a plurality of enzymes. In some embodiments, each of the enzymes can degrade an unsaturated fatty acid. In some embodiments, each of the plurality of enzymes exhibit different substrate specificity for one or more unsaturated fatty acids.
  • P450s
  • In some embodiments, an enzyme suitable for use in the context of the present disclosure is a P450. Cytochrome P450 enzymes form a superfamily of hemoproteins found in bacteria, archaea and eukaryotes. In a common activity, cytochrome P450 acts as a monooxygenase, by inserting one oxygen atom of molecular oxygen into a substrate molecule, while the other oxygen atom is reduced to water. A P450 catalytic reaction may require two electrons for the activation of molecular oxygen. P450s from eukaryotes use NADPH as the external reductant and source of electrons. Each electron may be transferred one at a time to a cytochrome P450 active site. In some embodiments, an electron transfer may be donated by an electron donor protein, e.g., a cytochrome P450 reductase (CPR). A CPR may be an electron donor protein for several different P450s from the same or from different organisms. In some cases P450s can also be coupled to a cytochrome b5 protein that can act as the electron donor protein or can improve the efficiency of the electron transfer from the CPR to the P450. In eukaryotic cells and particularly in plants, P450s and CPRs are generally membrane-bound proteins and are associated with the endoplasmic reticulum. These proteins may be anchored to the membrane by an N-terminal trans-membrane helix.
  • Many P450s have low substrate specificity and are therefore able to catalyze the oxidation of many diverse structures. Many P450s have a particular region and stereo-selectivity with a given substrate; however they produce a mixture of several products from a particular substrate. In some embodiments, a P450 is involved in breakdown and detoxification of molecules (e.g., xenobiotics). In some embodiments, a P450 is involved in a biosynthetic pathway. P450s involved in a biosynthetic pathway may exhibit specificity for certain types of substrates and region and stereo-selectivity. In some embodiments, a P450 is from a plant, bacteria, or fungus.
  • A large number of P450s can be found in nature and particularly in plants. One plant genome can contain several hundreds of genes encoding for P450s.
  • In some embodiments, a P450 is active on one or more unsaturated fatty acids. In some embodiments, a P450 facilitates catalysis of palmitoleic acid, oleic acid, myristoleic acid, linoleic acid, and/or arachidonic acid. In some embodiments, a P450 facilitates catalysis of oleic acid.
  • In some embodiments, compositions and methods of the present disclosure comprise a P450 and another enzyme (e.g., a dioxygenase, monooxygenase, heme peroxidase) that promote breakdown of compounds that cause damage. In some embodiments, compositions and methods of the present disclosure comprise a plurality of enzymes. In some embodiments, each of the enzymes can act on an unsaturated fatty acid. In some embodiments, each of the enzymes can degrade an unsaturated fatty acid. In some embodiments, each of the plurality of enzymes exhibit different substrate specificity for one or more unsaturated fatty acids.
  • Heme Peroxidases
  • In some embodiments, an enzyme for use in the context of the present disclosure is a heme peroxidase. In some embodiments, a heme peroxidase has a ferriprotoporphyrin IX prosthetic group located at the active site. The plant enzymes horseradish peroxidase (HRP) and plant soyabean peroxidase (SBP) are examples of plant heme peroxidases.
  • In some embodiments, a heme peroxidase facilitates catalysis of one or more unsaturated fatty acids. In some embodiments, a heme peroxidase facilitates catalysis of palmitoleic acid, oleic acid, myristoleic acid, linoleic acid, and/or arachidonic acid. In some embodiments, a heme peroxidase facilitates catalysis of oleic acid.
  • In some embodiments, compositions and methods of the present disclosure comprise a heme peroxidase and another enzyme (e.g., a dioxygenase, monooxygenase, P450) that promotes breakdown of compounds that cause damage to polymers. In some embodiments, compositions and methods of the present disclosure comprise a plurality of enzymes. In some embodiments, each of the enzymes facilitates catalysis of an unsaturated fatty acid. In some embodiments, each of the enzymes can degrade an unsaturated fatty acid. In some embodiments, each of the plurality of enzymes exhibit different substrate specificity for one or more unsaturated fatty acids.
  • Polypeptides
  • In some embodiments, protection of materials from damaging lipids (e.g., fatty acids, such as oleic acid and other unsaturated fatty acids), is additionally or alternatively performed via non-catalytic binding of a protein to a lipid. In some embodiments, binding to a lipid (e.g., an unsaturated fatty acid) results in formation of a protein-lipid complex that would be less able to diffuse into the material being protected. Binding of a lipid (e.g., an unsaturated fatty acid) could also limit or prevent it from reacting with other materials, such as a polymeric material or other material to be protected.
  • In some embodiments, compositions are provided comprising one or more enzymes that promote breakdown of a fatty acid and one or more polypeptides that form a complex with a fatty acid.
  • Nucleic Acid Construction and Expression
  • Enzymes and polypeptides as described herein may be produced from nucleic acid molecules using molecular biological methods known to the art. Nucleic acid molecules are inserted into a vector that is able to express the polypeptide when introduced into an appropriate host cell. Appropriate host cells include, but are not limited to, bacterial, yeast, insect, and mammalian cells. Any of the methods known to one skilled in the art for the insertion of DNA fragments into a vector may be used to construct expression vectors encoding the enzymes of the present disclosure under control of transcriptional/translational control signals. These methods may include in vitro recombinant DNA and synthetic techniques and in vivo recombination (See Sambrook et al., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory; Current Protocols in Molecular Biology, Eds. Ausubel, et al, Greene Publ. Assoc., Wiley-Interscience, N.Y.).
  • Expression of nucleic acid molecules in accordance with the present disclosure may be regulated by a second nucleic acid sequence so that the molecule is expressed in a host transformed with the recombinant DNA molecule. For example, expression of the nucleic acid molecules of the present disclosure may be controlled by promoter and/or enhancer elements, which are known in the art.
  • Nucleic acid constructs of the present disclosure may be inserted into an expression vector or viral vector by methods known to the art, and nucleic acid molecules operatively linked to an expression control sequence.
  • Where appropriate, nucleic acid sequences that encode enzyme as described herein may be modified to include codons that are optimized for expression in a particular cell type or organism. Codon optimized sequences are synthetic sequences, and preferably encode the identical polypeptide (or a biologically active fragment of a full length polypeptide which has substantially the same activity as the full length polypeptide) encoded by the non-codon optimized parent polynucleotide. In some embodiments, the coding region of the genetic material encoding antibody components, in whole or in part, may include an altered sequence to optimize codon usage for a particular cell type (e.g., a eukaryotic or prokaryotic cell). For example, the coding sequence for an enzyme as described herein may be optimized for expression in bacterial cells, fungal cells, plant cells, mammalian cells, etc. Such a sequence may be described as a codon-optimized sequence.
  • An expression vector containing a nucleic acid molecule is transformed into a suitable host cell to allow for production of the protein encoded by the nucleic acid constructs. Exemplary host cells include prokaryotes (e.g., E. coli) and eukaryotes (e.g., yeast cells or mammalian cells). Host cells transformed with an expression vector are grown under conditions permitting production of an enzyme of the present disclosure followed by recovery of the enzyme or polypeptide.
  • Enzyme and polypeptides of the present disclosure may be purified by any technique, which allows for the subsequent formation of a stable enzyme. For example, not wishing to be bound by theory, enzymes may be recovered from cells either as soluble polypeptides or as inclusion bodies, from which they may be extracted quantitatively by 8 M guanidinium hydrochloride and dialysis. In order to further purify enzymes of the present disclosure, conventional ion exchange chromatography, hydrophobic interaction chromatography, reverse phase chromatography or gel filtration may be used. Enzymes of the present invention may also be recovered from conditioned media following secretion from eukaryotic or prokaryotic cells.
  • Polymers
  • Biological fluids may include components that can damage polymers. For example, fatty acids (e.g., unsaturated fatty acids or other fatty acids) may include reactive compounds such as peroxide that can damage polymers. The present invention encompasses the recognition that protective enzymes may be incorporated into a polymer to prevent, mitigate or lessen damage to a polymer and/or a device containing the polymer. The protective enzymes may include any enzymes described herein suitable to protect against biological substances (e.g., fatty acids) that may degrade or otherwise damage polymeric materials.
  • In some embodiments, polymers suitable for use in the context of the present disclosure may include polyamides, polyesters, polyaryletherketones, polyimides, polyetherimides, polyamideimide, liquid crystalline polymers, polycarbonates, polyolefins, polyphenylene oxide, polysulfones, polyacrylates, acrylonitrile butadiene styrene polymer, polyoxymethylene, polystyrene, polyarylene sulfide, polyvinylidene fluoride, polytetrafluoroethylene, polyvinylidene chloride, polyvinyl chloride, and any other suitable polymer. In some embodiments, a polymer is or comprises a silicone resin, epoxy resin, polyvinyl butyral resin, cellulose acetate, ethylene-vinyl acetate copolymer (EVA) or an ionomer. In some embodiments, a polymer is or comprises an acrylic-based polymer. In some embodiments, a polymer is or comprises a silicon-based polymer.
  • In some embodiments, a protective enzyme or polypeptide is embedded within a polymeric composition. In some embodiments, a polymeric composition comprises a protective enzyme or polypeptide within a range from about 0.0001% to about 20% on w/w basis. In some embodiments, a polymeric composition comprises two or more protective enzymes, each present within a range from about 0.0001% to about 20% on w/w basis. In some embodiments, a polymeric composition comprises a protective enzyme or polypeptide within a range bounded by a lower limit and an upper limit, the upper limit being larger than the lower limit. In some embodiments, the lower limit may be about 0.0001% , 0.0002%, 0.0005%, 0.001%, 0.002%, 0.005%, 0.01%, 0.02%, 0.05%, 0.1%, 0.2%, 0.5%, 1%, 2%, 5%, or 10%. In some embodiments, the upper limit may be about 0.0005%, 0.001%, 0.002%, 0.005%, 0.01%, 0.02%, 0.05%, 0.1%, 0.2%, 0.5%, 1%, 2%, 5%, 10%, or 20%.
  • In some embodiments, a protective enzyme is applied to the surface of a polymeric composition. In some embodiments, a polymeric composition is coated with a protective enzyme.
  • Components of Electronic Devices
  • Electronic devices may be exposed to the bodily fluids of users such as sweat and sebum. These bodily fluids may contain fatty acids that degrade polymers in electronic devices. To prevent degradation, protective enzymes may be incorporated into one or more components of electronic device. Protective enzymes may include, for example, one or more enzymes from the lipoxygenase (LOX) enzyme family, or other suitable enzymes that degrade harmful substances such as fatty acids. Protective enzymes such as lipoxygenase enzymes can degrade these reactive compounds (e.g., peroxide) and thereby reduce the ability of a fatty acid (e.g., oleic acid, etc.) to degrade polymers and damage electronic devices. Protective enzymes may neutralize the destructive activity of the fatty acids and thereby help enhance robustness of polymer structures for electronic devices.
  • In some embodiments, a polymer with a protective enzyme may be part of an adhesive, gasket, tape, button, or other structure that may be vulnerable to damage by exposure to biological lipids (e.g., fatty acids). A protective enzyme may be incorporated into a coating, an adhesive, a gasket, or other structures in an electronic device. When fatty acids come into contact with a protective enzyme in a coating, adhesive, gasket, or other structure, the fatty acids in the structures are neutralized.
  • In general, any suitable components in an electronic device may include one or more protective enzymes (e.g., dioxygenases, monooxygenases, heme peroxidases, P450s, and/or lipoxygenases). For example, a protective enzyme may be incorporated into plastic portions of housings, gaskets, adhesive layers, tape layers, coatings, gap filling sealant and other sealants, liquid polymers that are dispensed as coatings, room temperature adhesives, fluoropolymer coatings and/or other hydrophobic coatings, liquid polymer materials that serve as carrier fluids for enzyme dispensing without serving as structural adhesive, and/or other materials (e.g., polymers) in an electronic device.
  • Topical Formulations
  • In some embodiments, a protective enzyme and/or polypeptide may be used as part of a topical formulation for application to the skin of a mammal (e.g., a human). In some embodiments, a protective enzyme and/or polypeptide may be used as part of a topical formulation for application to a polymer. In some embodiments, the polymer is a component of a device. In some embodiments, a protective enzyme and/or polypeptide may be used as part of a topical formulation for application to a device that comprises a polymer. Without wishing to be bound by theory, it is envisioned that inclusion of a protective enzyme and/or polypeptide may prevent degradation of other components of a topical formulation. In some embodiments, two or more protective enzymes may be used a part of a topical formulation for application to the skin of a mammal (e.g., a human). In some embodiments a mixture of enzymes may be used as part of a topical formulation. For example, it may be desirable to combine enzymes with specificities to multiple unsaturated fatty acids, for example to both oleic and linoleic acid present in sebum and sweat. Similarly, single enzymes or mixtures could be employed to target oleic acid or multiple unsaturated fatty acids in products applied to the skin.
  • In some embodiments, a topical formulation comprising a protective enzyme and/or polypeptide is an emulsion, gel, ointment, or lotion. Topical formulations may be prepared using methods known in the art, for example, as provided by reference texts such as, REMINGTON: THE SCIENCE AND PRACTICE OF PHARMACY 1577-1591, 1672-1673, 866-885; (Alfonso R. Gennaro ed. 19th ed. 1995); Ghosh, T. K.; et al. TRANSDERMAL AND TOPICAL DRUG DELIVERY SYSTEMS (1997), both of which are hereby incorporated herein by reference.
  • In some embodiments, a protective enzyme and/or polypeptide may be useful for compositions comprising a medicament for topical formulation. In some embodiments, a protective enzyme and/or polypeptide is a component of a topical sunscreen formulation.
  • In some embodiments, a topical formulation comprises a protective enzyme or polypeptide within a range from about 0.0001% to about 20% on w/w basis. In some embodiments, a polymeric composition comprises two or more protective enzymes, each present within a range from about 0.0001% to about 20% on w/w basis. In some embodiments, a topical formulation comprises a protective enzyme or polypeptide within a range bounded by a lower limit and an upper limit, the upper limit being larger than the lower limit. In some embodiments, the lower limit may be about 0.0001% , 0.0002%, 0.0005%, 0.001%, 0.002%, 0.005%, 0.01%, 0.02%, 0.05%, 0.1%, 0.2%, 0.5%, 1%, 2%, 5%, or 10%. In some embodiments, the upper limit may be about 0.0005%, 0.001%, 0.002%, 0.005%, 0.01%, 0.02%, 0.05%, 0.1%, 0.2%, 0.5%, 1%, 2%, 5%, 10%, or 20%.
  • The foregoing is merely illustrative and various modifications can be made to the described embodiments. The foregoing embodiments may be implemented individually or in any combination.
  • EXAMPLES Example 1—An Exemplary Protective Enzyme Prevents Fatty Acid Induced Polymer Swelling
  • This example shows the enzymatic activity of a series of LOX enzymes that were assayed for activity on oleic acid. The chemical activity of the enzymes that is measured is shown in FIG. 1. The assay detects the 10-HOME product derived from treatment of the unstable peroxide produced by the LOX enzyme with the reducing agent DTT. Enzymes were tested in the context of E. coli cell lysate. E. coli overexpressing the LOX enzyme were induced, then cells were lysed enzymatically using lysozyme. The lysate was added to the reaction containing oleic acid, dodecyl maltoside as a surfactant and Tris buffer pH 7.6 and the reaction was run at room temperature for 15 minutes. The reaction product was reduced using DTT and quenched in a methanol/acetonitrile mixture.and 10-HOME product was quantified using LC-MS. Resulting activity is shown in FIG. 2.
  • Example 2—An Exemplary Protective Enzyme Prevents Fatty Acid Induced Polymer Swelling
  • This example demonstrates the efficacy of an exemplary protective enzyme (e.g., a lipoxygenase). Specifically, this Example demonstrates that a polymer composition comprising an exemplary protective enzyme (e.g., a lipoxygenase) is able to prevent polymer swelling induced by treatment with a fatty acid. An acrylic foam pressure sensitive adhesive tape (3M™ VHB™ Tape 4914-015) was used as a representative composition to assess the efficacy protective enzymes to prevent polymeric swelling. This representative adhesive was exposed to an exemplary unsaturated fatty acid (oleic acid), and polymer swelling was assessed over time for both lipoxygenase treated (treated) and untreated samples, FIG. 3. Y-axis indicates the amount of swelling by area, X-axis indicates the number of hours post-exposure. As can be seen in FIG. 3, beginning at approximately 40 hours, the untreated samples show an increase in swelling greater than that of the treated samples. Thus, treatment with a lipoxygenase protected the representative adhesive from fatty acid induced damage over time.
  • Example 3—An Exemplary of an alternative assay demonstrating Protective Enzyme Efficacy
  • This example provides additional evidence of the protective effect of a protective enzyme on the swelling induced in an adhesive by fatty acids. An acrylic foam pressure sensitive adhesive tape (3M™ VHB™ Tape 4914-015) was used as a representative composition to assess the efficacy protective enzymes to prevent polymeric swelling. This representative adhesive was first treated with either lipoxygenase or left untreated and then exposed to an exemplary unsaturated fatty acid (oleic acid). Polymer swelling was assessed over time for both lipoxygenase treated (treated) and untreated samples, FIG. 4. Y-axis indicates the amount of swelling by area, X-axis indicates the number of hours post-exposure. As can be seen in FIG. 4, the untreated samples show an increase in swelling greater than that of the treated samples. Thus, pre-treatment with a lipoxygenase protected the representative adhesive from fatty acid induced damage over time.
  • Example 4—Analysis of LOX family Enzymes for Activity
  • This example describes assessment of a network of LOX enzymes for catalytic activity on an exemplary fatty acid substrate (e.g., oleic acid). Homologs of extant lipoxygenases were identified via bioinformatics methods, based on sequence and structural similarity. Each node represents a candidate LOX enzyme, with each enzyme clustered by pairwise similarity to the other enzymes in the library. Gray nodes were shown to have 10S-LOX activity on oleic acid. These 10S-LOX enzymes are distantly related to the more well-described 9S/13S-LOX enzymes described for plants and bacteria. The above example demonstrates that lipoxygenases are a class of enzyme that can degrade an exemplary fatty acid, oleic acid. Moreover, it is determined that other enzymes, such as dioxygenases, monooxygenases, heme peroxidases, P450s, and others could also catalyze the degradation of lipids such as fatty acids.
  • Enzyme family networks are depicted in FIG. 5, with gray nodes indicating possession 10S-LOX activity. Thus, several different heme peroxidase enzymes possess 10S-LOX activity. These sequences are distinct from 9/13-LOX from plants, bacteria, and fungi. Of note, the cluster contains primarily cyanobacterial enzymes was found to contain 10S-LOXs that are active on the specific exemplary fatty acid (oleic acid). The assays described herein can be used to characterize the ability of enzymes to protect from damage induced by lipids (e.g., specific fatty acids and/or combinations of fatty acids).
  • EXEMPLARY EMBODIMENTS
  • 1. A method for promoting the breakdown of one or more fatty acids in bodily fluid secreted from a human, the method comprising contacting the bodily fluid with an enzyme.
  • 2. A method for inhibiting swelling of a polymer caused by exposure to a fatty acid, the method comprising contacting the polymer with an enzyme.
  • 3. A method for inhibiting swelling of a polymer caused by exposure to a fatty acid, the method comprising contacting the polymer with a polypeptide that binds a fatty acid.
  • 4. The method according to any one of embodiments 1-3 wherein the fatty acid is unsaturated.
  • 5. The method according to any one of embodiments 1-3 wherein the fatty acid is an oleic acid.
  • 6. The method according to any one of embodiments 1-3 wherein the fatty acid is a linoleic acid.
  • 7. The method according to any one of embodiments 1-6 wherein the enzyme or polypeptide is embedded in a polymer.
  • 8. The method according to any one of embodiments 1 or 4-7 wherein the bodily fluid comprises sweat.
  • 9. The method according to any one of embodiments 1 or 4-7 wherein the bodily fluid comprises sebum.
  • 10. The method according to any one of embodiments 1-2, or 4-9 wherein the enzyme is a dioxygenase.
  • 11. The method according to any one of embodiments 1-2, or 4-9 wherein the enzyme is a lipoxygenase.
  • 12. The method according to any one of embodiments 1-2, or 4-9 wherein the enzyme is a monooxygenase.
  • 13. The method according to any one of embodiments 1-2, or 4-9 wherein the enzyme does not require adenosine triphosphate (ATP) for catalytic activity.
  • 14. The method according to any one of embodiments 1-2, or 4-13 comprising contacting the bodily fluid or polymer with a plurality of enzymes.
  • 15. The method according to embodiment 14, wherein the plurality of enzymes comprises a dioxygenase, monooxygenase, heme peroxidases, and/or P450s.
  • 16. The method according to any one of embodiments 1-2, or 4-15 wherein the enzyme is a cyanobacterial enzyme.
  • 17. The method according to any one of embodiments 1-2, or 14-16 wherein the enzyme catalyzes beta or omega oxidation.
  • 18. The method according to any one of embodiments 1-2, or 14-17 wherein the enzyme has activity at the 10S and/or 12S-carbon of an oleic acid.
  • 19. The method according to embodiment 3 wherein the polypeptide forms a complex with the fatty acid.
  • 20. The method according to embodiment 3 wherein the polypeptide inhibits reactivity of the fatty acid.
  • 21. The method according to embodiment 3 wherein the polypeptide inhibits diffusion of the fatty acid.
  • 22. A composition comprising a polymer and one or more enzymes that promote breakdown of a fatty acid.
  • 23. A composition comprising a polymer and one or more polypeptides that bind to a fatty acid.
  • 24. The composition according to embodiment 22 or 23 wherein the one or more enzymes or polypeptides are embedded in the polymer.
  • 25. The composition according to any one of embodiments 22-24 wherein the fatty acid is unsaturated.
  • 26. The composition according to any one of embodiments 22-24 wherein the fatty acid is an oleic acid.
  • 27. The composition according to any one of embodiments 24-24 wherein the fatty acid is a linoleic acid.
  • 28. The composition according to any one of embodiments 22, or 24-27 wherein the enzyme is a dioxygenase.
  • 29. The composition according to any one of embodiments 22, or 24-27 wherein the enzyme is a lipoxygenase.
  • 30. The composition according to any one of embodiments 22, or 24-27 wherein the enzyme is a monooxygenase.
  • 31. The composition according to any one of embodiments 22, or 24-30 wherein the enzyme does not require adenosine triphosphate (ATP) for catalytic activity.
  • 32. The composition according to any one of embodiments 22, or 24-31 comprising a plurality of enzymes.
  • 33. The composition according to embodiment 32 wherein the plurality of enzymes comprises a dioxygenase, monooxygenase, heme peroxidase, and/or P450.
  • 34. The composition according to any one of embodiments 22, or 25-33 wherein the enzyme is a cyanobacterial enzyme.
  • 35. The composition according to any one of embodiments 22, or 25-33 wherein the enzyme catalyzes beta or omega oxidation.
  • 36. The composition according to any one of embodiments 22, or 25-33 wherein the enzyme has activity at the 10S and/or 12S-carbon of an oleic acid.
  • 37. The composition according to embodiment 23 wherein the polypeptide forms a complex with the fatty acid.
  • 38. The composition according to embodiment 23 wherein the polypeptide inhibits reactivity of the fatty acid.
  • 39. The composition according to embodiment 23 wherein the polypeptide inhibits diffusion of the fatty acid.
  • 40. A composition comprising one or more enzymes according to any one of embodiments 22, or 25-33 and one or more polypeptides according to any one of embodiments 23, or 37-39.
  • 41. The method or composition according to any one of embodiments 1-2, or 22 wherein the enzyme comprises an amino acid sequence of SEQ ID NO: 1 or a circular permutated variant thereof..
  • 42. The method or composition according to any one of embodiments 1-2, or 22 wherein the enzyme comprises an amino acid sequence of SEQ ID NO: 2 or a circular permutated variant thereof.
  • 43. The method or composition according to any one of embodiments 1-2, or 22 wherein the enzyme comprises an amino acid sequence of SEQ ID NO: 3 or a circular permutated variant thereof.
  • 44. The method or composition according to any one of embodiments 1-2, or 22 wherein the enzyme comprises an amino acid sequence of SEQ ID NO: 4 or a circular permutated variant thereof.
  • 45. The method or composition according to any one of embodiments 1-2, or 22 wherein the enzyme comprises an amino acid sequence of SEQ ID NO: 5 or a circular permutated variant thereof.
  • 46. The method or composition according to any one of embodiments 1-2, or 22 wherein the enzyme comprises an amino acid sequence of SEQ ID NO: 6 or a circular permutated variant thereof.
  • 47. The method or composition according to any one of embodiments 1-2, or 22 wherein the enzyme comprises an amino acid sequence of SEQ ID NO: 7 or a circular permutated variant thereof.
  • 48. The method or composition according to any one of embodiments 1-2, or 22 wherein the enzyme comprises an amino acid sequence of SEQ ID NO: 8 or a circular permutated variant thereof.
  • 48. The method or composition according to any one of embodiments 1-2, or 22 wherein the enzyme comprises an amino acid sequence of SEQ ID NO: 9 or a circular permutated variant thereof.
  • 49. The method or composition according to any one of embodiments 1-2, or 22 wherein the enzyme comprises an amino acid sequence of SEQ ID NO: 10 or a circular permutated variant thereof.
  • 50. The method or composition according to any one of embodiments 1-2, or 22 wherein the enzyme comprises an amino acid sequence of SEQ ID NO: 11 or a circular permutated variant thereof.
  • 51. The method or composition according to any one of embodiments 1-2, or 22 wherein the enzyme comprises an amino acid sequence of SEQ ID NO: 12 or a circular permutated variant thereof.
  • 52. The method or composition according to any one of embodiments 1-2, or 22 wherein the enzyme comprises an amino acid sequence of any one of SEQ ID NOs: 13-15, or a circular permutated variant thereof.
  • Having thus described at least several aspects and embodiments of this invention, it is to be appreciated that various alterations, modifications, and improvements will readily be apparent to those skilled in the art. Such alterations, modifications, and improvements are intended to be part of this disclosure, and are intended to be within the spirit and scope of the invention. Accordingly, the foregoing description and drawings are by way of example only and the invention is described in further detail by the claims that follow.
  • EQUIVALENTS
  • The articles “a” and “an” as used herein in the specification and in the claims, unless clearly indicated to the contrary, should be understood to include the plural referents. Claims or descriptions that include “or” between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The invention also includes embodiments in which more than one, or the entire group members are present in, employed in, or otherwise relevant to a given product or process. Furthermore, it is to be understood that the invention encompasses all variations, combinations, and permutations in which one or more limitations, elements, clauses, descriptive terms, etc., from one or more of the listed claims is introduced into another claim dependent on the same base claim (or, as relevant, any other claim) unless otherwise indicated or unless it would be evident to one of ordinary skill in the art that a contradiction or inconsistency would arise. Where elements are presented as lists, (e.g., in Markush group or similar format) it is to be understood that each subgroup of the elements is also disclosed, and any element(s) can be removed from the group. It should be understood that, in general, where the invention, or aspects of the invention, is/are referred to as comprising particular elements, features, etc., certain embodiments of the invention or aspects of the invention consist, or consist essentially of, such elements, features, etc. For purposes of simplicity those embodiments have not in every case been specifically set forth in so many words herein. It should also be understood that any embodiment or aspect of the invention can be explicitly excluded from the claims, regardless of whether the specific exclusion is recited in the specification.

Claims (21)

1-34. (canceled)
35. A host cell that comprises a heterologous polynucleotide encoding a lipoxygenase, wherein the lipoxygenase comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 2.
36. The host cell of claim 35, wherein the lipoxygenase comprises SEQ ID NO: 2.
37. The host cell of claim 35, wherein the lipoxygenase has activity at the 10S-carbon of one or more fatty acids.
38. The host cell of claim 35, wherein the lipoxygenase promotes breakdown of one or more fatty acids.
39. The host cell of claim 38, wherein the lipoxygenase is capable of promoting the breakdown of one or more fatty acids in bodily fluid secreted from a human.
40. The host cell of claim 39, wherein the bodily fluid comprises sweat or sebum.
41. The host cell of claim 38, wherein the one or more fatty acids is an oleic acid and/or a linoleic acid.
42. The host cell of claim 35, wherein the host cell is a plant cell, a fungal cell, a yeast cell, a bacterial cell, or an animal cell.
43. The host cell of claim 42, wherein the bacterial cell is an Escherichia coli cell.
44. A method comprising culturing the host cell of claim 35.
45. A host cell that comprises a heterologous polynucleotide encoding a lipoxygenase, wherein the lipoxygenase comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 3.
46. The host cell of claim 45, wherein the lipoxygenase comprises SEQ ID NO: 3.
47. The host cell of claim 45, wherein the lipoxygenase has activity at the 10S-carbon of one or more fatty acids.
48. The host cell of claim 45, wherein the lipoxygenase promotes breakdown of one or more fatty acids.
49. The host cell of claim 48, wherein the lipoxygenase is capable of promoting the breakdown of one or more fatty acids in bodily fluid secreted from a human.
50. The host cell of claim 49, wherein the bodily fluid comprises sweat or sebum.
51. The host cell of claim 48, wherein the one or more fatty acids is an oleic acid and/or a linoleic acid.
52. The host cell of claim 45, wherein the host cell is a plant cell, a fungal cell, a yeast cell, a bacterial cell, or an animal cell.
53. The host cell of claim 52, wherein the bacterial cell is an Escherichia coli cell.
54. A method comprising culturing the host cell of claim 45.
US17/744,578 2017-09-12 2022-05-13 Protective enzymes Pending US20220348889A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US17/744,578 US20220348889A1 (en) 2017-09-12 2022-05-13 Protective enzymes

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201762557544P 2017-09-12 2017-09-12
PCT/US2018/050718 WO2019055541A1 (en) 2017-09-12 2018-09-12 Protective enzymes
US202016646814A 2020-03-12 2020-03-12
US17/744,578 US20220348889A1 (en) 2017-09-12 2022-05-13 Protective enzymes

Related Parent Applications (2)

Application Number Title Priority Date Filing Date
US16/646,814 Continuation US11359182B2 (en) 2017-09-12 2018-09-12 Protective enzymes
PCT/US2018/050718 Continuation WO2019055541A1 (en) 2017-09-12 2018-09-12 Protective enzymes

Publications (1)

Publication Number Publication Date
US20220348889A1 true US20220348889A1 (en) 2022-11-03

Family

ID=63714079

Family Applications (2)

Application Number Title Priority Date Filing Date
US16/646,814 Active US11359182B2 (en) 2017-09-12 2018-09-12 Protective enzymes
US17/744,578 Pending US20220348889A1 (en) 2017-09-12 2022-05-13 Protective enzymes

Family Applications Before (1)

Application Number Title Priority Date Filing Date
US16/646,814 Active US11359182B2 (en) 2017-09-12 2018-09-12 Protective enzymes

Country Status (4)

Country Link
US (2) US11359182B2 (en)
EP (1) EP3682002A1 (en)
CN (1) CN111278969A (en)
WO (1) WO2019055541A1 (en)

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN112209994B (en) * 2020-10-14 2021-05-18 仙桃市卫洁防护用品有限公司 Antiviral polypeptide and antiviral mask prepared from same
US11276436B1 (en) * 2021-01-05 2022-03-15 Seagate Technology Llc Corrosive gas reduction for electronic devices

Family Cites Families (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5520727A (en) 1993-08-16 1996-05-28 The Regents Of University Of California Aqueous algal-based phenolic type adhesives and glues
US6271015B1 (en) 1995-06-12 2001-08-07 The Scripps Research Institute Fatty-acid amide hydrolase
JP5230889B2 (en) * 2000-09-05 2013-07-10 ノボザイムス アクティーゼルスカブ Lipoxygenase
DE60234822D1 (en) * 2001-04-20 2010-02-04 Novozymes As LIPOXYGENASE VARIANTS AND THEIR USE
US20030124710A1 (en) 2001-10-23 2003-07-03 Novozymes A/S Oxidizing enzymes in the manufacture of paper materials
US20090238811A1 (en) 2002-09-09 2009-09-24 Mcdaniel C Steven Enzymatic Antimicrobial and Antifouling Coatings and Polymeric Materials
US20100210745A1 (en) 2002-09-09 2010-08-19 Reactive Surfaces, Ltd. Molecular Healing of Polymeric Materials, Coatings, Plastics, Elastomers, Composites, Laminates, Adhesives, and Sealants by Active Enzymes
JP4641214B2 (en) * 2004-10-26 2011-03-02 国立大学法人京都大学 Rubber composition for tire, method for producing the same, and pneumatic tire using the rubber composition for tire
EP1921134A1 (en) 2006-11-08 2008-05-14 Georg-August-Universität Göttingen Method of producing fatty acid hydroperoxides
DE102007049830A1 (en) 2007-10-16 2009-04-23 Henkel Ag & Co. Kgaa New protein variants by circular permutation
WO2009155115A2 (en) 2008-05-30 2009-12-23 Reactive Surfaces, Ltd. Coatings and surface treatments having active enzymes and peptides
WO2011034387A2 (en) 2009-09-18 2011-03-24 (주)Lg화학 Novel use of a lipolytic enzyme for forming an anti-fingerprint coating, method for forming anti-fingerprint coating, substrate comprising the anti-fingerprint coating formed by the method, and products comprising the substrate
FI124342B (en) 2009-12-16 2014-07-15 Teknologian Tutkimuskeskus Vtt Adhesive, method of preparation thereof and its use
FR2959128B1 (en) 2010-04-23 2012-07-13 Oreal COSMETIC USE OF A SPECIFIC BIFIDOBACTERIUM LYSATE FOR THE TREATMENT OF BODY ODORS
US8394618B2 (en) 2010-06-21 2013-03-12 Toyota Motor Engineering & Manufacturing North America, Inc. Lipase-containing polymeric coatings for the facilitated removal of fingerprints
EP2805439B1 (en) 2012-01-20 2016-12-28 Digimarc Corporation Shared secret arrangements and optical data transfer
US9075567B2 (en) 2012-06-08 2015-07-07 Apple Inc. Electronic device display structures
EP2861749A1 (en) 2012-06-19 2015-04-22 Novozymes Bioag A/S Enzymatic reduction of hydroperoxides
KR101993171B1 (en) 2012-09-28 2019-06-26 삼성전자주식회사 Touch panel sealing device
US9261915B2 (en) 2013-12-21 2016-02-16 Kyocera Corporation Electronic apparatus, light-transmissive cover plate, and portable device
KR102249030B1 (en) 2015-06-25 2021-05-07 엘지디스플레이 주식회사 Display device
US9742493B2 (en) 2015-09-30 2017-08-22 Osram Sylvania Inc. Reconstructing light-based communication signals captured with a rolling shutter image capture device
US9564966B1 (en) 2015-09-30 2017-02-07 Osram Sylvania Inc. Reconstructing light-based communication signals using an alias frequency
US20180077813A1 (en) 2016-09-12 2018-03-15 Apple Inc. Electronic Devices With Protective Enzymes

Also Published As

Publication number Publication date
WO2019055541A1 (en) 2019-03-21
US11359182B2 (en) 2022-06-14
US20200255809A1 (en) 2020-08-13
EP3682002A1 (en) 2020-07-22
CN111278969A (en) 2020-06-12

Similar Documents

Publication Publication Date Title
US20220348889A1 (en) Protective enzymes
Allocati et al. Glutathione transferases in bacteria
Newton et al. The DinB superfamily includes novel mycothiol, bacillithiol, and glutathione S-transferases
Robinson et al. Modelling and bioinformatics studies of the human Kappa-class glutathione transferase predict a novel third glutathione transferase family with similarity to prokaryotic 2-hydroxychromene-2-carboxylate isomerases
Lamb et al. On the occurrence of cytochrome P450 in viruses
Katzen et al. Evolutionary domain fusion expanded the substrate specificity of the transmembrane electron transporter DsbD
Wang et al. Membrane topology and mutational analysis of Mycobacterium tuberculosis VKOR, a protein involved in disulfide bond formation and a homologue of human vitamin K epoxide reductase
Jaroensuk et al. Methylation at position 32 of tRNA catalyzed by TrmJ alters oxidative stress response in Pseudomonas aeruginosa
Do et al. Mutations suppressing the loss of DegQ function in Bacillus subtilis (natto) poly-γ-glutamate synthesis
Amin et al. Post-translational serine/threonine phosphorylation and lysine acetylation: a novel regulatory aspect of the global nitrogen response regulator GlnR in S. coelicolor M145
Pandey et al. Characterization of a highly pH stable chi-class glutathione S-transferase from Synechocystis PCC 6803
Barreteau et al. Human-and plant-pathogenic Pseudomonas species produce bacteriocins exhibiting colicin M-like hydrolase activity towards peptidoglycan precursors
Gunne et al. Enhancement of copper content and specific activity of CotA laccase from Bacillus licheniformis by coexpression with CopZ copper chaperone in E. coli
Prabhu et al. Probing the molecular determinant for the catalytic efficiency of L-arabinose isomerase from Bacillus licheniformis
Lee et al. Introduction of bifunctionality into the multidomain architecture of the ω-ester-containing peptide plesiocin
Marín-Navarro et al. Identification and structural analysis of amino acid substitutions that increase the stability and activity of Aspergillus niger glucose oxidase
Matsumoto et al. A critical role of mevalonate for peptidoglycan synthesis in Staphylococcus aureus
Chatzikonstantinou et al. The glutathione transferase family of Chlamydomonas reinhardtii: identification and characterization of novel sigma class-like enzymes
US20180077813A1 (en) Electronic Devices With Protective Enzymes
Wasilko et al. Insights into the ubiquitin transfer cascade catalyzed by the Legionella effector SidC
Giannouli et al. On the role of an unusual tRNAGly isoacceptor in Staphylococcus aureus
Jo An intrinsically disordered peptide tag that confers an unusual solubility to aggregation-prone proteins
Tang et al. The enterococcal cytolysin synthetase coevolves with substrate for stereoselective lanthionine synthesis
Maeda et al. DYW deaminase domain has a distinct preference for neighboring nucleotides of the target RNA editing sites
Müller et al. Nitroreductases of bacterial origin in Giardia lamblia: Potential role in detoxification of xenobiotics

Legal Events

Date Code Title Description
AS Assignment

Owner name: GINKGO BIOWORKS, INC., MASSACHUSETTS

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:BOYLE, PATRICK;BOUCHER, JEFFREY IAN;NAPOLITANO, MICHAEL G.;SIGNING DATES FROM 20210413 TO 20210517;REEL/FRAME:060790/0583

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED