US20220257714A1 - Use of dermcidin in sterile inflammatory conditions - Google Patents

Use of dermcidin in sterile inflammatory conditions Download PDF

Info

Publication number
US20220257714A1
US20220257714A1 US17/685,993 US202217685993A US2022257714A1 US 20220257714 A1 US20220257714 A1 US 20220257714A1 US 202217685993 A US202217685993 A US 202217685993A US 2022257714 A1 US2022257714 A1 US 2022257714A1
Authority
US
United States
Prior art keywords
dermcidin
analog
peptide
subject
active
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
US17/685,993
Inventor
Ping Wang
Haichao Wang
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Feinstein Institutes for Medical Research
Original Assignee
Feinstein Institutes for Medical Research
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Feinstein Institutes for Medical Research filed Critical Feinstein Institutes for Medical Research
Priority to US17/685,993 priority Critical patent/US20220257714A1/en
Publication of US20220257714A1 publication Critical patent/US20220257714A1/en
Pending legal-status Critical Current

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • A61K38/1729Cationic antimicrobial peptides, e.g. defensins
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01NPRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
    • A01N1/00Preservation of bodies of humans or animals, or parts thereof
    • A01N1/02Preservation of living parts
    • A01N1/0205Chemical aspects
    • A01N1/021Preservation or perfusion media, liquids, solids or gases used in the preservation of cells, tissue, organs or bodily fluids
    • A01N1/0215Disinfecting agents, e.g. antimicrobials for preserving living parts
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/549Sugars, nucleosides, nucleotides or nucleic acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0014Skin, i.e. galenical aspects of topical compositions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]

Definitions

  • the present invention addresses the need for a new anti-inflammatory treatments and compositions.
  • a method for treating a sterile inflammatory condition in a subject comprising administering to the subject an amount of an isolated dermcidin peptide, or an active fragment thereof or an active analog thereof, effective to treat a sterile inflammatory condition.
  • Also provided is a method of inhibiting organ transplantation-associated ischemia/reperfusion and/or organ transplantation-associated inflammation in a recipient subject comprising storing and/or rinsing the organ to be transplanted in a solution comprising an amount of an isolated dermcidin peptide, or an active fragment thereof or an active analog thereof, effective to inhibit organ transplantation-associated ischemia/reperfusion and/or organ transplantation-associated inflammation in a recipient subject.
  • Also provided is a method of treating an inflammatory condition in a subject comprising administering to the subject an amount of an isolated dermcidin peptide, or an active fragment thereof or an active analog thereof, effective to treat an inflammatory condition.
  • FIG. 1A-1C Expression and purification of recombinant dermcidin.
  • 1 A Amino acid sequence of dermcidin precursor and various proteolytic peptides. (From top to bottom SEQ ID NOS:1, 7, 8, and 6, respectively).
  • DCD-1L is a 48 amino acid peptide corresponding to the C-terminal of the full length of dermcidin precursor.
  • 1 B Expression and purification of recombinant histidine-tag dermcidin precursor (20-110) (DCD). Recombinant dermcidin corresponding to residue 20-110 amino acid with an N-terminal histidine tag was expressed in E.
  • FIG. 2 Dermcidin dose-dependently attenuated LPS- and CIRP-induced NO release by murine macrophages.
  • Murine macrophages were stimulated with LPS or CIRP alone or in the presence of recombinant dermcidin (DCD) for 16 hours, and extracellular levels of nitric oxide (NO) were determined by the Griess Reagent. *, P ⁇ 0.05 versus “ ⁇ control”; #, P ⁇ 0.05 versus “+LPS”, or “+CIRP” alone.
  • FIG. 3A-3B Dermcidin modulated LPS- and HMGB1-induced chemokine release by human monocytes.
  • Human peripheral mononuclear cells huPBMCs
  • LPS 0.8 ⁇ g/ml
  • HMGB1 4.0 ⁇ g/ml
  • DCD 1.0 ⁇ g/ml
  • extracellular levels of cytokines and chemokines were determined by Cytokine Antibody Arrays (Panel A, B).
  • Cytokine Antibody Arrays Panel A, B.
  • 3 A Representative cytokine antibody arrays.
  • the name of the cytokines and positive controls (“Pos”, or “+Ctrl”) were labeled in the table below.
  • FIG. 4A-4B Intravenous administration of dermcidin conferred protection against hepatic ischemia/reperfusion (I/R) injury.
  • Male C57BL/6 mice (20-25 g) were subjected to hepatic ischemia/reperfusion by temporal clamping the hepatic artery and portal vein for 60 minutes, which typically produced ischemia in 70% of the liver.
  • 0.2 ml saline or recombinant dermcidin solution (“DCD”, 5.0 mg/kg BW) was injected via the internal jugular vein.
  • hepatic injury markers such as alanine aminotransferase (ALT) ( 4 A) and aspartate aminotransferase (AST) ( 4 B) using commercial kits.
  • ALT alanine aminotransferase
  • AST aspartate aminotransferase
  • dermcidin promoted significant protection against I/R injury. *, P ⁇ 0.05 versus sham control; #, P ⁇ 0.05 versus saline group (“I/R”).
  • FIG. 5 DCD monomer protects against hepatic ischemic/reperfusion injury.
  • the DCD monomer-treated group [“I/R+DCD (m)”] exhibited a well-preserved tissue structure. Liver injury was also assessed histologically using the Suzuki liver injury scores, and expressed as means ⁇ S.E. of 3-6 animals per group. *P ⁇ 0.05 vs. sham; #P ⁇ 0.05 vs. “I/R” group.
  • FIG. 6A-6B DCD protects against hepatic ischemic/reperfusion-induced lung injury.
  • 6 A Histopathological characteristics of lung injury after hepatic I/R. Representative H&E histological images of lung sections at 24 h post the onset of reperfusion. Note a normal lung architecture in the “Sham” control, and extensive lung injury and neutrophil infiltration in the “I/R” group.
  • DCD treatment group (“I/R+DCD”) exhibited a well-preserved tissue structure.
  • 6 B Histological Scores. Lung injury was assessed histologically using American Thoracic Society Documents' lung injury scores, and expressed as means ⁇ S.E. of 3-6 animals per group. *P ⁇ 0.05 vs. sham; #P ⁇ 0.05 vs. “I/R” group.
  • FIG. 7 DCD protects against lethal sepsis in mice.
  • Balb/C mice (7-10 weeks, 20-25 g, male) were subjected to sepsis by cecal ligation and puncture as previously described. Briefly, Balb/c mice were anesthetized with Ketamine (75 mg/kg, intramuscularly) and xylazine (10 mg/kg, intramuscularly) before a 15 mm midline incision was made to expose the cecum.
  • a 4-0 Prolene suture ligature was placed at a level 5.0 mm from the cecal tip away from the ileocecal valve, and the ligated cecal stump was then punctured once with a 22-gauge needle without direct extrusion of stool.
  • a method for treating a sterile inflammatory condition in a subject comprising administering to the subject an amount of an isolated dermcidin peptide, or an active fragment thereof of or an active analog thereof, effective to treat a sterile inflammatory condition.
  • the sterile inflammatory condition is caused by or associated with ischemia-reperfusion in an organ in the subject. In an embodiment, the sterile inflammatory condition is caused by or associated with ischemia-reperfusion in a gastrointestinal tract, liver, lung, kidney, heart, brain or crushed limb of the subject.
  • Also provided is a method of inhibiting organ transplantation-associated ischemia/reperfusion and/or organ transplantation-associated inflammation in a recipient subject comprising storing and/or rinsing the organ to be transplanted in a solution comprising an amount of an isolated dermcidin peptide, or an active fragment thereof or an active analog thereof, effective to inhibit organ transplantation-associated ischemia/reperfusion and/or organ transplantation-associated inflammation in a recipient subject.
  • the isolated dermcidin peptide, or an active fragment thereof or an active analog thereof is used as an adjuvant in an organ transplantation storage and/or organ transplantation rinse solution.
  • the organ is a kidney, liver, heart, or lung.
  • the organ transplantation storage and/or organ transplantation in an embodiment is a known and/or clinically used organ transplantation storage and/or organ transplantation.
  • the isolated dermcidin peptide is administered to the subject, or used in the storing and/or rinsing, respectively.
  • the isolated dermcidin peptide has the sequence of full-length human dermcidin without its signal sequence.
  • the active analog of dermcidin is administered to the subject, or used in the storing and/or rinsing, respectively.
  • the active analog of dermcidin has a Cysteine ⁇ Serine substitution that prevents dimerization via disulfide bonds between cysteine 34 of two dermcidin peptides.
  • the active fragment of dermcidin is administered to the subject, or used in the storing and/or rinsing, respectively.
  • a pharmaceutically acceptable salt of dermcidin peptide or of a dermcidin fragment or analog is used.
  • the dermcidin peptide has the sequence: YDPEAASAPGSGNP C HEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKK AVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL (SEQ ID NO:1).
  • the “cysteine 34” as referred to herein is the underlined C in SEQ ID NO:1.
  • the dermcidin active fragment has one of the following sequences:
  • the dermcidin fragment is DCD-1L, DCD-1 or SSL25 as shown in FIG. 1A .
  • the peptide, analog or fragment is modified to improve its plasma half-life. In an embodiment of the methods, the peptide, analog or fragment is modified by being PEGylated or mannosylated.
  • the amount of an isolated dermcidin peptide or an active fragment thereof or an active analog thereof is administered by intra-arterial, intravenous, intraventricular, or topical administration.
  • Other routes of medicament administration known in the art may also be used.
  • Also provided is a method of treating an inflammatory condition in a subject comprising administering to the subject an amount of an isolated dermcidin peptide, or an active fragment thereof or an active analog thereof, effective to treat an inflammatory condition.
  • the inflammatory condition is sepsis, septicemia or endotoxemia.
  • the inflammatory condition is sepsis.
  • the isolated dermcidin peptide, or an active fragment thereof or an active analog thereof is administered intraperitoneally.
  • the inflammatory condition is septicemia.
  • the isolated dermcidin peptide, or an active fragment thereof or an active analog thereof is administered intravascularly.
  • the inflammatory condition is endotoxemia.
  • the active fragment of dermcidin is administered or used.
  • the peptide, analog or fragment is modified to improve its plasma half-life.
  • the peptide, analog or fragment is modified with PEGylation or mannosylation.
  • the active analog of dermcidin is administered or used.
  • the isolated dermcidin peptide is administered or used.
  • the isolated dermcidin peptide has the sequence of full-length human dermcidin without its signal sequence.
  • the active analog of dermcidin has a Cysteine ⁇ Serine substitution that prevents dimerization via disulfide bonds between cysteine 34 of two dermcidin peptides.
  • the subject is a human subject.
  • dermcidin can be activated in salty and slightly acidic sweat to form channels that can possibly perforate microbe membranes, allowing water and Zn +2 ions in sweat to gush across the cell membrane, killing the microbe (2, 3).
  • dermcidin has not yet been reproducibly shown to permeabilize bacterial membranes (4), calling for further investigation in this arena. Nevertheless, at body sites in frequent contact with pathogenic microbes, a higher amount of dermcidin peptide is detected in sweat (5), supporting the essential role of sweat in the regulation of skin microbial flora.
  • dermcidin also has mammalian immune system-modulating properties and anti-inflammatory properties.
  • monocytes As the first line of defense against microbial infection, monocytes continuously patrol the body in search of invading pathogens or damaged tissues, and can immediately infiltrate the infected/injured tissue upon the detection of microbial products or host-derived chemotactic factors. Once reaching extravascular tissues, these monocytes are differentiated into tissue-specific resident macrophages, which ingest and eliminate invading pathogens in conjunction with other phagocytes (e.g., neutrophils).
  • phagocytes e.g., neutrophils
  • macrophages/monocytes are equipped with pattern recognition receptors [such as the Toll-like receptors (TLRs) TLR2, TLR3, TLR4, and TLR9] (7) for various pathogen-associated molecular patterns (PAMPs, such as bacterial peptidoglycan, double-stranded RNA, endotoxin, and CpG-DNA) (8).
  • PAMPs pathogen-associated molecular patterns
  • the engagement of various PAMPs with respective receptors triggers release of various proinflammatory mediators such as high mobility group box 1 (HMGB1) (9), cold-inducible RNA-binding protein (CIRP) (10, 11) as well as nitric oxide (NO) (12).
  • HMGB1 high mobility group box 1
  • CIRP cold-inducible RNA-binding protein
  • NO nitric oxide
  • HMGB1 can also be passively released from damaged cells (13) following ischemia/reperfusion (14), trauma (15), or toxemia (16), thereby serving as a damage-associated molecular pattern molecule (DAMP).
  • DAMP damage-associated molecular pattern molecule
  • dermcidin exhibits immune-modulating properties in response to PAMP or DAMP.
  • Dermcidin is expressed in sweat glands, and in the absence of an inflammatory stimulus, is constitutively secreted as a full-length protein (1).
  • This full length precursor can be further processed by unknown proteases in human sweat, to form several shorter peptides that exhibit anti-oxidant and antimicrobial activities ( FIG. 1A ).
  • the N-terminal peptide (residue 20-62) has been shown to protect various types of cells against oxidative or hypoxic stresses (25-27).
  • many C-terminal peptides exhibit anti-microbial properties against S. aureus, E. coli, E. faecalis, and C. albicans (1).
  • innate immune cells e.g., monocytes
  • dermcidin precursor in response to viral infection (28).
  • the full-length dermcidin precursor also exhibits bacterial killing activities towards S. aureus, E. coli, and P. acnes (29).
  • a C-terminal peptide, DCD-1L has been shown to activate keratinocytes to produce cytokines (e.g., TNF) and chemokines (e.g., IL-8/CXCL8, CXCL10, and CCL20) (30).
  • cytokines e.g., TNF
  • chemokines e.g., IL-8/CXCL8, CXCL10, and CCL20
  • Recombinant human dermcidin protein was generated in E. coli, and purified to homogeneity in the absence or presence of a reducing agent (DTT, FIG. 1B ). Although migrating at a slightly lower rate than the predicted molecular weight, the identity of this recombinant dermcidin was confirmed by Western blotting analysis using a commercially available antibody ( FIG. 1C ). This is consistent with a recent report that recombinant histidine tag-DCD migrated as a 15-16 kDa band on SDS-PAGE gel, even though its molecular weight was determined to be ⁇ 9.25 kDa by mass spectrometry (29).
  • dermcidin Using purified dermcidin, we then tested its immune-modulating properties using macrophage and monocyte cultures.
  • PAMPs e.g., bacterial endotoxin, LPS
  • endogenous cytokines e.g., CIRP
  • macrophages released large amounts of nitric oxide (NO, FIG. 2 ).
  • DCD dermcidin
  • monocytes Although activated monocytes cannot produce NO, they do produce various proinflammatory cytokines or chemokines.
  • Human monocytes were stimulated with PAMPs (e.g., LPS) or DAMPs (e.g., HMGB1), in the absence or presence of DCD.
  • PAMPs e.g., LPS
  • DAMPs e.g., HMGB1
  • The, relative levels of various cytokines/chemokines in the monocyte-conditioned culture medium were measured using Cytokine Antibody Arrays ( FIG. 3 ).
  • both LPS and HMGB1 elevated the relative levels of several chemokines such as GRO- ⁇ and MCP-3.
  • dermcidin effectively inhibited LPS- and HMGB1-induced release of GRO- ⁇ and MCP-3 from human monocyte cultures ( FIG. 3 ).
  • dermcidin slightly stimulated TNF secretion, an early proinflammatory cytokine that propagates protective innate immune response against microbial infection.
  • dermcidin's immune-modulating properties were also relatively stable.
  • dermcidin tended to form dimers in the absence of reducing agents ( FIG. 1B ), its immune modulating properties remained unaltered (data not shown), indicating the relative stability of dermcidin's biological activities in vitro.
  • CLP cecal ligation and puncture
  • cytokine-targeting therapeutic strategies e.g., anti-TNF antibody, infliximab
  • autoimmune diseases such as rheumatoid arthritis (34, 35).
  • the dual anti-bacterial (29) and anti-inflammatory ( FIG. 2 and FIG. 3 ) properties may distinguish dermcidin from previously tested anti-inflammatory agents, positioning it as a unique experimental agent for preclinical testing using various animal models of inflammatory diseases.
  • dermcidin may occupy an important role in the regulation of local or systemic inflammation in preclinical animal models. For instance, injection of bacterial endotoxin directly into the skin (e.g., footpad, subcutaneously) provides a murine model of local inflammation and edema. It is interesting to determine whether local co-administration of dermcidin attenuates paw edema at various time points after endotoxin challenge. Additionally, systemic inflammation can be induced in animals by infusion of bacterial endotoxin such as LPS (31), or surgical perforation of the cecum, a technique aforementioned as CLP (31). Systemic administration (intraperitoneally or intravenously) of dermcidin may confer a dose-dependent protection against lethal endotoxemia or CLP-induced bacteremia.
  • LPS LPS
  • CLP surgical perforation of the cecum
  • hepatic injury markers such as alanine aminotransferase (ALT) and aspartate aminotransferase (AST) using commercial kits.
  • ALT alanine aminotransferase
  • AST aspartate aminotransferase
  • the DCD monomer protects against hepatic ischemic/reperfusion injury, as shown in FIG. 5 .
  • a representative liver histology at 24 h post the onset of reperfusion is shown, note a normal liver parenchyma architecture in the “Sham” control, and hepatic necrosis in the “I/R”.
  • the DCD monomer-treated group [“I/R+DCD (m)”] exhibited a well-preserved tissue structure. Liver injury was also assessed histologically using the Suzuki liver injury scores, and expressed as means ⁇ S.E. of 3-6 animals per group. *P ⁇ 0.05 vs. sham; #P ⁇ 0.05 vs. “I/R” group.
  • FIG. 6 shows histopathological characteristics of lung injury after hepatic I/R.
  • FIG. 6A are shown representative H&E histological images of lung sections at 24 h post the onset of reperfusion. Note a normal lung architecture in the “Sham” control, and extensive lung injury and neutrophil infiltration in the “I/R” group.
  • DCD treatment group (“I/R+DCD”) exhibited a well-preserved tissue structure.
  • FIG. 6B shows histological Scores. Lung injury was assessed histologically using American Thoracic Society Documents' lung injury scores, and expressed as means ⁇ S.E. of 3-6 animals per group. *P ⁇ 0.05 vs. sham; #P ⁇ 0.05 vs. “I/R” group.
  • DCD was also found to protect against lethal sepsis in mice.
  • Balb/C mice (7-10 weeks, 20-25 g, male) were subjected to sepsis by cecal ligation and puncture as previously described. Briefly, Balb/c mice were anesthetized with Ketamine (75 mg/kg, intramuscularly) and xylazine (10 mg/kg, intramuscularly) before a 15 mm midline incision was made to expose the cecum.
  • a 4-0 Prolene suture ligature was placed at a level 5.0 mm from the cecal tip away from the ileocecal valve, and the ligated cecal stump was then punctured once with a 22-gauge needle without direct extrusion of stool.
  • Bacterial endotoxin lipopolysaccharide, LPS, E. coli 0111:B4, Cat. No. L4130
  • LPS lipopolysaccharide
  • E. coli 0111:B4, Cat. No. L4130 was obtained from Sigma-Aldrich (St. Louis, Mo.).
  • Dulbecco's Modified Eagle's Medium (DMEM, Cat. No. 11995-065), penicillin/streptomycin (Cat. No. 15140-122) and fetal bovine serum (FBS, Cat. No. 26140079) were from Invitrogen (Grand Island, N.Y.).
  • Recombinant HMGB1 and CIRP were expressed in E. coli, and purified to remove contaminating endotoxin by Triton X-114 extraction as previously described (10, 19).
  • Murine macrophage-like RAW 264.7 were obtained from the American Type Culture Collection (ATCC, Rockville, Md.), and were cultured in DMEM supplemented with 1% penicillin/streptomycin and 10% FBS.
  • Human blood was purchased from the Long Island Blood Bank (Melville, N.Y.), and human peripheral blood mononuclear cells (HuPBMCs) were isolated by density gradient centrifugation through Ficoll (Ficoll-Paque PLUS, Pharmacia, Piscataway, N.J.) as previously described (20-22).
  • Adherent macrophages or HuPBMCs were gently washed with, and cultured in, DMEM before stimulation with LPS (0.4 ⁇ g/ml), CIRP (2.0 ⁇ g/ml), or HMGB1 (1.0 ⁇ g/ml) in the absence or presence of recombinant dermcidin for 16 h. Subsequently, the cell-conditioned culture media were analyzed respectively for levels of nitric oxide, and other cytokines by the Griess Reaction and Cytokine Antibodies Arrays as previously described (19, 23).
  • Nitric oxide (NO) assay The levels of NO in the culture medium were determined indirectly by measuring the NO 2 ⁇ production with a colorimetric assay based on the Griess reaction (21, 24). NO 2 ⁇ concentrations were determined with reference to a standard curve generated with sodium nitrite at various dilutions.
  • Cytokine antibody array Human Cytokine Antibody Array C3 (Cat. No. AAH-CYT-3-4, RayBiotech Inc., Norcross, Ga., USA), which respectively detect 42 cytokines on one membrane, were used to determine cytokine levels in human monocyte-conditioned culture medium as previously described (21, 24). Briefly, the membranes were sequentially incubated with equal volumes of cell culture medium (200 ⁇ l), primary biotin-conjugated antibodies, and horseradish peroxidase-conjugated streptavidin. After exposing to X-ray film, the relative signal intensity was determined using the Scion Image software.
  • Schittek B The multiple facets of dermcidin in cell survival and host defense. J Innate Immun 4 (4):349-360, 2012.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Zoology (AREA)
  • Dermatology (AREA)
  • Rheumatology (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Organic Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pain & Pain Management (AREA)
  • Biochemistry (AREA)
  • Environmental Sciences (AREA)
  • Wood Science & Technology (AREA)
  • Dentistry (AREA)
  • Molecular Biology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)

Abstract

A method of treating a sterile inflammatory condition in a subject using an isolated dermcidin peptide or an active fragment thereof of or an active analog thereof is provided. Also provided is a method of inhibiting organ transplantation-associated ischemia/reperfusion and/or organ transplantation-associated inflammation.

Description

    CROSS-REFERENCE TO RELATED APPLICATIONS
  • This application is a continuation of U.S. patent application Ser. No. 15/769,880, filed Apr. 20, 2018, which is a U.S. national stage entry under 35 U.S.C. § 371 of PCT International Patent Application No. PCT/US2016/058027, filed Oct. 21, 2016, which claims the benefit of U.S. Provisional Application No. 62/244,779, filed Oct. 22, 2015, the contents of which are incorporated herein by reference into the subject application.
  • STATEMENT OF GOVERNMENT SUPPORT
  • This invention was made with government support under grant nos. AT005076, GM063075, GM053008, and GM076179 awarded by the National Institutes of Health. The government has certain rights in the invention.
  • BACKGROUND OF THE INVENTION
  • Throughout this application various patents and other publications are referred to in parenthesis. Full citations for the references may be found at the end of the specification. The disclosures of these patents and publications are hereby incorporated by reference in their entirety into the subject application to more fully describe the art to which the subject invention pertains.
  • Despite advances in medicine, conditions in which inflammatory responses result in complications, injury or death continue to be a problem area. This is true even in the case of sterile inflammatory responses.
  • The present invention addresses the need for a new anti-inflammatory treatments and compositions.
  • SUMMARY OF THE INVENTION
  • Provided is a method for treating a sterile inflammatory condition in a subject comprising administering to the subject an amount of an isolated dermcidin peptide, or an active fragment thereof or an active analog thereof, effective to treat a sterile inflammatory condition.
  • Also provided is a method of inhibiting organ transplantation-associated ischemia/reperfusion and/or organ transplantation-associated inflammation in a recipient subject comprising storing and/or rinsing the organ to be transplanted in a solution comprising an amount of an isolated dermcidin peptide, or an active fragment thereof or an active analog thereof, effective to inhibit organ transplantation-associated ischemia/reperfusion and/or organ transplantation-associated inflammation in a recipient subject.
  • Also provided is a method of treating an inflammatory condition in a subject comprising administering to the subject an amount of an isolated dermcidin peptide, or an active fragment thereof or an active analog thereof, effective to treat an inflammatory condition.
  • Additional objects of the invention will be apparent from the description which follows.
  • BRIEF DESCRIPTION OF THE DRAWINGS
  • FIG. 1A-1C. Expression and purification of recombinant dermcidin. 1A). Amino acid sequence of dermcidin precursor and various proteolytic peptides. (From top to bottom SEQ ID NOS:1, 7, 8, and 6, respectively). DCD-1L is a 48 amino acid peptide corresponding to the C-terminal of the full length of dermcidin precursor. 1B). Expression and purification of recombinant histidine-tag dermcidin precursor (20-110) (DCD). Recombinant dermcidin corresponding to residue 20-110 amino acid with an N-terminal histidine tag was expressed in E. coli BL21 (DE3) pLysS cells (Panel B, left gel), and purified by histidine-affinity chromatography (Panel B, right gel) and Triton X-114 extraction to remove contaminating endotoxins. Note that recombinant dermcidin migrated on SDS-PAGE gel as a 12-14 kDa monomer (DCD M) in the presence of a reducing agent (dithiothreitol, DTT), but migrated as both a monomer and 24-28 kDa dimer (24-28 kDa) in the absence of DTT, suggesting possible cross-linking between dimers through disulfide bonds. 1C). Confirmation of the identify of recombinant protein by Western blotting analysis using dermcidin-specific antibodies.
  • FIG. 2. Dermcidin dose-dependently attenuated LPS- and CIRP-induced NO release by murine macrophages. Murine macrophages were stimulated with LPS or CIRP alone or in the presence of recombinant dermcidin (DCD) for 16 hours, and extracellular levels of nitric oxide (NO) were determined by the Griess Reagent. *, P<0.05 versus “−control”; #, P<0.05 versus “+LPS”, or “+CIRP” alone.
  • FIG. 3A-3B. Dermcidin modulated LPS- and HMGB1-induced chemokine release by human monocytes. Human peripheral mononuclear cells (huPBMCs) were stimulated with LPS (0.8 μg/ml) or HMGB1 (4.0 μg/ml) alone, or in the presence of DCD (1.0 μg/ml) for 16 hours, and extracellular levels of cytokines and chemokines were determined by Cytokine Antibody Arrays (Panel A, B). 3A, Representative cytokine antibody arrays. The name of the cytokines and positive controls (“Pos”, or “+Ctrl”) were labeled in the table below. 3B, Relative cytokine levels. The relative cytokine levels were estimated by measuring the intensity of corresponding signal, and expressed as mean±SEM [% of positive controls (“+Ctrl”) of respective arrays] of two independent experiments. *, P<0.05 versus “untreated”; #, P<0.05 versus “+LPS” or “+HMGB1” alone.
  • FIG. 4A-4B. Intravenous administration of dermcidin conferred protection against hepatic ischemia/reperfusion (I/R) injury. Male C57BL/6 mice (20-25 g) were subjected to hepatic ischemia/reperfusion by temporal clamping the hepatic artery and portal vein for 60 minutes, which typically produced ischemia in 70% of the liver. At the beginning of the reperfusion, 0.2 ml saline or recombinant dermcidin solution (“DCD”, 5.0 mg/kg BW) was injected via the internal jugular vein. At 24 h after the onset of ischemia, animals were euthanized to harvest blood to measure serum levels of hepatic injury markers such as alanine aminotransferase (ALT) (4A) and aspartate aminotransferase (AST) (4B) using commercial kits. Note that dermcidin promoted significant protection against I/R injury. *, P<0.05 versus sham control; #, P<0.05 versus saline group (“I/R”).
  • FIG. 5. DCD monomer protects against hepatic ischemic/reperfusion injury. Representative liver histology at 24 h post the onset of reperfusion. Note a normal liver parenchyma architecture in the “Sham” control, but hepatic necrosis in the “I/R”. Unlike the DCD dimer-treated group [“I/R+DCD (d)”], the DCD monomer-treated group [“I/R+DCD (m)”] exhibited a well-preserved tissue structure. Liver injury was also assessed histologically using the Suzuki liver injury scores, and expressed as means±S.E. of 3-6 animals per group. *P<0.05 vs. sham; #P<0.05 vs. “I/R” group.
  • FIG. 6A-6B. DCD protects against hepatic ischemic/reperfusion-induced lung injury. 6A). Histopathological characteristics of lung injury after hepatic I/R. Representative H&E histological images of lung sections at 24 h post the onset of reperfusion. Note a normal lung architecture in the “Sham” control, and extensive lung injury and neutrophil infiltration in the “I/R” group. DCD treatment group (“I/R+DCD”) exhibited a well-preserved tissue structure. 6B). Histological Scores. Lung injury was assessed histologically using American Thoracic Society Documents' lung injury scores, and expressed as means±S.E. of 3-6 animals per group. *P<0.05 vs. sham; #P<0.05 vs. “I/R” group.
  • FIG. 7. DCD protects against lethal sepsis in mice. Balb/C mice (7-10 weeks, 20-25 g, male) were subjected to sepsis by cecal ligation and puncture as previously described. Briefly, Balb/c mice were anesthetized with Ketamine (75 mg/kg, intramuscularly) and xylazine (10 mg/kg, intramuscularly) before a 15 mm midline incision was made to expose the cecum. A 4-0 Prolene suture ligature was placed at a level 5.0 mm from the cecal tip away from the ileocecal valve, and the ligated cecal stump was then punctured once with a 22-gauge needle without direct extrusion of stool. The cecum was then replaced back into its normal intra-abdominal position, and the abdomen wound was closed with staples (wound clips) to prevent leakage of fluid. All animals were resuscitated with a normal saline solution (subcutaneously at 20 ml/kg of body weight), and given a subcutaneous injection of imipenem (0.5 mg/mouse in 200 μl sterile saline) (Primaxin, Merck & Co., Inc., West Point, Pa.) 30 minutes after the surgery. Saline or recombinant DCD (0.2 mg/kg body weight) were given intraperitoneally at +2 and +24 h post CLP surgery, and animal survival rates were monitored for up to two weeks. The Kaplan-Meier method was used to compare the differences in mortality rates between groups. Shown in the figure was a summary of two independent experiments with similar results. *, P<0.05 versus saline control group.
  • DETAILED DESCRIPTION OF THE INVENTION
  • A method is provided for treating a sterile inflammatory condition in a subject comprising administering to the subject an amount of an isolated dermcidin peptide, or an active fragment thereof of or an active analog thereof, effective to treat a sterile inflammatory condition.
  • In an embodiment, the sterile inflammatory condition is caused by or associated with ischemia-reperfusion in an organ in the subject. In an embodiment, the sterile inflammatory condition is caused by or associated with ischemia-reperfusion in a gastrointestinal tract, liver, lung, kidney, heart, brain or crushed limb of the subject.
  • Also provided is a method of inhibiting organ transplantation-associated ischemia/reperfusion and/or organ transplantation-associated inflammation in a recipient subject comprising storing and/or rinsing the organ to be transplanted in a solution comprising an amount of an isolated dermcidin peptide, or an active fragment thereof or an active analog thereof, effective to inhibit organ transplantation-associated ischemia/reperfusion and/or organ transplantation-associated inflammation in a recipient subject. In an embodiment, the isolated dermcidin peptide, or an active fragment thereof or an active analog thereof, is used as an adjuvant in an organ transplantation storage and/or organ transplantation rinse solution. In an embodiment, the organ is a kidney, liver, heart, or lung. The organ transplantation storage and/or organ transplantation in an embodiment is a known and/or clinically used organ transplantation storage and/or organ transplantation.
  • In an embodiment of the methods, the isolated dermcidin peptide is administered to the subject, or used in the storing and/or rinsing, respectively. In an embodiment of the methods, the isolated dermcidin peptide has the sequence of full-length human dermcidin without its signal sequence.
  • In an embodiment of the methods, the active analog of dermcidin is administered to the subject, or used in the storing and/or rinsing, respectively. In an embodiment of the methods, the active analog of dermcidin has a Cysteine→Serine substitution that prevents dimerization via disulfide bonds between cysteine 34 of two dermcidin peptides. In an embodiment of the methods, the active fragment of dermcidin is administered to the subject, or used in the storing and/or rinsing, respectively.
  • In an embodiment, a pharmaceutically acceptable salt of dermcidin peptide or of a dermcidin fragment or analog is used.
  • In an embodiment, the dermcidin peptide has the sequence: YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKK AVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL (SEQ ID NO:1). In an embodiment, the “cysteine 34” as referred to herein is the underlined C in SEQ ID NO:1. In an embodiment, the dermcidin active fragment has one of the following sequences:
  • (SEQ ID NO: 2)
    ESVGKGAVHDVKDVLDS;
    (SEQ ID NO: 3)
    [LL-37, 37 aa];
    (SEQ ID NO: 4)
    LEKGLDGAKKAVGGLGKLGKDAVE;
    (SEQ ID NO: 5)
    SSLLEKGLDGAKKAVGGLGKLGKDAVEDL;
    or
    (SEQ ID NO: 6)
    SSLLEKGLDGAKKAVGGLGKLGKDA.
  • In an embodiment, the dermcidin fragment is DCD-1L, DCD-1 or SSL25 as shown in FIG. 1A.
  • In an embodiment of the methods, the peptide, analog or fragment is modified to improve its plasma half-life. In an embodiment of the methods, the peptide, analog or fragment is modified by being PEGylated or mannosylated.
  • In an embodiment of the methods wherein administration is employed, the amount of an isolated dermcidin peptide or an active fragment thereof or an active analog thereof is administered by intra-arterial, intravenous, intraventricular, or topical administration. Other routes of medicament administration known in the art may also be used.
  • Also provided is a method of treating an inflammatory condition in a subject comprising administering to the subject an amount of an isolated dermcidin peptide, or an active fragment thereof or an active analog thereof, effective to treat an inflammatory condition.
  • In an embodiment, the inflammatory condition is sepsis, septicemia or endotoxemia.
  • In an embodiment, the inflammatory condition is sepsis. In an embodiment, the isolated dermcidin peptide, or an active fragment thereof or an active analog thereof is administered intraperitoneally.
  • In an embodiment, the inflammatory condition is septicemia. In an embodiment, the isolated dermcidin peptide, or an active fragment thereof or an active analog thereof is administered intravascularly.
  • In an embodiment, the inflammatory condition is endotoxemia.
  • In an embodiment of the methods, the active fragment of dermcidin is administered or used. In an embodiment of the methods, the peptide, analog or fragment is modified to improve its plasma half-life. In an embodiment of the methods, the peptide, analog or fragment is modified with PEGylation or mannosylation. In an embodiment of the methods, the active analog of dermcidin is administered or used. In an embodiment of the methods, the isolated dermcidin peptide is administered or used. In an embodiment of the methods, the isolated dermcidin peptide has the sequence of full-length human dermcidin without its signal sequence. In an embodiment of the methods, the active analog of dermcidin has a Cysteine→Serine substitution that prevents dimerization via disulfide bonds between cysteine 34 of two dermcidin peptides.
  • In an embodiment of the methods, the subject is a human subject.
  • All combinations of the various elements described herein are within the scope of the invention unless otherwise indicated herein or otherwise clearly contradicted by context.
  • This invention will be better understood from the Experimental Details, which follow. However, one skilled in the art will readily appreciate that the specific methods and results discussed are merely illustrative of the invention as described more fully in the claims that follow thereafter.
  • Experimental Details Introduction
  • Cohabitating with various microbes over millions of years, animals have developed multiple strategies to deal with microbial infections. The epidermal barriers of the skin serve as the first layer of defense by limiting the physical access of many pathogens to the blood circulation. In addition, sweat glands secrete a wide array of antimicrobial peptides, which restrain the growth of various microbes on the skin. For instance, during rigorous physical exercise, an antimicrobial peptide, called dermcidin, is secreted by the sweat glands onto the epidermal surface of the skin (1). It has been proposed that dermcidin can be activated in salty and slightly acidic sweat to form channels that can possibly perforate microbe membranes, allowing water and Zn+2 ions in sweat to gush across the cell membrane, killing the microbe (2, 3). Despite its capacity in binding to various bacterial strains, dermcidin has not yet been reproducibly shown to permeabilize bacterial membranes (4), calling for further investigation in this arena. Nevertheless, at body sites in frequent contact with pathogenic microbes, a higher amount of dermcidin peptide is detected in sweat (5), supporting the essential role of sweat in the regulation of skin microbial flora.
  • Prior to the disclosure herein, however, to applicants' knowledge it was not known that dermcidin also has mammalian immune system-modulating properties and anti-inflammatory properties.
  • As the first line of defense against microbial infection, monocytes continuously patrol the body in search of invading pathogens or damaged tissues, and can immediately infiltrate the infected/injured tissue upon the detection of microbial products or host-derived chemotactic factors. Once reaching extravascular tissues, these monocytes are differentiated into tissue-specific resident macrophages, which ingest and eliminate invading pathogens in conjunction with other phagocytes (e.g., neutrophils). Additionally, macrophages/monocytes are equipped with pattern recognition receptors [such as the Toll-like receptors (TLRs) TLR2, TLR3, TLR4, and TLR9] (7) for various pathogen-associated molecular patterns (PAMPs, such as bacterial peptidoglycan, double-stranded RNA, endotoxin, and CpG-DNA) (8). The engagement of various PAMPs with respective receptors triggers release of various proinflammatory mediators such as high mobility group box 1 (HMGB1) (9), cold-inducible RNA-binding protein (CIRP) (10, 11) as well as nitric oxide (NO) (12). In addition to active secretion, HMGB1 can also be passively released from damaged cells (13) following ischemia/reperfusion (14), trauma (15), or toxemia (16), thereby serving as a damage-associated molecular pattern molecule (DAMP). Thus, infection and injury converge on a common process, inflammation (17), which is orchestrated by HMGB1 and other proinflammatory mediators (e.g., CIRP) derived from activated immune cells and damaged tissues (10). If dysregulated, the excessive production of these proinflammatory mediators (e.g., HMGB1, NO, and CIRP) (9, 10, 12, 18), individually or in combination, contribute to the pathogenesis of inflammatory diseases.
  • Herein is provided evidence that dermcidin exhibits immune-modulating properties in response to PAMP or DAMP.
  • Dermcidin is expressed in sweat glands, and in the absence of an inflammatory stimulus, is constitutively secreted as a full-length protein (1). This full length precursor can be further processed by unknown proteases in human sweat, to form several shorter peptides that exhibit anti-oxidant and antimicrobial activities (FIG. 1A). For instance, the N-terminal peptide (residue 20-62) has been shown to protect various types of cells against oxidative or hypoxic stresses (25-27). On the other hand, many C-terminal peptides exhibit anti-microbial properties against S. aureus, E. coli, E. faecalis, and C. albicans (1). In addition to sweat glands, innate immune cells (e.g., monocytes) also express dermcidin in response to viral infection (28). Furthermore, the full-length dermcidin precursor (residue 22-110) also exhibits bacterial killing activities towards S. aureus, E. coli, and P. acnes (29). A C-terminal peptide, DCD-1L, has been shown to activate keratinocytes to produce cytokines (e.g., TNF) and chemokines (e.g., IL-8/CXCL8, CXCL10, and CCL20) (30). Herein it is disclosed that dermcidin precursor divergently modulated PAMP- and DAMP-induced production of TNF, NO, and chemokines by innate immune cells.
  • Recombinant human dermcidin protein was generated in E. coli, and purified to homogeneity in the absence or presence of a reducing agent (DTT, FIG. 1B). Although migrating at a slightly lower rate than the predicted molecular weight, the identity of this recombinant dermcidin was confirmed by Western blotting analysis using a commercially available antibody (FIG. 1C). This is consistent with a recent report that recombinant histidine tag-DCD migrated as a 15-16 kDa band on SDS-PAGE gel, even though its molecular weight was determined to be ˜9.25 kDa by mass spectrometry (29). Using purified dermcidin, we then tested its immune-modulating properties using macrophage and monocyte cultures. In response to PAMPs (e.g., bacterial endotoxin, LPS) or endogenous cytokines (e.g., CIRP), macrophages released large amounts of nitric oxide (NO, FIG. 2). However, dermcidin (DCD) dose-dependently and significantly attenuated both LPS- and CIRP-induced NO release (FIG. 2). Although activated monocytes cannot produce NO, they do produce various proinflammatory cytokines or chemokines. Human monocytes were stimulated with PAMPs (e.g., LPS) or DAMPs (e.g., HMGB1), in the absence or presence of DCD. The, relative levels of various cytokines/chemokines in the monocyte-conditioned culture medium were measured using Cytokine Antibody Arrays (FIG. 3). As shown in FIG. 3, both LPS and HMGB1 elevated the relative levels of several chemokines such as GRO-α and MCP-3. Similarly, dermcidin effectively inhibited LPS- and HMGB1-induced release of GRO-α and MCP-3 from human monocyte cultures (FIG. 3). Despite the inhibitory effects on the above chemokines, dermcidin slightly stimulated TNF secretion, an early proinflammatory cytokine that propagates protective innate immune response against microbial infection. In agreement with the stability of dermcidin's anti-bacterial properties over a broad pH range and salt concentrations (1), it was found that dermcidin's immune-modulating properties were also relatively stable. Although dermcidin tended to form dimers in the absence of reducing agents (FIG. 1B), its immune modulating properties remained unaltered (data not shown), indicating the relative stability of dermcidin's biological activities in vitro.
  • In animal models of peritoneal microbial infection induced by surgical perforation of the cecum, a technique known as cecal ligation and puncture (CLP) (31), neutralizing antibodies against TNF worsens the outcome (32), supporting a beneficial role of TNF in the innate immunity against bacterial infection. Although appropriate inflammatory responses might be needed for the innate immunity against microbial infection, excessive recruitment of leukocyte to infection or injury sites might be harmful to the host. As a critical element of the innate immune response, leukocyte recruitment is governed by chemotactic functions of bacterial products and chemokines (such as GRO-α and MCP-3) (33). The dermcidin-mediated suppression of both PAMP- and DAMP-induced chemokines (such as GRO-α and MCP-3) might attenuate leukocyte recruitment to the infection and injury site, and likely prevent excessive inflammatory responses to infection or injury.
  • Although many anti-inflammatory agents have failed to improve outcomes of many inflammatory diseases (such as sepsis), the investigation of pathogenic cytokines in animal models of diseases has led to the development of successful cytokine-targeting therapeutic strategies (e.g., anti-TNF antibody, infliximab) for autoimmune diseases such as rheumatoid arthritis (34, 35). The dual anti-bacterial (29) and anti-inflammatory (FIG. 2 and FIG. 3) properties may distinguish dermcidin from previously tested anti-inflammatory agents, positioning it as a unique experimental agent for preclinical testing using various animal models of inflammatory diseases. Given the complex and redundant roles of various cytokines and chemokines in various inflammatory diseases, it is now particularly important to test the hypothesis that dermcidin may occupy an important role in the regulation of local or systemic inflammation in preclinical animal models. For instance, injection of bacterial endotoxin directly into the skin (e.g., footpad, subcutaneously) provides a murine model of local inflammation and edema. It is interesting to determine whether local co-administration of dermcidin attenuates paw edema at various time points after endotoxin challenge. Additionally, systemic inflammation can be induced in animals by infusion of bacterial endotoxin such as LPS (31), or surgical perforation of the cecum, a technique aforementioned as CLP (31). Systemic administration (intraperitoneally or intravenously) of dermcidin may confer a dose-dependent protection against lethal endotoxemia or CLP-induced bacteremia.
  • In further experiments, intravenous administration of dermcidin conferred protection against hepatic ischemia/reperfusion (I/R) injury. Male C57BL/6 mice (20-25 g) were subjected to hepatic ischemia/reperfusion by temporal clamping the hepatic artery and portal vein for 60 minutes, which typically produced ischemia in 70% of the liver. At the beginning of the reperfusion, 0.2 ml saline or recombinant dermcidin solution (“DCD”, 5.0 mg/kg BW) was injected via the internal jugular vein. At 24 h after the onset of ischemia, animals were euthanized to harvest blood to measure serum levels of hepatic injury markers such as alanine aminotransferase (ALT) and aspartate aminotransferase (AST) using commercial kits. Dermcidin promoted significant protection against I/R injury. (see FIG. 4)
  • The DCD monomer protects against hepatic ischemic/reperfusion injury, as shown in FIG. 5. A representative liver histology at 24 h post the onset of reperfusion is shown, note a normal liver parenchyma architecture in the “Sham” control, and hepatic necrosis in the “I/R”. Unlike the DCD dimer-treated group [“I/R+DCD (d)”], the DCD monomer-treated group [“I/R+DCD (m)”] exhibited a well-preserved tissue structure. Liver injury was also assessed histologically using the Suzuki liver injury scores, and expressed as means±S.E. of 3-6 animals per group. *P<0.05 vs. sham; #P<0.05 vs. “I/R” group.
  • DCD also protects against hepatic ischemic/reperfusion-induced lung injury. FIG. 6 shows histopathological characteristics of lung injury after hepatic I/R. In FIG. 6A are shown representative H&E histological images of lung sections at 24 h post the onset of reperfusion. Note a normal lung architecture in the “Sham” control, and extensive lung injury and neutrophil infiltration in the “I/R” group. DCD treatment group (“I/R+DCD”) exhibited a well-preserved tissue structure. FIG. 6B shows histological Scores. Lung injury was assessed histologically using American Thoracic Society Documents' lung injury scores, and expressed as means±S.E. of 3-6 animals per group. *P<0.05 vs. sham; #P<0.05 vs. “I/R” group.
  • DCD was also found to protect against lethal sepsis in mice. Balb/C mice (7-10 weeks, 20-25 g, male) were subjected to sepsis by cecal ligation and puncture as previously described. Briefly, Balb/c mice were anesthetized with Ketamine (75 mg/kg, intramuscularly) and xylazine (10 mg/kg, intramuscularly) before a 15 mm midline incision was made to expose the cecum. A 4-0 Prolene suture ligature was placed at a level 5.0 mm from the cecal tip away from the ileocecal valve, and the ligated cecal stump was then punctured once with a 22-gauge needle without direct extrusion of stool. The cecum was then replaced back into its normal intra-abdominal position, and the abdomen wound was closed with staples (wound clips) to prevent leakage of fluid. All animals were resuscitated with a normal saline solution (subcutaneously at 20 ml/kg of body weight), and given a subcutaneous injection of imipenem (0.5 mg/mouse in 200 μl sterile saline) (Primaxin, Merck & Co., Inc., West Point, PA) 30 minutes after the surgery. Saline or recombinant DCD (0.2 mg/kg body weight) were given intraperitoneally at +2 and +24 h post CLP surgery, and animal survival rates were monitored for up to two weeks. The Kaplan-Meier method was used to compare the differences in mortality rates between groups. Shown in FIG. 7 is a summary of two independent experiments with similar results. *, P<0.05 versus saline control group.
  • Materials and Methods
  • Materials: Bacterial endotoxin (lipopolysaccharide, LPS, E. coli 0111:B4, Cat. No. L4130) was obtained from Sigma-Aldrich (St. Louis, Mo.). Dulbecco's Modified Eagle's Medium (DMEM, Cat. No. 11995-065), penicillin/streptomycin (Cat. No. 15140-122) and fetal bovine serum (FBS, Cat. No. 26140079) were from Invitrogen (Grand Island, N.Y.). Recombinant HMGB1 and CIRP were expressed in E. coli, and purified to remove contaminating endotoxin by Triton X-114 extraction as previously described (10, 19). To express recombinant dermcidin, the cDNA encoding for the mature form of dermcidin (DCD, NM_053283.2) (corresponding to residues 20-110, without the N-terminal signal peptide, amino acid 1-19) was cloned onto a pReceiver-B01 (CS-T3198-B01-01, GeneCopoeia) vector, and the recombinant DCD was expressed in E. coli BL21 (DE3) pLysS cells. Recombinant DCD containing an N-terminal histidine tag (His-DCD) was isolated and purified to remove contaminating endotoxin by Triton X-114 extraction.
  • Cell culture: Murine macrophage-like RAW 264.7 were obtained from the American Type Culture Collection (ATCC, Rockville, Md.), and were cultured in DMEM supplemented with 1% penicillin/streptomycin and 10% FBS. Human blood was purchased from the Long Island Blood Bank (Melville, N.Y.), and human peripheral blood mononuclear cells (HuPBMCs) were isolated by density gradient centrifugation through Ficoll (Ficoll-Paque PLUS, Pharmacia, Piscataway, N.J.) as previously described (20-22). Adherent macrophages or HuPBMCs were gently washed with, and cultured in, DMEM before stimulation with LPS (0.4 μg/ml), CIRP (2.0 μg/ml), or HMGB1 (1.0 μg/ml) in the absence or presence of recombinant dermcidin for 16 h. Subsequently, the cell-conditioned culture media were analyzed respectively for levels of nitric oxide, and other cytokines by the Griess Reaction and Cytokine Antibodies Arrays as previously described (19, 23).
  • Nitric oxide (NO) assay: The levels of NO in the culture medium were determined indirectly by measuring the NO2− production with a colorimetric assay based on the Griess reaction (21, 24). NO2− concentrations were determined with reference to a standard curve generated with sodium nitrite at various dilutions.
  • Cytokine antibody array: Human Cytokine Antibody Array C3 (Cat. No. AAH-CYT-3-4, RayBiotech Inc., Norcross, Ga., USA), which respectively detect 42 cytokines on one membrane, were used to determine cytokine levels in human monocyte-conditioned culture medium as previously described (21, 24). Briefly, the membranes were sequentially incubated with equal volumes of cell culture medium (200 μl), primary biotin-conjugated antibodies, and horseradish peroxidase-conjugated streptavidin. After exposing to X-ray film, the relative signal intensity was determined using the Scion Image software.
  • Statistical analysis: Data are expressed as mean±SEM of two independent experiments in triplicates. One-way analyses of variance (ANOVA) followed by the Tukey's test for multiple comparisons were used to compare between different groups. A P value less than 0.05 was considered statistically significant.
  • REFERENCES
  • 1. Schittek B, Hipfel R, Sauer B, Bauer J, Kalbacher H, Stevanovic S, Schirle M, Schroeder K, Blin N, Meier F, et al.: a novel human antibiotic peptide secreted by sweat glands. Nat Immunol 2 (12):1133-1137, 2001.
  • 2. Li M, Rigby K, Lai Y, Nair V, Peschel A, Schittek B, Otto M: Staphylococcus aureus mutant screen reveals interaction of the human antimicrobial peptide dermcidin with membrane phospholipids. Antimicrob Agents Chemother 53 (10):4200-4210, 2009.
  • 3. Lai Y, Villaruz A E, Li M, Cha D J, Sturdevant D E, Otto M: The human anionic antimicrobial peptide dermcidin induces proteolytic defence mechanisms in staphylococci. Mol Microbiol 63 (2):497-506, 2007.
  • 4. Steffen H, Rieg S, Wiedemann I, Kalbacher H, Deeg M, Sahl H G, Peschel A, Gotz F, Garbe C, Schittek B. Naturally processed dermcidin-derived peptides do not permeabilize bacterial membranes and kill microorganisms irrespective of their charge. Antimicrob Agents Chemother 50 (8):2608-2620, 2006.
  • 5. Rieg S, Seeber S, Steffen H, Humeny A, Kalbacher H, Stevanovic S, Kimura A, Garbe C, Schittek B: Generation of multiple stable dermcidin-derived antimicrobial peptides in sweat of different body sites. J Invest Dermatol 126 (2):354-365, 2006.
  • 6. Wang H, Zhu S, Zhou R, Li W, Sama A E: Therapeutic potential of HMGB1-targeting agents in sepsis. Expert Rev Mol Med 10: e32, 2008.
  • 7. Salomao R, Martins P S, Brunialti M K, Fernandes M L, Martos L S, Mendes M E, Gomes N E, Rigato O. TLR signaling pathway in patients with sepsis. Shock 30 Suppl 1:73-77, 2008.
  • 8. Akira S, Takeda K: Toll-like receptor signalling. Nat Rev Immunol 4 (7):499-511, 2004.
  • 9. Wang H, Bloom O, Zhang M, Vishnubhakat J M, Ombrellino M, Che J, Frazier A, Yang H, Ivanova S, Borovikova L, et al.: HMG-1 as a late mediator of endotoxin lethality in mice. Science 285 (5425):248-251, 1999.
  • 10. Qiang X, Yang W L, Wu R, Zhou M, Jacob A, Dong W, Kuncewitch M, Ji Y, Yang H, Wang H, et al.: Cold-inducible RNA-binding protein (CIRP) triggers inflammatory responses in hemorrhagic shock and sepsis. Nat Med 19 (11):1489-1495, 2013.
  • 11. Godwin A, Yang W L, Sharma A, Khader A, Wang Z, Zhang F, Nicastro J, Coppa G F, Wang P. Blocking cold-inducible RNA-binding protein protects liver from ischemia-reperfusion injury. Shock 43 (1):24-30, 2015.
  • 12. MacMicking J D, Nathan C, Hom G, Chartrain N, Fletcher D S, Trumbauer M, Stevens K, Xie Q W, Sokol K, Hutchinson N: Altered responses to bacterial infection and endotoxic shock in mice lacking inducible nitric oxide synthase. Cell 81 (4):641-650, 1995.
  • 13. Scaffidi P, Misteli T, Bianchi M E: Release of chromatin protein HMGB1 by necrotic cells triggers inflammation. Nature 418 (6894):191-195, 2002.
  • 14. Tsung A, Sahai R, Tanaka H, Nakao A, Fink M P, Lotze M T, Yang H, Li J, Tracey K J, Geller D A, et al.: The nuclear factor HMGB1 mediates hepatic injury after murine liver ischemia-reperfusion. J Exp Med 201 (7):1135-1143, 2005.
  • 15. Peltz E D, Moore E E, Eckels P C, Damle S S, Tsuruta Y, Johnson J L, Sauaia A, Silliman C C, Banerjee A, Abraham E: HMGB1 is markedly elevated within 6 hours of mechanical trauma in humans. Shock 32 (1):17-22, 2009.
  • 16. Antoine D J, Dear J W, Lewis P S, Platt V, Coyle J, Masson M, Thanacoody R H, Gray A J, Webb D J, Moggs J G, et al.: Mechanistic biomarkers provide early and sensitive detection of acetaminophen-induced acute liver injury at first presentation to hospital. Hepatology 58 (2):777-787, 2013.
  • 17. Andersson U, Tracey K J: HMGB1 is a therapeutic target for sterile inflammation and infection. Annu Rev Immunol 29:139-62, 2011.
  • 18. Petros A, Lamb G, Leone A, Moncada S, Bennett D, Vallance P: Effects of a nitric oxide synthase inhibitor in humans with septic shock. Cardiovasc Res 28 (1):34-39, 1994.
  • 19. Zhu S, Ashok M, Li J, Li W, Yang H, Wang P, Tracey K J, Sama A E, Wang H: Spermine protects mice against lethal sepsis partly by attenuating surrogate inflammatory markers. Mol Med 15 (7-8):275-282, 2009.
  • 20. Chen G, Li J, Ochani M, Rendon-Mitchell B, Qiang X, Susarla S, Ulloa L, Yang H, Fan S, Goyert S M, et al.: Bacterial endotoxin stimulates macrophages to release HMGB1 partly through CD14- and TNF-dependent mechanisms. J Leukoc Biol 76 (5):994-1001, 2004.
  • 21. Li W, Li J, Ashok M, Wu R, Chen D, Yang L, Yang H, Tracey K J, Wang P, Sama A E, et al.: A cardiovascular drug rescues mice from lethal sepsis by selectively attenuating a late-acting proinflammatory mediator, high mobility group box 1. J Immunol 178 (6):3856-3864, 2007.
  • 22. Rendon-Mitchell B, Ochani M, Li J, Han J, Wang H, Yang H, Susarla S, Czura C, Mitchell R A, Chen G, et al.: IFN-gamma Induces High Mobility Group Box 1 Protein Release Partly Through a TNF-Dependent Mechanism. J Immunol 170 (7):3890-3897, 2003.
  • 23. Li W, Li J, Sama A E, Wang H: Carbenoxolone Blocks Endotoxin-Induced Protein Kinase R (PKR) Activation and High Mobility Group Box 1 (HMGB1) Release. Mol Med 19 (1):203-211, 2013.
  • 24. Li W, Ashok M, Li J, Yang H, Sama A E, Wang H: A Major Ingredient of Green Tea Rescues Mice from Lethal Sepsis Partly by Inhibiting HMGB1. PLoS ONE 2 (11):e1153, 2007.
  • 25. Stewart G D, Lowrie A G, Riddick A C, Fearon K C, Habib F K, Ross J A. Dermcidin expression confers a survival advantage in prostate cancer cells subjected to oxidative stress or hypoxia. Prostate 67 (12):1308-1317, 2007
  • 26. Porter D, Weremowicz S, Chin K, Seth P, Keshaviah A, Lahti-Domenici J, Bae Y K, Monitto C L, Merlos-Suarez A, Chan J, Hulette C M, Richardson A, Morton C C, Marks J, Duyao M, Hruban R, Gabrielson E, Gelman R, Polyak K. A neural survival factor is a candidate oncogene in breast cancer. Proc Natl Acad Sci USA 100 (19):10931-10936, 2003.
  • 27. Schittek B. The multiple facets of dermcidin in cell survival and host defense. J Innate Immun 4 (4):349-360, 2012.
  • 28. Pathak S, De Souza G A, Salte T, Wiker H G, Asjo B. HIV induces both a down-regulation of IRAK-4 that impairs TLR signalling and an up-regulation of the antibiotic peptide dermcidin in monocytic cells. Scand J Immunol 70 (3):264-276, 2009.
  • 29. Nakano T, Yoshino T, Fujimura T, Arai S, Mukuno A, Sato N, Katsuoka K. Reduced Expression of Dermcidin, a Peptide Active Against Propionibacterium acnes, in Sweat of Patients with Acne Vulgaris. Acta Derm Venereol 95 (7):783-986, 2015.
  • 30. Niyonsaba F, Suzuki A, Ushio H, Nagaoka I, Ogawa H, Okumura K. The human antimicrobial peptide dermcidin activates normal human keratinocytes. Br J Dermatol 160 (2):243-249, 2009.
  • 31. Wichterman K A, Baue A E, Chaudry I H: Sepsis and septic shock—a review of laboratory models and a proposal. J Surg Res 29 (2):189-201, 1980.
  • 32. Eskandari M K, Bolgos G, Miller C, Nguyen D T, DeForge L E, Remick D G: Anti-tumor necrosis factor antibody therapy fails to prevent lethality after cecal ligation and puncture or endotoxemia. J Immunol 148 (9):2724-2730, 1992.
  • 33. Sallusto F, Baggiolini M. Chemokines and leukocyte traffic. Nat Immunol 9 (9):949-952, 2008.
  • 34. Feldmann M, Maini R N. Anti-TNF alpha therapy of rheumatoid arthritis: what have we learned? Annu Rev Immunol 19:163-196, 2001.
  • 35. Osuchowski M F, Remick D G, Lederer J A, Lang C H, Aasen A O, Aibiki M, Azevedo L C, Bahrami S, Boros M, Cooney R, et al.: Abandon the mouse research ship? Not just yet! Shock 41 (6):463-475, 2014.

Claims (13)

What is claimed is:
1. A method of treating a sterile inflammatory condition in a subject comprising administering to the subject an amount of an isolated dermcidin peptide, or an active fragment thereof, or an active analog thereof, effective to treat a sterile inflammatory condition.
2. The method of claim 1, wherein the sterile inflammatory condition is caused by or associated with ischemia-reperfusion in an organ in the subject.
3. The method of claim 1, wherein the sterile inflammatory condition is caused by or associated with ischemia-reperfusion in a gastrointestinal tract, liver, lung, kidney, heart, brain or crushed limb of the subject.
4. The method of claim 1, wherein the active analog of dermcidin is administered or used.
5. The method of claim 4, wherein the active analog of dermcidin has a cysteine to serine substitution that prevents dimerization via disulfide bonds between cysteine 34 of two dermcidin peptides.
6. The method of claim 1, wherein the active fragment of dermcidin is administered or used.
7. The method of claim 1, wherein the peptide, analog or fragment is modified to improve its plasma half-life.
8. The method of claim 7, wherein the peptide, analog or fragment is modified with PEGylation or mannosylation.
9. The method of claim 1, wherein the amount of an isolated dermcidin peptide or an active fragment thereof or an active analog thereof is administered by intra-arterial, intravenous, intraventricular, or topical administration.
10. The method of claim 1, wherein the subject is a human subject.
11. A dermcidin analog comprising the following sequence:
YDPEAASAPGSGNPSHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKG LDGAKK.
12. The dermcidin analog of claim 11, wherein the peptide, analog or fragment is modified with PEGylation or mannosylation.
13. A composition comprising the dermcidin analog of claim 11 in monomer form.
US17/685,993 2015-10-22 2022-03-03 Use of dermcidin in sterile inflammatory conditions Pending US20220257714A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US17/685,993 US20220257714A1 (en) 2015-10-22 2022-03-03 Use of dermcidin in sterile inflammatory conditions

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201562244779P 2015-10-22 2015-10-22
PCT/US2016/058027 WO2017070421A1 (en) 2015-10-22 2016-10-21 Use of dermcidin in sterile inflammatory conditions
US201815769880A 2018-04-20 2018-04-20
US17/685,993 US20220257714A1 (en) 2015-10-22 2022-03-03 Use of dermcidin in sterile inflammatory conditions

Related Parent Applications (2)

Application Number Title Priority Date Filing Date
PCT/US2016/058027 Continuation WO2017070421A1 (en) 2015-10-22 2016-10-21 Use of dermcidin in sterile inflammatory conditions
US15/769,880 Continuation US11266716B2 (en) 2015-10-22 2016-10-21 Use of dermcidin in sterile inflammatory conditions

Publications (1)

Publication Number Publication Date
US20220257714A1 true US20220257714A1 (en) 2022-08-18

Family

ID=58557793

Family Applications (2)

Application Number Title Priority Date Filing Date
US15/769,880 Active 2037-07-20 US11266716B2 (en) 2015-10-22 2016-10-21 Use of dermcidin in sterile inflammatory conditions
US17/685,993 Pending US20220257714A1 (en) 2015-10-22 2022-03-03 Use of dermcidin in sterile inflammatory conditions

Family Applications Before (1)

Application Number Title Priority Date Filing Date
US15/769,880 Active 2037-07-20 US11266716B2 (en) 2015-10-22 2016-10-21 Use of dermcidin in sterile inflammatory conditions

Country Status (2)

Country Link
US (2) US11266716B2 (en)
WO (1) WO2017070421A1 (en)

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2005208821B8 (en) * 2003-02-04 2010-10-14 Cornell Research Foundation, Inc. Methods for reducing oxidative damage
US20070009880A1 (en) * 2005-07-11 2007-01-11 Toledo Luis H Methods And Solutions For Storing Donor Organs
AU2007207675B2 (en) 2006-01-13 2013-01-31 The Feinstein Institute For Medical Research Inhibition of inflammatory cytokine production with tanshinones
US8821851B2 (en) 2006-03-23 2014-09-02 The General Hospital Corporation Inflammation-inhibitory serum factors and uses thereof
WO2009075788A1 (en) * 2007-12-05 2009-06-18 Semprus Biociences Corporation Synthetic non-fouling amino acids
IT1401909B1 (en) * 2010-08-04 2013-08-28 Bluegreen Biotech S R L GLYCOLIPIDE FOR THE TREATMENT OF INFLAMMATION ASSOCIATED WITH ISCHEMIA AND REPERFUSION.

Also Published As

Publication number Publication date
WO2017070421A1 (en) 2017-04-27
US20190030124A1 (en) 2019-01-31
US11266716B2 (en) 2022-03-08

Similar Documents

Publication Publication Date Title
Borthwick et al. Cytokine mediated tissue fibrosis
Wang et al. Extracellular role of HMGB1 in inflammation and sepsis
Beuscher et al. Bacterial evasion of host immune defense: Yersinia enterocolitica encodes a suppressor for tumor necrosis factor alpha expression
Harder et al. Antimicrobial peptides in human skin
US11779631B2 (en) CD47 blockade therapy by HDAC inhibitors
Czura et al. HMGB1 in the immunology of sepsis (not septic shock) and arthritis
Wawrocki et al. Inflammasomes in Mycobacterium tuberculosis-driven immunity
KR20180012856A (en) Methods for the modulation of immune responses and polypeptides
US11752203B2 (en) Methods for treatment of and prophylaxis against inflammatory disorders
WO2013034982A2 (en) Immunomodulatory peptides for treatment of progressive neurodegenerative diseases
US20200384062A1 (en) Use of inhibitors of il-36 proteolytic processing for the treatment and/or reduction of inflammation
US20100166708A1 (en) Antimicrobial and anti-inflammatory therapies and compositions
Wang et al. The in vitro immune-modulating properties of a sweat gland-derived antimicrobial peptide dermcidin
US20220257714A1 (en) Use of dermcidin in sterile inflammatory conditions
EP2751133B1 (en) Modified toll-like receptor 2 (tlr2) ligands as inhibitors of neutrophil recruitment
CN106046144B (en) TNF alpha short peptide related to apoptosis or necrosis and application thereof
US20170296629A1 (en) Inhibitor of extracellular trap formation in leukocyte
US10857201B2 (en) NNIF and nNIF-related peptides and related methods
JP2008509969A (en) Peptides for the treatment of herpes virus infection
CA3044334A1 (en) Combined cd6 and imipenem therapy for treatment of infectious diseases and related inflammatory processes
US20110053830A1 (en) Methods for treating septic shock
US8937038B2 (en) Composition containing peptide ligand that bonds with CXCR2 for treating infective and inflammatory diseases
AU2020234718A1 (en) Compositions and methods for promoting islet viability and enhancing insulin secretion
McConachie et al. Inflammation, endotoxemia and systemic inflammatory response syndrome
Chen et al. Modulation of HMGB1 Release for Treating Lethal Infection and Injury

Legal Events

Date Code Title Description
STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER