US20220193197A1 - Synergistic tumor treatment with il-2 and integrin-binding-fc fusion protein - Google Patents
Synergistic tumor treatment with il-2 and integrin-binding-fc fusion protein Download PDFInfo
- Publication number
- US20220193197A1 US20220193197A1 US17/407,011 US202117407011A US2022193197A1 US 20220193197 A1 US20220193197 A1 US 20220193197A1 US 202117407011 A US202117407011 A US 202117407011A US 2022193197 A1 US2022193197 A1 US 2022193197A1
- Authority
- US
- United States
- Prior art keywords
- knottin
- integrin
- binding
- domain
- polypeptide
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 206010028980 Neoplasm Diseases 0.000 title claims abstract description 244
- 108010044426 integrins Proteins 0.000 title claims abstract description 185
- 102000006495 integrins Human genes 0.000 title claims abstract description 185
- 108020001507 fusion proteins Proteins 0.000 title claims abstract description 48
- 102000037865 fusion proteins Human genes 0.000 title claims abstract description 48
- 238000011282 treatment Methods 0.000 title description 80
- 230000002195 synergetic effect Effects 0.000 title description 22
- 108010002350 Interleukin-2 Proteins 0.000 claims abstract description 354
- 238000000034 method Methods 0.000 claims abstract description 120
- 201000011510 cancer Diseases 0.000 claims abstract description 39
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 227
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 188
- 229920001184 polypeptide Polymers 0.000 claims description 155
- 230000027455 binding Effects 0.000 claims description 147
- 238000009739 binding Methods 0.000 claims description 147
- 235000001014 amino acid Nutrition 0.000 claims description 113
- 108090000623 proteins and genes Proteins 0.000 claims description 85
- 150000001413 amino acids Chemical class 0.000 claims description 83
- 108010025905 Cystine-Knot Miniproteins Proteins 0.000 claims description 80
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 claims description 80
- 229940126533 immune checkpoint blocker Drugs 0.000 claims description 77
- 102000004169 proteins and genes Human genes 0.000 claims description 72
- 235000018102 proteins Nutrition 0.000 claims description 66
- 101000609473 Ecballium elaterium Trypsin inhibitor 2 Proteins 0.000 claims description 61
- 229920001223 polyethylene glycol Polymers 0.000 claims description 60
- 239000005557 antagonist Substances 0.000 claims description 55
- 239000002202 Polyethylene glycol Substances 0.000 claims description 52
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 claims description 30
- 230000002401 inhibitory effect Effects 0.000 claims description 29
- IYMAXBFPHPZYIK-BQBZGAKWSA-N Arg-Gly-Asp Chemical group NC(N)=NCCC[C@H](N)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(O)=O IYMAXBFPHPZYIK-BQBZGAKWSA-N 0.000 claims description 24
- 108060003951 Immunoglobulin Proteins 0.000 claims description 23
- 102000018358 immunoglobulin Human genes 0.000 claims description 23
- 102000008100 Human Serum Albumin Human genes 0.000 claims description 21
- 108091006905 Human Serum Albumin Proteins 0.000 claims description 21
- 210000004881 tumor cell Anatomy 0.000 claims description 21
- 102000008394 Immunoglobulin Fragments Human genes 0.000 claims description 17
- 108010021625 Immunoglobulin Fragments Proteins 0.000 claims description 17
- 102000009484 Vascular Endothelial Growth Factor Receptors Human genes 0.000 claims description 16
- 108091008605 VEGF receptors Proteins 0.000 claims description 14
- 229920000642 polymer Polymers 0.000 claims description 14
- 230000035755 proliferation Effects 0.000 claims description 13
- 235000018417 cysteine Nutrition 0.000 claims description 12
- 230000012010 growth Effects 0.000 claims description 10
- 102000015696 Interleukins Human genes 0.000 claims description 9
- 108010063738 Interleukins Proteins 0.000 claims description 9
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 claims description 9
- 150000003384 small molecules Chemical class 0.000 claims description 8
- LEVWYRKDKASIDU-IMJSIDKUSA-N L-cystine Chemical compound [O-]C(=O)[C@@H]([NH3+])CSSC[C@H]([NH3+])C([O-])=O LEVWYRKDKASIDU-IMJSIDKUSA-N 0.000 claims description 5
- 239000003112 inhibitor Substances 0.000 claims description 4
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 claims 4
- 102000000588 Interleukin-2 Human genes 0.000 description 345
- 210000004027 cell Anatomy 0.000 description 104
- 229940024606 amino acid Drugs 0.000 description 88
- 125000003275 alpha amino acid group Chemical group 0.000 description 84
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 description 80
- 102100039037 Vascular endothelial growth factor A Human genes 0.000 description 80
- 238000011081 inoculation Methods 0.000 description 55
- 150000007523 nucleic acids Chemical class 0.000 description 50
- 102000039446 nucleic acids Human genes 0.000 description 45
- 108020004707 nucleic acids Proteins 0.000 description 45
- 239000000203 mixture Substances 0.000 description 44
- 125000000539 amino acid group Chemical group 0.000 description 41
- 230000004083 survival effect Effects 0.000 description 39
- 241000699670 Mus sp. Species 0.000 description 34
- 238000006467 substitution reaction Methods 0.000 description 31
- 238000011740 C57BL/6 mouse Methods 0.000 description 30
- 239000000427 antigen Substances 0.000 description 30
- 108091007433 antigens Proteins 0.000 description 30
- 102000036639 antigens Human genes 0.000 description 30
- 230000001225 therapeutic effect Effects 0.000 description 29
- 230000035772 mutation Effects 0.000 description 28
- 230000000694 effects Effects 0.000 description 27
- 239000008194 pharmaceutical composition Substances 0.000 description 27
- 101100519207 Mus musculus Pdcd1 gene Proteins 0.000 description 25
- 108020004414 DNA Proteins 0.000 description 24
- 239000002253 acid Substances 0.000 description 24
- 230000006870 function Effects 0.000 description 23
- 230000004927 fusion Effects 0.000 description 23
- -1 O-phosphoserine Amino acid Chemical class 0.000 description 22
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 22
- 239000012634 fragment Substances 0.000 description 21
- 230000003993 interaction Effects 0.000 description 21
- 102000005962 receptors Human genes 0.000 description 21
- 108020003175 receptors Proteins 0.000 description 21
- 108010074708 B7-H1 Antigen Proteins 0.000 description 20
- 102000008096 B7-H1 Antigen Human genes 0.000 description 20
- 239000002773 nucleotide Substances 0.000 description 20
- 125000003729 nucleotide group Chemical group 0.000 description 20
- 230000004614 tumor growth Effects 0.000 description 20
- 239000013598 vector Substances 0.000 description 20
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 18
- 241000699666 Mus <mouse, genus> Species 0.000 description 18
- 201000001441 melanoma Diseases 0.000 description 18
- 210000004899 c-terminal region Anatomy 0.000 description 17
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 16
- 239000003795 chemical substances by application Substances 0.000 description 16
- 239000003814 drug Substances 0.000 description 16
- 210000002966 serum Anatomy 0.000 description 16
- 238000001727 in vivo Methods 0.000 description 15
- 210000001519 tissue Anatomy 0.000 description 15
- 238000009472 formulation Methods 0.000 description 14
- 150000001875 compounds Chemical class 0.000 description 13
- 238000012217 deletion Methods 0.000 description 13
- 230000037430 deletion Effects 0.000 description 13
- 239000003446 ligand Substances 0.000 description 13
- 239000002904 solvent Substances 0.000 description 13
- 230000008685 targeting Effects 0.000 description 13
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 12
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 12
- 101710083479 Hepatitis A virus cellular receptor 2 homolog Proteins 0.000 description 12
- 102000007562 Serum Albumin Human genes 0.000 description 12
- 108010071390 Serum Albumin Proteins 0.000 description 12
- 201000010099 disease Diseases 0.000 description 12
- 239000012636 effector Substances 0.000 description 12
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 11
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 description 11
- 230000021615 conjugation Effects 0.000 description 11
- 239000003085 diluting agent Substances 0.000 description 11
- 229920002477 rna polymer Polymers 0.000 description 11
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 10
- 101001002657 Homo sapiens Interleukin-2 Proteins 0.000 description 10
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 10
- 101001137987 Homo sapiens Lymphocyte activation gene 3 protein Proteins 0.000 description 10
- 102100020862 Lymphocyte activation gene 3 protein Human genes 0.000 description 10
- 101001034843 Mus musculus Interferon-induced transmembrane protein 1 Proteins 0.000 description 10
- 210000001744 T-lymphocyte Anatomy 0.000 description 10
- 208000035475 disorder Diseases 0.000 description 10
- 230000001965 increasing effect Effects 0.000 description 10
- 239000000126 substance Substances 0.000 description 10
- 229940045513 CTLA4 antagonist Drugs 0.000 description 9
- 201000009030 Carcinoma Diseases 0.000 description 9
- BCCRXDTUTZHDEU-VKHMYHEASA-N Gly-Ser Chemical compound NCC(=O)N[C@@H](CO)C(O)=O BCCRXDTUTZHDEU-VKHMYHEASA-N 0.000 description 9
- 102000037982 Immune checkpoint proteins Human genes 0.000 description 9
- 108091008036 Immune checkpoint proteins Proteins 0.000 description 9
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 9
- 241001529936 Murinae Species 0.000 description 9
- 239000003995 emulsifying agent Substances 0.000 description 9
- 239000002062 molecular scaffold Substances 0.000 description 9
- 239000003755 preservative agent Substances 0.000 description 9
- 241000894007 species Species 0.000 description 9
- 229940124597 therapeutic agent Drugs 0.000 description 9
- 238000002560 therapeutic procedure Methods 0.000 description 9
- 206010009944 Colon cancer Diseases 0.000 description 8
- 102000053602 DNA Human genes 0.000 description 8
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 8
- 108091028043 Nucleic acid sequence Proteins 0.000 description 8
- 238000007792 addition Methods 0.000 description 8
- 239000002671 adjuvant Substances 0.000 description 8
- 230000005975 antitumor immune response Effects 0.000 description 8
- 230000002354 daily effect Effects 0.000 description 8
- 230000004048 modification Effects 0.000 description 8
- 238000012986 modification Methods 0.000 description 8
- 229910052698 phosphorus Inorganic materials 0.000 description 8
- 230000002335 preservative effect Effects 0.000 description 8
- 229910052717 sulfur Inorganic materials 0.000 description 8
- 239000003981 vehicle Substances 0.000 description 8
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 7
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 7
- 108700025316 aldesleukin Proteins 0.000 description 7
- 239000000872 buffer Substances 0.000 description 7
- 238000006243 chemical reaction Methods 0.000 description 7
- 238000002648 combination therapy Methods 0.000 description 7
- 239000013604 expression vector Substances 0.000 description 7
- 238000002347 injection Methods 0.000 description 7
- 239000007924 injection Substances 0.000 description 7
- 238000003780 insertion Methods 0.000 description 7
- 230000037431 insertion Effects 0.000 description 7
- 239000000463 material Substances 0.000 description 7
- 238000005259 measurement Methods 0.000 description 7
- 230000006320 pegylation Effects 0.000 description 7
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 7
- 230000019491 signal transduction Effects 0.000 description 7
- 238000003786 synthesis reaction Methods 0.000 description 7
- 239000004471 Glycine Substances 0.000 description 6
- 241000282412 Homo Species 0.000 description 6
- 101000611936 Homo sapiens Programmed cell death protein 1 Proteins 0.000 description 6
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 6
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 6
- 206010060862 Prostate cancer Diseases 0.000 description 6
- 108020004511 Recombinant DNA Proteins 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 239000002585 base Substances 0.000 description 6
- 230000008901 benefit Effects 0.000 description 6
- 210000000481 breast Anatomy 0.000 description 6
- 239000003153 chemical reaction reagent Substances 0.000 description 6
- 208000029742 colonic neoplasm Diseases 0.000 description 6
- 102000043321 human CTLA4 Human genes 0.000 description 6
- 102000048362 human PDCD1 Human genes 0.000 description 6
- 238000009169 immunotherapy Methods 0.000 description 6
- 235000018977 lysine Nutrition 0.000 description 6
- 210000000056 organ Anatomy 0.000 description 6
- 102000040430 polynucleotide Human genes 0.000 description 6
- 108091033319 polynucleotide Proteins 0.000 description 6
- 238000009097 single-agent therapy Methods 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 230000009885 systemic effect Effects 0.000 description 6
- 230000003442 weekly effect Effects 0.000 description 6
- 208000026310 Breast neoplasm Diseases 0.000 description 5
- 101710172562 Cobra venom factor Proteins 0.000 description 5
- 102000004127 Cytokines Human genes 0.000 description 5
- 108090000695 Cytokines Proteins 0.000 description 5
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 5
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 5
- 102000016359 Fibronectins Human genes 0.000 description 5
- 108010067306 Fibronectins Proteins 0.000 description 5
- 102100031351 Galectin-9 Human genes 0.000 description 5
- 101710121810 Galectin-9 Proteins 0.000 description 5
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 5
- 101001068133 Homo sapiens Hepatitis A virus cellular receptor 2 Proteins 0.000 description 5
- 101001117317 Homo sapiens Programmed cell death 1 ligand 1 Proteins 0.000 description 5
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 5
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 5
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 5
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 5
- 239000004472 Lysine Substances 0.000 description 5
- 108091054438 MHC class II family Proteins 0.000 description 5
- 102000043131 MHC class II family Human genes 0.000 description 5
- 206010027476 Metastases Diseases 0.000 description 5
- 206010033128 Ovarian cancer Diseases 0.000 description 5
- 108010029485 Protein Isoforms Proteins 0.000 description 5
- 102000001708 Protein Isoforms Human genes 0.000 description 5
- 208000006265 Renal cell carcinoma Diseases 0.000 description 5
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 5
- 108010072041 arginyl-glycyl-aspartic acid Proteins 0.000 description 5
- 239000011230 binding agent Substances 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 230000000295 complement effect Effects 0.000 description 5
- 102000048776 human CD274 Human genes 0.000 description 5
- 102000049109 human HAVCR2 Human genes 0.000 description 5
- 210000002865 immune cell Anatomy 0.000 description 5
- 238000002513 implantation Methods 0.000 description 5
- 238000010348 incorporation Methods 0.000 description 5
- 238000001990 intravenous administration Methods 0.000 description 5
- 239000003550 marker Substances 0.000 description 5
- 238000002703 mutagenesis Methods 0.000 description 5
- 231100000350 mutagenesis Toxicity 0.000 description 5
- 230000001613 neoplastic effect Effects 0.000 description 5
- 239000000546 pharmaceutical excipient Substances 0.000 description 5
- 238000003752 polymerase chain reaction Methods 0.000 description 5
- 239000002157 polynucleotide Substances 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- 229940087463 proleukin Drugs 0.000 description 5
- 210000002307 prostate Anatomy 0.000 description 5
- 208000011581 secondary neoplasm Diseases 0.000 description 5
- 230000011664 signaling Effects 0.000 description 5
- 239000000600 sorbitol Substances 0.000 description 5
- 125000006850 spacer group Chemical group 0.000 description 5
- 239000004475 Arginine Substances 0.000 description 4
- 241000894006 Bacteria Species 0.000 description 4
- 108091026890 Coding region Proteins 0.000 description 4
- 108020004705 Codon Proteins 0.000 description 4
- 239000004971 Cross linker Substances 0.000 description 4
- 108010069514 Cyclic Peptides Proteins 0.000 description 4
- 102000001189 Cyclic Peptides Human genes 0.000 description 4
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 4
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 4
- 241000238631 Hexapoda Species 0.000 description 4
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 4
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 4
- 101100154912 Mus musculus Tyrp1 gene Proteins 0.000 description 4
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 4
- 239000004473 Threonine Substances 0.000 description 4
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 4
- 235000004279 alanine Nutrition 0.000 description 4
- 230000006023 anti-tumor response Effects 0.000 description 4
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 4
- 235000009697 arginine Nutrition 0.000 description 4
- 230000004071 biological effect Effects 0.000 description 4
- 210000004443 dendritic cell Anatomy 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 210000002744 extracellular matrix Anatomy 0.000 description 4
- 230000013595 glycosylation Effects 0.000 description 4
- 238000006206 glycosylation reaction Methods 0.000 description 4
- 230000003394 haemopoietic effect Effects 0.000 description 4
- 230000003463 hyperproliferative effect Effects 0.000 description 4
- 210000000987 immune system Anatomy 0.000 description 4
- 230000001976 improved effect Effects 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- 208000032839 leukemia Diseases 0.000 description 4
- 210000004072 lung Anatomy 0.000 description 4
- 125000003588 lysine group Chemical class [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 4
- 230000036210 malignancy Effects 0.000 description 4
- 210000004962 mammalian cell Anatomy 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 210000000822 natural killer cell Anatomy 0.000 description 4
- 238000011275 oncology therapy Methods 0.000 description 4
- 230000001575 pathological effect Effects 0.000 description 4
- 239000002953 phosphate buffered saline Substances 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 230000002062 proliferating effect Effects 0.000 description 4
- 238000011321 prophylaxis Methods 0.000 description 4
- 102200027865 rs62507347 Human genes 0.000 description 4
- 102200027880 rs62507347 Human genes 0.000 description 4
- 239000000523 sample Substances 0.000 description 4
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- 238000007920 subcutaneous administration Methods 0.000 description 4
- 238000013268 sustained release Methods 0.000 description 4
- 239000012730 sustained-release form Substances 0.000 description 4
- 239000003826 tablet Substances 0.000 description 4
- 238000012360 testing method Methods 0.000 description 4
- 231100000419 toxicity Toxicity 0.000 description 4
- 230000001988 toxicity Effects 0.000 description 4
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 3
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 3
- 208000003174 Brain Neoplasms Diseases 0.000 description 3
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 3
- 102000014914 Carrier Proteins Human genes 0.000 description 3
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 3
- 201000008808 Fibrosarcoma Diseases 0.000 description 3
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 3
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 3
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 3
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 3
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 3
- 229930195725 Mannitol Natural products 0.000 description 3
- 101001043827 Mus musculus Interleukin-2 Proteins 0.000 description 3
- 206010061535 Ovarian neoplasm Diseases 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 3
- 229930006000 Sucrose Natural products 0.000 description 3
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 3
- 230000006044 T cell activation Effects 0.000 description 3
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 3
- 108010053099 Vascular Endothelial Growth Factor Receptor-2 Proteins 0.000 description 3
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 3
- 230000004913 activation Effects 0.000 description 3
- 239000000556 agonist Substances 0.000 description 3
- 125000003277 amino group Chemical group 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 235000009582 asparagine Nutrition 0.000 description 3
- 230000009286 beneficial effect Effects 0.000 description 3
- 108091008324 binding proteins Proteins 0.000 description 3
- 210000004204 blood vessel Anatomy 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 230000015556 catabolic process Effects 0.000 description 3
- 230000003915 cell function Effects 0.000 description 3
- 230000010261 cell growth Effects 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 238000003776 cleavage reaction Methods 0.000 description 3
- 238000004132 cross linking Methods 0.000 description 3
- 229960003067 cystine Drugs 0.000 description 3
- 238000006731 degradation reaction Methods 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 229960002989 glutamic acid Drugs 0.000 description 3
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 3
- 235000004554 glutamine Nutrition 0.000 description 3
- 239000003102 growth factor Substances 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 229910052739 hydrogen Inorganic materials 0.000 description 3
- 230000028993 immune response Effects 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 238000001802 infusion Methods 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 229960005386 ipilimumab Drugs 0.000 description 3
- 229960000310 isoleucine Drugs 0.000 description 3
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 3
- 239000002502 liposome Substances 0.000 description 3
- 210000004698 lymphocyte Anatomy 0.000 description 3
- 210000002540 macrophage Anatomy 0.000 description 3
- 239000000594 mannitol Substances 0.000 description 3
- 235000010355 mannitol Nutrition 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 230000009401 metastasis Effects 0.000 description 3
- 206010061289 metastatic neoplasm Diseases 0.000 description 3
- 238000007911 parenteral administration Methods 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- 108700001787 polyethylene glycol-modified interleukin-2 Proteins 0.000 description 3
- 239000002243 precursor Substances 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 230000001105 regulatory effect Effects 0.000 description 3
- 108091008146 restriction endonucleases Proteins 0.000 description 3
- 230000007017 scission Effects 0.000 description 3
- 239000007790 solid phase Substances 0.000 description 3
- 239000005720 sucrose Substances 0.000 description 3
- 125000003396 thiol group Chemical group [H]S* 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- 239000004474 valine Substances 0.000 description 3
- 210000003556 vascular endothelial cell Anatomy 0.000 description 3
- 210000005166 vasculature Anatomy 0.000 description 3
- 239000013603 viral vector Substances 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical group O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- WRMNZCZEMHIOCP-UHFFFAOYSA-N 2-phenylethanol Chemical compound OCCC1=CC=CC=C1 WRMNZCZEMHIOCP-UHFFFAOYSA-N 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- 101710169336 5'-deoxyadenosine deaminase Proteins 0.000 description 2
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 2
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 2
- 102000055025 Adenosine deaminases Human genes 0.000 description 2
- 208000016683 Adult T-cell leukemia/lymphoma Diseases 0.000 description 2
- 102000054930 Agouti-Related Human genes 0.000 description 2
- 101710127426 Agouti-related protein Proteins 0.000 description 2
- 102000009027 Albumins Human genes 0.000 description 2
- 108010088751 Albumins Proteins 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- 206010006187 Breast cancer Diseases 0.000 description 2
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 2
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 2
- 241000700199 Cavia porcellus Species 0.000 description 2
- 108010035563 Chloramphenicol O-acetyltransferase Proteins 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 241000283073 Equus caballus Species 0.000 description 2
- 108010087819 Fc receptors Proteins 0.000 description 2
- 102000009109 Fc receptors Human genes 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 2
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- 108010038453 Interleukin-2 Receptors Proteins 0.000 description 2
- 102000010789 Interleukin-2 Receptors Human genes 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical group CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical group CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- 208000006552 Lewis Lung Carcinoma Diseases 0.000 description 2
- 102000019298 Lipocalin Human genes 0.000 description 2
- 108050006654 Lipocalin Proteins 0.000 description 2
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 101000609452 Momordica cochinchinensis Trypsin inhibitor 1 Proteins 0.000 description 2
- 101100407308 Mus musculus Pdcd1lg2 gene Proteins 0.000 description 2
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 2
- 230000004988 N-glycosylation Effects 0.000 description 2
- 206010061309 Neoplasm progression Diseases 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 238000012408 PCR amplification Methods 0.000 description 2
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 2
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 2
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 description 2
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 2
- 208000033766 Prolymphocytic Leukemia Diseases 0.000 description 2
- 108010076504 Protein Sorting Signals Proteins 0.000 description 2
- 101000781681 Protobothrops flavoviridis Disintegrin triflavin Proteins 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- 206010038389 Renal cancer Diseases 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- 239000012505 Superdex™ Substances 0.000 description 2
- 230000005867 T cell response Effects 0.000 description 2
- 208000031673 T-Cell Cutaneous Lymphoma Diseases 0.000 description 2
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 2
- 108010022394 Threonine synthase Proteins 0.000 description 2
- 102000006601 Thymidine Kinase Human genes 0.000 description 2
- 108020004440 Thymidine kinase Proteins 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 2
- 108010027570 Xanthine phosphoribosyltransferase Proteins 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- 208000009956 adenocarcinoma Diseases 0.000 description 2
- 102000019997 adhesion receptor Human genes 0.000 description 2
- 108010013985 adhesion receptor Proteins 0.000 description 2
- 201000006966 adult T-cell leukemia Diseases 0.000 description 2
- 229960005310 aldesleukin Drugs 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 150000001412 amines Chemical class 0.000 description 2
- 230000003042 antagnostic effect Effects 0.000 description 2
- 230000005809 anti-tumor immunity Effects 0.000 description 2
- 230000014102 antigen processing and presentation of exogenous peptide antigen via MHC class I Effects 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 150000001508 asparagines Chemical class 0.000 description 2
- 235000003704 aspartic acid Nutrition 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 2
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 2
- 230000003115 biocidal effect Effects 0.000 description 2
- PFYXSUNOLOJMDX-UHFFFAOYSA-N bis(2,5-dioxopyrrolidin-1-yl) carbonate Chemical compound O=C1CCC(=O)N1OC(=O)ON1C(=O)CCC1=O PFYXSUNOLOJMDX-UHFFFAOYSA-N 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 239000007975 buffered saline Substances 0.000 description 2
- RYYVLZVUVIJVGH-UHFFFAOYSA-N caffeine Chemical compound CN1C(=O)N(C)C(=O)C2=C1N=CN2C RYYVLZVUVIJVGH-UHFFFAOYSA-N 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 210000001072 colon Anatomy 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 239000000470 constituent Substances 0.000 description 2
- 238000013270 controlled release Methods 0.000 description 2
- 230000001276 controlling effect Effects 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 239000003431 cross linking reagent Substances 0.000 description 2
- 201000007241 cutaneous T cell lymphoma Diseases 0.000 description 2
- 229910052805 deuterium Inorganic materials 0.000 description 2
- 102000004419 dihydrofolate reductase Human genes 0.000 description 2
- 238000006471 dimerization reaction Methods 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 238000012377 drug delivery Methods 0.000 description 2
- 238000002330 electrospray ionisation mass spectrometry Methods 0.000 description 2
- 210000002889 endothelial cell Anatomy 0.000 description 2
- 230000007717 exclusion Effects 0.000 description 2
- 238000000855 fermentation Methods 0.000 description 2
- 230000004151 fermentation Effects 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 2
- 229910052731 fluorine Inorganic materials 0.000 description 2
- 210000001035 gastrointestinal tract Anatomy 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 238000002523 gelfiltration Methods 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 230000000762 glandular Effects 0.000 description 2
- 208000005017 glioblastoma Diseases 0.000 description 2
- 235000013922 glutamic acid Nutrition 0.000 description 2
- 239000004220 glutamic acid Substances 0.000 description 2
- 235000011187 glycerol Nutrition 0.000 description 2
- 201000009277 hairy cell leukemia Diseases 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 238000003384 imaging method Methods 0.000 description 2
- 230000005746 immune checkpoint blockade Effects 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 230000008629 immune suppression Effects 0.000 description 2
- 108091008042 inhibitory receptors Proteins 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 239000000314 lubricant Substances 0.000 description 2
- 201000005202 lung cancer Diseases 0.000 description 2
- 208000020816 lung neoplasm Diseases 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 230000014759 maintenance of location Effects 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 2
- 230000001394 metastastic effect Effects 0.000 description 2
- 229930182817 methionine Chemical group 0.000 description 2
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 2
- 239000011859 microparticle Substances 0.000 description 2
- 230000003278 mimic effect Effects 0.000 description 2
- 201000005962 mycosis fungoides Diseases 0.000 description 2
- 239000002105 nanoparticle Substances 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 229960003301 nivolumab Drugs 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 230000002611 ovarian Effects 0.000 description 2
- 210000001672 ovary Anatomy 0.000 description 2
- 229960002621 pembrolizumab Drugs 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 239000012071 phase Substances 0.000 description 2
- 230000004983 pleiotropic effect Effects 0.000 description 2
- 229920000747 poly(lactic acid) Polymers 0.000 description 2
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 2
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 2
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 208000025638 primary cutaneous T-cell non-Hodgkin lymphoma Diseases 0.000 description 2
- 230000002035 prolonged effect Effects 0.000 description 2
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 2
- 201000001514 prostate carcinoma Diseases 0.000 description 2
- 125000006239 protecting group Chemical group 0.000 description 2
- 230000002797 proteolythic effect Effects 0.000 description 2
- 230000002685 pulmonary effect Effects 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 201000010174 renal carcinoma Diseases 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 239000011347 resin Substances 0.000 description 2
- 229920005989 resin Polymers 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- YGSDEFSMJLZEOE-UHFFFAOYSA-N salicylic acid Chemical compound OC(=O)C1=CC=CC=C1O YGSDEFSMJLZEOE-UHFFFAOYSA-N 0.000 description 2
- 230000009919 sequestration Effects 0.000 description 2
- 238000002741 site-directed mutagenesis Methods 0.000 description 2
- 235000015424 sodium Nutrition 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- GEHJYWRUCIMESM-UHFFFAOYSA-L sodium sulfite Chemical compound [Na+].[Na+].[O-]S([O-])=O GEHJYWRUCIMESM-UHFFFAOYSA-L 0.000 description 2
- 238000010532 solid phase synthesis reaction Methods 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 239000000375 suspending agent Substances 0.000 description 2
- 230000002459 sustained effect Effects 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- 230000005751 tumor progression Effects 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 238000011179 visual inspection Methods 0.000 description 2
- 229910052727 yttrium Inorganic materials 0.000 description 2
- DIGQNXIGRZPYDK-WKSCXVIASA-N (2R)-6-amino-2-[[2-[[(2S)-2-[[2-[[(2R)-2-[[(2S)-2-[[(2R,3S)-2-[[2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2R)-2-[[(2S,3S)-2-[[(2R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2R)-2-[[2-[[2-[[2-[(2-amino-1-hydroxyethylidene)amino]-3-carboxy-1-hydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1,5-dihydroxy-5-iminopentylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]hexanoic acid Chemical compound C[C@@H]([C@@H](C(=N[C@@H](CS)C(=N[C@@H](C)C(=N[C@@H](CO)C(=NCC(=N[C@@H](CCC(=N)O)C(=NC(CS)C(=N[C@H]([C@H](C)O)C(=N[C@H](CS)C(=N[C@H](CO)C(=NCC(=N[C@H](CS)C(=NCC(=N[C@H](CCCCN)C(=O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)N=C([C@H](CS)N=C([C@H](CO)N=C([C@H](CO)N=C([C@H](C)N=C(CN=C([C@H](CO)N=C([C@H](CS)N=C(CN=C(C(CS)N=C(C(CC(=O)O)N=C(CN)O)O)O)O)O)O)O)O)O)O)O)O DIGQNXIGRZPYDK-WKSCXVIASA-N 0.000 description 1
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 1
- JNYAEWCLZODPBN-JGWLITMVSA-N (2r,3r,4s)-2-[(1r)-1,2-dihydroxyethyl]oxolane-3,4-diol Chemical class OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O JNYAEWCLZODPBN-JGWLITMVSA-N 0.000 description 1
- FQWZLZJRZNURGX-BYPYZUCNSA-N (2s)-2-(2-diazohydrazinyl)-4-methylsulfanylbutanoic acid Chemical group CSCC[C@@H](C(O)=O)NN=[N+]=[N-] FQWZLZJRZNURGX-BYPYZUCNSA-N 0.000 description 1
- XMQUEQJCYRFIQS-YFKPBYRVSA-N (2s)-2-amino-5-ethoxy-5-oxopentanoic acid Chemical compound CCOC(=O)CC[C@H](N)C(O)=O XMQUEQJCYRFIQS-YFKPBYRVSA-N 0.000 description 1
- 125000004178 (C1-C4) alkyl group Chemical group 0.000 description 1
- WHBMMWSBFZVSSR-GSVOUGTGSA-N (R)-3-hydroxybutyric acid Chemical compound C[C@@H](O)CC(O)=O WHBMMWSBFZVSSR-GSVOUGTGSA-N 0.000 description 1
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- UKAUYVFTDYCKQA-UHFFFAOYSA-N -2-Amino-4-hydroxybutanoic acid Natural products OC(=O)C(N)CCO UKAUYVFTDYCKQA-UHFFFAOYSA-N 0.000 description 1
- SLYRGJDSFOCAAI-UHFFFAOYSA-N 1,3-thiazolidin-2-one Chemical compound O=C1NCCS1 SLYRGJDSFOCAAI-UHFFFAOYSA-N 0.000 description 1
- KZNQNBZMBZJQJO-UHFFFAOYSA-N 1-(2-azaniumylacetyl)pyrrolidine-2-carboxylate Chemical compound NCC(=O)N1CCCC1C(O)=O KZNQNBZMBZJQJO-UHFFFAOYSA-N 0.000 description 1
- BJHCYTJNPVGSBZ-YXSASFKJSA-N 1-[4-[6-amino-5-[(Z)-methoxyiminomethyl]pyrimidin-4-yl]oxy-2-chlorophenyl]-3-ethylurea Chemical compound CCNC(=O)Nc1ccc(Oc2ncnc(N)c2\C=N/OC)cc1Cl BJHCYTJNPVGSBZ-YXSASFKJSA-N 0.000 description 1
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- VGONTNSXDCQUGY-RRKCRQDMSA-N 2'-deoxyinosine Chemical group C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC2=O)=C2N=C1 VGONTNSXDCQUGY-RRKCRQDMSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- 206010000830 Acute leukaemia Diseases 0.000 description 1
- 101000658237 Agelenopsis aperta Omega-agatoxin-Aa4b Proteins 0.000 description 1
- 108700028369 Alleles Proteins 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 201000003076 Angiosarcoma Diseases 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 1
- 102100023013 Basic leucine zipper transcriptional factor ATF-like 3 Human genes 0.000 description 1
- 101150014003 Batf3 gene Proteins 0.000 description 1
- 241000254127 Bemisia tabaci Species 0.000 description 1
- 239000005711 Benzoic acid Substances 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-M Bicarbonate Chemical compound OC([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-M 0.000 description 1
- BTBUEUYNUDRHOZ-UHFFFAOYSA-N Borate Chemical compound [O-]B([O-])[O-] BTBUEUYNUDRHOZ-UHFFFAOYSA-N 0.000 description 1
- 241000701822 Bovine papillomavirus Species 0.000 description 1
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 1
- 210000005236 CD8+ effector T cell Anatomy 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 208000017897 Carcinoma of esophagus Diseases 0.000 description 1
- 201000000274 Carcinosarcoma Diseases 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 108091006146 Channels Proteins 0.000 description 1
- GHXZTYHSJHQHIJ-UHFFFAOYSA-N Chlorhexidine Chemical compound C=1C=C(Cl)C=CC=1NC(N)=NC(N)=NCCCCCCN=C(N)N=C(N)NC1=CC=C(Cl)C=C1 GHXZTYHSJHQHIJ-UHFFFAOYSA-N 0.000 description 1
- 241001638933 Cochlicella barbara Species 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 241000237972 Conus geographus Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 229920000858 Cyclodextrin Polymers 0.000 description 1
- OABOXRPGTFRBFZ-IMJSIDKUSA-N Cys-Cys Chemical group SC[C@H](N)C(=O)N[C@@H](CS)C(O)=O OABOXRPGTFRBFZ-IMJSIDKUSA-N 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- SHZGCJCMOBCMKK-UHFFFAOYSA-N D-mannomethylose Natural products CC1OC(O)C(O)C(O)C1O SHZGCJCMOBCMKK-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 238000011238 DNA vaccination Methods 0.000 description 1
- 229920001353 Dextrin Polymers 0.000 description 1
- 239000004375 Dextrin Substances 0.000 description 1
- 108090000204 Dipeptidase 1 Proteins 0.000 description 1
- 240000006337 Ecballium elaterium Species 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 241001125671 Eretmochelys imbricata Species 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- IAYPIBMASNFSPL-UHFFFAOYSA-N Ethylene oxide Chemical compound C1CO1 IAYPIBMASNFSPL-UHFFFAOYSA-N 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 208000001382 Experimental Melanoma Diseases 0.000 description 1
- 239000001116 FEMA 4028 Substances 0.000 description 1
- 241000282324 Felis Species 0.000 description 1
- 108090000386 Fibroblast Growth Factor 1 Proteins 0.000 description 1
- 102100031706 Fibroblast growth factor 1 Human genes 0.000 description 1
- 239000004606 Fillers/Extenders Substances 0.000 description 1
- PNNNRSAQSRJVSB-SLPGGIOYSA-N Fucose Natural products C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)C=O PNNNRSAQSRJVSB-SLPGGIOYSA-N 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 description 1
- 208000001258 Hemangiosarcoma Diseases 0.000 description 1
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 101000903609 Homo sapiens Basic leucine zipper transcriptional factor ATF-like 3 Proteins 0.000 description 1
- 101000808011 Homo sapiens Vascular endothelial growth factor A Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical class O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 1
- 208000001953 Hypotension Diseases 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 102100037850 Interferon gamma Human genes 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- LPHGQDQBBGAPDZ-UHFFFAOYSA-N Isocaffeine Natural products CN1C(=O)N(C)C(=O)C2=C1N(C)C=N2 LPHGQDQBBGAPDZ-UHFFFAOYSA-N 0.000 description 1
- 108010025815 Kanamycin Kinase Proteins 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- SHZGCJCMOBCMKK-DHVFOXMCSA-N L-fucopyranose Chemical compound C[C@@H]1OC(O)[C@@H](O)[C@H](O)[C@@H]1O SHZGCJCMOBCMKK-DHVFOXMCSA-N 0.000 description 1
- UKAUYVFTDYCKQA-VKHMYHEASA-N L-homoserine Chemical group OC(=O)[C@@H](N)CCO UKAUYVFTDYCKQA-VKHMYHEASA-N 0.000 description 1
- QEFRNWWLZKMPFJ-ZXPFJRLXSA-N L-methionine (R)-S-oxide Chemical group C[S@@](=O)CC[C@H]([NH3+])C([O-])=O QEFRNWWLZKMPFJ-ZXPFJRLXSA-N 0.000 description 1
- QEFRNWWLZKMPFJ-UHFFFAOYSA-N L-methionine sulphoxide Chemical group CS(=O)CCC(N)C(O)=O QEFRNWWLZKMPFJ-UHFFFAOYSA-N 0.000 description 1
- 102000017578 LAG3 Human genes 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 101150030213 Lag3 gene Proteins 0.000 description 1
- 102000007547 Laminin Human genes 0.000 description 1
- 108010085895 Laminin Proteins 0.000 description 1
- 208000006404 Large Granular Lymphocytic Leukemia Diseases 0.000 description 1
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 1
- 240000007472 Leucaena leucocephala Species 0.000 description 1
- 102100029193 Low affinity immunoglobulin gamma Fc region receptor III-A Human genes 0.000 description 1
- 101710099301 Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 108091054437 MHC class I family Proteins 0.000 description 1
- 102000043129 MHC class I family Human genes 0.000 description 1
- 239000007993 MOPS buffer Substances 0.000 description 1
- 241000282553 Macaca Species 0.000 description 1
- 208000035490 Megakaryoblastic Acute Leukemia Diseases 0.000 description 1
- 102000012750 Membrane Glycoproteins Human genes 0.000 description 1
- 108010090054 Membrane Glycoproteins Proteins 0.000 description 1
- 102000003792 Metallothionein Human genes 0.000 description 1
- 108090000157 Metallothionein Proteins 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical class ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 1
- 125000000729 N-terminal amino-acid group Chemical group 0.000 description 1
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 1
- 206010028813 Nausea Diseases 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 230000004989 O-glycosylation Effects 0.000 description 1
- 101710115095 Omega-agatoxin-Aa3b Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 241000282577 Pan troglodytes Species 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 241001504519 Papio ursinus Species 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 208000027190 Peripheral T-cell lymphomas Diseases 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 206010057249 Phagocytosis Diseases 0.000 description 1
- 241001315609 Pittosporum crassifolium Species 0.000 description 1
- 102100040681 Platelet-derived growth factor C Human genes 0.000 description 1
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 101710182846 Polyhedrin Proteins 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 241001415846 Procellariidae Species 0.000 description 1
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 1
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-N Propionic acid Chemical class CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 101000852966 Rattus norvegicus Interleukin-1 receptor-like 1 Proteins 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 241000235088 Saccharomyces sp. Species 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 206010040070 Septic Shock Diseases 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- 101710105463 Snake venom vascular endothelial growth factor toxin Proteins 0.000 description 1
- UIIMBOGNXHQVGW-DEQYMQKBSA-M Sodium bicarbonate-14C Chemical compound [Na+].O[14C]([O-])=O UIIMBOGNXHQVGW-DEQYMQKBSA-M 0.000 description 1
- DWAQJAXMDSEUJJ-UHFFFAOYSA-M Sodium bisulfite Chemical compound [Na+].OS([O-])=O DWAQJAXMDSEUJJ-UHFFFAOYSA-M 0.000 description 1
- 101800001707 Spacer peptide Proteins 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 238000003800 Staudinger reaction Methods 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 108700005078 Synthetic Genes Proteins 0.000 description 1
- 230000006052 T cell proliferation Effects 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 208000031672 T-Cell Peripheral Lymphoma Diseases 0.000 description 1
- 201000008717 T-cell large granular lymphocyte leukemia Diseases 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 102000012607 Thrombomodulin Human genes 0.000 description 1
- 108010079274 Thrombomodulin Proteins 0.000 description 1
- 229940122753 Thrombopoietin antagonist Drugs 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 108090000901 Transferrin Proteins 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 229940122618 Trypsin inhibitor Drugs 0.000 description 1
- 101710162629 Trypsin inhibitor Proteins 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 108010073925 Vascular Endothelial Growth Factor B Proteins 0.000 description 1
- 108010073923 Vascular Endothelial Growth Factor C Proteins 0.000 description 1
- 108010073919 Vascular Endothelial Growth Factor D Proteins 0.000 description 1
- 108010053096 Vascular Endothelial Growth Factor Receptor-1 Proteins 0.000 description 1
- 102000016549 Vascular Endothelial Growth Factor Receptor-2 Human genes 0.000 description 1
- 102100038217 Vascular endothelial growth factor B Human genes 0.000 description 1
- 102100038232 Vascular endothelial growth factor C Human genes 0.000 description 1
- 102100038234 Vascular endothelial growth factor D Human genes 0.000 description 1
- 102100033178 Vascular endothelial growth factor receptor 1 Human genes 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 239000008351 acetate buffer Substances 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 208000021841 acute erythroid leukemia Diseases 0.000 description 1
- 208000013593 acute megakaryoblastic leukemia Diseases 0.000 description 1
- 208000020700 acute megakaryocytic leukemia Diseases 0.000 description 1
- 230000003044 adaptive effect Effects 0.000 description 1
- 238000012382 advanced drug delivery Methods 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 1
- 229910001508 alkali metal halide Inorganic materials 0.000 description 1
- 150000008045 alkali metal halides Chemical class 0.000 description 1
- 229940125516 allosteric modulator Drugs 0.000 description 1
- 150000001408 amides Chemical group 0.000 description 1
- 102000006646 aminoglycoside phosphotransferase Human genes 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 230000002491 angiogenic effect Effects 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 238000011230 antibody-based therapy Methods 0.000 description 1
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 239000012062 aqueous buffer Substances 0.000 description 1
- 239000013011 aqueous formulation Substances 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 229940120638 avastin Drugs 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 229960000686 benzalkonium chloride Drugs 0.000 description 1
- 235000010233 benzoic acid Nutrition 0.000 description 1
- 229960004365 benzoic acid Drugs 0.000 description 1
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 102000005936 beta-Galactosidase Human genes 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 1
- WHGYBXFWUBPSRW-FOUAGVGXSA-N beta-cyclodextrin Chemical compound OC[C@H]([C@H]([C@@H]([C@H]1O)O)O[C@H]2O[C@@H]([C@@H](O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O3)[C@H](O)[C@H]2O)CO)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@@H]3O[C@@H]1CO WHGYBXFWUBPSRW-FOUAGVGXSA-N 0.000 description 1
- 235000011175 beta-cyclodextrine Nutrition 0.000 description 1
- 102000006635 beta-lactamase Human genes 0.000 description 1
- 229960004853 betadex Drugs 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 230000001588 bifunctional effect Effects 0.000 description 1
- 229920001222 biopolymer Polymers 0.000 description 1
- OWMVSZAMULFTJU-UHFFFAOYSA-N bis-tris Chemical compound OCCN(CCO)C(CO)(CO)CO OWMVSZAMULFTJU-UHFFFAOYSA-N 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 239000004067 bulking agent Substances 0.000 description 1
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 1
- 150000004648 butanoic acid derivatives Chemical class 0.000 description 1
- 229960001948 caffeine Drugs 0.000 description 1
- VJEONQKOZGKCAK-UHFFFAOYSA-N caffeine Natural products CN1C(=O)N(C)C(=O)C2=C1C=CN2C VJEONQKOZGKCAK-UHFFFAOYSA-N 0.000 description 1
- 229910000019 calcium carbonate Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 208000035269 cancer or benign tumor Diseases 0.000 description 1
- 125000000837 carbohydrate group Chemical group 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 150000004649 carbonic acid derivatives Chemical class 0.000 description 1
- UHBYWPGGCSDKFX-UHFFFAOYSA-N carboxyglutamic acid Chemical class OC(=O)C(N)CC(C(O)=O)C(O)=O UHBYWPGGCSDKFX-UHFFFAOYSA-N 0.000 description 1
- 230000021164 cell adhesion Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 210000003679 cervix uteri Anatomy 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 125000003636 chemical group Chemical group 0.000 description 1
- 238000001311 chemical methods and process Methods 0.000 description 1
- 229960003260 chlorhexidine Drugs 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 229940107161 cholesterol Drugs 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 150000001860 citric acid derivatives Chemical class 0.000 description 1
- 238000011260 co-administration Methods 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 201000010897 colon adenocarcinoma Diseases 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 238000004040 coloring Methods 0.000 description 1
- 230000024203 complement activation Effects 0.000 description 1
- 230000000536 complexating effect Effects 0.000 description 1
- 239000008139 complexing agent Substances 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 230000001268 conjugating effect Effects 0.000 description 1
- 108050003126 conotoxin Proteins 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 108091008034 costimulatory receptors Proteins 0.000 description 1
- 108010004073 cysteinylcysteine Proteins 0.000 description 1
- 230000016396 cytokine production Effects 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 239000003405 delayed action preparation Substances 0.000 description 1
- 230000003297 denaturating effect Effects 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000010511 deprotection reaction Methods 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 235000019425 dextrin Nutrition 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- 208000018554 digestive system carcinoma Diseases 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- GCSAXWHQFYOIFE-UHFFFAOYSA-N dipyridin-2-yl carbonate Chemical compound C=1C=CC=NC=1OC(=O)OC1=CC=CC=N1 GCSAXWHQFYOIFE-UHFFFAOYSA-N 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 230000006334 disulfide bridging Effects 0.000 description 1
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 1
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Natural products OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 230000007783 downstream signaling Effects 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 229940056913 eftilagimod alfa Drugs 0.000 description 1
- 238000001493 electron microscopy Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 238000005538 encapsulation Methods 0.000 description 1
- 230000002124 endocrine Effects 0.000 description 1
- 210000000750 endocrine system Anatomy 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 230000000925 erythroid effect Effects 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 230000003203 everyday effect Effects 0.000 description 1
- 102000036444 extracellular matrix enzymes Human genes 0.000 description 1
- 108091007167 extracellular matrix enzymes Proteins 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000012467 final product Substances 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 210000004907 gland Anatomy 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 210000003128 head Anatomy 0.000 description 1
- 230000003118 histopathologic effect Effects 0.000 description 1
- 239000000710 homodimer Substances 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 102000058223 human VEGFA Human genes 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 229920002674 hyaluronan Polymers 0.000 description 1
- 229960003160 hyaluronic acid Drugs 0.000 description 1
- 239000000017 hydrogel Substances 0.000 description 1
- 150000002431 hydrogen Chemical group 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 229960002163 hydrogen peroxide Drugs 0.000 description 1
- 229920001477 hydrophilic polymer Polymers 0.000 description 1
- 125000004356 hydroxy functional group Chemical group O* 0.000 description 1
- 229960002591 hydroxyproline Drugs 0.000 description 1
- 206010020718 hyperplasia Diseases 0.000 description 1
- 230000002390 hyperplastic effect Effects 0.000 description 1
- 230000036543 hypotension Effects 0.000 description 1
- 230000005965 immune activity Effects 0.000 description 1
- 239000012642 immune effector Substances 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 102000028557 immunoglobulin binding proteins Human genes 0.000 description 1
- 108091009323 immunoglobulin binding proteins Proteins 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 230000003259 immunoinhibitory effect Effects 0.000 description 1
- 229940121354 immunomodulator Drugs 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 230000036512 infertility Effects 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 229940041682 inhalant solution Drugs 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 102000029719 integrin binding proteins Human genes 0.000 description 1
- 108091009291 integrin binding proteins Proteins 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 239000000543 intermediate Substances 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000000185 intracerebroventricular administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 239000000644 isotonic solution Substances 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 231100001231 less toxic Toxicity 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 230000033001 locomotion Effects 0.000 description 1
- 229940076783 lucentis Drugs 0.000 description 1
- 201000005296 lung carcinoma Diseases 0.000 description 1
- 210000002751 lymph Anatomy 0.000 description 1
- 210000003563 lymphoid tissue Anatomy 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 229920001427 mPEG Polymers 0.000 description 1
- LGAILEFNHXWAJP-BMEPFDOTSA-N macrocycle Chemical compound N([C@H]1[C@@H](C)CC)C(=O)C(N=2)=CSC=2CNC(=O)C(=C(O2)C)N=C2[C@H]([C@@H](C)CC)NC(=O)C2=CSC1=N2 LGAILEFNHXWAJP-BMEPFDOTSA-N 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 1
- 229960002216 methylparaben Drugs 0.000 description 1
- LSDPWZHWYPCBBB-UHFFFAOYSA-O methylsulfide anion Chemical compound [SH2+]C LSDPWZHWYPCBBB-UHFFFAOYSA-O 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 239000003094 microcapsule Substances 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 239000003226 mitogen Substances 0.000 description 1
- 230000002297 mitogenic effect Effects 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 108091005601 modified peptides Proteins 0.000 description 1
- 102000035118 modified proteins Human genes 0.000 description 1
- 108091005573 modified proteins Proteins 0.000 description 1
- 239000002991 molded plastic Substances 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 230000008693 nausea Effects 0.000 description 1
- 210000003739 neck Anatomy 0.000 description 1
- 229910052754 neon Inorganic materials 0.000 description 1
- GKAOGPIIYCISHV-UHFFFAOYSA-N neon atom Chemical compound [Ne] GKAOGPIIYCISHV-UHFFFAOYSA-N 0.000 description 1
- 210000005170 neoplastic cell Anatomy 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 210000000440 neutrophil Anatomy 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 230000000269 nucleophilic effect Effects 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 238000006384 oligomerization reaction Methods 0.000 description 1
- 108010041214 omega-agatoxin-Aa4b Proteins 0.000 description 1
- 231100000590 oncogenic Toxicity 0.000 description 1
- 230000002246 oncogenic effect Effects 0.000 description 1
- 210000004789 organ system Anatomy 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 201000008968 osteosarcoma Diseases 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- FJKROLUGYXJWQN-UHFFFAOYSA-N papa-hydroxy-benzoic acid Natural products OC(=O)C1=CC=C(O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-N 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 244000045947 parasite Species 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 239000000816 peptidomimetic Substances 0.000 description 1
- 230000035699 permeability Effects 0.000 description 1
- 210000001539 phagocyte Anatomy 0.000 description 1
- 230000008782 phagocytosis Effects 0.000 description 1
- 230000003285 pharmacodynamic effect Effects 0.000 description 1
- 235000021317 phosphate Nutrition 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- PTMHPRAIXMAOOB-UHFFFAOYSA-L phosphoramidate Chemical compound NP([O-])([O-])=O PTMHPRAIXMAOOB-UHFFFAOYSA-L 0.000 description 1
- 150000008300 phosphoramidites Chemical class 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 230000036470 plasma concentration Effects 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 108010017992 platelet-derived growth factor C Proteins 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 239000004633 polyglycolic acid Substances 0.000 description 1
- 229920002338 polyhydroxyethylmethacrylate Polymers 0.000 description 1
- 239000004626 polylactic acid Substances 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229940068977 polysorbate 20 Drugs 0.000 description 1
- 229940068968 polysorbate 80 Drugs 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 229940068965 polysorbates Drugs 0.000 description 1
- 238000011176 pooling Methods 0.000 description 1
- 239000001103 potassium chloride Substances 0.000 description 1
- 235000011164 potassium chloride Nutrition 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 239000003380 propellant Substances 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 239000003223 protective agent Substances 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 229960003876 ranibizumab Drugs 0.000 description 1
- 229940044551 receptor antagonist Drugs 0.000 description 1
- 239000002464 receptor antagonist Substances 0.000 description 1
- 108091008598 receptor tyrosine kinases Proteins 0.000 description 1
- 102000027426 receptor tyrosine kinases Human genes 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 210000003289 regulatory T cell Anatomy 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 210000002345 respiratory system Anatomy 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 238000007151 ring opening polymerisation reaction Methods 0.000 description 1
- 102220080600 rs797046116 Human genes 0.000 description 1
- 108091008601 sVEGFR Proteins 0.000 description 1
- 229960004889 salicylic acid Drugs 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 230000036303 septic shock Effects 0.000 description 1
- 231100000004 severe toxicity Toxicity 0.000 description 1
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 description 1
- 238000001542 size-exclusion chromatography Methods 0.000 description 1
- 210000000813 small intestine Anatomy 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 229940079827 sodium hydrogen sulfite Drugs 0.000 description 1
- 235000010267 sodium hydrogen sulphite Nutrition 0.000 description 1
- 229940001482 sodium sulfite Drugs 0.000 description 1
- 235000010265 sodium sulphite Nutrition 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000007909 solid dosage form Substances 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 238000001179 sorption measurement Methods 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 238000011146 sterile filtration Methods 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 150000005846 sugar alcohols Chemical class 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000008866 synergistic binding Effects 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 229950001790 tendamistat Drugs 0.000 description 1
- 108010037401 tendamistate Proteins 0.000 description 1
- 238000011191 terminal modification Methods 0.000 description 1
- 230000002381 testicular Effects 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 108010059728 thrombopoietin mimetic peptide Proteins 0.000 description 1
- 210000001685 thyroid gland Anatomy 0.000 description 1
- 239000012443 tonicity enhancing agent Substances 0.000 description 1
- 231100000167 toxic agent Toxicity 0.000 description 1
- 239000003440 toxic substance Substances 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- FGMPLJWBKKVCDB-UHFFFAOYSA-N trans-L-hydroxy-proline Natural products ON1CCCC1C(O)=O FGMPLJWBKKVCDB-UHFFFAOYSA-N 0.000 description 1
- 239000012581 transferrin Substances 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- ODLHGICHYURWBS-LKONHMLTSA-N trappsol cyclo Chemical compound CC(O)COC[C@H]([C@H]([C@@H]([C@H]1O)O)O[C@H]2O[C@@H]([C@@H](O[C@H]3O[C@H](COCC(C)O)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](COCC(C)O)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](COCC(C)O)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](COCC(C)O)[C@H]([C@@H]([C@H]3O)O)O3)[C@H](O)[C@H]2O)COCC(O)C)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@@H]3O[C@@H]1COCC(C)O ODLHGICHYURWBS-LKONHMLTSA-N 0.000 description 1
- 229950007217 tremelimumab Drugs 0.000 description 1
- ZGYICYBLPGRURT-UHFFFAOYSA-N tri(propan-2-yl)silicon Chemical compound CC(C)[Si](C(C)C)C(C)C ZGYICYBLPGRURT-UHFFFAOYSA-N 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 1
- 229960000281 trometamol Drugs 0.000 description 1
- 239000002753 trypsin inhibitor Substances 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 210000002229 urogenital system Anatomy 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 239000002435 venom Substances 0.000 description 1
- 231100000611 venom Toxicity 0.000 description 1
- 210000001048 venom Anatomy 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 239000000664 voltage gated sodium channel blocking agent Substances 0.000 description 1
- 239000008215 water for injection Substances 0.000 description 1
- 229920003169 water-soluble polymer Polymers 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 230000037314 wound repair Effects 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/20—Interleukins [IL]
- A61K38/2013—IL-2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/179—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/38—Albumins
- A61K38/385—Serum albumin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/55—IL-2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/22—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/249—Interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2812—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD4
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2815—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD8
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3053—Skin, nerves, brain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/31—Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
Definitions
- Interleukin-2 is a pleiotropic cytokine that activates and induces the proliferation of T cells and NK cells.
- IL-2 is an FDA approved therapy
- systemic IL-2 treatment has significant toxicity and therefore the response rate of patients is less than 25%.
- Combining extended half-life IL-2 and an antibody against a tumor-specific antigen shows promising results for treatment.
- antibody-based therapies often suffer from the fact that many tumors lack known tumor-associated antigens.
- Integrins are a family of extracellular matrix adhesion receptors that regulate a diverse array of cellular functions crucial to the initiation, progression and metastasis of solid tumors. The importance of integrins in tumor progression has made them an appealing target for cancer therapy and allows for the treatment of a variety of cancer types.
- the integrins present on cancerous cells include ⁇ v ⁇ 3 , ⁇ v ⁇ 5 , and ⁇ 5 ⁇ 1 .
- a variety of therapeutics have been developed to target individual integrins associated with cancer, including antibodies, linear peptides, cyclic peptides, and peptidomimetics. However, none have utilized small, structured peptide scaffolds or targeted more than two integrins simultaneously. Additionally, current integrin targeting drugs are given as a monotherapy. Novel combination therapies are needed to more effectively combat various cancers.
- the present invention is based, in part, on the discovery that administration of IL-2 attached to a pharmacokinetic modifying group (hereafter referred to as “extended-pharmacokinetic (PK) IL-2”) and an integrin-binding-Fc fusion protein provides synergistic tumor control and prolongs survival relative to monotherapy of either agent alone.
- the integrin-binding-Fc fusion protein comprises (i) an integrin-binding polypeptide having an integrin-binding loop and a knottin polypeptide scaffold; and (ii) an immunoglobulin Fc domain, wherein the integrin-binding polypeptide is operably linked to the Fc domain.
- An improved cancer therapy is provided that involves the combined administration of an effective amount of IL-2 and an integrin-binding-Fc fusion protein.
- the invention provides a method for treating cancer in a subject comprising administering to the subject an effective amount of interleukin (IL)-2, and an integrin-binding-Fc fusion protein, wherein the integrin-binding-Fc fusion protein comprises (i) an integrin-binding polypeptide comprising an integrin-binding loop and an knottin polypeptide scaffold; and (ii) an immunoglobulin Fc domain, wherein the integrin-binding polypeptide is operably linked to the Fc domain.
- IL interleukin
- the IL-2 is in the form of an extended-PK IL-2, such as an IL-2 fusion protein.
- the fusion protein comprises an IL-2 moiety and a moiety selected from the group consisting of an immunoglobulin fragment, human serum albumin, and Fn3.
- the fusion protein comprises an IL-2 moiety operably linked to an immunoglobulin Fc domain.
- the fusion protein comprises an IL-2 moiety operably linked to human serum albumin
- the extended-PK IL-2 comprises an IL-2 moiety conjugated to a non-protein polymer.
- the non-protein polymer is polyethylene glycol.
- the integrin-binding-Fc fusion protein includes an integrin-binding polypeptide that binds to a tumor associated integrin selected from the group consisting of ⁇ v ⁇ 3 , ⁇ v ⁇ 5 , and ⁇ 5 ⁇ 1 , or combination thereof.
- the integrin-binding polypeptide binds to ⁇ v ⁇ 3 , ⁇ v ⁇ 5 , and ⁇ 5 ⁇ 1 .
- the integrin-binding polypeptide includes an integrin-binding loop within a knottin polypeptide scaffold.
- the knottin polypeptide scaffold comprises at least three cysteine disulfide linkages or crosslinked cysteine residues, and the integrin-binding loop is adjacent cysteine residues of the knottin polypeptide scaffold.
- the integrin-binding loop comprises an RGD peptide sequence.
- the knottin polypeptide scaffold is derived from a knottin protein selected from the group consisting of EETI-II, AgRP, and agatoxin.
- the knottin protein is EETI-II.
- the integrin-binding polypeptide includes an integrin-binding loop comprising an RGD peptide sequence and the knottin polypeptide scaffold is derived from EETI-II.
- the knottin polypeptide scaffold is derived from EETI-II and the integrin-binding loop comprises the sequence, X 1 X 2 X 3 RGDX 7 X 8 X 9 X 10 X 11 , wherein each X represents any amino acid, wherein the loop is inserted between 2 cysteine residues in the EETI-II sequence and replaces the native EETI-II sequence.
- the integrin-binding loop is inserted after the first cysteine in the native EETI-II sequence.
- the integrin-binding polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 42 or 43, wherein X 1 is selected from the group consisting of A, V, L, P, F, Y, S, H, D, and N; X 2 is selected from the group consisting of G, V, L, P, R, E, and Q; X 3 is selected from the group consisting of G, A, and P; X 7 is selected from the group consisting of W and N; X 8 is selected from the group consisting of A, P, and S; X 9 is selected from the group consisting of P and R; X 10 is selected from the group consisting of A, V, L, P, S, T, and E; and X 11 is selected from the group consisting of G, A, W, S, T, K, and E.
- the integrin-binding-Fc fusion comprises an integrin-binding polypeptide, as set forth in SEQ ID NOs: 42 or 43, operably linked to a human IgG Fc domain, as set forth in SEQ ID NOs: 2 or 3.
- the integrin-binding polypeptide comprises an amino acid sequence selected from the amino acid sequences set forth in Table 1.
- the integrin-binding polypeptide comprises an amino acid sequence from the group consisting of SEQ ID NOs: 67-133.
- an integrin-binding polypeptide, set forth in Table 1 is operably linked to a human IgG1 Fc domain, set forth in SEQ ID NOs: 2 or 3.
- the integrin-binding polypeptide comprises the amino acid sequence of SEQ ID NO: 93, 94, 95 or 96.
- the Fc domain is a human IgG1 Fc domain.
- the integrin-binding polypeptide is operably linked with or without a linker to the Fc domain In some embodiments, the integrin-binding polypeptide is linked to the N-terminus or C-terminus of the Fc domain without a linker. In other embodiments, the integrin-binding polypeptide is linked to the N-terminus or C-terminus of the Fc donor with a linker such as a Gly-Ser linker.
- the integrin-binding-Fc fusion protein comprises the amino acid sequence of SEQ ID NO: 48, 49, 50 or 51.
- the methods comprise administering IL-2 and the integrin-binding-Fc fusion protein in the form of a pharmaceutical composition with a pharmaceutically acceptable carrier.
- the integrin-binding-Fc fusion protein is in the form of a dimer.
- the methods comprise administering IL-2 and the integrin-binding-Fc fusion protein simultaneously or sequentially.
- the methods further comprise administering an immune checkpoint blocker, such an antibody or antibody fragment targeting PD-1, PD-L1, CTLA-4, TIM3, LAG3, or a member of the B7 family
- an immune checkpoint blocker such an antibody or antibody fragment targeting PD-1, PD-L1, CTLA-4, TIM3, LAG3, or a member of the B7 family
- the immune checkpoint blocker is an antibody or antibody fragment thereof targeting PD-1.
- the immune checkpoint blocker is an antibody or antibody fragment targeting CTLA4.
- an antagonist of VEGF is administered in place of an immune checkpoint blocker.
- the antagonist of VEGF is an antibody or antibody fragment thereof that binds VEGF, an antibody or antibody fragment thereof that binds VEGF receptor, a small molecule inhibitor of the VEGF receptor tyrosine kinases, a dominant negative VEGF, or a VEGF receptor.
- the methods comprise administering an integrin-binding-Fc fusion protein and an immune checkpoint blocker, with or without IL-2.
- the cancer is selected from the group consisting of melanoma, leukemia, lung cancer, breast cancer, prostate cancer, ovarian cancer, colon cancer, renal cell carcinoma, pancreatic cancer, cervical cancer, and brain cancer.
- the cancer is melanoma.
- the cancer is brain cancer, such as medullablastoma.
- the cancer is colon cancer.
- the invention provides a method for inhibiting growth and/or proliferation of tumor cells in a subject comprising administering to the subject an effective amount of an extended-pharmacokinetic (PK) interleukin (IL)-2, and an integrin-binding-Fc fusion protein, wherein the integrin-binding-Fc fusion protein comprises (i) an integrin-binding polypeptide comprising an integrin-binding loop and a knottin polypeptide scaffold; and (ii) an immunoglobulin Fc domain, wherein the integrin-binding polypeptide is operably linked to the Fc domain.
- PK extended-pharmacokinetic
- IL-2 interleukin-2
- integrin-binding-Fc fusion protein comprises (i) an integrin-binding polypeptide comprising an integrin-binding loop and a knottin polypeptide scaffold; and (ii) an immunoglobulin Fc domain, wherein the integrin-binding polypeptide is operably linked to the Fc domain
- the invention provides a method for inhibiting growth and/or proliferation of tumor cells in a subject comprising administering to the subject an effective amount of an integrin-binding-Fc fusion protein, wherein the integrin-binding-Fc fusion protein comprises (i) an integrin-binding polypeptide comprising an integrin-binding loop and a knottin polypeptide scaffold; and (ii) an immunoglobulin Fc domain, wherein the integrin-binding polypeptide is operably linked to the Fc domain, and an immune checkpoint blocker.
- an effective amount of IL-2 is also administered.
- the immune checkpoint blocker is an antibody or antibody fragment targeting PD-1. In another aspect, the immune checkpoint blocker is an antibody or antibody fragment targeting CTLA-4.
- the invention provides a method for inhibiting growth and/or proliferation of tumor cells in a subject comprising administering to the subject an effective amount of an integrin-binding-Fc fusion protein, wherein the integrin-binding-Fc fusion protein comprises (i) an integrin-binding polypeptide comprising an integrin-binding loop and a knottin polypeptide scaffold; and (ii) an immunoglobulin Fc domain, wherein the integrin-binding polypeptide is operably linked to the Fc domain, and an antagonist of VEGF.
- the antagonist of VEGF is an antibody or antibody fragment thereof that binds VEGF, an antibody or antibody fragment thereof that binds VEGF receptor, a small molecule inhibitor of the VEGF receptor tyrosine kinases, a dominant negative VEGF, or a VEGF receptor.
- FIG. 1 shows the positions of the Cys-Cys disulfide linkages in the sequences of knottin proteins EETI-II (SEQ ID NO: 39), AgRP (SEQ ID NO: 40) and omega agatoxin 4B (SEQ ID NO: 41).
- Cysteine residues can be seen to be immediately flanking the RGD mimic loops, which, in the present engineered peptides, are between the brackets.
- AgRP it can be seen that the cysteines flanking the RGD sequence will be linked to each other, whereas in EETI they are not.
- the size of the grafted sequence will depend on the molecular framework structure, such that shorter loops will be preferred in cases where they are in the framework adjacent to linked cysteines.
- Disulfide linkages for other knottin proteins are set forth in the knottin database.
- FIG. 1 is adapted from Biochemistry, 40, 15520-15527 (2001) and J. Biol. Chem., 2003, 278:6314-63
- FIG. 2 is a graph comparing tumor control with TA99 and integrin binding knottin-Fc (SEQ ID NO: 45) in subcutaneous B16F10 melanoma tumors.
- TA99 is an antibody against TYRP-1, an antigen that is overexpressed on melanoma cells.
- Tumors were established by injecting 2.5 ⁇ 10 5 B16F10 cells into the flanks of C57BL/6 mice. Starting on the day of tumor inoculation and every 2 days after, 80 ⁇ g knottin-Fc, 80 ⁇ g knottin-Fc D265A, or 200 ⁇ g TA99 was administered. Error bars represent standard error of the mean (SEM).
- FIGS. 3A and 3B depict synergistic tumor control in established B16F10 melanoma tumors. 1 ⁇ 10 6 B16F10 cells were injected into the flanks of C57BL/6 mice. 30 ⁇ g MSA/IL-2 and/or 500 ⁇ g knottin-Fc was administered on day 6 after tumor inoculation, and every 6 days after for a total of four treatments.
- FIG. 3A Tumor area graphs for each treatment.
- FIG. 3B Kaplan-Meier survival plot.
- FIGS. 4A and 4B depict synergistic tumor control in established MC38 colon tumors. 1 ⁇ 10 6 MC38 cells were injected into the flanks of C57BL/6 mice and 30 ⁇ g MSA/IL-2 and/or 500 ⁇ g knottin-Fc was administered on day 6 after tumor inoculation, and every 6 days after for a total of four treatments.
- FIG. 4A Tumor area graphs for each treatment.
- FIG. 4B Kaplan-Meier survival plot.
- FIGS. 5A and 5B depict synergistic tumor control in established Ag104A fibrosarcoma tumors. 1 ⁇ 10 6 Ag104A cells were injected into the flanks of C3H/HeN mice. 12.5 ⁇ g MSA/IL-2 and/or 500 ⁇ g knottin-Fc was administered on day 6 after tumor inoculation, and every 6 days after for a total of four treatments.
- FIG. 5A Tumor area graphs for each treatment.
- FIG. 5B Kaplan-Meier survival plot.
- FIGS. 6A and 6B depict synergistic tumor control in established B16F10 melanoma tumors.
- 1 ⁇ 10 6 B16F10 cells were injected into the flanks of C57BL/6 mice.
- 30 ⁇ g MSA/IL-2 was and 500 ⁇ g knottin-Fc or knottin-Fc D265A was administered on day 6 after tumor inoculation and every day after for a total of four treatments.
- FIG. 6A Tumor area graphs for each treatment.
- FIG. 6B Kaplan-Meier survival plot.
- FIGS. 7A and 7B depict synergistic tumor control in established MC38 tumors. 1 ⁇ 10 6 MC38 cells were injected into the flanks of C57BL/6 mice and 30 ⁇ g MSA/IL-2 and 500 ⁇ g knottin-Fc or knottin-Fc D265A was administered on day 6 after tumor inoculation and every 6 days after for a total of four treatments.
- FIG. 7A Tumor area graphs for each treatment.
- FIG. 7B Kaplan-Meier survival plot.
- FIGS. 8A and 8B depict synergistic tumor control with an antibody in established B16F10 tumors.
- 1 ⁇ 10 6 B16F10 cells were injected into the flanks of C57BL/6 mice.
- 30 ⁇ g MSA/IL-2 was administered every 6 days beginning on day 6 after tumor inoculation for a total of 5 treatments.
- 200 ⁇ g knottin-Fc was administered daily from days 6-30 after tumor inoculation.
- Antibodies against TYRP-1 (TA99) were administered at 100 ⁇ g per mouse every 6 days starting on day 6 after tumor inoculation.
- Antibodies against PD-1 (for immune checkpoint blockade) were administered at 200 ⁇ g per mouse every 6 days starting on day 6 after tumor inoculation.
- FIG. 8A Tumor area graphs for each treatment.
- FIG. 8B Kaplan-Meier survival plot.
- FIGS. 9A and 9B depict synergistic tumor control with an antibody in established MC38 tumors.
- 1 ⁇ 10 6 MC38 cells were injected into the flanks of C57BL/6 mice.
- 30 ⁇ g MSA/IL-2, 500 ⁇ g knottin-Fc, and/or 200 ⁇ g anti-PD-1 antibody was administered on day 6 after tumor inoculation and every 6 days after for a total of four treatments.
- FIG. 9A Tumor area graphs for each treatment.
- FIG. 9B Kaplan-Meier survival plot.
- FIG. 10 is a line graph depicting tumor growth control comparing dosing schedules of knottin-Fc with MSA-IL-2 in the B16F10 tumor model.
- 30 ⁇ g MSA/IL-2 was administered on days 6, 12, 18 and 24 after tumor inoculation.
- 200 ⁇ g knottin-Fc was administered daily or every other day starting 6 days after tumor inoculation.
- 500 ⁇ g knottin-Fc was administered for the weekly regiment on the same days as MSA/IL-2.
- Mean tumor area is plotted with 5 mice per group and error bars represent SEM.
- FIG. 11 is a line graph depicting tumor growth control comparing dosing schedules of knottin-Fc with MSA/IL-2 in the MC38 tumor model.
- 30 ⁇ g MSA/IL-2 was administered on days 6, 12, 18 and 24 after tumor inoculation.
- 200 ⁇ g knottin-Fc was administered daily or every other day starting 6 days after tumor inoculation.
- 500 ⁇ g knottin-Fc was administered for the weekly regiment on the same days as MSA/IL-2.
- Mean tumor area is plotted with 5 mice per group and error bars represent SEM.
- FIG. 12 is a line graph depicting tumor control in subcutaneous B16F10 tumors.
- Fc was either fused to the N-terminus (knottin-Fc) or C-terminus (Fc-knottin) to compare efficacies of fusion placement. Additionally, knottin was fused to the heavy chain of an irrelevant IgG on the C-terminus (IgG-knottin). Mice were treated with 80 ⁇ g knottin-Fc or Fc-knottin or 200 ⁇ g IgG-knottin every two days starting immediately after tumor inoculation.
- FIG. 13 is a line graph depicting tumor control in subcutaneous MC38 tumors.
- Fc was either fused to the N-terminus (knottin-Fc) or C-terminus (Fc-knottin) to compare efficacies of fusion placement. Additionally, knottin was fused to the heavy chain of an irrelevant IgG on the C-terminus (IgG-knottin). Mice were treated with 200 ⁇ g knottin-Fc or Fc-knottin every two days starting immediately after tumor inoculation.
- FIGS. 14A and 14B depict tumor control after secondary tumor challenge with MC38 tumors cells.
- Previously cured mice (treated with MSA/IL-2 and knottin-Fc) and age-matched na ⁇ ve mice were inoculated with 1 ⁇ 10 6 MC38 tumor cells in the opposite flank 16-20 weeks after the initial tumor inoculation. No further treatment was administered.
- FIG. 14A Tumor area graphs for previously cured mice and age-matched na ⁇ ve mice following secondary tumor challenge.
- FIG. 14B Kaplan-Meier plot of mice subjected to secondary tumor challenge.
- FIGS. 15A and 15B depict synergistic tumor control in established B16F10 melanoma tumors.
- 1 ⁇ 10 6 B16F10 cells were injected into the flanks of C57BL/6 mice.
- FIG. 15A Tumor area graphs for each treatment.
- FIG. 15B Kaplan-Meier survival plot.
- FIGS. 16A and 16B depict synergistic tumor control in established MC38 tumors. 1 ⁇ 10 6 MC38 cells were injected into the flanks of C57BL/6 mice. 30 ⁇ g MSA/IL-2, 500 ⁇ g knottin-Fc that targets 3 integrins (“2.5F_knottin-Fc”), and/or knottin-Fc that targets 2 integrins (“2.5D_knottin-Fc”), was administered on day 6 after tumor inoculation, and every 6 days after for a total of four treatments.
- FIG. 16A Tumor area graphs for each treatment.
- FIG. 16B Kaplan-Meier survival plot.
- FIGS. 17A and 17B depict synergistic tumor control in established Ag104A angiosarcoma tumors.
- 1 ⁇ 10 6 Ag104A cells were injected into the flanks of C3H/HeN mice.
- FIG. 17A Tumor area graphs for each treatment.
- FIG. 17B Kaplan-Meier survival plot.
- FIGS. 18A and 18B depict the effect of immune cell depletions on survival of mice with established MC38 tumors treated with knottin-Fc and MSA/IL-2.
- 1 ⁇ 10 6 MC38 cells were injected into the flanks of C57BL/6 mice.
- 30 ⁇ g MSA/IL-2 and 500 ⁇ g knottin-Fc was administered on day 6 after tumor inoculation, and every 6 days after for a total of four treatments.
- 400 ⁇ g anti-CD8, anti-CD4, anti-NK1.1, anti-Ly6G or anti-CD19 antibodies were dosed every four days for a total of six treatments starting on day 4 after tumor inoculation.
- FIG. 18A Tumor area graphs for each treatment.
- FIG. 18B Kaplan-Meier survival plots.
- FIGS. 19A and 19B depict the effect of dendritic cell depletion on survival of mice with established MC38 tumors.
- 1 ⁇ 10 6 MC38 cells were injected into the flanks of C57BL/6 mice or Batf3 ⁇ / ⁇ mice.
- 30 ⁇ g MSA/IL-2 and 500 ⁇ g knottin-Fc was administered on day 6 after tumor inoculation, and every 6 days after for a total of four treatments.
- FIG. 19A Tumor area graphs for each treatment.
- FIG. 19B Kaplan-Meier survival plot.
- FIGS. 20A and 20B depict the role of IFN ⁇ in the efficacy of treatment with MSA/IL-2 and knottin-Fc in mice with established MC38 tumors.
- 1 ⁇ 10 6 MC38 cells were injected into the flanks of C57BL/6 mice.
- 30 ⁇ g MSA/IL-2 and 500 ⁇ g knottin-Fc was administered on day 6 after tumor inoculation, and every 6 days after for a total of four treatments.
- 200 ⁇ g anti-IFN ⁇ antibody was administered every two days for a total of eleven treatments starting on day 5 after tumor inoculation.
- FIG. 20A Tumor area graphs for each treatment.
- FIG. 20B Kaplan-Meier survival plot.
- FIGS. 21A and 21B depict synergistic tumor control in established MC38 tumors. 1 ⁇ 10 6 MC38 cells were injected into the flanks of C57BL/6 mice. 30 ⁇ g MSA/IL-2, 500 ⁇ g knottin-Fc, and/or 200 ⁇ g anti-VEGF antibody was administered on day 6 after tumor inoculation, and every 6 days after for a total for 4 treatments.
- FIG. 21A Tumor area graphs for each treatment.
- FIG. 21B Kaplan-Meier survival plot.
- FIG. 22 shows tumor area graphs depicting synergistic tumor control in established MC38 tumors.
- 1 ⁇ 10 6 MC38 cells were injected into the flanks of C57BL/6 mice.
- 30 ⁇ g MSA/IL-2, 500 ⁇ g knottin-Fc, and/or 200 ⁇ g anti-CTLA-4 antibody was administered on day 6 after tumor inoculation, and every 6 days after for a total for 4 treatments.
- FIGS. 23A and 23B depict the synergistic tumor control in established B16F10 tumors.
- 1 ⁇ 10 6 B16F10 cells were injected into the flanks of C57BL/6 mice.
- 30 ⁇ g MSA/IL-2, 500 ⁇ g knottin-Fc, 200 ⁇ g anti-VEGF antibody and/or 200 ⁇ g anti-CTLA-4 antibody was administered on day 6 after tumor inoculation, and every 6 days after for a total for 4 treatments.
- FIG. 23A Tumor area graphs for each treatment.
- FIG. 23B Kaplan-Meier survival plots
- amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
- Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, ⁇ -carboxyglutamate, and O-phosphoserine
- Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium.
- Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that function in a manner similar to a naturally occurring amino acid.
- Amino acids can be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, can be referred to by their commonly accepted single-letter codes.
- amino acid substitution refers to the replacement of at least one existing amino acid residue in a predetermined amino acid sequence (an amino acid sequence of a starting polypeptide) with a second, different “replacement” amino acid residue.
- amino acid insertion refers to the incorporation of at least one additional amino acid into a predetermined amino acid sequence. While the insertion will usually consist of the insertion of one or two amino acid residues, the present larger “peptide insertions,” can be made, e.g. insertion of about three to about five or even up to about ten, fifteen, or twenty amino acid residues. The inserted residue(s) may be naturally occurring or non-naturally occurring as disclosed above.
- amino acid deletion refers to the removal of at least one amino acid residue from a predetermined amino acid sequence.
- Polypeptide “peptide”, and “protein” are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymer.
- Nucleic acid refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) and complementary sequences and as well as the sequence explicitly indicated.
- degenerate codon substitutions can be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081, 1991; Ohtsuka et al. Biol. Chem. 260:2605-2608, 1985; and Cassol et al, 1992; Rossolini et al, Mol. Cell. Probes 8:91-98, 1994).
- arginine and leucine modifications at the second base can also be conservative.
- nucleic acid is used interchangeably with gene, cDNA, and mRNA encoded by a gene.
- Polynucleotides used herein can be composed of any polyribonucleotide or polydeoxribonucleotide, which can be unmodified RNA or DNA or modified RNA or DNA.
- polynucleotides can be composed of single- and double-stranded DNA, DNA that is a mixture of single- and double-stranded regions, single- and double-stranded RNA, and RNA that is mixture of single- and double-stranded regions, hybrid molecules comprising DNA and RNA that can be single-stranded or, more typically, double-stranded or a mixture of single- and double-stranded regions.
- polynucleotide can be composed of triple-stranded regions comprising RNA or DNA or both RNA and DNA.
- a polynucleotide can also contain one or more modified bases or DNA or RNA backbones modified for stability or for other reasons. “Modified” bases include, for example, tritylated bases and unusual bases such as inosine. A variety of modifications can be made to DNA and RNA; thus, “polynucleotide” embraces chemically, enzymatically, or metabolically modified forms.
- IL-2 refers to a pleiotropic cytokine that activates and induces proliferation of T cells and natural killer (NK) cells.
- IL-2 signals by binding its receptor, IL-2R, which is comprised of alpha, beta, and gamma subunits. IL-2 signaling stimulates proliferation of antigen-activated T cells.
- PK is an acronym for “pharmacokinetic” and encompasses properties of a compound including, by way of example, absorption, distribution, metabolism, and elimination by a subject.
- an “extended-PK group” refers to a protein, peptide, or moiety that increases the circulation half-life of a biologically active molecule when fused to or administered together with the biologically active molecule. Examples of an extended-PK group include PEG, human serum albumin (HSA) binders (as disclosed in U.S. Publication Nos. 2005/0287153 and 2007/0003549, PCT Publication Nos.
- extended-PK IL-2 refers to an IL-2 moiety in combination with an extended-PK group.
- the extended-PK IL-2 is a fusion protein in which an IL-2 moiety is linked or fused to an extended-PK group.
- An exemplary fusion protein is an HSA/IL-2 fusion in which one or more IL-2 moieties are linked to HSA.
- extended-PK IL-2 is also intended to encompass IL-2 mutants with mutations in one or more amino acid residues that enhance the affinity of IL-2 for one or more of its receptors, for example, CD25.
- the IL-2 moiety of extended-PK IL-2 is wild-type IL-2.
- the IL-2 moiety is a mutant IL-2 which exhibits greater affinity for CD25 than wild-type IL-2.
- HSA-IL-2 it should be understood that this encompasses both HSA or MSA fused to a wild-type IL-2 moiety or HSA or MSA fused to a mutant IL-2 moiety.
- the extended-PK IL-2 or knottin-Fc described can employ one or more “linker domains,” such as polypeptide linkers.
- linker or “linker domain” refers to a sequence which connects two or more domains (e.g., the PK moiety and IL-2) in a linear sequence.
- polypeptide linker refers to a peptide or polypeptide sequence (e.g., a synthetic peptide or polypeptide sequence) which connects two or more domains in a linear amino acid sequence of a polypeptide chain.
- polypeptide linkers may be used to connect an IL-2 moiety or an integrin binding polypeptide to an Fc domain or other PK-extender such as HSA.
- polypeptide linkers can provide flexibility to the polypeptide molecule.
- Exemplary linkers include Gly-Ser linkers.
- the terms “linked,” “fused”, or “fusion” are used interchangeably. These terms refer to the joining together of two or more elements or components or domains, by whatever means including chemical conjugation or recombinant means. Methods of chemical conjugation (e.g., using heterobifunctional crosslinking agents) are known in the art.
- Integrin means a transmembrane heterodimeric protein important for cell adhesion. Integrins comprise an ⁇ and ⁇ subunit. These proteins bind to extracellular matrix components (e.g., fibronectin, collagen, laminin, etc.) and respond by inducing signaling cascades. Integrins bind to extracellular matrix components by recognition of the RGD motif. Certain integrins are found on the surface of tumor cells and therefore make promising therapeutic targets. In certain embodiments, the integrins being targeted are ⁇ v ⁇ 3 , ⁇ v ⁇ 5 , and ⁇ 5 ⁇ 1 , individually or in combination.
- integrin-binding polypeptide refers to a polypeptide which includes an integrin-binding domain or loop within a knottin polypeptide scaffold.
- the integrin binding domain or loop includes at least one RGD peptide.
- the RGD peptide is recognized by ⁇ v ⁇ 3 , ⁇ v ⁇ 5 , or ⁇ 5 ⁇ 1 .
- the RGD peptide binds to a combination of ⁇ v ⁇ 3 , ⁇ v ⁇ 5 , and/or ⁇ 5 ⁇ 1 .
- loop domain refers to an amino acid subsequence within a peptide chain that has no ordered secondary structure, and resides generally on the surface of the peptide.
- loop is understood in the art as referring to secondary structures that are not ordered as in the form of an alpha helix, beta sheet, etc.
- integrin-binding loop refers to a primary sequence of about 9-13 amino acids which is typically created ab initio through experimental methods such as directed molecular evolution to bind to integrins.
- the integrin-binding loop includes an RGD peptide sequence, or the like, placed between amino acids which are particular to the scaffold and the binding specificity desired.
- the RGD-containing peptide or like (RYD, etc) is generally not simply taken from a natural binding sequence of a known protein.
- the integrin-binding loop is preferably inserted within a knottin polypeptide scaffold between cysteine residues, and the length of the loop adjusted for optimal integrin-binding depending on the three-dimensional spacing between cysteine residues.
- the optimal loop may be shorter than if the flanking cysteine residues are linked to cysteine residues separated in primary sequence. Otherwise, particular amino acid substitutions can be introduced to constrain a longer RGD-containing loop into an optimal conformation for high affinity integrin binding.
- the knottin polypeptide scaffolds used herein may contain certain modifications made to truncate the native knottin, or to remove a loop or unnecessary cysteine residue or disulfide bond.
- Incorporation of integrin-binding sequences into a molecular (e.g., knottin polypeptide) scaffold provides a framework for ligand presentation that is more rigid and stable than linear or cyclic peptide loops.
- the conformational flexibility of small peptides in solution is high, and results in large entropic penalties upon binding.
- Incorporation of an integrin-binding sequence into a knottin polypeptide scaffold provides conformational constraints that are required for high affinity integrin binding.
- the scaffold provides a platform to carry out protein engineering studies such as affinity or stability maturation.
- knottin protein refers to a structural family of small proteins, typically 25-40 amino acids, which bind to a range of molecular targets like proteins, sugars and lipids. Their three-dimensional structure is essentially defined by a peculiar arrangement of three to five disulfide bonds. A characteristic knotted topology with one disulfide bridge crossing the macro-cycle limited by the two other intra-chain disulfide bonds, which was found in several different microproteins with the same cystine network, lent its name to this class of biomolecules. Although their secondary structure content is generally low, the knottins share a small triple-stranded antiparallel (3-sheet, which is stabilized by the disulfide bond framework.
- Biochemically well-defined members of the knottin family also called cystine knot proteins, include the trypsin inhibitor EETI-II from Ecballium elaterium seeds, the neuronal N-type Ca2+ channel blocker w-conotoxin from the venom of the predatory cone snail Conus geographus, agouti-related protein (AgRP, See Millhauser et al., “Loops and Links: Structural Insights into the Remarkable Function of the Agouti-Related Protein,” Ann. N.Y. Acad. Sci., Jun. 1, 2003; 994(1): 27-35), the omega agatoxin family, etc.
- trypsin inhibitor EETI-II from Ecballium elaterium seeds
- the neuronal N-type Ca2+ channel blocker w-conotoxin from the venom of the predatory cone snail Conus geographus
- agouti-related protein AgRP, See Millhauser et al.,
- a suitable agatoxin sequence [SEQ ID NO: 41] is given in U.S. Pat. No. 8,536,301, having a common inventor with the present application.
- Other agatoxin sequences suitable for use in the methods disclosed herein include, Omega-agatoxin-Aa4b (GenBank Accession number P37045) and Omega-agatoxin-Aa3b (GenBank Accession number P81744).
- Knottin proteins have a characteristic disulfide linked structure. This structure is also illustrated in Gelly et al., “The KNOTTIN website and database: a new information system dedicated to the knottin scaffold,” Nucleic Acids Research, 2004, Vol. 32, Database issue D156-D159. A triple-stranded (3-sheet is present in many knottins. The spacing between cysteine residues is important, as is the molecular topology and conformation of the integrin-binding loop.
- molecular scaffold means a polymer having a predefined three-dimensional structure, into which an integrin-binding loop is incorporated, such as an RGD peptide sequence as described herein.
- the term “molecular scaffold” has an art-recognized meaning (in other contexts), which is also intended here.
- Skerra “Engineered protein scaffolds for molecular recognition,” J. Mol. Recognit. 2000; 13:167-187 describes the following scaffolds: single domains of antibodies of the immunoglobulin superfamily, protease inhibitors, helix-bundle proteins, disulfide-knotted peptides and lipocalins. Guidance is given for the selection of an appropriate molecular scaffold.
- knottin polypeptide scaffold refers to a knottin protein suitable for use as a molecular scaffold, as described herein. Characteristics of a desirable knottin polypeptide scaffold for engineering include 1) high stability in vitro and in vivo, 2) the ability to replace amino acid regions of the scaffold with other sequences without disrupting the overall fold, 3) the ability to create multifunctional or bispecific targeting by engineering separate regions of the molecule, and 4) a small size to allow for chemical synthesis and incorporation of non-natural amino acids if desired. Scaffolds derived from human proteins are favored for therapeutic applications to reduce toxicity or immunogenicity concerns, but are not always a strict requirement.
- scaffolds that have been used for protein design include fibronectin (Koide et al., 1998), lipocalin (Beste et al., 1999), cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) (Hufton et al., 2000), and tendamistat (McConnell and Hoess, 1995; Li et al., 2003). While these scaffolds have proved to be useful frameworks for protein engineering, molecular scaffolds such as knottins have distinct advantages: their small size and high stability.
- EETI Protein Data Bank Entry 2ETI. Its entry in the Knottin database is EETI-II. It has the sequence:
- AgRP means PDB entry 1HYK. Its entry in the Knottin database is SwissProt AGRP_HUMAN, where the full-length sequence of 129 amino acids may be found. It comprises the sequence beginning at amino acid 87. An additional G is added to this construct. It also includes a C105A mutation described in Jackson, et al. 2002 Biochemistry, 41, 7565.
- loop 4 The bold and underlined portion, from loop 4, is replaced by the RGD sequences described herein. Loops 1 and 3 are shown between brackets below:
- integrin-binding-Fc fusion is used interchangeably with “knottin-Fc” and refers to an integrin-binding polypeptide that includes an integrin-binding amino acid sequence within a knottin polypeptide scaffold and is operably linked to an Fc domain.
- the Fc domain is fused to the N-terminus of the integrin-binding polypeptide.
- the Fc domain is fused to the C-terminus of the integrin binding polypeptide.
- the Fc domain is operably linked to the integrin-binding polypeptide via a linker.
- Fc region refers to the portion of a native immunoglobulin formed by the respective Fc domains (or Fc moieties) of its two heavy chains.
- Fc domain refers to a portion of a single immunoglobulin (Ig) heavy chain wherein the Fc domain does not comprise an Fv domain.
- an Fc domain can also be referred to as “Ig” or “IgG.”
- an Fc domain begins in the hinge region just upstream of the papain cleavage site and ends at the C-terminus of the antibody. Accordingly, a complete Fc domain comprises at least a hinge domain, a CH2 domain, and a CH3 domain.
- an Fc domain comprises at least one of: a hinge (e.g., upper, middle, and/or lower hinge region) domain, a CH2 domain, a CH3 domain, a CH4 domain, or a variant, portion, or fragment thereof.
- an Fc domain comprises a complete Fc domain (i.e., a hinge domain, a CH2 domain, and a CH3 domain).
- an Fc domain comprises a hinge domain (or portion thereof) fused to a CH3 domain (or portion thereof).
- an Fc domain comprises a CH2 domain (or portion thereof) fused to a CH3 domain (or portion thereof).
- an Fc domain consists of a CH3 domain or portion thereof.
- an Fc domain consists of a hinge domain (or portion thereof) and a CH3 domain (or portion thereof). In another embodiment, an Fc domain consists of a CH2 domain (or portion thereof) and a CH3 domain. In another embodiment, an Fc domain consists of a hinge domain (or portion thereof) and a CH2 domain (or portion thereof). In one embodiment, an Fc domain lacks at least a portion of a CH2 domain (e.g., all or part of a CH2 domain).
- An Fc domain herein generally refers to a polypeptide comprising all or part of the Fc domain of an immunoglobulin heavy-chain.
- the Fc domain may be derived from an immunoglobulin of any species and/or any subtype, including, but not limited to, a human IgGl, IgG2, IgG3, IgG4, IgD, IgA, IgE, or IgM antibody.
- a human IgG1 constant region can be found at Uniprot P01857 and in Table 2 (i.e., SEQ ID NO: 1)
- the Fc domain of human IgG1 can be found in Table 2 (i.e., SEQ ID NO: 2).
- the Fc domain of human IgG1 with a deletion of the upper hinge region can be found in Table 2 (i.e., SEQ ID NO: 3).
- the Fc domain encompasses native Fc and Fc variant molecules.
- the term Fc domain includes molecules in monomeric or multimeric (e.g., dimeric) form, whether digested from whole antibody or produced by other means. The assignment of amino acid residue numbers to an Fc domain is in accordance with the definitions of Kabat.
- any Fc domain may be modified such that it varies in amino acid sequence from the native Fc domain of a naturally occurring immunoglobulin molecule.
- the Fc domain has increased effector function (e.g., FcyR binding).
- the Fc domains of a polypeptide of the invention may be derived from different immunoglobulin molecules.
- an Fc domain of a polypeptide may comprise a CH2 and/or CH3 domain derived from an IgG1 molecule and a hinge region derived from an IgG3 molecule.
- an Fc domain can comprise a chimeric hinge region derived, in part, from an IgG1 molecule and, in part, from an IgG3 molecule.
- an Fc domain can comprise a chimeric hinge derived, in part, from an IgG1 molecule and, in part, from an IgG4 molecule.
- a polypeptide or amino acid sequence “derived from” a designated polypeptide or protein refers to the origin of the polypeptide.
- the polypeptide or amino acid sequence which is derived from a particular sequence has an amino acid sequence that is essentially identical to that sequence or a portion thereof, wherein the portion consists of at least 10-20 amino acids, preferably at least 20-30 amino acids, more preferably at least 30-50 amino acids, or which is otherwise identifiable to one of ordinary skill in the art as having its origin in the sequence.
- Polypeptides derived from another peptide may have one or more mutations relative to the starting polypeptide, e.g., one or more amino acid residues which have been substituted with another amino acid residue or which has one or more amino acid residue insertions or deletions.
- a polypeptide can comprise an amino acid sequence which is not naturally occurring.
- Such variants in the context of IL-2 or a knottin protein, necessarily have less than 100% sequence identity or similarity with the starting IL-2 or knottin protein.
- the variant will have an amino acid sequence from about 75% to less than 100% amino acid sequence identity or similarity with the amino acid sequence of the starting polypeptide, more preferably from about 80% to less than 100%, more preferably from about 85% to less than 100%, more preferably from about 90% to less than 100% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) and most preferably from about 95% to less than 100%, e.g., over the length of the variant molecule.
- Identity or similarity with respect to this sequence is defined herein as the percentage of amino acid residues in the candidate sequence that are identical (i.e., same residue) with the starting amino acid residues, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity.
- a polypeptide comprising IL-2 or a variant thereof, for use in extended-PK IL-2 consists of, consists essentially of, or comprises an amino acid sequence selected from SEQ ID Nos: 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, and 35.
- a polypeptide includes an amino acid sequence at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence selected from SEQ ID Nos: 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, and 35.
- a polypeptide includes a contiguous amino acid sequence at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a contiguous amino acid sequence selected from SEQ ID Nos: 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, and 35.
- a polypeptide includes an amino acid sequence having at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 200, 300, 400, or 500 (or any integer within these numbers) contiguous amino acids of an amino acid sequence selected from SEQ ID Nos: 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, and 35.
- the peptides are encoded by a nucleotide sequence.
- Nucleotide sequences can be useful for a number of applications, including: cloning, gene therapy, protein expression and purification, mutation introduction, DNA vaccination of a host in need thereof, antibody generation for, e.g., passive immunization, PCR, primer and probe generation, and the like.
- the nucleotide sequence of the invention comprises, consists of, or consists essentially of, a nucleotide sequence of IL-2, or a variant thereof, selected from SEQ ID Nos: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, and 34.
- a nucleotide sequence includes a nucleotide sequence at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a nucleotide sequence set forth in SEQ ID Nos: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, and 34.
- a nucleotide sequence includes a contiguous nucleotide sequence at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a contiguous nucleotide sequence set forth in SEQ ID Nos: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, and 34.
- a nucleotide sequence includes a nucleotide sequence having at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 200, 300, 400, or 500 (or any integer within these numbers) contiguous nucleotides of a nucleotide sequence set forth in SEQ ID Nos: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, and 34.
- a polypeptide comprising integrin-binding peptide or a variant thereof consists of, consists essentially of, or comprises an amino acid sequence selected from SEQ ID Nos: 67-133.
- a polypeptide includes an amino acid sequence at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence selected from SEQ ID Nos: 67-133.
- a polypeptide includes a contiguous amino acid sequence at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a contiguous amino acid sequence selected from SEQ ID Nos: 67-133.
- a polypeptide includes an amino acid sequence having at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 200, 300, 400, or 500 (or any integer within these numbers) contiguous amino acids of an amino acid sequence selected from SEQ ID Nos: 67-133.
- extended-PK IL-2 or a knottin-Fc fusion used herein may be altered such that they vary in sequence from the naturally occurring or native sequences from which they were derived, while retaining the desirable activity of the native sequences.
- nucleotide or amino acid substitutions leading to conservative substitutions or changes at “non-essential” amino acid residues may be made.
- Mutations may be introduced by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis.
- polypeptides described herein may comprise conservative amino acid substitutions at one or more amino acid residues, e.g., at essential or non-essential amino acid residues.
- a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagines, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- basic side chains e.g.
- a nonessential amino acid residue in a binding polypeptide is preferably replaced with another amino acid residue from the same side chain family
- a string of amino acids can be replaced with a structurally similar string that differs in order and/or composition of side chain family members.
- mutations may be introduced randomly along all or part of a coding sequence, such as by saturation mutagenesis, and the resultant mutants can be incorporated into binding polypeptides of the invention and screened for their ability to bind to the desired target.
- the “Programmed Death-1 (PD-1)” receptor refers to an immuno-inhibitory receptor belonging to the CD28 family PD-1 is expressed predominantly on previously activated T cells in vivo, and binds to two ligands, PD-L1 and PD-L2.
- the term “PD-1” as used herein includes human PD-1 (hPD-1), variants, isoforms, and species homologs of hPD-1, and analogs having at least one common epitope with hPD-1.
- the complete hPD-1 sequence can be found under GenBank Accession No. AAC51773 (SEQ ID NO: 52).
- P-L1 Programmed Death Ligand-1
- PD-L1 is one of two cell surface glycoprotein ligands for PD-1 (the other being PD-L2) that downregulates T cell activation and cytokine secretion upon binding to PD-1.
- the term “PD-L1” as used herein includes human PD-L1 (hPD-L1), variants, isoforms, and species homologs of hPD-L1, and analogs having at least one common epitope with hPD-L1.
- the complete hPD-L1 sequence can be found under GenBank Accession No. Q9NZQ7 (SEQ ID NO: 53).
- CTLA-4 Cytotoxic T Lymphocyte Associated Antigen-4
- hCTLA-4 human CTLA-4
- isoforms and species homologs of hCTLA-4, and analogs having at least one common epitope with hCTLA-4.
- GenBank Accession No. P16410 SEQ ID NO: 54
- LAGS Lymphocyte Activation Gene-3
- hLAG3 human LAGS
- variants variants
- isoforms and species homologs of hLAG3, and analogs having at least one common epitope.
- GenBank Accession No. P18627 SEQ ID NO: 55.
- T Cell Membrane Protein-3 is an inhibitory receptor involved in the inhibition of lymphocyte activity by inhibition of T H 1 cells responses. Its ligand is galectin 9, which is upregulated in various types of cancers.
- TIM3 as used herein includes human TIM3 (hTIM3), variants, isoforms, and species homologs of hTIM3, and analogs having at least one common epitope. The complete hTIM3 sequence can be found under GenBank Accession No. Q8TDQo (SEQ ID NO: 56).
- the “B7 family” refers to inhibitory ligands with undefined receptors.
- the B7 family encompasses B7-H3 and B7-H4, both upregulated on tumor cells and tumor infiltrating cells.
- the complete hB7-H3 and hB7-H4 sequence can be found under GenBank Accession Nos. Q5ZPR3 and AAZ17406 (SEQ ID Nos: 57 and 58) respectively.
- VEGF Vascular Endothelial Growth Factor
- VEGF vascular endothelial cell growth factor
- VEGF-A 165-amino acid human vascular endothelial cell growth factor and related 121-, 145-, 189-, and 206-amino acid human vascular endothelial cell growth factors, as described by, e.g., Leung et al. Science, 246: 1306 (1989), and Houck et al. Mol. Endocrin., 5: 1806 (1991), together with the naturally occurring allelic and processed forms thereof.
- VEGF-A is part of a gene family including VEGF-B, VEGF-C, VEGF-D, VEGF-E, VEGF-F, and P1GF.
- VEGF-A primarily binds to two high affinity receptor tyrosine kinases, VEGFR-1 (Fit-1) and VEGFR-2 (Flk-1/KDR), the latter being the major transmitter of vascular endothelial cell mitogenic signals of VEGF-A.
- immune checkpoint refers to co-stimulatory and inhibitory signals that regulate the amplitude and quality of T cell receptor recognition of an antigen.
- the immune checkpoint is an inhibitory signal.
- the inhibitory signal is the interaction between PD-1 and PD-L1.
- the inhibitory signal is the interaction between CTLA-4 and CD80 or CD86 to displace CD28 binding.
- the inhibitory signal is the interaction between LAG3 and MHC class II molecules.
- the inhibitory signal is the interaction between TIM3 and galectin 9.
- immune checkpoint blocker refers to a molecule that reduces, inhibits, interferes with or modulates one or more checkpoint proteins.
- the immune checkpoint blocker prevents inhibitory signals associated with the immune checkpoint.
- the immune checkpoint blocker is an antibody, or fragment thereof, that disrupts inhibitory signaling associated with the immune checkpoint.
- the immune checkpoint blocker is a small molecule that disrupts inhibitory signaling.
- the immune checkpoint blocker is an antibody, fragment thereof, or antibody mimic, that prevents the interaction between checkpoint blocker proteins, e.g., an antibody, or fragment thereof, that prevents the interaction between PD-1 and PD-L1.
- the immune checkpoint blocker is an antibody, or fragment thereof, that prevents the interaction between CTLA-4 and CD80 or CD86. In certain embodiments, the immune checkpoint blocker is an antibody, or fragment thereof, that prevents the interaction between LAG3 and MHC class II molecules. In certain embodiments the, the immune checkpoint blocker is an antibody, or fragment thereof, that prevents the interaction between TIM3 and galectin9.
- the checkpoint blocker may also be in the form of the soluble form of the molecules (or mutation thereof) themselves, e.g., a soluble PD-L1 or PD-L1 fusion.
- ameliorating refers to any therapeutically beneficial result in the treatment of a disease state, e.g., cancer, including prophylaxis, lessening in the severity or progression, remission, or cure thereof.
- in vivo refers to processes that occur in a living organism.
- mammal or “subject” or “patient” as used herein includes both humans and non-humans and include but is not limited to humans, non-human primates, canines, felines, murines, bovines, equines, and porcines.
- percent identity in the context of two or more nucleic acid or polypeptide sequences, refer to two or more sequences or subsequences that have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned for maximum correspondence, as measured using one of the sequence comparison algorithms described below (e.g., BLASTP and BLASTN or other algorithms available to persons of skill) or by visual inspection.
- sequence comparison algorithms e.g., BLASTP and BLASTN or other algorithms available to persons of skill
- the “percent identity” can exist over a region of the sequence being compared, e.g., over a functional domain, or, alternatively, exist over the full length of the two sequences to be compared.
- sequence comparison typically one sequence acts as a reference sequence to which test sequences are compared.
- test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
- sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
- Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by visual inspection (see generally Ausubel et al., infra).
- BLAST algorithm One example of an algorithm that is suitable for determining percent sequence identity and sequence similarity is the BLAST algorithm, which is described in Altschul et al., J. Mol. Biol. 215:403-410 (1990). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information website.
- gly-ser polypeptide linker refers to a peptide that consists of glycine and serine residues.
- half-life refers to the time taken for the serum or plasma concentration of a polypeptide to reduce by 50%, in vivo, for example due to degradation and/or clearance or sequestration by natural mechanisms.
- the extended-PK IL-2 used herein is stabilized in vivo and its half-life increased by, e.g., fusion to HSA, MSA or Fc, through PEGylation, or by binding to serum albumin molecules (e.g., human serum albumin) which resist degradation and/or clearance or sequestration.
- the half-life can be determined in any manner known per se, such as by pharmacokinetic analysis.
- Suitable techniques will be clear to the person skilled in the art, and may for example generally involve the steps of suitably administering a suitable dose of the amino acid sequence or compound of the invention to a subject; collecting blood samples or other samples from said subject at regular intervals; determining the level or concentration of the amino acid sequence or compound of the invention in said blood sample; and calculating, from (a plot of) the data thus obtained, the time until the level or concentration of the amino acid sequence or compound of the invention has been reduced by 50% compared to the initial level upon dosing. Further details are provided in, e.g., standard handbooks, such as Kenneth, A.
- a “small molecule” is a molecule with a molecular weight below about 500 Daltons.
- therapeutic protein refers to any polypeptide, protein, protein variant, fusion protein and/or fragment thereof which may be administered to a subject as a medicament.
- An exemplary therapeutic protein is an interleukin, e.g., IL-7.
- “synergy” or “synergistic effect” with regard to an effect produced by two or more individual components refers to a phenomenon in which the total effect produced by these components, when utilized in combination, is greater than the sum of the individual effects of each component acting alone.
- sufficient amount means an amount sufficient to produce a desired effect, e.g., an amount sufficient to reduce the size of a tumor.
- therapeutically effective amount is an amount that is effective to ameliorate a symptom of a disease.
- a therapeutically effective amount can be a “prophylactically effective amount” as prophylaxis can be considered therapy.
- Combination therapy embraces administration of each agent or therapy in a sequential manner in a regiment that will provide beneficial effects of the combination and co-administration of these agents or therapies in a substantially simultaneous manner
- Combination therapy also includes combinations where individual elements may be administered at different times and/or by different routes but which act in combination to provide a beneficial effect by co-action or pharmacokinetic and pharmacodynamics effect of each agent or tumor treatment approaches of the combination therapy.
- Interleukin-2 is a cytokine that induces proliferation of antigen-activated T cells and stimulates natural killer (NK) cells.
- the biological activity of IL-2 is mediated through a multi-subunit IL-2 receptor complex (IL-2R) of three polypeptide subunits that span the cell membrane: p55 (IL-2R ⁇ , the alpha subunit, also known as CD25 in humans), p75 (IL-2RP, the beta subunit, also known as CD 122 in humans) and p64 (IL-2Ry, the gamma subunit, also known as CD 132 in humans).
- IL-2R multi-subunit IL-2 receptor complex
- T cell response to IL-2 depends on a variety of factors, including: (1) the concentration of IL-2; (2) the number of IL-2R molecules on the cell surface; and (3) the number of IL-2R occupied by IL-2 (i.e., the affinity of the binding interaction between IL-2 and IL-2R (Smith, “Cell Growth Signal Transduction is Quantal” In Receptor Activation by Antigens, Cytokines, Hormones, and Growth Factors 766:263-271, 1995)).
- the IL-2:IL-2R complex is internalized upon ligand binding and the different components undergo differential sorting.
- IL-2Ra is recycled to the cell surface, while IL-2 associated with the IL-2:IL-2Rp ⁇ complex is routed to the lysosome and degraded.
- IL-2 When administered as an intravenous (i.v.) bolus, IL-2 has a rapid systemic clearance (an initial clearance phase with a half-life of 12.9 minutes followed by a slower clearance phase with a half-life of 85 minutes) (Konrad et al., Cancer Res. 50:2009-2017, 1990).
- IL-2 therapy such as systemic IL-2
- IL-2 therapy is administered to a subject in an effective amount in combination with an integrin-binding-Fc fusion protein, and optionally an immune checkpoint blocker.
- NK cells express the intermediate-affinity receptor, IL-2Rp ⁇ c , and thus are stimulated at nanomolar concentrations of IL-2, which do in fact result in patient sera during high-dose IL-2 therapy.
- extended-pharmacokinetic (PK) IL-2 has a prolonged circulation half-life relative to free IL-2.
- the prolonged circulation half-life of extended-PK IL-2 permits in vivo serum IL-2 concentrations to be maintained within a therapeutic range, leading to the enhanced activation of many types of immune cells, including T cells.
- extended-PK IL-2 can be dosed less frequently and for longer periods of time when compared with unmodified IL-2.
- Extended-PK IL-2 is described in detail in International Patent Application NO. PCT/US2013/042057, filed May 21, 2013, and claiming the benefit of priority to US Provisional Patent Application NO. 61/650,277, filed May 22, 2012. The entire contents of the foregoing applications are incorporated by reference herein.
- an effective amount of human IL-2 is administered systemically. In some embodiments, an effective amount of an extended-PK IL-2 is administered systemically.
- the IL-2 is a human recombinant IL-2 such as Proleukin® (aldesleukin).
- Proleukin® is a human recombinant interleukin-2 product produced in E. coli. Proleukin® differs from the native interleukin-2 in the following ways: a) it is not glycosylated; b) it has no N-terminal alanine; and c) it has serine substituted for cysteine at amino acid positions 125.
- Proleukin® exists as biologicially active, non-covalently bound microaggregates with an average size of 27 recombinant interleukin-2 molecules.
- Proleukin® (aldesleukin) is administered by intravenous infusion.
- the IL-2 portion of the extended-PK IL-2 is wild-type IL-2 (e.g., human IL-2 in its precursor form (SEQ ID NO: 33) or mature IL-2 (SEQ ID NO: 35)).
- the extended-PK IL-2 is mutated such that it has an altered affinity (e.g., a higher affinity) for the IL-2R alpha receptor compared with unmodified IL-2.
- Site-directed mutagenesis can be used to isolate IL-2 mutants that exhibit high affinity binding to CD25, i.e., IL-2R ⁇ , as compared to wild-type IL-2.
- IL-2R ⁇ a site-directed mutagenesis
- Increasing the affinity of IL-2 for IL-2R ⁇ at the cell surface will increase receptor occupancy within a limited range of IL-2 concentration, as well as raise the local concentration of IL-2 at the cell surface.
- the invention features IL-2 mutants, which may be, but are not necessarily, substantially purified and which can function as high affinity CD25 binders.
- IL-2 is a T cell growth factor that induces proliferation of antigen-activated T cells and stimulation of NK cells.
- Exemplary IL-2 mutants which are high affinity binders include those described in WO2013/177187A2 (herein incorporated by reference in its entirety), such as those with amino acid sequences set forth in SEQ ID Nos: 7, 23, 25, 27, 29, and 31.
- Further exemplary IL-2 mutants with increased affinity for CD25 are disclosed in U.S. Pat. No. 7,569,215, the contents of which are incorporated herein by reference.
- the IL-2 mutant does not bind to CD25, e.g., those with amino acid sequences set forth in SEQ ID Nos: 9 and 11.
- IL-2 mutants include an amino acid sequence that is at least 80% identical to SEQ ID NO: 33 that bind CD25.
- an IL-2 mutant can have at least one mutation (e.g., a deletion, addition, or substitution of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more amino acid residues) that increases the affinity for the alpha subunit of the IL-2 receptor relative to wild-type IL-2.
- mouse IL-2 may be made at corresponding residues in full length human IL-2 (nucleic acid sequence (accession: NM000586) of SEQ ID NO: 32; amino acid sequence (accession: P60568) of SEQ ID NO: 33) or human IL-2 without the signal peptide (nucleic acid sequence of SEQ ID NO: 34; amino acid sequence of SEQ ID NO: 35).
- the IL-2 moiety of the extended-PK IL-2 is human IL-2.
- the IL-2 moiety of the extended-PK IL-2 is a mutant human IL-2.
- IL-2 mutants can be at least or about 50%, at least or about 65%, at least or about 70%, at least or about 80%, at least or about 85%, at least or about 87%, at least or about 90%, at least or about 95%, at least or about 97%, at least or about 98%, or at least or about 99% identical in amino acid sequence to wild-type IL-2 (in its precursor form or, preferably, the mature form).
- the mutation can consist of a change in the number or content of amino acid residues.
- the IL-2 mutants can have a greater or a lesser number of amino acid residues than wild-type IL-2.
- IL-2 mutants can contain a substitution of one or more amino acid residues that are present in the wild-type IL-2.
- a polypeptide that includes an amino acid sequence that is at least 95% identical to a reference amino acid sequence of SEQ ID NO: 33 is a polypeptide that includes a sequence that is identical to the reference sequence except for the inclusion of up to five alterations of the reference amino acid of SEQ ID NO: 33.
- up to 5% of the amino acid residues in the reference sequence may be deleted or substituted with another amino acid, or a number of amino acids up to 5% of the total amino acid residues in the reference sequence may be inserted into the reference sequence.
- alterations of the reference sequence may occur at the amino (N-) or carboxy (C-) terminal positions of the reference amino acid sequence or anywhere between those terminal positions, interspersed either individually among residues in the reference sequence or in one or more contiguous groups within the reference sequence.
- the substituted amino acid residue(s) can be, but are not necessarily, conservative substitutions, which typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid; asparagines, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. These mutations can be at amino acid residues that contact IL-2R ⁇ .
- polypeptides used in the practice of the instant invention will be synthetic, or produced by expression of a recombinant nucleic acid molecule.
- polypeptide is an extended-PK IL-2 (e.g., a fusion protein containing at least IL-2 and a heterologous polypeptide, such as a hexa-histidine tag or hemagglutinin tag or an Fc region or human serum albumin), it can be encoded by a hybrid nucleic acid molecule containing one sequence that encodes IL-2 and a second sequence that encodes all or part of the heterologous polypeptide.
- extended-PK IL-2 e.g., a fusion protein containing at least IL-2 and a heterologous polypeptide, such as a hexa-histidine tag or hemagglutinin tag or an Fc region or human serum albumin
- IL-2 mutants are routine in the art, and can be performed without resort to undue experimentation by one of ordinary skill in the art.
- a mutation that consists of a substitution of one or more of the amino acid residues in IL-2 can be created using a PCR-assisted mutagenesis technique (e.g., as known in the art and/or described herein for the creation of IL-2 mutants).
- Mutations that consist of deletions or additions of amino acid residues to an IL-2 polypeptide can also be made with standard recombinant techniques.
- the nucleic acid molecule encoding IL-2 is simply digested with an appropriate restriction endonuclease.
- the resulting fragment can either be expressed directly or manipulated further by, for example, ligating it to a second fragment.
- the ligation may be facilitated if the two ends of the nucleic acid molecules contain complementary nucleotides that overlap one another, but blunt-ended fragments can also be ligated.
- PCR-generated nucleic acids can also be used to generate various mutant sequences.
- IL-2 mutants can be chemically synthesized. Chemically synthesized polypeptides are routinely generated by those of skill in the art.
- IL-2 can also be prepared as fusion or chimeric polypeptides that include IL-2 and a heterologous polypeptide (i.e., a polypeptide that is not IL-2).
- the heterologous polypeptide can increase the circulating half-life of the chimeric polypeptide in vivo, and may, therefore, further enhance the properties of IL-2.
- the polypeptide that increases the circulating half-life may be serum albumin, such as human or mouse serum albumin.
- the chimeric polypeptide can include IL-2 and a polypeptide that functions as an antigenic tag, such as a FLAG sequence.
- FLAG sequences are recognized by biotinylated, highly specific, anti-FLAG antibodies, as described herein (see also Blanar et al., Science 256: 1014, 1992; LeClair et al., Proc. Natl. Acad. Sci. USA 89:8145, 1992).
- the chimeric polypeptide further comprises a C-terminal c-myc epitope tag.
- Chimeric polypeptides can be constructed using no more than conventional molecular biological techniques, which are well within the ability of those of ordinary skill in the art to perform.
- IL-2 either alone or as a part of a chimeric polypeptide, such as those described herein, can be obtained by expression of a nucleic acid molecule.
- nucleic acid molecules encoding polypeptides containing IL-2 or an IL-2 mutant are considered within the scope of the invention, such as those with nucleic acid sequences set forth in SEQ ID Nos: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, and 34.
- IL-2 mutants can be described in terms of their identity with wild-type IL-2, the nucleic acid molecules encoding them will necessarily have a certain identity with those that encode wild-type IL-2.
- the nucleic acid molecule encoding an IL-2 mutant can be at least 50%, at least 65%, preferably at least 75%, more preferably at least 85%, and most preferably at least 95% (e.g., 99%) identical to the nucleic acid encoding full length wild-type IL-2 (e.g., SEQ ID NO: 32 or wild-type IL-2 without the signal peptide (e.g., SEQ ID NO: 34).
- wild-type IL-2 e.g., SEQ ID NO: 32 or wild-type IL-2 without the signal peptide (e.g., SEQ ID NO: 34).
- the nucleic acid molecules of the invention can contain naturally occurring sequences, or sequences that differ from those that occur naturally, but, due to the degeneracy of the genetic code, encode the same polypeptide.
- These nucleic acid molecules can consist of RNA or DNA (for example, genomic DNA, cDNA, or synthetic DNA, such as that produced by phosphoramidite-based synthesis), or combinations or modifications of the nucleotides within these types of nucleic acids.
- the nucleic acid molecules can be double-stranded or single-stranded (i.e., either a sense or an antisense strand).
- the nucleic acid molecules are not limited to sequences that encode polypeptides; some or all of the non-coding sequences that lie upstream or downstream from a coding sequence (e.g., the coding sequence of IL-2) can also be included.
- a coding sequence e.g., the coding sequence of IL-2
- Those of ordinary skill in the art of molecular biology are familiar with routine procedures for isolating nucleic acid molecules. They can, for example, be generated by treatment of genomic DNA with restriction endonucleases, or by performance of the polymerase chain reaction (PCR).
- PCR polymerase chain reaction
- nucleic acid molecule is a ribonucleic acid (RNA) molecules can be produced, for example, by in vitro transcription.
- the isolated nucleic acid molecules can include fragments not found as such in the natural state.
- the invention encompasses use of recombinant molecules, such as those in which a nucleic acid sequence (for example, a sequence encoding an IL-2 mutant) is incorporated into a vector (e.g., a plasmid or viral vector) or into the genome of a heterologous cell (or the genome of a homologous cell, at a position other than the natural chromosomal location).
- IL-2 mutants of the invention may exist as a part of a chimeric polypeptide.
- a nucleic acid molecule of the invention can contain sequences encoding a “marker” or “reporter.”
- marker or reporter genes include ⁇ -lactamase, chloramphenicol acetyltransferase (CAT), adenosine deaminase (ADA), aminoglycoside phosphotransferase (neon, G418k), dihydrofolate reductase (DHFR), hygromycin-B-hosphotransferase (HPH), thymidine kinase (TK), lacz (encoding ⁇ -galactosidase), and xanthine guanine phosphoribosyl transferase (XGPRT).
- CAT chloramphenicol acetyltransferase
- ADA adenosine deaminase
- HPH
- the nucleic acid molecules of the invention can be obtained by introducing a mutation into IL-2-encoding DNA obtained from any biological cell, such as the cell of a mammal.
- the nucleic acids used herein (and the polypeptides they encode) can be those of a mouse, rat, guinea pig, cow, sheep, horse, pig, rabbit, monkey, baboon, dog, or cat.
- the nucleic acid molecules will be those of a human.
- IL-2 or mutant IL-2 is fused to an extended-PK group, which increases circulation half-life.
- extended-PK groups are described infra. It should be understood that other PK groups that increase the circulation half-life of IL-2, or variants thereof, are also applicable to extended-PK IL-2.
- the serum half-life of extended-PK IL-2 is increased relative to IL-2 alone (i.e., IL-2 not fused to an extended-PK group). In certain embodiments, the serum half-life of extended-PK IL-2 is at least 20, 40, 60, 80, 100, 120, 150, 180, 200, 400, 600, 800, or 1000% longer relative to the serum half-life of IL-2 alone.
- the serum half-life of the extended-PK IL-2 is at least 1.5-fold, 2-fold, 2.5-fold, 3-fold, 3.5 fold, 4-fold, 4.5-fold, 5-fold, 6-fold, 7-fold, 8-fold, 10-fold, 12-fold, 13-fold, 15-fold, 17-fold, 20-fold, 22-fold, 25-fold, 27-fold, 30-fold, 35-fold, 40-fold, or 50-fold greater than the serum half-life of IL-2 alone.
- the serum half-life of the extended-PK IL-2 is at least 10 hours, 15 hours, 20 hours, 25 hours, 30 hours, 35 hours, 40 hours, 50 hours, 60 hours, 70 hours, 80 hours, 90 hours, 100 hours, 110 hours, 120 hours, 130 hours, 135 hours, 140 hours, 150 hours, 160 hours, or 200 hours.
- the extended-PK group is a serum albumin, or fragments thereof. Methods of fusing serum albumin to proteins are disclosed in, e.g., US2010/0144599, US2007/0048282, and US2011/0020345, which are herein incorporated by reference in their entirety.
- the extended-PK group is HSA, or variants or fragments thereof, such as those disclosed in U.S. Pat. No. 5,876,969, WO 2011/124718, WO 2013/075066, and WO 2011/0514789.
- the extended-PK group is a serum albumin binding protein such as those described in US2005/0287153, US2007/0003549, US2007/0178082, US2007/0269422, US2010/0113339, W02009/083804, and W02009/133208, which are herein incorporated by reference in their entirety.
- an extended-PK IL-2 used herein includes a polyethylene glycol (PEG) domain.
- PEGylation is well known in the art to confer increased circulation half-life to proteins. Methods of PEGylation are well known and disclosed in, e.g., U.S. Pat. Nos. 7,610,156, 7,847,062, all of which are hereby incorporated by reference.
- PEG is a well-known, water soluble polymer that is commercially available or can be prepared by ring-opening polymerization of ethylene glycol according to methods well known in the art (Sandler and Karo, Polymer Synthesis, Academic Press, New York, Vol. 3, pages 138-161).
- the term “PEG” is used broadly to encompass any polyethylene glycol molecule, without regard to size or to modification at an end of the PEG, and can be represented by the formula: X-0(CH 2 CH 2 0) n-1 CH 2 CH 2 OH, where n is 20 to 2300 and X is H or a terminal modification, e.g., a C 1-4 alkyl.
- the PEG of the invention terminates on one end with hydroxy or methoxy, i.e., X is H or CH 3 (“methoxy PEG”).
- PEG can contain further chemical groups which are necessary for binding reactions; which results from the chemical synthesis of the molecule; or which is a spacer for optimal distance of parts of the molecule.
- such a PEG can consist of one or more PEG side-chains which are linked together.
- PEGs with more than one PEG chain are called multiarmed or branched PEGs.
- Branched PEGs can be prepared, for example, by the addition of polyethylene oxide to various polyols, including glycerol, pentaerythriol, and sorbitol.
- a four-armed branched PEG can be prepared from pentaerythriol and ethylene oxide.
- Branched PEG are described in, for example, EP-A 0 473 084 and U.S. Pat. No. 5,932,462, both of which are hereby incorporated by reference.
- One form of PEGs includes two PEG side-chains (PEG2) linked via the primary amino groups of a lysine (Monfardini et al., Bioconjugate Chem 1995; 6:62-9).
- pegylated IL-2 is produced by site-directed pegylation, particularly by conjugation of PEG to a cysteine moiety at the N- or C-terminus.
- a PEG moiety may also be attached by other chemistry, including by conjugation to amines.
- PEG conjugation to peptides or proteins generally involves the activation of PEG and coupling of the activated PEG-intermediates directly to target proteins/peptides or to a linker, which is subsequently activated and coupled to target proteins/peptides (see Abuchowski et al., JBC 1977; 252:3571 and JBC 1977; 252:3582, and Harris et. al., in: Poly(ethylene glycol) Chemistry: Biotechnical and Biomedical Applications; (J. M. Harris ed.) Plenum Press: New York, 1992; Chap. 21 and 22).
- a variety of molecular mass forms of PEG can be selected, e.g., from about 1,000 Daltons (Da) to 100,000 Da (n is 20 to 2300), for conjugating to IL-2.
- the number of repeating units “n” in the PEG is approximated for the molecular mass described in Daltons. It is preferred that the combined molecular mass of PEG on an activated linker is suitable for pharmaceutical use. Thus, in one embodiment, the molecular mass of the PEG molecules does not exceed 100,000 Da.
- each PEG molecule has the same molecular mass of 12,000 Da (each n is about 270)
- the total molecular mass of PEG on the linker is about 36,000 Da (total n is about 820).
- the molecular masses of the PEG attached to the linker can also be different, e.g., of three molecules on a linker two PEG molecules can be 5,000 Da each (each n is about 110) and one PEG molecule can be 12,000 Da (n is about 270).
- PEG poly(ethylene glycol)
- a suitable molecular mass for PEG e.g., based on how the pegylated IL-2 will be used therapeutically, the desired dosage, circulation time, resistance to proteolysis, immunogenicity, and other considerations.
- PEG molecules may be activated to react with amino groups on IL-2 such as with lysines (Bencham C. O. et al., Anal. Biochem., 131, 25 (1983); Veronese, F. M. et al., Appl. Biochem., 11, 141 (1985); Zalipsky, S. et al., Polymeric Drugs and Drug Delivery Systems, adrs 9-110 ACS Symposium Series 469 (1999); Zalipsky, S. et al., Europ. Polym. J., 19, 1177-1183 (1983); Delgado, C. et al., Biotechnology and Applied Biochemistry, 12, 119-128 (1990)).
- carbonate esters of PEG are used to form the PEG-IL-2 conjugates.
- N,N′-disuccinimidylcarbonate (DSC) may be used in the reaction with PEG to form active mixed PEG-succinimidyl carbonate that may be subsequently reacted with a nucleophilic group of a linker or an amino group of IL-2 (see U.S. Pat. Nos. 5,281,698 and 5,932,462).
- 1,1′-(dibenzotriazolyl)carbonate and di-(2-pyridyl)carbonate may be reacted with PEG to form PEG-benzotriazolyl and PEG-pyridyl mixed carbonate (U.S. Pat. No. 5,382,657), respectively.
- Pegylation of IL-2 can be performed according to the methods of the state of the art, for example by reaction of IL-2 with electrophilically active PEGs (Shearwater Corp., USA, www.shearwatercorp.com).
- PEG reagents are, e.g., N-hydroxysuccinimidyl propionates (PEG-SPA), butanoates (PEG-SBA), PEG-succinimidyl propionate or branched N-hydroxysuccinimides such as mPEG2-NHS (Monfardini, C, et al., Bioconjugate Chem. 6 (1995) 62-69).
- PEG molecules may be coupled to sulfhydryl groups on IL-2 (Sartore, L., et al., Appl. Biochem. Biotechnol., 27, 45 (1991); Morpurgo et al., Biocon. Chem., 7, 363-368 (1996); Goodson et al., Bio/Technology (1990) 8, 343; U.S. Pat. No. 5,766,897).
- U.S. Pat. Nos. 6,610,281 and 5,766,897 describe exemplary reactive PEG species that may be coupled to sulfhydryl groups.
- cysteine residues are native to IL-2 whereas in other embodiments, one or more cysteine residues are engineered into IL-2.
- Mutations may be introduced into the coding sequence of IL-2 to generate cysteine residues. This might be achieved, for example, by mutating one or more amino acid residues to cysteine.
- Preferred amino acids for mutating to a cysteine residue include serine, threonine, alanine and other hydrophilic residues.
- the residue to be mutated to cysteine is a surface-exposed residue. Algorithms are well-known in the art for predicting surface accessibility of residues based on primary sequence or a protein.
- pegylated IL-2 comprise one or more PEG molecules covalently attached to a linker.
- IL-2 is pegylated at the C-terminus.
- a protein is pegylated at the C-terminus by the introduction of C-terminal azido-methionine and the subsequent conjugation of a methyl-PEG-triarylphosphine compound via the Staudinger reaction. This C-terminal conjugation method is described in Cazalis et al., C-Terminal Site-Specific PEGylation of a Truncated Thrombomodulin Mutant with Retention of Full Bioactivity, Bioconjug Chem. 2004; 15(5): 1005-1009.
- WO 94/01451 describes a method for preparing a recombinant polypeptide with a modified terminal amino acid alpha-carbon reactive group. The steps of the method involve forming the recombinant polypeptide and protecting it with one or more biologically added protecting groups at the N-terminal alpha-amine and C-terminal alpha-carboxyl. The polypeptide can then be reacted with chemical protecting agents to selectively protect reactive side chain groups and thereby prevent side chain groups from being modified.
- the polypeptide is then cleaved with a cleavage reagent specific for the biological protecting group to form an unprotected terminal amino acid alpha-carbon reactive group.
- the unprotected terminal amino acid alpha-carbon reactive group is modified with a chemical modifying agent.
- the side chain protected terminally modified single copy polypeptide is then deprotected at the side chain groups to form a terminally modified recombinant single copy polypeptide.
- the number and sequence of steps in the method can be varied to achieve selective modification at the N- and/or C-terminal amino acid of the polypeptide.
- the ratio of IL-2 to activated PEG in the conjugation reaction can be from about 1:0.5 to 1:50, between from about 1: 1 to 1:30, or from about 1:5 to 1: 15.
- Various aqueous buffers can be used to catalyze the covalent addition of PEG to IL-2, or variants thereof.
- the pH of a buffer used is from about 7.0 to 9.0.
- the pH is in a slightly basic range, e.g., from about 7.5 to 8.5. Buffers having a pKa close to neutral pH range may be used, e.g., phosphate buffer.
- PEGylated IL-2 of the invention contains one, two or more PEG moieties.
- the PEG moiety(ies) are bound to an amino acid residue which is on the surface of the protein and/or away from the surface that contacts CD25.
- the combined or total molecular mass of PEG in PEG-IL-2 is from about 3,000 Da to 60,000 Da, optionally from about 10,000 Da to 36,000 Da.
- PEG in pegylated IL-2 is a substantially linear, straight-chain PEG.
- PEGylated IL-2 of the invention will preferably retain at least 25%, 50%, 60%, 70%, 80%, 85%, 90%, 95% or 100% of the biological activity associated with the unmodified protein.
- biological activity refers to the ability to bind CD25.
- the serum clearance rate of PEG-modified IL-2 may be decreased by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or even 90%, relative to the clearance rate of the unmodified IL-2.
- PEG-modified IL-2 may have a circulation half-life which is enhanced relative to the half-life of unmodified IL-2.
- the half-life of PEG-IL-2 may be enhanced by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 175%, 200%, 250%, 300%, 400% or 500%, or even by 1000% relative to the half-life of unmodified IL-2.
- the protein half-life is determined in vitro, such as in a buffered saline solution or in serum.
- the protein half-life is an in vivo circulation half-life, such as the half-life of the protein in the serum or other bodily fluid of an animal
- the extended-PK group is transferrin, as disclosed in U.S. Pat. Nos. 7,176,278 and 8,158,579, which are herein incorporated by reference in their entirety.
- the extended-PK group is a serum immunoglobulin binding protein such as those disclosed in US2007/0178082, which is herein incorporated by reference in its entirety.
- the extended-PK group is a fibronectin (Fn)-based scaffold domain protein that binds to serum albumin, such as those disclosed in US2012/0094909, which is herein incorporated by reference in its entirety. Methods of making fibronectin-based scaffold domain proteins are also disclosed in US2012/0094909.
- Fn3-based extended-PK group is Fn3(HSA), i.e., a Fn3 protein that binds to human serum albumin.
- an extended-PK IL-2 includes an Fc domain, as described in WO2013177187.
- the Fc domain does not contain a variable region that binds to antigen.
- Fc domains useful for producing the extended-PK IL-2 described herein may be obtained from a number of different sources.
- an Fc domain of the extended-PK IL-2 is derived from a human immunoglobulin.
- the Fc domain is from a human IgG1 constant region (SEQ ID NO: 1).
- the Fc domain of human IgG1 is set forth in SEQ ID NO: 2.
- the Fc domain of human IgG1 does not have the upper hinge region (SEQ ID NO: 3).
- the Fc domain may be derived from an immunoglobulin of another mammalian species, including for example, a rodent (e.g. a mouse, rat, rabbit, guinea pig) or non-human primate (e.g. chimpanzee, macaque) species.
- a rodent e.g. a mouse, rat, rabbit, guinea pig
- non-human primate e.g. chimpanzee, macaque
- the Fc domain or portion thereof may be derived from any immunoglobulin class, including IgM, IgG, IgD, IgA, and IgE, and any immunoglobulin isotype, including IgG1, IgG2, IgG3, and IgG4.
- an extended-PK IL-2 includes a mutant Fc domain. In some aspects, an extended-PK IL-2 includes a mutant, IgGl Fc domain. In some aspects, a mutant Fc domain comprises one or more mutations in the hinge, CH2, and/or CH3 domains. In some aspects, a mutant Fc domain includes a D265A mutation.
- the extended-PK IL-2 of the invention lacks one or more constant region domains of a complete Fc region, i.e., they are partially or entirely deleted. In certain embodiments, the extended-PK IL-2 of the invention will lack an entire CH2 domain. In certain embodiments, the extended-PK IL-2 of the invention comprise CH2 domain-deleted Fc regions derived from a vector (e.g., from IDEC Pharmaceuticals, San Diego) encoding an IgG1 human constant region domain (see, e.g., WO02/060955A2 and WO02/096948A2). This exemplary vector is engineered to delete the CH2 domain and provide a synthetic vector expressing a domain-deleted IgG1 constant region. It will be noted that these exemplary constructs are preferably engineered to fuse a binding CH3 domain directly to a hinge region of the respective Fc domain.
- a vector e.g., from IDEC Pharmaceuticals, San Diego
- IgG1 human constant region domain see, e
- Integrins are a family of extracellular matrix adhesion receptors that regulate a diverse array of cellular functions crucial to the initiation, progression and metastasis of solid tumors. The importance of integrins in tumor progression has made them an appealing target for cancer therapy and allows for the treatment of a variety of cancer types.
- the integrins present on cancerous cells include ⁇ v ⁇ 3 , ⁇ v ⁇ 5 , and ⁇ 5 ⁇ 1 .
- Knottin proteins are small compact peptides that have high thermal and proteolytic stability and are tolerant to mutagenesis, making them good molecular scaffolds. These peptides contain at least 3 disulfide bonds that form a “knot” core. They also contain several loops exposed to the surface, allowing these loops to bind targets. These loops can be engineered to bind specific targets with high affinity, making them a useful tool for therapy.
- the present invention involves the use of a knottin polypeptide scaffold engineered with an RGD sequence capable of binding integrins, fused to an Fc donor, which confers a therapeutic benefit (also referred to as “knottin-Fc”).
- Fc fragments have been added to proteins and/or therapeutics to extend half-life.
- the effector function of Fc contributes to the treatment of a variety of cancers when used in conjunction with systemic IL-2, such as extended-PK IL-2.
- a knottin-Fc that binds two integrins simultaneously is used (2.5D, SEQ ID NO: 93 or 95).
- a knottin-Fc that binds three integrins simultaneously, reflected in Table 1, is used (2.5F, SEQ ID NO: 94 or 96).
- Knottin polypeptide scaffolds are used to insert an integrin-binding sequence, preferably in the form of a loop, to confer specific integrin binding.
- Integrin-binding is preferably engineered into a knottin polypeptide scaffold by inserting an integrin-binding peptide sequence, such as an RGD peptide.
- insertion of an integrin-binding peptide sequence results in replacement of portion of the native knottin protein.
- an RGD peptide sequence is inserted into a native solvent exposed loop by replacing all or a portion of the loop with an RGD-containing peptide sequence (e.g., 5-12 amino acid sequence) that has been selected for binding to one or more integrins.
- the solvent-exposed loop (i.e., on the surface) will generally be anchored by disulfide-linked cysteine residues in the native knottin protein sequence.
- the integrin-binding replacement amino acid sequence can be obtained by randomizing codons in the loop portion, expressing the engineered peptide, and selecting the mutants with the highest binding to the predetermined ligand. This selection step may be repeated several times, taking the tightest binding proteins from the previous step and re-randomizing the loops.
- Integrin-binding polypeptides may be modified in a number of ways.
- the polypeptide may be further cross-linked internally, or may be cross-linked to each other, or the RGD loops may be grafted onto other cross linked molecular scaffolds.
- crosslinking reagents for preparing protein or peptide bioconjugates. Many of these crosslinkers allow dimeric homo- or heteroconjugation of biological molecules through free amine or sulfhydryl groups in protein side chains. More recently, other crosslinking methods involving coupling through carbohydrate groups with hydrazide moieties have been developed. These reagents have offered convenient, facile, crosslinking strategies for researchers with little or no chemistry experience in preparing bioconjugates.
- the EETI-II knottin protein (SEQ ID NO: 39) contains a disulfide knotted topology and possesses multiple solvent-exposed loops that are amenable to mutagenesis. Preferred embodiments use EETI-II as the molecular scaffold.
- knottin protein which can be used as a molecular scaffold is AgRP or agatoxin.
- the amino acid sequences of AgRP (SEQ ID NO: 40) and agatoxin (SEQ ID NO: 41) differ but their structure is identical.
- Exemplary AgRP knottins are found in Table 1.
- AgRP engineered knottins can be made as described in the above-referenced US 2009/0257952 to Cochran et al. (the contents of which are incorporated herein by reference).
- AgRP knottin fusions can be prepared using AgRP loops 1, 2 and 3, as well as loop 4 as exemplified above.
- the present polypeptides may be produced by recombinant DNA or may be synthesized in solid phase using a peptide synthesizer, which has been done for the peptides of all three scaffolds described herein. They may further be capped at their N-termini by reaction with fluorescein isothiocyanate (FITC) or other labels, and, still further, may be synthesized with amino acid residues selected for additional crosslinking reactions.
- FITC fluorescein isothiocyanate
- TentaGel S RAM Fmoc resin may be used to give a C-terminal amide upon cleavage.
- B-alanine is used as the N-terminal amino acid to prevent thiazolidone formation and release of fluorescein during peptide deprotection (Hermanson, 1996). Peptides are cleaved from the resin and side-chains are deprotected with 8% trifluoroacetic acid, 2% triisopropylsilane, 5% dithiothreitol, and the final product is recovered by ether precipitation.
- Peptides are purified by reverse phase HPLC using an acetonitrile gradient in 0.1% trifluoroacetic acid and a C4 or C18 column (Vydac) and verified using matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF) or electrospray ionization-mass spectrometry (ESI-MS).
- MALDI-TOF matrix-assisted laser desorption/ionization time-of-flight mass spectrometry
- ESI-MS electrospray ionization-mass spectrometry
- expression vectors encoding the selected peptide are transformed into a suitable host.
- the host should be selected to ensure proper peptide folding and disulfide bond formation as described above.
- Certain peptides, such as EETI-II can fold properly when expressed in prokaryotic hosts such as bacteria.
- Dimeric, trimeric, and tetrameric complexes of the present peptides can be formed through genetic engineering of the above sequences or by reaction of the synthetic cross-linkers with engineered peptides carrying an introduced cysteine residue, for example on the C-terminus of the peptide.
- These oligomeric peptide complexes can be purified by gel filtration.
- Oligomers of the present peptides can be prepared by preparing vectors encoding multiple peptide sequences end-to-end. Also, multimers may be prepared by complexing the peptides, such as, e.g., described in U.S. Pat. No. 6,265,539.
- an active HIV peptide is prepared in multimer form by altering the amino-terminal residue of the peptide so that it is peptide-bonded to a spacer peptide that contains an amino-terminal lysyl residue and one to about five amino acid residues such as glycyl residues to form a composite polypeptide.
- each peptide is synthesized to contain a cysteine (Cys) residue at each of its amino- and carboxy-termini.
- the resulting di-cysteine-terminated (di-Cys) peptide is then oxidized to polymerize the di-Cys peptide monomers into a polymer or cyclic peptide multimer.
- Multimers may also be prepared by solid phase peptide synthesis utilizing a lysine core matrix.
- the present peptides may also be prepared as nanoparticles. See, “Multivalent Effects of RGD Peptides Obtained by Nanoparticle Display,” Montet, et al., J. Med. Chem.; 2006; 49(20) pp 6087-6093.
- EETI dimerization may be carried out with the present EETI-II peptides according to the EETI-II dimerization paper: “Grafting of thrombopoietin-mimetic peptides into cystine knot miniproteins yields high-affinity thrombopoietin antagonist and agonists,” Krause, et al., FEBS Journal; 2006; 274 pp 86-95. This is further described in PCT application No. PCT/US2013/065610, herein incorporated by reference.
- the integrin-binding polypeptides for use in Fc fusions include an integrin-binding loop (e.g., RGD peptide sequence) and a knottin polypeptide scaffold.
- integrin-binding loop e.g., RGD peptide sequence
- knottin polypeptide scaffold e.g., RGD peptide sequence
- integrin-binding polypeptides are described in U.S. Pat. No. 8,536,301, the contents of which are incorporated herein by reference.
- integrin-binding polypeptides may be varied in the non-RGD residues to a certain degree without affecting binding specificity and potency. For example, if three of the eleven residues were varied, one would have about 70% identity to 2.5D.
- Table 1 shows exemplary integrin-binding polypeptides within the scope of the invention, and their specific knottin polypeptide scaffold (e.g., EETI-II or AgRP).
- Preferred integrin-binding polypeptides for use in Fc fusions are peptides 2.5D and 2.5F.
- the integrin-binding polypeptide binds to ⁇ v ⁇ 3 , ⁇ v ⁇ 5 , or ⁇ 5 ⁇ 1 separately.
- the integrin-binding polypeptide binds to ⁇ v ⁇ 3 and ⁇ v ⁇ 5 simultaneously.
- the integrin-binding polypeptide binds to ⁇ v ⁇ 3 , ⁇ v ⁇ 5 , and ⁇ 5 ⁇ 1 simultaneously.
- the integrin-binding loop is within an engineered EETI-II scaffold.
- the lysine in position 15 of the EETI-II scaffold is replaced with a serine.
- the integrin-binding polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 42 or 43, wherein Xi is selected from the group consisting of A, V, L, P, F, Y, S, H, D, and N; X 1 is selected from the group consisting of G, V, L, P, R, E, and Q; X 3 is selected from the group consisting of G, A, and P; X 7 is selected from the group consisting of W and N; X 8 is selected from the group consisting of A, P, and S; X 9 is selected from the group consisting of P and R; X 10 is selected from the group consisting of A, V, L, P, S, T, and E; and X 11 is selected from the group consisting of G,
- the integrin-binding-Fc fusion comprises an integrin-binding polypeptide, as set forth in SEQ ID Nos: 42 or 43, operably linked to a human IgG Fc domain, as set forth in SEQ ID Nos: 2 or 3.
- the integrin-binding loop is within an engineered AgRP or agatoxin scaffold.
- the integrin-binding polypeptide is 2.5D and 2.5F, disclosed in Table 1. Any of the integrin-binding polypeptides in Table 1 can be used in Fc fusion as described herein.
- the present polypeptides target ⁇ v ⁇ 3 , ⁇ v ⁇ 5 , and in some cases ⁇ 5 ⁇ 1 integrin receptors. They do not bind to other integrins tested, such as ⁇ iib ⁇ 3 , where there was little to no affinity.
- these engineered integrin-binding polypeptides have broad diagnostic and therapeutic applications in a variety of human cancers that specifically overexpress the above named integrins. As described below, these polypeptides bind with high affinity to both detergent-solubilized and tumor cell surface integrin receptors.
- the ⁇ v ⁇ 3 (and ⁇ v ⁇ 5 ) integrins are also highly expressed on many tumor cells including osteosarcomas, neuroblastomas, carcinomas of the lung, breast, prostate, and bladder, glioblastomas, and invasive melanomas
- the ⁇ v ⁇ 3 integrin has been shown to be expressed on tumor cells and/or the vasculature of breast, ovarian, prostate, and colon carcinomas, but not on normal adult tissues or blood vessels.
- the ⁇ 5 ⁇ 1 integrin has been shown to be expressed on tumor cells and/or the vasculature of breast, ovarian, prostate, and colon carcinomas, but not on normal adult tissue or blood vessels.
- EETI-II has three disulfide linkages. This will make it more stable in vivo.
- These peptides target ⁇ v integrins alone, or both ⁇ v and ⁇ 5 ⁇ 3 integrins.
- a broad spectrum targeting agent i.e., ⁇ v ⁇ 3 , ⁇ v ⁇ 5 , and ⁇ 5 ⁇ 1 .
- the present engineered knottin-Fc fusions have several advantages over previously identified integrin-targeting compounds. They possess a compact, disulfide-bonded core that confers proteolytic resistance and exceptional in vivo stability.
- knottin-Fc proteins are small enough to allow for chemical synthesis and site-specific conjugation of imaging probes, radioisotopes, or chemotherapeutic agents. Furthermore, they can easily be chemically modified to further improve in vivo properties if necessary.
- knottin-Fc fusions described herein and in U.S. Patent Application No. 2014/0073518, herein incorporated by reference in its entirety, combine an engineered integrin-binding polypeptide (within a knottin scaffold) and an Fc domain or antibody like construct capable of binding Fc ⁇ R and inducing ADCC.
- the Fc portion of an antibody is formed by the two carboxy terminal domains of the two heavy chains that make up an immunoglobin molecule.
- the IgG molecule contains 2 heavy chains ( ⁇ 50 kDa each) and 2 light chains ( ⁇ 25 kDa each).
- the general structure of all antibodies is very similar, a small region at the tip of the protein is extremely variable, allowing millions of antibodies with slightly different tip structures to exist. This region is known as the hypervariable region (Fab).
- the other fragment contains no antigen-binding activity but was originally observed to crystallize readily, and for this reason was named the Fc fragment, for Fragment crystallizable. This fragment corresponds to the paired CH 2 and CH 3 domains and is the part of the antibody molecule that interacts with effector molecules and cells.
- the functional differences between heavy-chain isotypes lie mainly in the Fc fragment.
- the hinge region that links the Fc and Fab portions of the antibody molecule is in reality a flexible tether, allowing independent movement of the two Fab arms, rather than a rigid hinge. This has been demonstrated by electron microscopy of antibodies bound to haptens.
- the present fusion proteins can be made to contain two knottin peptides, one on each arm of the antibody fragment.
- the Fc portion varies between antibody classes (and subclasses) but is identical within that class.
- the C-terminal end of the heavy chain forms the Fc region.
- the Fc region plays an important role as a receptor binding portion.
- the Fc portion of antibodies will bind to Fc receptors in two different ways. For example, after IgG and IgM bind to a pathogen by their Fab portion their Fc portions can bind to receptors on phagocytic cells (like macrophages) inducing phagocytosis.
- the present knottin-Fc fusions can be implemented such that the Fc portion is used to provide dual binding capability, and/or for half-life extension, for improving expression levels, etc.
- the Fc fragment in the knottin-Fc can be, for example, from murine IgG2a or human IgG1.
- Linkers can be optionally used to connect the knottin to the Fc portion. Preferably, the linkers do not affect the binding affinity of the knottin-Fc to integrins or Fc receptors.
- a variety of Fc domain gene sequences e.g., mouse and human constant region gene sequences are available in the form of publicly accessible deposits.
- Fc domain gene sequences e.g., mouse and human constant region gene sequences
- Constant region domains comprising an Fc domain sequence can be selected lacking a particular effector function and/or with a particular modification to reduce immunogenicity.
- Many sequences of antibodies and antibody-encoding genes have been published and suitable Fc domain sequences (e.g., hinge, CH2, and/or CH3 sequences, or portions thereof) can be derived from these sequences using art recognized techniques.
- the genetic material obtained using any of the foregoing methods may then be altered or synthesized to obtain polypeptides used herein. It will further be appreciated that alleles, variants and mutations of constant region DNA sequences are suitable for use in the methods disclosed herein.
- Knottin-Fc suitable for use in the methods disclosed herein may comprise one or more Fc domains (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, or more Fc domains).
- the Fc domains may be of different types.
- at least one Fc domain present in a knottin-Fc comprises a hinge domain or portion thereof.
- a knottin-Fc comprises at least one Fc domain which comprises at least one CH2 domain or portion thereof.
- a knottin-Fc comprises at least one Fc domain which comprises at least one CH3 domain or portion thereof.
- a knottin-Fc comprises at least one Fc domain which comprises at least one CH4 domain or portion thereof.
- a knottin-Fc comprises at least one Fc domain which comprises at least one hinge domain or portion thereof and at least one CH2 domain or portion thereof (e.g, in the hinge-CH2 orientation). In another embodiment, a knottin-Fc comprises at least one Fc domain which comprises at least one CH2 domain or portion thereof and at least one CH3 domain or portion thereof (e.g, in the CH2-CH3 orientation). In another embodiment, a knottin-Fc comprises at least one Fc domain comprising at least one hinge domain or portion thereof, at least one CH2 domain or portion thereof, and least one CH3 domain or portion thereof, for example in the orientation hinge-CH2-CH3, hinge-CH3-CH2, or CH2-CH3-hinge.
- a knottin-Fc comprises at least one complete Fc region derived from one or more immunoglobulin heavy chains (e.g., an Fc domain including hinge, CH2, and CH3 domains, although these need not be derived from the same antibody). In other embodiments a knottin-Fc comprises at least two complete Fc domains derived from one or more immunoglobulin heavy chains. In certain embodiments, the complete Fc domain is derived from a human IgG immunoglobulin heavy chain (e.g., human IgG1).
- a knottin-Fc comprises at least one Fc domain comprising a complete CH3 domain. In another embodiment, a knottin-Fc comprises at least one Fc domain comprising a complete CH2 domain. In another embodiment, a knottin-Fc comprises at least one Fc domain comprising at least a CH3 domain, and at least one of a hinge region, and a CH2 domain. In one embodiment, a knottin-Fc comprises at least one Fc domain comprising a hinge and a CH3 domain. In another embodiment, a knottin-Fc comprises at least one Fc domain comprising a hinge, a CH2, and a CH3 domain.
- the Fc domain is derived from a human IgG immunoglobulin heavy chain (e.g., human IgG1).
- a human IgG1 Fc domain is used with a hinge region mutation, substitution, or deletion to remove or substitute one or more hinge retion cysteine residues.
- the constant region domains or portions thereof making up an Fc domain of a knottin-Fc may be derived from different immunoglobulin molecules.
- a polypeptide used in the invention may comprise a CH2 domain or portion thereof derived from an IgG1 molecule and a CH3 region or portion thereof derived from an IgG3 molecule.
- a knottin-Fc can comprise an Fc domain comprising a hinge domain derived, in part, from an IgG1 molecule and, in part, from an IgG3 molecule.
- an Fc domain may be altered such that it varies in amino acid sequence from a naturally occurring antibody molecule.
- a peptide spacer may be placed between a hinge region and a CH2 domain and/or between a CH2 and a CH3 domain.
- compatible constructs could be expressed wherein the CH2 domain has been deleted and the remaining CH3 domain (synthetic or unsynthetic) is joined to the hinge region with a 1-20, 1-10, or 1-5 amino acid peptide spacer.
- Such a peptide spacer may be added, for instance, to ensure that the regulatory elements of the constant region domain remain free and accessible or that the hinge region remains flexible.
- any linker peptide compatible with the instant invention will be relatively non-immunogenic and not prevent proper folding of the Fc.
- an Fc domain is altered or modified, e.g., by amino acid mutation (e.g., addition, deletion, or substitution).
- the term “Fc domain variant” refers to an Fc domain having at least one amino acid modification, such as an amino acid substitution, as compared to the wild-type Fc from which the Fc domain is derived.
- a variant comprises at least one amino acid mutation (e.g., substitution) as compared to a wild type amino acid at the corresponding position of the human IgG1 Fc region.
- the hinge region of human IgG1 Fc domain is altered by an amino acid substitution or deletion to mutate or remove one or more of three hinge region cysteine residues (located at residues 220, 226, and 229 by EU numbering).
- the upper hinge region is deleted to remove a cysteine that pairs with the light chain.
- amino acids “EPKSC” in the upper hinge region are deleted, as set forth in SEQ ID NO: 3.
- one or more of three hinge region cysteines is mutated (e.g., to serine).
- cysteine 220 is mutated to serine.
- the Fc variant comprises a substitution at an amino acid position located in a hinge domain or portion thereof. In another embodiment, the Fc variant comprises a substitution at an amino acid position located in a CH2 domain or portion thereof. In another embodiment, the Fc variant comprises a substitution at an amino acid position located in a CH3 domain or portion thereof. In another embodiment, the Fc variant comprises a substitution at an amino acid position located in a CH4 domain or portion thereof.
- a knottin-Fc fusion comprises an Fc variant comprising more than one amino acid substitution.
- the knottin-Fc fusion used in the methods described herein may comprise, for example, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acid substitutions.
- the amino acid substitutions are spatially positioned from each other by an interval of at least 1 amino acid position or more, for example, at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid positions or more. More preferably, the engineered amino acids are spatially positioned apart from each other by an interval of at least 5, 10, 15, 20, or 25 amino acid positions or more.
- a knottin-Fc fusion comprises an amino acid substitution to an Fc domain which alters the antigen-independent effector functions of the polypeptide, in particular the circulating half-life of the polypeptide.
- the knottin-Fc exhibits enhanced binding to an activating FcyR (e.g. Fc ⁇ l, Fc ⁇ la, or Fc ⁇ RIIIa).
- an activating FcyR e.g. Fc ⁇ l, Fc ⁇ la, or Fc ⁇ RIIIa.
- Exemplary amino acid substitutions which altered FcR or complement binding activity are disclosed in International PCT Publication No. WO 2005/063815 which is incorporated by reference herein.
- the Fc region contains at least one of the following mutations: S239D, S239E, L261A, H268D, S298A, A330H, A330L, I332D, I332E, I332Q, K334V, A378F, A378K, A378W, A378Y, H435S, or H435G.
- the Fc region contains at least one of the following mutations: S239D, S239E, I332D or I332E or H268D. In certain embodiments, the Fc region contains at least one of the following mutations: I332D or I332E or H268D.
- the knottin-Fc used herein may also comprise an amino acid substitution which alters the glycosylation of the knottin-Fc.
- the Fc domain of the knottin-Fc may comprise an Fc domain having a mutation leading to reduced glycosylation (e.g., N- or O-linked glycosylation) or may comprise an altered glycoform of the wild-type Fc domain (e.g., a low fucose or fucose-free glycan).
- the knottin-Fc has an amino acid substitution near or within a glycosylation motif, for example, an N-linked glycosylation motif that contains the amino acid sequence NXT or NXS.
- the knottin-Fc used herein comprises at least one Fc domain having engineered cysteine residue or analog thereof which is located at the solvent-exposed surface.
- the knottin-Fc used herein comprises an Fc domain comprising at least one engineered free cysteine residue or analog thereof that is substantially free of disulfide bonding with a second cysteine residue. Any of the above engineered cysteine residues or analogs thereof may subsequently be conjugated to a functional domain using art-recognized techniques (e.g., conjugated with a thiol-reactive heterobifunctional linker).
- the knottin-Fc used herein may comprise a genetically fused Fc domain having two or more of its constituent Fc domains independently selected from the Fc domains described herein. In one embodiment, the Fc domains are the same. In another embodiment, at least two of the Fc domains are different.
- the Fc domains of the knottin-Fc used herein comprise the same number of amino acid residues or they may differ in length by one or more amino acid residues (e.g., by about 5 amino acid residues (e.g., 1, 2, 3, 4, or 5 amino acid residues), about 10 residues, about 15 residues, about 20 residues, about 30 residues, about 40 residues, or about 50 residues).
- the Fc domains of the knottin-Fc used herein may differ in sequence at one or more amino acid positions.
- at least two of the Fc domains may differ at about 5 amino acid positions (e.g., 1, 2, 3, 4, or 5 amino acid positions), about 10 positions, about 15 positions, about 20 positions, about 30 positions, about 40 positions, or about 50 positions).
- immune checkpoint blockers are used in combination with other therapeutic agents described herein (e.g., extended-PK IL-2 and integrin-binding-Fc fusion protein). T cell activation and effector functions are balanced by co-stimulatory and inhibitory signals, referred to as “immune checkpoints.” Inhibitory ligands and receptors that regulate T cell effector functions are overexpressed on tumor cells. Subsequently, agonists of co-stimulatory receptors or antagonists of inhibitory signals, result in the amplification of antigen-specific T cell responses. In contrast to therapeutic antibodies which target tumor cells directly, immune checkpoint blockers enhance endogenous anti-tumor activity.
- other therapeutic agents described herein e.g., extended-PK IL-2 and integrin-binding-Fc fusion protein.
- the immune checkpoint blocker suitable for use in the methods disclosed herein is an antagonist of inhibitory signals, e.g., an antibody which targets, for example, PD-1, PD-L1, CTLA-4, LAGS, B7-H3, B7-H4, and TIM3.
- inhibitory signals e.g., an antibody which targets, for example, PD-1, PD-L1, CTLA-4, LAGS, B7-H3, B7-H4, and TIM3.
- the methods for treating a subject afflicted with diseases such as cancer which methods comprise administering to the subject a composition comprising a therapeutically effective amount of a molecule which blocks the immune checkpoint, an integrin-binding-Fc fusion protein, and IL-2 (e.g., extended-PK IL-2).
- the immune checkpoint blocker is an antibody or an antigen-binding portion thereof, that disrupts or inhibits signaling from an inhibitory immunoregulator. In certain embodiments, the immune checkpoint blocker is a small molecule that disrupts or inhibits signaling from an inhibitory immunoregulator.
- the inhibitory immunoregulator is a component of the PD-1/PD-L1 signaling pathway. Accordingly, certain embodiments provide methods for immunotherapy of a subject afflicted with cancer, which methods comprise administering to the subject a therapeutically effective amount of an antibody or an antigen-binding portion thereof that disrupts the interaction between the PD-1 receptor and its ligand, PD-L1. Antibodies known in the art which bind to PD-1 and disrupt the interaction between the PD-1 and its ligand, PD-L1, and stimulates an anti-tumor immune response, are suitable for use in the methods disclosed herein. In certain embodiments, the antibody or antigen-binding portion thereof binds specifically to PD-1.
- antibodies that target PD-1 include, e.g., nivolumab (BMS-936558, Bristol-Myers Squibb) and pembrolizumab (lambrolizumab, MK03475, Merck).
- BMS-936558 Bristol-Myers Squibb
- pembrolizumab lambrolizumab, MK03475, Merck
- Other suitable antibodies for use in the methods disclosed herein are anti-PD-1 antibodies disclosed in U.S. Pat. No. 8,008,449, herein incorporated by reference.
- the antibody or antigen-binding portion thereof binds specifically to PD-L1 and inhibits its interaction with PD-1, thereby increasing immune activity.
- Antibodies known in the art which bind to PD-L1 and disrupt the interaction between the PD-1 and PD-L1, and stimulates an anti-tumor immune response are suitable for use in the methods disclosed herein.
- antibodies that target PD-L1 and are in clinical trials include BMS-936559 (Bristol-Myers Squibb) and MPDL3280A (Genetech).
- BMS-936559 Bristol-Myers Squibb
- MPDL3280A Genetech
- Other suitable antibodies that target PD-L1 are disclosed in U.S. Pat. No. 7,943,743, herein incorporated by reference. It will be understood by one of ordinary skill that any antibody which binds to PD-1 or PD-L1, disrupts the PD-1/PD-L1 interaction, and stimulates an anti-tumor immune response, are suitable for use in the methods disclosed herein.
- the inhibitory immunoregulator is a component of the CTLA-4 signaling pathway. Accordingly, certain embodiments provide methods for immunotherapy of a subject afflicted with cancer, which methods comprise administering to the subject a therapeutically effective amount of an antibody or an antigen-binding portion thereof that targets CTLA-4 and disrupts its interaction with CD80 and CD86.
- Exemplary antibodies that target CTLA-4 include ipilimumab (MDX-010, MDX-101, Bristol-Myers Squibb), which is FDA approved, and tremelimumab (ticilimumab, CP-675, 206, Pfizer), currently undergoing human trials.
- Other suitable antibodies that target CTLA-4 are disclosed in WO 2012/120125, U.S. Pat.
- the inhibitory immunoregulator is a component of the LAG3 (lymphocyte activation gene 3) signaling pathway. Accordingly, certain embodiments provide methods for immunotherapy of a subject afflicted with cancer, which methods comprise administering to the subject a therapeutically effective amount of an antibody or an antigen-binding portion thereof that targets LAG3 and disrupts its interaction with MHC class II molecules.
- An exemplary antibody that targets LAG3 is IMP321 (Immutep), currently undergoing human trials.
- Other suitable antibodies that target LAG3 are disclosed in U.S. Patent Application 2011/0150892, herein incorporated by reference. It will be understood by one of ordinary skill that any antibody which binds to LAG3, disrupts its interaction with MHC class II molecules, and stimulates an anti-tumor immune response, are suitable for use in the methods disclosed herein.
- the inhibitory immunoregulator is a component of the B7 family signaling pathway.
- the B7 family members are B7-H3 and B7-H4. Accordingly, certain embodiments provide methods for immunotherapy of a subject afflicted with cancer, which methods comprise administering to the subject a therapeutically effective amount of an antibody or an antigen-binding portion thereof that targets B7-H3 or -H4.
- the B7 family does not have any defined receptors but these ligands are upregulated on tumor cells or tumor-infiltrating cells. Preclinical mouse models have shown that blockade of these ligands can enhance anti-tumor immunity.
- An exemplary antibody that targets B7-H3 is MGA271 (Macrogenics), currently undergoing human trials.
- MGA271 Macrogenics
- Other suitable antibodies that target B7 family members are disclosed in U.S. Patent Application 2013/0149236, herein incorporated by reference. It will be understood by one of ordinary skill that any antibody which binds to B7-H3 or H4, and stimulates an anti-tumor immune response, are suitable for use in the methods disclosed herein.
- the inhibitory immunoregulator is a component of the TIM3 (T cell membrane protein 3) signaling pathway. Accordingly, certain embodiments provide methods for immunotherapy of a subject afflicted with cancer, which methods comprise administering to the subject a therapeutically effective amount of an antibody or an antigen-binding portion thereof that targets TIM3 and disrupts its interaction with galectin 9. Suitable antibodies that target TIM3 are disclosed in U.S. Patent Application 2013/0022623, herein incorporated by reference. It will be understood by one of ordinary skill that any antibody which binds to TIM3, disrupts its interaction with galectin 9, and stimulates an anti-tumor immune response, are suitable for use in the methods disclosed herein.
- antibodies targeting immune checkpoints suitable for use in the methods disclosed herein are not limited to those described supra.
- other immune checkpoint targets can also be targeted by antagonists or antibodies in the methods described herein, provided that the targeting results in the stimulation of an anti-tumor immune response as reflected in, e.g., an increase in T cell proliferation, enhanced T cell activation, and/or increased cytokine production (e.g., IFN- ⁇ , IL-2).
- an antagonist of vascular endothelial growth factor is used in place of an immune checkpoint blocker.
- VEGF has recently been demonstrated to play a role in immune suppression (Liang, W.-C. et al. J. Biol. Chem. (2006) Vol 281: 951-961; Voron, T. et al. Front Oncol (2014) Vol. 4: Article 70; Terme, M. et al., Clin Dev Immunol (2012) Vol. 2012: Article ID 492920; Kandalaft, E. et al., Curr Top Microbiol Immunol (2011) Vol 344: 129-48), therefore blocking its activity would enhance the immune response, similar to that of an immune checkpoint blocker.
- VEGF antagonist refers to a molecule capable of neutralizing, blocking, inhibiting, abrogating, reducing or interfering with VEGF activities including its binding to one or more VEGF receptors.
- VEGF antagonists include anti-VEGF antibodies and antigen-binding fragments thereof, receptor molecules and derivatives which bind specifically to VEGF thereby sequestering its binding to one or more receptors (e.g., a VEGF receptor), anti-VEGF receptor antibodies, VEGF receptor antagonists such as small molecule inhibitors of the VEGFR tyrosine kinases, or a dominant negative VEGF.
- the VEGF antagonist is an antibody.
- An “anti-VEGF antibody” is an antibody that binds to VEGF with sufficient affinity and specificity.
- Non-limiting examples of anti-VEGF antibodies are described in U.S. Pat. Nos. 6,884,879, 7,060,269, 6,582,959, 6,703,030, 6,054,297, US Patent Application Nos. 2006009360, 20050186208, 20030206899, 20030190317, 20030203409, 20050112126, and PCT Publication Nos. WO 98/45332, 96/30046, 94/10202, 05/044853, 13/181452. The contents of these patents and patent applications are herein incorporated by reference.
- the VEGF antibody is bevacizumab (Avastin® Genentech/Roche) or ranibizumab (Lucentis® Genentech/Roche).
- the VEGF antagonist binds to the VEGF receptor.
- VEGF receptors, or fragments thereof, that specifically bind to VEGF can be used to bind to and sequester the VEGF protein, thereby preventing it from activating downstream signaling.
- the VEGF receptor, or VEGF binding fragment thereof is a soluble VEGF receptor, such as sFlt-1. The soluble form of the receptor exerts an inhibitory effect on the biological activity of VEGF by binding to VEGF, thereby preventing it from binding to its natural receptors present on the surface of target cells.
- VEGF antagonists which bind the VEGF receptor are disclosed in PCT Application Nos.
- the VEGF antagonist is a polypeptide with a bifunctional single-chain antagonistic human VEGF variant comprising a modified VEGF wherein the modified VEGF comprises a loop with an integrin-recognition RGD sequence, as described in U.S. Pat. Nos. 8,741,839, herein incorporated by reference.
- the extended-PK group is optionally fused to IL-2 via a linker.
- an integrin-binding polypeptide is fused to an Fc fragment via a linker.
- Suitable linkers are well known in the art, such as those disclosed in, e.g., US2010/0210511 US2010/0179094, and US2012/0094909, which are herein incorporated by reference in its entirety.
- Exemplary linkers include gly-ser polypeptide linkers, glycine-proline polypeptide linkers, and proline-alanine polypeptide linkers.
- the linker is a gly-ser polypeptide linker, i.e., a peptide that consists of glycine and serine residues.
- the integrin-binding-Fc fusion protein suitable for use in the methods disclosed herein, can be used in conjunction with one or more therapeutic agents.
- the therapeutic agent is a therapeutic antibody.
- the therapeutic agent is a therapeutic protein.
- the therapeutic agent is a small molecule.
- the therapeutic agent is an antigen.
- the therapeutic agent is a population of cells.
- engineered molecules that comprise two or more of IL-2, and an antibody (e.g., a therapeutic antibody, an immune checkpoint blocker, or an antibody that antagonizes VEGF) or antibody fragment described herein.
- an antibody e.g., a therapeutic antibody, an immune checkpoint blocker, or an antibody that antagonizes VEGF
- Such engineered molecules can effectively reduce the number of components to be administered to a subject (e.g., a cancer patient) in the methods described herein.
- the antibody or antibody fragment serves as the scaffold for conjugation with other components (e.g., IL-2).
- the engineered molecule comprises IL-2 and an antibody or antibody fragment.
- the antibody for use in the engineered protein is a bispecific antibody, wherein one component is a therapeutic antibody and the other component is an antibody that binds to an immune checkpoint blocker or an antibody that antagonizes VEGF activity.
- Methods for generating bispecific antibodies are known in the art.
- the engineered molecule comprises IL-2 and a bispecific antibody which binds to a therapeutic target and an immune checkpoint blocker or an antibody that antagonizes VEGF.
- the IL-2 component for use in the engineered protein is an IL-2 lacking a pharmacokinetic moiety (i.e., a non-extended-PK IL-2).
- the IL-2 comprises a pharmacokinetic moiety (an extended-PK IL-2).
- the components of the engineered molecule are conjugated to the antibody or bispecific antibody with or without a linker.
- Suitable linkers for conjugation are described herein and extensively described in the art.
- Regions to which polypeptide-based components (e.g., IL-2) of the engineered molecule can be fused, with or without a linker, to the antibody are generally known in the art, and include, for example, the C-terminus of the antibody heavy chain, and the C-terminus of the antibody light chain.
- components of the engineered molecule do not interfere with the function of the other components.
- the engineered protein comprises a therapeutic antibody and IL-2
- the IL-2 will be fused to the therapeutic antibody in a manner such that the antibody retains its antigen-binding function, and IL-2 retains the ability to interact with its receptor.
- the methods described herein, e.g., in the Examples, can be used to determine whether components of the engineered protein retain their respective functions.
- the polypeptides described herein are made in transformed host cells using recombinant DNA techniques.
- a recombinant DNA molecule coding for the peptide is prepared. Methods of preparing such DNA molecules are well known in the art. For instance, sequences coding for the peptides could be excised from DNA using suitable restriction enzymes. Alternatively, the DNA molecule could be synthesized using chemical synthesis techniques, such as the phosphoramidate method. Also, a combination of these techniques could be used.
- the methods of making polypeptides also include a vector capable of expressing the peptides in an appropriate host.
- the vector comprises the DNA molecule that codes for the peptides operatively linked to appropriate expression control sequences. Methods of affecting this operative linking, either before or after the DNA molecule is inserted into the vector, are well known.
- Expression control sequences include promoters, activators, enhancers, operators, ribosomal nuclease domains, start signals, stop signals, cap signals, polyadenylation signals, and other signals involved with the control of transcription or translation.
- the resulting vector having the DNA molecule thereon is used to transform an appropriate host. This transformation may be performed using methods well known in the art.
- Any of a large number of available and well-known host cells may be used in the practice of this invention.
- the selection of a particular host is dependent upon a number of factors recognized by the art. These include, for example, compatibility with the chosen expression vector, toxicity of the peptides encoded by the DNA molecule, rate of transformation, ease of recovery of the peptides, expression characteristics, bio-safety and costs. A balance of these factors must be struck with the understanding that not all hosts may be equally effective for the expression of a particular DNA sequence.
- useful microbial hosts include bacteria (such as E. coli sp.), yeast (such as Saccharomyces sp.) and other fungi, insects, plants, mammalian (including human) cells in culture, or other hosts known in the art.
- Host cells may be cultured under conventional fermentation conditions so that the desired compounds are expressed. Such fermentation conditions are well known in the art.
- the peptides are purified from culture by methods well known in the art.
- the compounds may also be made by synthetic methods.
- solid phase synthesis techniques may be used. Suitable techniques are well known in the art, and include those described in Merrifield (1973), Chem. Polypeptides, pp. 335-61 (Katsoyannis and Panayotis eds.); Merrifield (1963), J. Am. Chem. Soc. 85: 2149; Davis et al. (1985), Biochem. Intl. 10: 394-414; Stewart and Young (1969), Solid Phase Peptide Synthesis; U.S. Pat. No. 3,941,763; Finn et al. (1976), The Proteins (3 rd ed.) 2: 105-253; and Erickson et al.
- Solid phase synthesis is the preferred technique of making individual peptides since it is the most cost-effective method of making small peptides.
- Compounds that contain derivatized peptides or which contain non-peptide groups may be synthesized by well-known organic chemistry techniques.
- nucleic acid molecules described above can be contained within a vector that is capable of directing their expression in, for example, a cell that has been transduced with the vector. Accordingly, in addition to extended-PK IL-2 and knottin-Fc mutants, expression vectors containing a nucleic acid molecule encoding an extended-PK IL-2 or knottin-Fc mutant and cells transfected with these vectors are among the certain embodiments.
- Vectors suitable for use include T7-based vectors for use in bacteria (see, for example, Rosenberg et al., Gene 56: 125, 1987), the pMSXND expression vector for use in mammalian cells (Lee and Nathans, J. Biol. Chem. 263:3521, 1988), and baculovirus-derived vectors (for example the expression vector pBacPAKS from Clontech, Palo Alto, Calif.) for use in insect cells.
- the nucleic acid inserts, which encode the polypeptide of interest in such vectors can be operably linked to a promoter, which is selected based on, for example, the cell type in which expression is sought.
- a T7 promoter can be used in bacteria
- a polyhedrin promoter can be used in insect cells
- a cytomegalovirus or metallothionein promoter can be used in mammalian cells.
- tissue-specific and cell type-specific promoters are widely available. These promoters are so named for their ability to direct expression of a nucleic acid molecule in a given tissue or cell type within the body. Skilled artisans are well aware of numerous promoters and other regulatory elements which can be used to direct expression of nucleic acids.
- vectors can contain origins of replication, and other genes that encode a selectable marker.
- neomycin-resistance (neo r ) gene imparts G418 resistance to cells in which it is expressed, and thus permits phenotypic selection of the transfected cells.
- Viral vectors that can be used in the invention include, for example, retroviral, adenoviral, and adeno-associated vectors, herpes virus, simian virus 40 (SV40), and bovine papilloma virus vectors (see, for example, Gluzman (Ed.), Eukaryotic Viral Vectors, CSH Laboratory Press, Cold Spring Harbor, N.Y.).
- Prokaryotic or eukaryotic cells that contain and express a nucleic acid molecule that encodes an extended-PK IL-2 or knottin-Fc mutant are also features of the invention.
- a cell of the invention is a transfected cell, i.e., a cell into which a nucleic acid molecule, for example a nucleic acid molecule encoding an extended-PK IL-2 mutant or knottin-Fc, has been introduced by means of recombinant DNA techniques. The progeny of such a cell are also considered within the scope of the invention.
- an extended-PK IL-2 or knottin-Fc mutant can be produced in a prokaryotic host, such as the bacterium E. coli, or in a eukaryotic host, such as an insect cell (e.g., an Sf21 cell), or mammalian cells (e.g., COS cells, NIH 3T3 cells, or HeLa cells). These cells are available from many sources, including the American Type Culture Collection (Manassas, Va.). In selecting an expression system, it matters only that the components are compatible with one another. Artisans or ordinary skill are able to make such a determination.
- the expressed polypeptides can be purified from the expression system using routine biochemical procedures, and can be used, e.g., as therapeutic agents, as described herein.
- IL-2 is administered together (simultaneously or sequentially) with a knottin-Fc. In certain embodiments, IL-2 is administered prior to the administration of a knottin-Fc. In certain embodiments, IL-2 is administered concurrently with the administration of a knottin-Fc. In certain embodiments, IL-2 is administered subsequent to the administration of a knottin-Fc. In certain embodiments, the IL-2 and a knottin-Fc are administered simultaneously. In other embodiments, the IL-2 and a knottin-Fc are administered sequentially. In yet other embodiments, the IL-2 and a knottin-Fc are administered within one, two, or three days of each other.
- IL-2 and knottin-Fc are administered with an immune checkpoint blocker.
- the immune checkpoint blocker is an anti-PD-1 antibody.
- the immune checkpoint blocker is an anti-CTLA-4 antibody.
- an antagonist of VEGF is used in place of an immune checkpoint blocker.
- compositions of the invention can be administered in combination therapy, i.e., combined with other agents.
- Agents include, but are not limited to, in vitro synthetically prepared chemical compositions, antibodies, antigen binding regions, and combinations and conjugates thereof.
- an agent can act as an agonist, antagonist, allosteric modulator, or toxin.
- the invention provides for separate pharmaceutical compositions comprising extended-PK IL-2 with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant, and another pharmaceutical composition comprising a knottin-Fc with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant.
- the invention further provides for a separate pharmaceutical composition comprising an immune checkpoint blocker (or an antagonist of VEGF) with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant.
- the pharmaceutical compositions comprise both extended-PK IL-2 and knottin-Fc with a pharmaceutically acceptable diluents, carrier, solubilizer, emulsifier, preservative and/or adjuvant.
- the pharmaceutical composition comprises extended-PK IL-2, knottin-Fc, and an immune checkpoint blocker (or an antagonist of VEGF) with a pharmaceutically acceptable diluents, carrier, solubilizer, emulsifier, preservative and/or adjuvant.
- the invention provides for pharmaceutical compositions comprising extended-PK IL-2, together with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant, and another pharmaceutical composition comprises a knottin-Fc, together with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant.
- the invention provides for pharmaceutical compositions comprising an immune checkpoint blocker, together with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant.
- each of the agents can be formulated as separate compositions.
- acceptable formulation materials preferably are nontoxic to recipients at the dosages and concentrations employed.
- the formulation material(s) are for s.c. and/or I.V. administration.
- the pharmaceutical composition can contain formulation materials for modifying, maintaining or preserving, for example, the pH, osmolality, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption or penetration of the composition.
- suitable formulation materials include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine or lysine); antimicrobials; antioxidants (such as ascorbic acid, sodium sulfite or sodium hydrogen-sulfite); buffers (such as borate, bicarbonate, Tris-HCl, citrates, phosphates or other organic acids); bulking agents (such as mannitol or glycine); chelating agents (such as ethylenediamine tetraacetic acid (EDTA)); complexing agents (such as caffeine, polyvinylpyrrolidone, beta-cyclodextrin or hydroxypropyl-beta-cyclodextrin); fillers; monosaccharides; disaccharides; and other carbohydrates (such as glucose, mannose or dextrins); proteins (such as serum albumin, gelatin or immunoglobulins); coloring, flavoring and diluting agents; emulsifying agents;
- amino acids
- the formulation comprises PBS; 20 mM NaOAC, pH 5.2, 50 mM NaCl; and/or 10 mM NAOAC, pH 5.2, 9% Sucrose.
- the optimal pharmaceutical composition will be determined by one skilled in the art depending upon, for example, the intended route of administration, delivery format and desired dosage. See, for example, Remington's Pharmaceutical Sciences, supra.
- compositions may influence the physical state, stability, rate of in vivo release and rate of in vivo clearance of extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF).
- the primary vehicle or carrier in a pharmaceutical composition can be either aqueous or non-aqueous in nature.
- a suitable vehicle or carrier can be water for injection, physiological saline solution or artificial cerebrospinal fluid, possibly supplemented with other materials common in compositions for parenteral administration.
- the saline comprises isotonic phosphate-buffered saline.
- neutral buffered saline or saline mixed with serum albumin are further exemplary vehicles.
- pharmaceutical compositions comprise Tris buffer of about pH 7.0-8.5, or acetate buffer of about pH 4.0-5.5, which can further include sorbitol or a suitable substitute therefore.
- a composition comprising extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF) can be prepared for storage by mixing the selected composition having the desired degree of purity with optional formulation agents (Remington's Pharmaceutical Sciences, supra) in the form of a lyophilized cake or an aqueous solution.
- a composition comprising extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF) can be formulated as a lyophilizate using appropriate excipients such as sucrose.
- the pharmaceutical composition can be selected for parenteral delivery. In certain embodiments, the compositions can be selected for inhalation or for delivery through the digestive tract, such as orally.
- the preparation of such pharmaceutically acceptable compositions is within the ability of one skilled in the art.
- the formulation components are present in concentrations that are acceptable to the site of administration.
- buffers are used to maintain the composition at physiological pH or at a slightly lower pH, typically within a pH range of from about 5 to about 8.
- a therapeutic composition when parenteral administration is contemplated, can be in the form of a pyrogen-free, parenterally acceptable aqueous solution comprising a desired extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), in a pharmaceutically acceptable vehicle.
- a vehicle for parenteral injection is sterile distilled water in which extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), are formulated as a sterile, isotonic solution, properly preserved.
- the preparation can involve the formulation of the desired molecule with an agent, such as injectable microspheres, bio-erodible particles, polymeric compounds (such as polylactic acid or polyglycolic acid), beads or liposomes, that can provide for the controlled or sustained release of the product which can then be delivered via a depot injection.
- an agent such as injectable microspheres, bio-erodible particles, polymeric compounds (such as polylactic acid or polyglycolic acid), beads or liposomes, that can provide for the controlled or sustained release of the product which can then be delivered via a depot injection.
- hyaluronic acid can also be used, and can have the effect of promoting sustained duration in the circulation.
- implantable drug delivery devices can be used to introduce the desired molecule.
- a pharmaceutical composition can be formulated for inhalation.
- extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF) can be formulated as a dry powder for inhalation.
- an inhalation solution comprising extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), can be formulated with a propellant for aerosol delivery.
- solutions can be nebulized. Pulmonary administration is further described in PCT application No. PCT/US94/001875, which describes pulmonary delivery of chemically modified proteins.
- formulations can be administered orally.
- extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), that is administered in this fashion can be formulated with or without those carriers customarily used in the compounding of solid dosage forms such as tablets and capsules.
- a capsule can be designed to release the active portion of the formulation at the point in the gastrointestinal tract when bioavailability is maximized and pre-systemic degradation is minimized
- at least one additional agent can be included to facilitate absorption of extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF).
- diluents, flavorings, low melting point waxes, vegetable oils, lubricants, suspending agents, tablet disintegrating agents, and binders can also be employed.
- a pharmaceutical composition can involve an effective quantity of extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), in a mixture with non-toxic excipients which are suitable for the manufacture of tablets.
- an immune checkpoint blocker or an antagonist of VEGF
- solutions can be prepared in unit-dose form.
- suitable excipients include, but are not limited to, inert diluents, such as calcium carbonate, sodium carbonate or bicarbonate, lactose, or calcium phosphate; or binding agents, such as starch, gelatin, or acacia; or lubricating agents such as magnesium stearate, stearic acid, or talc.
- inert diluents such as calcium carbonate, sodium carbonate or bicarbonate, lactose, or calcium phosphate
- binding agents such as starch, gelatin, or acacia
- lubricating agents such as magnesium stearate, stearic acid, or talc.
- compositions will be evident to those skilled in the art, including formulations involving extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), in sustained- or controlled-delivery formulations.
- techniques for formulating a variety of other sustained- or controlled-delivery means such as liposome carriers, bio-erodible microparticles or porous beads and depot injections, are also known to those skilled in the art. See for example, PCT Application No. PCT/US93/00829 which describes the controlled release of porous polymeric microparticles for the delivery of pharmaceutical compositions.
- sustained-release preparations can include semipermeable polymer matrices in the form of shaped articles, e.g. films, or microcapsules.
- Sustained release matrices can include polyesters, hydrogels, polylactides (U.S. Pat. No. 3,773,919 and EP 058,481), copolymers of L-glutamic acid and gamma ethyl-L-glutamate (Sidman et al., Biopolymers, 22:547-556 (1983)), poly (2-hydroxyethyl-methacrylate) (Langer et al., J. Biomed. Mater. Res., 15: 167-277 (1981) and Langer, Chem.
- sustained release compositions can also include liposomes, which can be prepared by any of several methods known in the art. See, e.g., Eppstein et al, Proc. Natl. Acad. Sci. USA, 82:3688-3692 (1985); EP 036,676; EP 088,046 and EP 143,949.
- the pharmaceutical composition to be used for in vivo administration typically is sterile. In certain embodiments, this can be accomplished by filtration through sterile filtration membranes. In certain embodiments, where the composition is lyophilized, sterilization using this method can be conducted either prior to or following lyophilization and reconstitution. In certain embodiments, the composition for parenteral administration can be stored in lyophilized form or in a solution. In certain embodiments, parenteral compositions generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
- the pharmaceutical composition once the pharmaceutical composition has been formulated, it can be stored in sterile vials as a solution, suspension, gel, emulsion, solid, or as a dehydrated or lyophilized powder. In certain embodiments, such formulations can be stored either in a ready-to-use form or in a form (e.g., lyophilized) that is reconstituted prior to administration.
- kits are provided for producing a single-dose administration unit.
- the kit can contain both a first container having a dried protein and a second container having an aqueous formulation.
- kits containing single and multi-chambered pre-filled syringes e.g., liquid syringes and lyosyringes are included.
- the effective amount of a pharmaceutical composition comprising extended-PK IL-2 and/or one or more pharmaceutical compositions comprising a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), to be employed therapeutically will depend, for example, upon the therapeutic context and objectives.
- the appropriate dosage levels for treatment will thus vary depending, in part, upon the molecule delivered, the indication for which extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), are being used, the route of administration, and the size (body weight, body surface or organ size) and/or condition (the age and general health) of the patient.
- a typical dosage of extended-PK IL-2 and a knottin-Fc can each range from about 0.1 pg/kg to up to about 100 mg/kg or more, depending on the factors mentioned above. In certain embodiments, the dosage can range from 0.1 pg/kg up to about 100 mg/kg; or 1 pg/kg up to about 100 mg/kg; or 5 pg/kg up to about 100 mg/kg.
- a typical dosage for an immune checkpoint blocker can range from about 0.1 mg/kg to up to about 300 mg/kg or more, depending on the factors mentioned above. In certain embodiments, the dosage can range from 1 mg/kg up to about 300 mg/kg; or 5 mg/kg up to about 300 mg/kg; or 10 mg/kg up to about 300 mg/kg.
- the frequency of dosing will take into account the pharmacokinetic parameters of extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), in the formulation used.
- a clinician will administer the composition until a dosage is reached that achieves the desired effect.
- the composition can therefore be administered as a single dose, or as two or more doses (which may or may not contain the same amount of the desired molecule) over time, or as a continuous infusion via an implantation device or catheter. Further refinement of the appropriate dosage is routinely made by those of ordinary skill in the art and is within the ambit of tasks routinely performed by them.
- appropriate dosages can be ascertained through use of appropriate dose-response data. As described in the Examples below, dosing can occur daily, every other day, or weekly, all with similar anti-tumor responses.
- the route of administration of the pharmaceutical composition is in accord with known methods, e.g. orally, through injection by intravenous, intraperitoneal, intracerebral (intra-parenchymal), intracerebroventricular, intramuscular, subcutaneously, intra-ocular, intraarterial, intraportal, or intralesional routes; by sustained release systems or by implantation devices.
- the compositions can be administered by bolus injection or continuously by infusion, or by implantation device.
- individual elements of the combination therapy may be administered by different routes.
- the composition can be administered locally via implantation of a membrane, sponge or another appropriate material onto which the desired molecule has been absorbed or encapsulated.
- the device can be implanted into any suitable tissue or organ, and delivery of the desired molecule can be via diffusion, timed-release bolus, or continuous administration.
- a pharmaceutical composition comprising extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), in an ex vivo manner
- a pharmaceutical composition comprising extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF)
- VEGF an antagonist of VEGF
- extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF) can be delivered by implanting certain cells that have been genetically engineered, using methods such as those described herein, to express and secrete the polypeptides.
- such cells can be animal or human cells, and can be autologous, heterologous, or xenogeneic.
- the cells can be immortalized.
- the cells in order to decrease the chance of an immunological response, the cells can be encapsulated to avoid infiltration of surrounding tissues.
- the encapsulation materials are typically biocompatible, semi-permeable polymeric enclosures or membranes that allow the release of the protein product(s) but prevent the destruction of the cells by the patient's immune system or by other detrimental factors from the surrounding tissues.
- the extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), and/or nucleic acids expressing them, described herein, are useful for treating a disorder associated with abnormal apoptosis or a differentiative process (e.g., cellular proliferative disorders or cellular differentiative disorders, such as cancer).
- a disorder associated with abnormal apoptosis or a differentiative process e.g., cellular proliferative disorders or cellular differentiative disorders, such as cancer.
- Examples of cellular proliferative and/or differentiative disorders include cancer (e.g., carcinoma, sarcoma, metastatic disorders or hematopoietic neoplastic disorders, e.g., leukemias).
- a metastatic tumor can arise from a multitude of primary tumor types, including but not limited to those of prostate, colon, lung, breast and liver.
- the compositions used herein comprising, e.g., extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), can be administered to a patient who has cancer.
- cancer or “cancerous”
- hyperproliferative or “hyperproliferative”
- neoplastic refers to cells having the capacity for autonomous growth (i.e., an abnormal state or condition characterized by rapidly proliferating cell growth).
- hyperproliferative and neoplastic disease states may be categorized as pathologic (i.e., characterizing or constituting a disease state), or they may be categorized as non-pathologic (i.e., as a deviation from normal but not associated with a disease state). The terms are meant to include all types of cancerous growths or oncogenic processes, metastatic tissues or malignantly transformed cells, tissues, or organs, irrespective of histopathologic type or stage of invasiveness.
- “Pathologic hyperproliferative” cells occur in disease states characterized by malignant tumor growth. Examples of non-pathologic hyperproliferative cells include proliferation of cells associated with wound repair.
- cancer or “neoplasm” are used to refer to malignancies of the various organ systems, including those affecting the lung, breast, thyroid, lymph glands and lymphoid tissue, gastrointestinal organs, and the genitourinary tract, as well as to adenocarcinomas which are generally considered to include malignancies such as most colon cancers, renal-cell carcinoma, prostate cancer and/or testicular tumors, non-small cell carcinoma of the lung, cancer of the small intestine and cancer of the esophagus.
- carcinoma is art recognized and refers to malignancies of epithelial or endocrine tissues including respiratory system carcinomas, gastrointestinal system carcinomas, genitourinary system carcinomas, testicular carcinomas, breast carcinomas, prostatic carcinomas, endocrine system carcinomas, and melanomas.
- the mutant IL-2 polypeptides can be used to treat patients who have, who are suspected of having, or who may be at high risk for developing any type of cancer, including renal carcinoma or melanoma, or any viral disease.
- Exemplary carcinomas include those forming from tissue of the cervix, lung, prostate, breast, head and neck, colon and ovary.
- carcinosarcomas which include malignant tumors composed of carcinomatous and sarcomatous tissues.
- An “adenocarcinoma” refers to a carcinoma derived from glandular tissue or in which the tumor cells form recognizable glandular structures.
- proliferative disorders include hematopoietic neoplastic disorders.
- hematopoietic neoplastic disorders includes diseases involving hyperplastic/neoplastic cells of hematopoietic origin, e.g., arising from myeloid, lymphoid or erythroid lineages, or precursor cells thereof.
- the diseases arise from poorly differentiated acute leukemias (e.g., erythroblastic leukemia and acute megakaryoblastic leukemia).
- myeloid disorders include, but are not limited to, acute promyeloid leukemia (APML), acute myelogenous leukemia (AML) and chronic myelogenous leukemia (CML) (reviewed in Vaickus, L. (1991) Crit. Rev. in Oncol./Hemotol. 11:267-97); lymphoid malignancies include, but are not limited to acute lymphoblastic leukemia (ALL) which includes B-lineage ALL and T-lineage ALL, chronic lymphocytic leukemia (CLL), prolymphocytic leukemia (PLL), hairy cell leukemia (HLL) and Waldenstrom's macro globulinemia (WM).
- ALL acute lymphoblastic leukemia
- CLL chronic lymphocytic leukemia
- PLL prolymphocytic leukemia
- HLL hairy cell leukemia
- malignant lymphomas include, but are not limited to non-Hodgkin lymphoma and variants thereof, peripheral T cell lymphomas, adult T cell leukemia/lymphoma (ATL), cutaneous T cell lymphoma (CTCL), large granular lymphocytic leukemia (LGF), Hodgkin's disease and Reed-Sternberg disease.
- amounts for each of the extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), that are sufficient to reduce tumor growth and size, or a therapeutically effective amount will vary not only on the particular compounds or compositions selected, but also with the route of administration, the nature of the condition being treated, and the age and condition of the patient, and will ultimately be at the discretion of the patient's physician or pharmacist.
- the length of time during which the compounds used in the instant method will be given varies on an individual basis.
- the B16 melanoma model used herein is a generalized model for solid tumors. That is, efficacy of treatments in this model is also predictive of efficacy of the treatments in other non-melanoma solid tumors.
- efficacy of cps a parasite strain that induces an adaptive immune resposnse, in mediating anti-tumor immunity against B16F10 tumors was found to be generalizable to other solid tumors, including models of lung carcinoma and ovarian cancer.
- results from a line of research into VEGF targeting lymphocytes also shows that results in B16F10 tumors were generalizable to the other tumor types studied (Chinnasamy et al., JCI 2010; 120:3953-68; Chinnasamy et al., Clin Cancer Res 2012; 18:1672-83).
- immunotherapy involving LAG-3 and PD-1 led to reduced tumor burden, with generalizable results in a fibrosarcoma and colon adenocarcinoma cell lines (Woo et al., Cancer Res 2012;72:917-27).
- the extended-PK IL-2, knottin-Fc, and optional immune checkpoint blocker are used to treat cancer.
- the extended-PK IL-2, knottin-Fc, and optional immune checkpoint blocker are used to treat melanoma, leukemia, lung cancer, breast cancer, prostate cancer, ovarian cancer, colon cancer, renal carcinoma, and brain cancer.
- the extended-PK IL-2, knottin-Fc and optional immune checkpoint blocker inhibit growth and/or proliferation of tumor cells.
- the extended-PK IL-2, knottin-Fc, and optional immune checkpoint blocker reduce tumor size.
- the extended-PK IL-2, knottin-Fc, and optional immune checkpoint blocker inhibit metastases of a primary tumor.
- knottin-Fc and an immune checkpoint blocker (or an antagonist of VEGF), with or without IL-2, inhibit growth and/or proliferation of tumor cells. In certain embodiments, knottin-Fc and an immune checkpoint blocker (or an antagonist of VEGF), with or without IL-2, reduce tumor size. In certain embodiments, knottin-Fc and an immune checkpoint blocker, with or without IL-2, inhibit metastases of a primary tumor.
- kits can include extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), as disclosed herein, and instructions for use.
- the kits may comprise, in a suitable container, extended-PK IL-2, an integrin binding knottin-Fc, an optional immune checkpoint blocker (or an antagonist of VEGF), one or more controls, and various buffers, reagents, enzymes and other standard ingredients well known in the art.
- Certain embodiments include a kit with extended-PK IL-2, knottin-Fc, and optional immune checkpoint blocker (or an antagonist of VEGF) in the same vial.
- a kit includes extended-PK IL-2, knottin-Fc, and optional immune checkpoint blocker (or an antagonist of VEGF) in separate vials.
- the container can include at least one vial, well, test tube, flask, bottle, syringe, or other container means, into which extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF) may be placed, and in some instances, suitably aliquoted.
- the kit can contain additional containers into which this component may be placed.
- the kits can also include a means for containing extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF) and any other reagent containers in close confinement for commercial sale.
- Such containers may include injection or blow-molded plastic containers into which the desired vials are retained.
- Containers and/or kits can include labeling with instructions for use and/or warnings.
- extended-PK IL-2 of mouse origin i.e., both the extended-PK group (mouse serum albumin) and IL-2 are of mouse origin
- mouse Fc fused to an integrin-binding knottin i.e., mouse Fc fused to an integrin-binding knottin
- corresponding human extended-PK IL-2 i.e., human serum albumin (HSA) and human IL-2, and variants thereof
- integrin-binding-human-Fc i.e., Fc from human IgG1 fused to knottin
- knottin-Fc protein comprises two parts: 1) an engineered cystine knot (knottin) peptide that binds with high affinity to tumor-associated ⁇ v ⁇ 3 , ⁇ v ⁇ 5 , and ⁇ 5 ⁇ 1 integrin receptors (specifically 2.5F, SEQ ID NO: 94 or 96), and 2) an antibody Fc domain that mediates immune effector functions in vivo.
- the knottin-Fc used is 2.5F with a KISS substitution, fused to a mouse IgG2a Fc domain, SEQ ID NO: 45, unless stated otherwise.
- TA99 is an antibody which binds to TYRP-1, (an antigen found on melanoma cells) and inhibits melanoma tumor growth.
- Tumor area was measured and plotted ( FIG. 2 ). Tumor area was measured using calipers. The longest dimension of the tumor in any direction was measured first, followed by the measurement of the longest perpendicular dimension. The two values were then multiplied to quantify tumor area in square millimeters.
- knottin-D265A The failure of knottin-D265A to prevent tumor growth indicates that tumor control by knottin-Fc is mediated by the effector function of Fc.
- Tumors were established by injecting C57BL/6 mice subcutaneously with 1 ⁇ 10 6 B16F10 murine melanoma cells.
- 30 ⁇ g MSA/IL-2 and/or 500 ⁇ g knottin-Fc was administered intraperitoneally on day 6 after tumor inoculation and every 6 days after that for 4 treatments total.
- FIG. 3A Tumor area was measured and plotted. While MSA/IL-2 and knottin-Fc alone had no effect on tumor growth, the combination of MSA/IL-2 and knottin-Fc effectively controlled tumor growth. A Kaplan-Meier survival plot revealed that the combination of MSA/IL-2 and knottin-Fc extended the survival of these mice, whereas monotherapies had no significant effect ( FIG. 3B ).
- FIG. 4A A Kaplan-Meier survival plot shows an increase in survival in the mice treated with the combination of MSA/IL-2 and knottin-Fc compared to when each component was administered as a monotherapy ( FIG. 4B ).
- FIG. 5A A Kaplan-Meier survival plot shows an increase in survival in mice treated with the combination of MSA/IL-2 and knottin-Fc compared to when each component was administered alone ( FIG. 5B ).
- Example 1 The results of Example 1 indicate that effector function is required for tumor control by knottin-Fc.
- knottin-Fc or knottin-D265AFc (the D265A mutation in the murine IgG2a Fc domain eliminates binding to Fc ⁇ R and complement) was administered intraperitoneally on day 6 after tumor inoculation and every six days thereafter for a total of 4 treatments.
- FIGS. 6A and 7A Individual tumor size measurements ( FIGS. 6A and 7A ) and survival plots ( FIGS. 6B and 7B ) indicate that tumor control by knottin-Fc requires the effector function of Fc.
- B16F10 cells 1 ⁇ 10 6 B16F10 cells were injected into the flanks of C57BL/6 mice. 30 ⁇ g MSA/IL-2 was administered every 6 days beginning on day 6 after tumor inoculation for a total of 5 treatments and 200 ⁇ g knottin-Fc was administered daily from days 6-30 after tumor inoculation.
- Antibodies against TYRP-1 (TA99) were administered at 100 ⁇ g per mouse every 6 days starting on day 6 after B16F10 tumor inoculation.
- Antibodies against PD-1 were administered at 200 ⁇ g per mouse every 6 days starting on day 6 after tumor inoculation.
- FIGS. 8A and 8B Individual tumor size measurements ( FIGS. 8A ) and a survival plot ( FIGS. 8B ) indicate that antibodies enhanced tumor control via knottin-Fc and MSA/IL-2. However, this is only effective if the antibody targets an antigen present on the tumor cells. Combining knottin-Fc and MSA/IL-2 with a therapeutic antibody or immune checkpoint blocker increased the efficacy of tumor control and survival improvement.
- FIGS. 9A and 9B Individual tumor size measurements ( FIGS. 9A ) and survival plots ( FIGS. 9B ) indicate that antibodies enhanced tumor control via knottin-Fc and MSA/IL-2. However, this is only effective if the antibody targets an antigen present on the tumor cells. The most effective treatment was to combine knottin-Fc and MSA/IL-2 with an immune checkpoint blockade (anti-PD-1) antibody.
- knottin-Fc was administered daily, every other day, or weekly.
- 1 ⁇ 10 6 B16F10 cells FIG. 10
- 1 ⁇ 10 6 MC38 cells FIG. 11
- 100 ⁇ g of knottin-Fc was administered daily or every other day starting on day 6 and ending on day 28.
- 500 ⁇ g of knottin-Fc was administered on days 6, 12, 18, and 24 for the weekly regimen. In both models, administration of knottin-Fc in conjunction with MSA/IL-2 every other day or every 6 days was equivalent to daily administration.
- Fc was fused to either the N-terminus (Knottin-Fc) or the C-terminus (Fc-Knottin).
- Knottin-Fc the N-terminus
- Fc-Knottin the C-terminus
- 2.5 ⁇ 10 5 B16F10 melanoma cells were injected into the flanks of C57BL/6 mice.
- 80 ⁇ g of knottin-Fc, 80 ⁇ g of Fc-knottin, or 200 ⁇ g of IgG-knottin was administered immediately after tumor inoculation and every two days after, for a total of 10 treatments. Tumor area was measured ( FIG. 12 ). There was essentially no difference in efficacy between the different knottin-Fc fusion proteins.
- a fusion protein was made containing a (Gly4Ser)3 linker in between the knottin and the Fc domain. No difference in integrin binding affinity to U87MG glioblastoma cells were observed compared to integrin-binding-knottin-Fc containing no linker (data not shown).
- the MC38 tumor model was used. 1 ⁇ 10 6 MC38 cells were injected into the flanks of C57BL/6 mice and both 30 ⁇ g MSA/IL-2 and 500 ⁇ g knottin-Fc were administered every 6 days beginning on day 6 after tumor inoculation for a total of 4 treatments. 16-20 weeks after the initial tumor inoculation, previously cured mice or age-matched na ⁇ ve mice were inoculated with 1 ⁇ 10 6 MC38 cells in the opposite flank. No further treatment was administered.
- FIG. 14A Individual tumor size measurements ( FIG. 14A ) and survival plot ( FIG. 14B ) indicate that knottin-Fc and MSA/IL-2 protect previously treated mice against secondary tumor challenge, demonstrating a potent and sustained immune response against the tumors.
- FIGS. 16A and 16B were injected into the flanks of C57BL/6 mice.
- 1.0 ⁇ 10 6 Ag104A cells FIGS. 17A and 17B
- FIGS. 15A, 16A and 17A Individual tumor size measurements ( FIGS. 15A, 16A and 17A ) and survival plots ( FIGS. 15B, 16B and 17B ) indicate that a knottin-Fc that targets all three integrins more effectively controls tumor growth than a knottin-Fc that only targets two integrins.
- Anti-CD8 depletes CD8+ T cells
- anti-CD4 depletes CD4+ T cells
- anti-NK1.1 depletes natural killer cells
- anti-Ly6G depletes neutrophils
- anti-CD19 depletes B cells
- anti-CSF-1R depletes tissue-resident/tumor-resident macrophages.
- CVF inhibits complement activity.
- FIG. 18A Individual tumor size measurements ( FIG. 18A ) and survival plots ( FIG. 18B ) indicate that CD8+ T cells and macrophages are particularly important for the synergistic effect of knottin-Fc and MSA/IL-2 on tumor control.
- Batf3 ⁇ / ⁇ mice were used to evaluate the role of cross-presenting CD8+ dendritic cells.
- Batf3 ⁇ / ⁇ mice lack the function of the basic leucine zipper transcription factor, ATF-like 3.
- Deletion of Batf3 has been shown to prevent the development of CD8+ dendritic cells, which are important for the cross-presentation of exogenous antigen on MHC Class I.
- FIG. 19A Tumor areas of treated C57BL/6 (i.e. “control”) and Batf3 ⁇ / ⁇ mice were measured and plotted ( FIG. 19A ), and demonstrated less tumor control in Batf3 ⁇ / ⁇ mice treated with MSA/IL-2 and knottin-Fc.
- IFN ⁇ depletion did not significantly affect tumor control or survival of mice with MC38 tumors.
- VEGF vascular endothelial growth factor
- CTLA-4 cytotoxic T-lymphocyte-associated protein 4
- Synthetic genes encoding the heavy (VH) and light (VL) chain variable regions of anti-VEGF (clone B20-4.1.1) (Bagri et al., Clin. Cancer Res. (2010) Vol 16: 3887-900) and anti-CTLA-4 (9D9) (Selby et al., Cancer Immunol. Res. (2013) Vol 1:32-42) antibodies, were codon-optimized for expression in mammalian cells (GeneArt, Life Technologies).
- B20-4.1.1 antibody constructs were generated by PCR-amplification of DNA inserts encoding for VH and VL regions and cloned via Gibson assembly into separate gWiz expression vectors (Genlantis) containing a CMV promoter, a kanamycin antibiotic resistance gene and the DNA sequence encoding for either murine IgG2a heavy-chain (CH1, CH2 and CH3) or light-chain (CL) constant regions (see below Sequence 1 and 2 for B20-4.1.1).
- the 9D9 antibody construct was generated by PCR-amplification of DNA inserts encoding the VH and VL regions and sub-cloned into a double cassette p2MPT expression vector (EPFL Protein expression core facility, http://pecf.epfl.ch), containing a CMV promoter, an ampicillin antibiotic resistance gene and both murine IgG2a heavy-chain (CH1, CH2 and CH3) or light-chain (CL) constant regions, via the restriction sites NotI/BamHI and EcoRI/XbaI, respectively. All constructs were verified by DNA sequencing (Macrogen).
- Anti-VEGF antibody B20-4.1.1 was expressed in transiently transfected human embryonic kidney (HEK293-F) cells using the Free-Style 293 Expression System (Life Technologies) as described previously (Zhu et al., Cancer Cell (2015) Vol 27: 489-501).
- Antibody 9D9 was expressed in transiently transfected Chinese hamster ovary (CHO) cells and provided by EPFL Protein expression core facility (http://pecf.epfl.ch). After 7 days of expression, cells were removed by centrifugation (15,000 ⁇ g for 30 min at 4° C.) and filtration (0.22 ⁇ m PES membranes filter) and the proteins in the supernatant purified by protein A chromatography according to the manufacturer's instructions (GE Healthcare).
- Eluted antibodies were further desalted and purified on a HiLoad Superdex 200 10/600 size exclusion column (GE Healthcare) connected to an AKTApurifier system and equilibrated with buffer PBS 1 ⁇ pH 7.4.
- the purified antibodies were concentrated using a 30000 NMWL Amicon Ultra centrifugal filter device (Millipore) at 4000 g and 4° C. and quantified by measuring absorbance at 280 nm using a NanoDrop 2000 spectrophotometer (Thermo Scientific). Molecular weights were confirmed by reducing and non-reducing SDS/PAGE. Purity was evaluated by FPLC.
- Protein samples were analyzed by SDS-PAGE under denaturating and reducing conditions using NuPAGE 4-12% Bis-Tris Gels (Life Technologies) in MOPS buffer followed by Coomassie staining. Native size and oligomerization state of antibodies after concentration were also analyzed by size-exclusion chromatography with a Superdex 200 10/300 GL column (GE Healthcare) connected to an AKTApurifier system and equilibrated with buffer PBS 1 ⁇ pH 7.4.
- FIGS. 21A, 22 and 23A Tumor area was measured and plotted ( FIGS. 21A, 22 and 23A ) and survival plots were generated ( FIG. 21B and 23B ).
- the triple combinations i.e., MSA/IL-2+knottin-Fc+anti-VEGF and MSA/IL-2+knottin-Fc+anti-CTLA-4) significantly controlled tumor growth and improved survival compared to the double combinations (i.e., MSA/IL-2+anti-VEGF and knottin-Fc+anti-VEGF or MSA/IL-2+anti-CTLA-4 and knottin-Fc+anti-CTLA-4).
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Engineering & Computer Science (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Epidemiology (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Cell Biology (AREA)
- Biomedical Technology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Oncology (AREA)
- Neurology (AREA)
- Toxicology (AREA)
- Endocrinology (AREA)
- Hematology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
Description
- This application is a continuation of U.S. patent application Ser. No. 16/230,466, filed Dec. 21, 2018, which claims priority to 371 application Ser. No. 15/501,028, now U.S. Pat. No. 10,166,273, issued on Jan. 1, 2019, which claims priority to International Application No. PCT/US2015/044920, filed on Aug. 12, 2015, which claims priority to U.S. Provisional Patent Application No. 62/036,554, filed Aug. 12, 2014. The contents of the aforementioned applications are hereby incorporated by reference in their entireties.
- This invention was made with Government support under contract CA174795 awarded by the National Institutes of Health. The Government has certain rights in the invention.
- A Sequence Listing is provided herewith in a text file, STAN-1426CON_ST25, created on Jun. 20, 2017 and having a size of 160000 bytes. The contents of the text file are incorporated herein by reference in its entirety.
- Interleukin-2 (IL-2) is a pleiotropic cytokine that activates and induces the proliferation of T cells and NK cells. Although IL-2 is an FDA approved therapy, systemic IL-2 treatment has significant toxicity and therefore the response rate of patients is less than 25%. Combining extended half-life IL-2 and an antibody against a tumor-specific antigen shows promising results for treatment. However, antibody-based therapies often suffer from the fact that many tumors lack known tumor-associated antigens.
- Integrins are a family of extracellular matrix adhesion receptors that regulate a diverse array of cellular functions crucial to the initiation, progression and metastasis of solid tumors. The importance of integrins in tumor progression has made them an appealing target for cancer therapy and allows for the treatment of a variety of cancer types. The integrins present on cancerous cells include αvβ3, αvβ5, and α5β1. A variety of therapeutics have been developed to target individual integrins associated with cancer, including antibodies, linear peptides, cyclic peptides, and peptidomimetics. However, none have utilized small, structured peptide scaffolds or targeted more than two integrins simultaneously. Additionally, current integrin targeting drugs are given as a monotherapy. Novel combination therapies are needed to more effectively combat various cancers.
- The present invention is based, in part, on the discovery that administration of IL-2 attached to a pharmacokinetic modifying group (hereafter referred to as “extended-pharmacokinetic (PK) IL-2”) and an integrin-binding-Fc fusion protein provides synergistic tumor control and prolongs survival relative to monotherapy of either agent alone. The integrin-binding-Fc fusion protein comprises (i) an integrin-binding polypeptide having an integrin-binding loop and a knottin polypeptide scaffold; and (ii) an immunoglobulin Fc domain, wherein the integrin-binding polypeptide is operably linked to the Fc domain. An improved cancer therapy is provided that involves the combined administration of an effective amount of IL-2 and an integrin-binding-Fc fusion protein.
- Accordingly, in one aspect, the invention provides a method for treating cancer in a subject comprising administering to the subject an effective amount of interleukin (IL)-2, and an integrin-binding-Fc fusion protein, wherein the integrin-binding-Fc fusion protein comprises (i) an integrin-binding polypeptide comprising an integrin-binding loop and an knottin polypeptide scaffold; and (ii) an immunoglobulin Fc domain, wherein the integrin-binding polypeptide is operably linked to the Fc domain.
- In one embodiment of the foregoing aspects, the IL-2 is in the form of an extended-PK IL-2, such as an IL-2 fusion protein. In one embodiment, the fusion protein comprises an IL-2 moiety and a moiety selected from the group consisting of an immunoglobulin fragment, human serum albumin, and Fn3. In another embodiment, the fusion protein comprises an IL-2 moiety operably linked to an immunoglobulin Fc domain. In another embodiment, the fusion protein comprises an IL-2 moiety operably linked to human serum albumin In another embodiment, the extended-PK IL-2 comprises an IL-2 moiety conjugated to a non-protein polymer. In one embodiment, the non-protein polymer is polyethylene glycol.
- In one embodiment of the foregoing aspects, the integrin-binding-Fc fusion protein includes an integrin-binding polypeptide that binds to a tumor associated integrin selected from the group consisting of αvβ3, αvβ5, and α5β1, or combination thereof. In one embodiment, the integrin-binding polypeptide binds to αvβ3, αvβ5, and α5β1.
- In one embodiment of the foregoing aspects, the integrin-binding polypeptide includes an integrin-binding loop within a knottin polypeptide scaffold. In some embodiments, the knottin polypeptide scaffold comprises at least three cysteine disulfide linkages or crosslinked cysteine residues, and the integrin-binding loop is adjacent cysteine residues of the knottin polypeptide scaffold. In one embodiment, the integrin-binding loop comprises an RGD peptide sequence. In another embodiment, the knottin polypeptide scaffold is derived from a knottin protein selected from the group consisting of EETI-II, AgRP, and agatoxin. In one embodiment, the knottin protein is EETI-II.
- In one embodiment of the foregoing aspects, the integrin-binding polypeptide includes an integrin-binding loop comprising an RGD peptide sequence and the knottin polypeptide scaffold is derived from EETI-II.
- In one embodiment of the foregoing aspects, the knottin polypeptide scaffold is derived from EETI-II and the integrin-binding loop comprises the sequence, X1X2X3RGDX7X8X9X10X11, wherein each X represents any amino acid, wherein the loop is inserted between 2 cysteine residues in the EETI-II sequence and replaces the native EETI-II sequence. In another embodiment, the integrin-binding loop is inserted after the first cysteine in the native EETI-II sequence.
- In one embodiment of the foregoing aspects, the integrin-binding polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 42 or 43, wherein X1 is selected from the group consisting of A, V, L, P, F, Y, S, H, D, and N; X2 is selected from the group consisting of G, V, L, P, R, E, and Q; X3 is selected from the group consisting of G, A, and P; X7 is selected from the group consisting of W and N; X8 is selected from the group consisting of A, P, and S; X9 is selected from the group consisting of P and R; X10 is selected from the group consisting of A, V, L, P, S, T, and E; and X11 is selected from the group consisting of G, A, W, S, T, K, and E. In a further embodiment, the integrin-binding-Fc fusion comprises an integrin-binding polypeptide, as set forth in SEQ ID NOs: 42 or 43, operably linked to a human IgG Fc domain, as set forth in SEQ ID NOs: 2 or 3.
- In one embodiment of the foregoing aspects, the integrin-binding polypeptide comprises an amino acid sequence selected from the amino acid sequences set forth in Table 1. In another embodiment, the integrin-binding polypeptide comprises an amino acid sequence from the group consisting of SEQ ID NOs: 67-133. In a further embodiment, an integrin-binding polypeptide, set forth in Table 1, is operably linked to a human IgG1 Fc domain, set forth in SEQ ID NOs: 2 or 3.
- In one embodiment of the foregoing aspects, the integrin-binding polypeptide comprises the amino acid sequence of SEQ ID NO: 93, 94, 95 or 96.
- In one embodiment of the foregoing aspects, the Fc domain is a human IgG1 Fc domain.
- In one embodiment of the foregoing aspects, the integrin-binding polypeptide is operably linked with or without a linker to the Fc domain In some embodiments, the integrin-binding polypeptide is linked to the N-terminus or C-terminus of the Fc domain without a linker. In other embodiments, the integrin-binding polypeptide is linked to the N-terminus or C-terminus of the Fc donor with a linker such as a Gly-Ser linker.
- In one embodiment of the foregoing aspects, the integrin-binding-Fc fusion protein comprises the amino acid sequence of SEQ ID NO: 48, 49, 50 or 51.
- In any of the foregoing aspects, the methods comprise administering IL-2 and the integrin-binding-Fc fusion protein in the form of a pharmaceutical composition with a pharmaceutically acceptable carrier.
- In some embodiments, the integrin-binding-Fc fusion protein is in the form of a dimer.
- In any of the foregoing aspects, the methods comprise administering IL-2 and the integrin-binding-Fc fusion protein simultaneously or sequentially.
- In any of the foregoing aspects, the methods further comprise administering an immune checkpoint blocker, such an antibody or antibody fragment targeting PD-1, PD-L1, CTLA-4, TIM3, LAG3, or a member of the B7 family In one embodiment, the immune checkpoint blocker is an antibody or antibody fragment thereof targeting PD-1. In another embodiment, the immune checkpoint blocker is an antibody or antibody fragment targeting CTLA4.
- In certain embodiments, an antagonist of VEGF is administered in place of an immune checkpoint blocker. In a further embodiment, the antagonist of VEGF is an antibody or antibody fragment thereof that binds VEGF, an antibody or antibody fragment thereof that binds VEGF receptor, a small molecule inhibitor of the VEGF receptor tyrosine kinases, a dominant negative VEGF, or a VEGF receptor.
- In one embodiment of the foregoing aspects, the methods comprise administering an integrin-binding-Fc fusion protein and an immune checkpoint blocker, with or without IL-2.
- In any of the foregoing aspects, the cancer is selected from the group consisting of melanoma, leukemia, lung cancer, breast cancer, prostate cancer, ovarian cancer, colon cancer, renal cell carcinoma, pancreatic cancer, cervical cancer, and brain cancer. In some embodiments, the cancer is melanoma. In other embodiments, the cancer is brain cancer, such as medullablastoma. In other embodiments, the cancer is colon cancer.
- In another aspect, the invention provides a method for inhibiting growth and/or proliferation of tumor cells in a subject comprising administering to the subject an effective amount of an extended-pharmacokinetic (PK) interleukin (IL)-2, and an integrin-binding-Fc fusion protein, wherein the integrin-binding-Fc fusion protein comprises (i) an integrin-binding polypeptide comprising an integrin-binding loop and a knottin polypeptide scaffold; and (ii) an immunoglobulin Fc domain, wherein the integrin-binding polypeptide is operably linked to the Fc domain.
- In another aspect, the invention provides a method for inhibiting growth and/or proliferation of tumor cells in a subject comprising administering to the subject an effective amount of an integrin-binding-Fc fusion protein, wherein the integrin-binding-Fc fusion protein comprises (i) an integrin-binding polypeptide comprising an integrin-binding loop and a knottin polypeptide scaffold; and (ii) an immunoglobulin Fc domain, wherein the integrin-binding polypeptide is operably linked to the Fc domain, and an immune checkpoint blocker. In a further embodiment, an effective amount of IL-2 is also administered.
- In one embodiment of the foregoing aspect, the immune checkpoint blocker is an antibody or antibody fragment targeting PD-1. In another aspect, the immune checkpoint blocker is an antibody or antibody fragment targeting CTLA-4.
- In another aspect, the invention provides a method for inhibiting growth and/or proliferation of tumor cells in a subject comprising administering to the subject an effective amount of an integrin-binding-Fc fusion protein, wherein the integrin-binding-Fc fusion protein comprises (i) an integrin-binding polypeptide comprising an integrin-binding loop and a knottin polypeptide scaffold; and (ii) an immunoglobulin Fc domain, wherein the integrin-binding polypeptide is operably linked to the Fc domain, and an antagonist of VEGF. In certain embodiments, the antagonist of VEGF is an antibody or antibody fragment thereof that binds VEGF, an antibody or antibody fragment thereof that binds VEGF receptor, a small molecule inhibitor of the VEGF receptor tyrosine kinases, a dominant negative VEGF, or a VEGF receptor.
- These and other features, aspects, and advantages of the present invention will become better understood with regard to the following description, and accompanying drawings.
-
FIG. 1 shows the positions of the Cys-Cys disulfide linkages in the sequences of knottin proteins EETI-II (SEQ ID NO: 39), AgRP (SEQ ID NO: 40) andomega agatoxin 4B (SEQ ID NO: 41). Cysteine residues can be seen to be immediately flanking the RGD mimic loops, which, in the present engineered peptides, are between the brackets. For example, in AgRP, it can be seen that the cysteines flanking the RGD sequence will be linked to each other, whereas in EETI they are not. The size of the grafted sequence will depend on the molecular framework structure, such that shorter loops will be preferred in cases where they are in the framework adjacent to linked cysteines. Disulfide linkages for other knottin proteins are set forth in the knottin database.FIG. 1 is adapted from Biochemistry, 40, 15520-15527 (2001) and J. Biol. Chem., 2003, 278:6314-6322. -
FIG. 2 is a graph comparing tumor control with TA99 and integrin binding knottin-Fc (SEQ ID NO: 45) in subcutaneous B16F10 melanoma tumors. TA99 is an antibody against TYRP-1, an antigen that is overexpressed on melanoma cells. Tumors were established by injecting 2.5×105 B16F10 cells into the flanks of C57BL/6 mice. Starting on the day of tumor inoculation and every 2 days after, 80 μg knottin-Fc, 80 μg knottin-Fc D265A, or 200 μg TA99 was administered. Error bars represent standard error of the mean (SEM). -
FIGS. 3A and 3B depict synergistic tumor control in established B16F10 melanoma tumors. 1×106 B16F10 cells were injected into the flanks of C57BL/6 mice. 30 μg MSA/IL-2 and/or 500 μg knottin-Fc was administered on day 6 after tumor inoculation, and every 6 days after for a total of four treatments.FIG. 3A ) Tumor area graphs for each treatment.FIG. 3B ) Kaplan-Meier survival plot. -
FIGS. 4A and 4B depict synergistic tumor control in established MC38 colon tumors. 1×106 MC38 cells were injected into the flanks of C57BL/6 mice and 30 μg MSA/IL-2 and/or 500 μg knottin-Fc was administered on day 6 after tumor inoculation, and every 6 days after for a total of four treatments.FIG. 4A ) Tumor area graphs for each treatment.FIG. 4B ) Kaplan-Meier survival plot. -
FIGS. 5A and 5B depict synergistic tumor control in established Ag104A fibrosarcoma tumors. 1×106 Ag104A cells were injected into the flanks of C3H/HeN mice. 12.5 μg MSA/IL-2 and/or 500 μg knottin-Fc was administered on day 6 after tumor inoculation, and every 6 days after for a total of four treatments.FIG. 5A ) Tumor area graphs for each treatment.FIG. 5B ) Kaplan-Meier survival plot. -
FIGS. 6A and 6B depict synergistic tumor control in established B16F10 melanoma tumors. 1×106 B16F10 cells were injected into the flanks of C57BL/6 mice. 30 μg MSA/IL-2 was and 500 μg knottin-Fc or knottin-Fc D265A was administered on day 6 after tumor inoculation and every day after for a total of four treatments.FIG. 6A ) Tumor area graphs for each treatment.FIG. 6B ) Kaplan-Meier survival plot. -
FIGS. 7A and 7B depict synergistic tumor control in established MC38 tumors. 1×106 MC38 cells were injected into the flanks of C57BL/6 mice and 30 μg MSA/IL-2 and 500 μg knottin-Fc or knottin-Fc D265A was administered on day 6 after tumor inoculation and every 6 days after for a total of four treatments.FIG. 7A ) Tumor area graphs for each treatment.FIG. 7B ) Kaplan-Meier survival plot. -
FIGS. 8A and 8B depict synergistic tumor control with an antibody in established B16F10 tumors. 1×106 B16F10 cells were injected into the flanks of C57BL/6 mice. 30 μg MSA/IL-2 was administered every 6 days beginning on day 6 after tumor inoculation for a total of 5 treatments. 200 μg knottin-Fc was administered daily from days 6-30 after tumor inoculation. Antibodies against TYRP-1 (TA99) were administered at 100 μg per mouse every 6 days starting on day 6 after tumor inoculation. Antibodies against PD-1 (for immune checkpoint blockade) were administered at 200 μg per mouse every 6 days starting on day 6 after tumor inoculation.FIG. 8A ) Tumor area graphs for each treatment.FIG. 8B ) Kaplan-Meier survival plot. -
FIGS. 9A and 9B depict synergistic tumor control with an antibody in established MC38 tumors. 1×106 MC38 cells were injected into the flanks of C57BL/6 mice. 30 μg MSA/IL-2, 500 μg knottin-Fc, and/or 200 μg anti-PD-1 antibody was administered on day 6 after tumor inoculation and every 6 days after for a total of four treatments.FIG. 9A ) Tumor area graphs for each treatment.FIG. 9B ) Kaplan-Meier survival plot. -
FIG. 10 is a line graph depicting tumor growth control comparing dosing schedules of knottin-Fc with MSA-IL-2 in the B16F10 tumor model. 30 μg MSA/IL-2 was administered on days 6, 12, 18 and 24 after tumor inoculation. 200 μg knottin-Fc was administered daily or every other day starting 6 days after tumor inoculation. 500 μg knottin-Fc was administered for the weekly regiment on the same days as MSA/IL-2. Mean tumor area is plotted with 5 mice per group and error bars represent SEM. -
FIG. 11 is a line graph depicting tumor growth control comparing dosing schedules of knottin-Fc with MSA/IL-2 in the MC38 tumor model. 30 μg MSA/IL-2 was administered on days 6, 12, 18 and 24 after tumor inoculation. 200 μg knottin-Fc was administered daily or every other day starting 6 days after tumor inoculation. 500 μg knottin-Fc was administered for the weekly regiment on the same days as MSA/IL-2. Mean tumor area is plotted with 5 mice per group and error bars represent SEM. -
FIG. 12 is a line graph depicting tumor control in subcutaneous B16F10 tumors. Fc was either fused to the N-terminus (knottin-Fc) or C-terminus (Fc-knottin) to compare efficacies of fusion placement. Additionally, knottin was fused to the heavy chain of an irrelevant IgG on the C-terminus (IgG-knottin). Mice were treated with 80 μg knottin-Fc or Fc-knottin or 200 μg IgG-knottin every two days starting immediately after tumor inoculation. -
FIG. 13 is a line graph depicting tumor control in subcutaneous MC38 tumors. Fc was either fused to the N-terminus (knottin-Fc) or C-terminus (Fc-knottin) to compare efficacies of fusion placement. Additionally, knottin was fused to the heavy chain of an irrelevant IgG on the C-terminus (IgG-knottin). Mice were treated with 200 μg knottin-Fc or Fc-knottin every two days starting immediately after tumor inoculation. -
FIGS. 14A and 14B depict tumor control after secondary tumor challenge with MC38 tumors cells. Previously cured mice (treated with MSA/IL-2 and knottin-Fc) and age-matched naïve mice were inoculated with 1×106 MC38 tumor cells in the opposite flank 16-20 weeks after the initial tumor inoculation. No further treatment was administered.FIG. 14A ) Tumor area graphs for previously cured mice and age-matched naïve mice following secondary tumor challenge.FIG. 14B ) Kaplan-Meier plot of mice subjected to secondary tumor challenge. -
FIGS. 15A and 15B depict synergistic tumor control in established B16F10 melanoma tumors. 1×106 B16F10 cells were injected into the flanks of C57BL/6 mice. 30 μg MSA/IL-2, 500 μg knottin-Fc that targets 3 integrins (“2.5F_knottin-Fc”), and/or knottin-Fc that targets 2 integrins (“2.5D_knottin-Fc”), was administered on day 6 after tumor inoculation, and every 6 days after for a total of four treatments.FIG. 15A ) Tumor area graphs for each treatment.FIG. 15B ) Kaplan-Meier survival plot. -
FIGS. 16A and 16B depict synergistic tumor control in established MC38 tumors. 1×106 MC38 cells were injected into the flanks of C57BL/6 mice. 30 μg MSA/IL-2, 500 μg knottin-Fc that targets 3 integrins (“2.5F_knottin-Fc”), and/or knottin-Fc that targets 2 integrins (“2.5D_knottin-Fc”), was administered on day 6 after tumor inoculation, and every 6 days after for a total of four treatments.FIG. 16A ) Tumor area graphs for each treatment.FIG. 16B ) Kaplan-Meier survival plot. -
FIGS. 17A and 17B depict synergistic tumor control in established Ag104A angiosarcoma tumors. 1×106 Ag104A cells were injected into the flanks of C3H/HeN mice. 30 μg MSA/IL-2, 500 μg knottin-Fc that targets 3 integrins (“2.5F_knottin-Fc”), and/or knottin-Fc that targets 2 integrins (“2.5D_knottin-Fc”) was administered on day 6 after tumor inoculation, and every 6 days after for a total of four treatments.FIG. 17A ) Tumor area graphs for each treatment.FIG. 17B ) Kaplan-Meier survival plot. -
FIGS. 18A and 18B depict the effect of immune cell depletions on survival of mice with established MC38 tumors treated with knottin-Fc and MSA/IL-2. 1×106 MC38 cells were injected into the flanks of C57BL/6 mice. 30 μg MSA/IL-2 and 500 μg knottin-Fc was administered on day 6 after tumor inoculation, and every 6 days after for a total of four treatments. 400 μg anti-CD8, anti-CD4, anti-NK1.1, anti-Ly6G or anti-CD19 antibodies were dosed every four days for a total of six treatments starting onday 4 after tumor inoculation. 300 μg anti-CSF-1R was dosed every two days for a total of eleven treatments starting onday 5 of tumor inoculation. 30 μg cobra venom factor (CVF) was administered every 6 days for a total of 4 treatments starting onday 5 after tumor inoculation.FIG. 18A ) Tumor area graphs for each treatment.FIG. 18B ) Kaplan-Meier survival plots. -
FIGS. 19A and 19B depict the effect of dendritic cell depletion on survival of mice with established MC38 tumors. 1×106 MC38 cells were injected into the flanks of C57BL/6 mice or Batf3−/− mice. 30 μg MSA/IL-2 and 500 μg knottin-Fc was administered on day 6 after tumor inoculation, and every 6 days after for a total of four treatments.FIG. 19A ) Tumor area graphs for each treatment.FIG. 19B ) Kaplan-Meier survival plot. -
FIGS. 20A and 20B depict the role of IFNγ in the efficacy of treatment with MSA/IL-2 and knottin-Fc in mice with established MC38 tumors. 1×106 MC38 cells were injected into the flanks of C57BL/6 mice. 30 μg MSA/IL-2 and 500 μg knottin-Fc was administered on day 6 after tumor inoculation, and every 6 days after for a total of four treatments. 200 μg anti-IFNγ antibody was administered every two days for a total of eleven treatments starting onday 5 after tumor inoculation.FIG. 20A ) Tumor area graphs for each treatment.FIG. 20B ) Kaplan-Meier survival plot. -
FIGS. 21A and 21B depict synergistic tumor control in established MC38 tumors. 1×106 MC38 cells were injected into the flanks of C57BL/6 mice. 30 μg MSA/IL-2, 500 μg knottin-Fc, and/or 200 μg anti-VEGF antibody was administered on day 6 after tumor inoculation, and every 6 days after for a total for 4 treatments.FIG. 21A ) Tumor area graphs for each treatment.FIG. 21B ) Kaplan-Meier survival plot. -
FIG. 22 shows tumor area graphs depicting synergistic tumor control in established MC38 tumors. 1×106 MC38 cells were injected into the flanks of C57BL/6 mice. 30 μg MSA/IL-2, 500 μg knottin-Fc, and/or 200 μg anti-CTLA-4 antibody was administered on day 6 after tumor inoculation, and every 6 days after for a total for 4 treatments. -
FIGS. 23A and 23B depict the synergistic tumor control in established B16F10 tumors. 1×106 B16F10 cells were injected into the flanks of C57BL/6 mice. 30 μg MSA/IL-2, 500 μg knottin-Fc, 200 μg anti-VEGF antibody and/or 200 μg anti-CTLA-4 antibody was administered on day 6 after tumor inoculation, and every 6 days after for a total for 4 treatments.FIG. 23A ) Tumor area graphs for each treatment.FIG. 23B ). Kaplan-Meier survival plots - Terms used in the claims and specification are defined as set forth below unless otherwise specified. In the case of direct conflict with a term used in a parent provisional patent application, the term used in the instant specification shall control.
- “Amino acid” refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, γ-carboxyglutamate, and O-phosphoserine Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups {e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that function in a manner similar to a naturally occurring amino acid. Amino acids can be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, can be referred to by their commonly accepted single-letter codes.
- An “amino acid substitution” refers to the replacement of at least one existing amino acid residue in a predetermined amino acid sequence (an amino acid sequence of a starting polypeptide) with a second, different “replacement” amino acid residue. An “amino acid insertion” refers to the incorporation of at least one additional amino acid into a predetermined amino acid sequence. While the insertion will usually consist of the insertion of one or two amino acid residues, the present larger “peptide insertions,” can be made, e.g. insertion of about three to about five or even up to about ten, fifteen, or twenty amino acid residues. The inserted residue(s) may be naturally occurring or non-naturally occurring as disclosed above. An “amino acid deletion” refers to the removal of at least one amino acid residue from a predetermined amino acid sequence.
- “Polypeptide,” “peptide”, and “protein” are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymer.
- “Nucleic acid” refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) and complementary sequences and as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions can be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081, 1991; Ohtsuka et al. Biol. Chem. 260:2605-2608, 1985; and Cassol et al, 1992; Rossolini et al, Mol. Cell. Probes 8:91-98, 1994). For arginine and leucine, modifications at the second base can also be conservative. The term nucleic acid is used interchangeably with gene, cDNA, and mRNA encoded by a gene. Polynucleotides used herein can be composed of any polyribonucleotide or polydeoxribonucleotide, which can be unmodified RNA or DNA or modified RNA or DNA. For example, polynucleotides can be composed of single- and double-stranded DNA, DNA that is a mixture of single- and double-stranded regions, single- and double-stranded RNA, and RNA that is mixture of single- and double-stranded regions, hybrid molecules comprising DNA and RNA that can be single-stranded or, more typically, double-stranded or a mixture of single- and double-stranded regions. In addition, the polynucleotide can be composed of triple-stranded regions comprising RNA or DNA or both RNA and DNA. A polynucleotide can also contain one or more modified bases or DNA or RNA backbones modified for stability or for other reasons. “Modified” bases include, for example, tritylated bases and unusual bases such as inosine. A variety of modifications can be made to DNA and RNA; thus, “polynucleotide” embraces chemically, enzymatically, or metabolically modified forms.
- As used herein, “interleukin (IL)-2,” refers to a pleiotropic cytokine that activates and induces proliferation of T cells and natural killer (NK) cells. IL-2 signals by binding its receptor, IL-2R, which is comprised of alpha, beta, and gamma subunits. IL-2 signaling stimulates proliferation of antigen-activated T cells.
- As used herein, the term “PK” is an acronym for “pharmacokinetic” and encompasses properties of a compound including, by way of example, absorption, distribution, metabolism, and elimination by a subject. As used herein, an “extended-PK group” refers to a protein, peptide, or moiety that increases the circulation half-life of a biologically active molecule when fused to or administered together with the biologically active molecule. Examples of an extended-PK group include PEG, human serum albumin (HSA) binders (as disclosed in U.S. Publication Nos. 2005/0287153 and 2007/0003549, PCT Publication Nos. WO 2009/083804 and WO 2009/133208, and SABA molecules as described in US2012/094909), human serum albumin, Fc or Fc fragments and variants thereof, and sugars (e.g., sialic acid). Other exemplary extended-PK groups are disclosed in Kontermann et al., Current Opinion in Biotechnology 2011; 22:868-876, which is herein incorporated by reference in its entirety. As used herein, an “extended-PK IL-2” refers to an IL-2 moiety in combination with an extended-PK group. In one embodiment, the extended-PK IL-2 is a fusion protein in which an IL-2 moiety is linked or fused to an extended-PK group. An exemplary fusion protein is an HSA/IL-2 fusion in which one or more IL-2 moieties are linked to HSA.
- The term “extended-PK IL-2” is also intended to encompass IL-2 mutants with mutations in one or more amino acid residues that enhance the affinity of IL-2 for one or more of its receptors, for example, CD25. In one embodiment, the IL-2 moiety of extended-PK IL-2 is wild-type IL-2. In another embodiment, the IL-2 moiety is a mutant IL-2 which exhibits greater affinity for CD25 than wild-type IL-2. When a particular type of extended-PK group is indicated, such as HSA-IL-2, it should be understood that this encompasses both HSA or MSA fused to a wild-type IL-2 moiety or HSA or MSA fused to a mutant IL-2 moiety.
- In certain aspects, the extended-PK IL-2 or knottin-Fc described can employ one or more “linker domains,” such as polypeptide linkers. As used herein, the term “linker” or “linker domain” refers to a sequence which connects two or more domains (e.g., the PK moiety and IL-2) in a linear sequence. As used herein, the term “polypeptide linker” refers to a peptide or polypeptide sequence (e.g., a synthetic peptide or polypeptide sequence) which connects two or more domains in a linear amino acid sequence of a polypeptide chain. For example, polypeptide linkers may be used to connect an IL-2 moiety or an integrin binding polypeptide to an Fc domain or other PK-extender such as HSA. In some embodiments, such polypeptide linkers can provide flexibility to the polypeptide molecule. Exemplary linkers include Gly-Ser linkers.
- As used herein, the terms “linked,” “fused”, or “fusion” are used interchangeably. These terms refer to the joining together of two or more elements or components or domains, by whatever means including chemical conjugation or recombinant means. Methods of chemical conjugation (e.g., using heterobifunctional crosslinking agents) are known in the art.
- The term “integrin” means a transmembrane heterodimeric protein important for cell adhesion. Integrins comprise an α and β subunit. These proteins bind to extracellular matrix components (e.g., fibronectin, collagen, laminin, etc.) and respond by inducing signaling cascades. Integrins bind to extracellular matrix components by recognition of the RGD motif. Certain integrins are found on the surface of tumor cells and therefore make promising therapeutic targets. In certain embodiments, the integrins being targeted are αvβ3, αvβ5, and α5β1, individually or in combination.
- The term “integrin-binding polypeptide” refers to a polypeptide which includes an integrin-binding domain or loop within a knottin polypeptide scaffold. The integrin binding domain or loop includes at least one RGD peptide. In certain embodiments, the RGD peptide is recognized by αvβ3, αvβ5, or α5β1. In certain embodiments the RGD peptide binds to a combination of αvβ3, αvβ5, and/or α5β1. These specific integrins are found on tumor cells and their vasculature and are therefore the targets of interest.
- The term “loop domain” refers to an amino acid subsequence within a peptide chain that has no ordered secondary structure, and resides generally on the surface of the peptide. The term “loop” is understood in the art as referring to secondary structures that are not ordered as in the form of an alpha helix, beta sheet, etc.
- The term “integrin-binding loop” refers to a primary sequence of about 9-13 amino acids which is typically created ab initio through experimental methods such as directed molecular evolution to bind to integrins. In certain embodiments, the integrin-binding loop includes an RGD peptide sequence, or the like, placed between amino acids which are particular to the scaffold and the binding specificity desired. The RGD-containing peptide or like (RYD, etc) is generally not simply taken from a natural binding sequence of a known protein. The integrin-binding loop is preferably inserted within a knottin polypeptide scaffold between cysteine residues, and the length of the loop adjusted for optimal integrin-binding depending on the three-dimensional spacing between cysteine residues. For example, if the flanking cysteine residues in the knottin scaffold are linked to each other, the optimal loop may be shorter than if the flanking cysteine residues are linked to cysteine residues separated in primary sequence. Otherwise, particular amino acid substitutions can be introduced to constrain a longer RGD-containing loop into an optimal conformation for high affinity integrin binding. The knottin polypeptide scaffolds used herein may contain certain modifications made to truncate the native knottin, or to remove a loop or unnecessary cysteine residue or disulfide bond.
- Incorporation of integrin-binding sequences into a molecular (e.g., knottin polypeptide) scaffold provides a framework for ligand presentation that is more rigid and stable than linear or cyclic peptide loops. In addition, the conformational flexibility of small peptides in solution is high, and results in large entropic penalties upon binding. Incorporation of an integrin-binding sequence into a knottin polypeptide scaffold provides conformational constraints that are required for high affinity integrin binding. Furthermore, the scaffold provides a platform to carry out protein engineering studies such as affinity or stability maturation.
- As used herein, the term “knottin protein” refers to a structural family of small proteins, typically 25-40 amino acids, which bind to a range of molecular targets like proteins, sugars and lipids. Their three-dimensional structure is essentially defined by a peculiar arrangement of three to five disulfide bonds. A characteristic knotted topology with one disulfide bridge crossing the macro-cycle limited by the two other intra-chain disulfide bonds, which was found in several different microproteins with the same cystine network, lent its name to this class of biomolecules. Although their secondary structure content is generally low, the knottins share a small triple-stranded antiparallel (3-sheet, which is stabilized by the disulfide bond framework. Biochemically well-defined members of the knottin family, also called cystine knot proteins, include the trypsin inhibitor EETI-II from Ecballium elaterium seeds, the neuronal N-type Ca2+ channel blocker w-conotoxin from the venom of the predatory cone snail Conus geographus, agouti-related protein (AgRP, See Millhauser et al., “Loops and Links: Structural Insights into the Remarkable Function of the Agouti-Related Protein,” Ann. N.Y. Acad. Sci., Jun. 1, 2003; 994(1): 27-35), the omega agatoxin family, etc. A suitable agatoxin sequence [SEQ ID NO: 41] is given in U.S. Pat. No. 8,536,301, having a common inventor with the present application. Other agatoxin sequences suitable for use in the methods disclosed herein include, Omega-agatoxin-Aa4b (GenBank Accession number P37045) and Omega-agatoxin-Aa3b (GenBank Accession number P81744). Other knottin sequences suitable for use in the methods disclosed herein include, knottin [Bemisia tabaci] (GenBank Accession number FJ601218.1), Omega-lycotoxin (Genbank Accession number P85079), mu-O conotoxin MrVIA=voltage-gated sodium channel blocker (Genbank Accession number AAB34917) and Momordica cochinchinensis Trypsin Inhibitor I (MCoTI-I) or II (McoTI-II) (Uniprot Accession numbers P82408 and P82409 respectively).
- Knottin proteins have a characteristic disulfide linked structure. This structure is also illustrated in Gelly et al., “The KNOTTIN website and database: a new information system dedicated to the knottin scaffold,” Nucleic Acids Research, 2004, Vol. 32, Database issue D156-D159. A triple-stranded (3-sheet is present in many knottins. The spacing between cysteine residues is important, as is the molecular topology and conformation of the integrin-binding loop.
- The term “molecular scaffold” means a polymer having a predefined three-dimensional structure, into which an integrin-binding loop is incorporated, such as an RGD peptide sequence as described herein. The term “molecular scaffold” has an art-recognized meaning (in other contexts), which is also intended here. For example, a review by Skerra, “Engineered protein scaffolds for molecular recognition,” J. Mol. Recognit. 2000; 13:167-187 describes the following scaffolds: single domains of antibodies of the immunoglobulin superfamily, protease inhibitors, helix-bundle proteins, disulfide-knotted peptides and lipocalins. Guidance is given for the selection of an appropriate molecular scaffold.
- The term “knottin polypeptide scaffold” refers to a knottin protein suitable for use as a molecular scaffold, as described herein. Characteristics of a desirable knottin polypeptide scaffold for engineering include 1) high stability in vitro and in vivo, 2) the ability to replace amino acid regions of the scaffold with other sequences without disrupting the overall fold, 3) the ability to create multifunctional or bispecific targeting by engineering separate regions of the molecule, and 4) a small size to allow for chemical synthesis and incorporation of non-natural amino acids if desired. Scaffolds derived from human proteins are favored for therapeutic applications to reduce toxicity or immunogenicity concerns, but are not always a strict requirement. Other scaffolds that have been used for protein design include fibronectin (Koide et al., 1998), lipocalin (Beste et al., 1999), cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) (Hufton et al., 2000), and tendamistat (McConnell and Hoess, 1995; Li et al., 2003). While these scaffolds have proved to be useful frameworks for protein engineering, molecular scaffolds such as knottins have distinct advantages: their small size and high stability.
- As used herein, the term “EETI” means Protein Data Bank Entry (PDB) 2ETI. Its entry in the Knottin database is EETI-II. It has the sequence:
-
(SEQ ID NO: 39) GC PRILMRCKQDSDCLAGCVCGPNGFCG. - As used herein, the term “AgRP” means PDB entry 1HYK. Its entry in the Knottin database is SwissProt AGRP_HUMAN, where the full-length sequence of 129 amino acids may be found. It comprises the sequence beginning at amino acid 87. An additional G is added to this construct. It also includes a C105A mutation described in Jackson, et al. 2002 Biochemistry, 41, 7565.
-
(SEQ ID NO: 40) GCVRLHESCLGQQVPCCDPCATCYC RFFNAF CYCR-KLGTAMNPCSRT - The bold and underlined portion, from
loop 4, is replaced by the RGD sequences described herein.Loops 1 and 3 are shown between brackets below: -
GC[VRLHES]CLGQQVPCC[DPCAT]CYCRFFNAFCYCR-KLGTAMNPCS RT - As used herein, “integrin-binding-Fc fusion” is used interchangeably with “knottin-Fc” and refers to an integrin-binding polypeptide that includes an integrin-binding amino acid sequence within a knottin polypeptide scaffold and is operably linked to an Fc domain. In certain embodiments, the Fc domain is fused to the N-terminus of the integrin-binding polypeptide. In certain embodiments, the Fc domain is fused to the C-terminus of the integrin binding polypeptide. In some embodiments, the Fc domain is operably linked to the integrin-binding polypeptide via a linker.
- As used herein, the term “Fc region” refers to the portion of a native immunoglobulin formed by the respective Fc domains (or Fc moieties) of its two heavy chains. As used herein, the term “Fc domain” refers to a portion of a single immunoglobulin (Ig) heavy chain wherein the Fc domain does not comprise an Fv domain. As such, an Fc domain can also be referred to as “Ig” or “IgG.” In certain embodiments, an Fc domain begins in the hinge region just upstream of the papain cleavage site and ends at the C-terminus of the antibody. Accordingly, a complete Fc domain comprises at least a hinge domain, a CH2 domain, and a CH3 domain. In certain embodiments, an Fc domain comprises at least one of: a hinge (e.g., upper, middle, and/or lower hinge region) domain, a CH2 domain, a CH3 domain, a CH4 domain, or a variant, portion, or fragment thereof. In other embodiments, an Fc domain comprises a complete Fc domain (i.e., a hinge domain, a CH2 domain, and a CH3 domain). In one embodiment, an Fc domain comprises a hinge domain (or portion thereof) fused to a CH3 domain (or portion thereof). In another embodiment, an Fc domain comprises a CH2 domain (or portion thereof) fused to a CH3 domain (or portion thereof). In another embodiment, an Fc domain consists of a CH3 domain or portion thereof. In another embodiment, an Fc domain consists of a hinge domain (or portion thereof) and a CH3 domain (or portion thereof). In another embodiment, an Fc domain consists of a CH2 domain (or portion thereof) and a CH3 domain. In another embodiment, an Fc domain consists of a hinge domain (or portion thereof) and a CH2 domain (or portion thereof). In one embodiment, an Fc domain lacks at least a portion of a CH2 domain (e.g., all or part of a CH2 domain). An Fc domain herein generally refers to a polypeptide comprising all or part of the Fc domain of an immunoglobulin heavy-chain. This includes, but is not limited to, polypeptides comprising the entire CH1, hinge, CH2, and/or CH3 domains as well as fragments of such peptides comprising only, e.g., the hinge, CH2, and CH3 domain. The Fc domain may be derived from an immunoglobulin of any species and/or any subtype, including, but not limited to, a human IgGl, IgG2, IgG3, IgG4, IgD, IgA, IgE, or IgM antibody. A human IgG1 constant region can be found at Uniprot P01857 and in Table 2 (i.e., SEQ ID NO: 1) The Fc domain of human IgG1 can be found in Table 2 (i.e., SEQ ID NO: 2). The Fc domain of human IgG1 with a deletion of the upper hinge region can be found in Table 2 (i.e., SEQ ID NO: 3). The Fc domain encompasses native Fc and Fc variant molecules. As with Fc variants and native Fc's, the term Fc domain includes molecules in monomeric or multimeric (e.g., dimeric) form, whether digested from whole antibody or produced by other means. The assignment of amino acid residue numbers to an Fc domain is in accordance with the definitions of Kabat. See, e.g., Sequences of Proteins of Immunological Interest (Table of Contents, Introduction and Constant Region Sequences sections), 5th edition, Bethesda, Md.: NIH vol. 1:647-723 (1991); Kabat et al., “Introduction” Sequences of Proteins of Immunological Interest, US Dept of Health and Human Services, NIH, 5th edition, Bethesda, Md. vol. 1: xiii-xcvi (1991); Chothia & Lesk, J. Mol. Biol. 196:901-917 (1987); Chothia et al., Nature 342:878-883 (1989), each of which is herein incorporated by reference for all purposes.
- As set forth herein, it will be understood by one of ordinary skill in the art that any Fc domain may be modified such that it varies in amino acid sequence from the native Fc domain of a naturally occurring immunoglobulin molecule. In certain exemplary embodiments, the Fc domain has increased effector function (e.g., FcyR binding).
- The Fc domains of a polypeptide of the invention may be derived from different immunoglobulin molecules. For example, an Fc domain of a polypeptide may comprise a CH2 and/or CH3 domain derived from an IgG1 molecule and a hinge region derived from an IgG3 molecule. In another example, an Fc domain can comprise a chimeric hinge region derived, in part, from an IgG1 molecule and, in part, from an IgG3 molecule. In another example, an Fc domain can comprise a chimeric hinge derived, in part, from an IgG1 molecule and, in part, from an IgG4 molecule.
- A polypeptide or amino acid sequence “derived from” a designated polypeptide or protein refers to the origin of the polypeptide. Preferably, the polypeptide or amino acid sequence which is derived from a particular sequence has an amino acid sequence that is essentially identical to that sequence or a portion thereof, wherein the portion consists of at least 10-20 amino acids, preferably at least 20-30 amino acids, more preferably at least 30-50 amino acids, or which is otherwise identifiable to one of ordinary skill in the art as having its origin in the sequence. Polypeptides derived from another peptide may have one or more mutations relative to the starting polypeptide, e.g., one or more amino acid residues which have been substituted with another amino acid residue or which has one or more amino acid residue insertions or deletions.
- A polypeptide can comprise an amino acid sequence which is not naturally occurring. Such variants, in the context of IL-2 or a knottin protein, necessarily have less than 100% sequence identity or similarity with the starting IL-2 or knottin protein. In a preferred embodiment, the variant will have an amino acid sequence from about 75% to less than 100% amino acid sequence identity or similarity with the amino acid sequence of the starting polypeptide, more preferably from about 80% to less than 100%, more preferably from about 85% to less than 100%, more preferably from about 90% to less than 100% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) and most preferably from about 95% to less than 100%, e.g., over the length of the variant molecule.
- In one embodiment, there is one amino acid difference between a starting polypeptide sequence and the sequence derived therefrom. Identity or similarity with respect to this sequence is defined herein as the percentage of amino acid residues in the candidate sequence that are identical (i.e., same residue) with the starting amino acid residues, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity.
- In one embodiment, a polypeptide comprising IL-2 or a variant thereof, for use in extended-PK IL-2 consists of, consists essentially of, or comprises an amino acid sequence selected from SEQ ID Nos: 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, and 35. In an embodiment, a polypeptide includes an amino acid sequence at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence selected from SEQ ID Nos: 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, and 35. In an embodiment, a polypeptide includes a contiguous amino acid sequence at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a contiguous amino acid sequence selected from SEQ ID Nos: 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, and 35. In an embodiment, a polypeptide includes an amino acid sequence having at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 200, 300, 400, or 500 (or any integer within these numbers) contiguous amino acids of an amino acid sequence selected from SEQ ID Nos: 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, and 35.
- In an embodiment, the peptides are encoded by a nucleotide sequence. Nucleotide sequences can be useful for a number of applications, including: cloning, gene therapy, protein expression and purification, mutation introduction, DNA vaccination of a host in need thereof, antibody generation for, e.g., passive immunization, PCR, primer and probe generation, and the like. In an embodiment, the nucleotide sequence of the invention comprises, consists of, or consists essentially of, a nucleotide sequence of IL-2, or a variant thereof, selected from SEQ ID Nos: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, and 34. In an embodiment, a nucleotide sequence includes a nucleotide sequence at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a nucleotide sequence set forth in SEQ ID Nos: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, and 34. In an embodiment, a nucleotide sequence includes a contiguous nucleotide sequence at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a contiguous nucleotide sequence set forth in SEQ ID Nos: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, and 34. In an embodiment, a nucleotide sequence includes a nucleotide sequence having at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 200, 300, 400, or 500 (or any integer within these numbers) contiguous nucleotides of a nucleotide sequence set forth in SEQ ID Nos: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, and 34.
- In one embodiment, a polypeptide comprising integrin-binding peptide or a variant thereof, consists of, consists essentially of, or comprises an amino acid sequence selected from SEQ ID Nos: 67-133. In an embodiment, a polypeptide includes an amino acid sequence at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence selected from SEQ ID Nos: 67-133. In an embodiment, a polypeptide includes a contiguous amino acid sequence at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a contiguous amino acid sequence selected from SEQ ID Nos: 67-133. In an embodiment, a polypeptide includes an amino acid sequence having at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 200, 300, 400, or 500 (or any integer within these numbers) contiguous amino acids of an amino acid sequence selected from SEQ ID Nos: 67-133.
- It will also be understood by one of ordinary skill in the art that the extended-PK IL-2 or a knottin-Fc fusion used herein may be altered such that they vary in sequence from the naturally occurring or native sequences from which they were derived, while retaining the desirable activity of the native sequences. For example, nucleotide or amino acid substitutions leading to conservative substitutions or changes at “non-essential” amino acid residues may be made. Mutations may be introduced by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis.
- The polypeptides described herein (e.g., IL-2, extended-PK IL-2, PK moieties, knottin, Fc, knottin-Fc, and the like) may comprise conservative amino acid substitutions at one or more amino acid residues, e.g., at essential or non-essential amino acid residues. A “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagines, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, a nonessential amino acid residue in a binding polypeptide is preferably replaced with another amino acid residue from the same side chain family In another embodiment, a string of amino acids can be replaced with a structurally similar string that differs in order and/or composition of side chain family members. Alternatively, in another embodiment, mutations may be introduced randomly along all or part of a coding sequence, such as by saturation mutagenesis, and the resultant mutants can be incorporated into binding polypeptides of the invention and screened for their ability to bind to the desired target.
- The “Programmed Death-1 (PD-1)” receptor refers to an immuno-inhibitory receptor belonging to the CD28 family PD-1 is expressed predominantly on previously activated T cells in vivo, and binds to two ligands, PD-L1 and PD-L2. The term “PD-1” as used herein includes human PD-1 (hPD-1), variants, isoforms, and species homologs of hPD-1, and analogs having at least one common epitope with hPD-1. The complete hPD-1 sequence can be found under GenBank Accession No. AAC51773 (SEQ ID NO: 52).
- “Programmed Death Ligand-1 (PD-L1)” is one of two cell surface glycoprotein ligands for PD-1 (the other being PD-L2) that downregulates T cell activation and cytokine secretion upon binding to PD-1. The term “PD-L1” as used herein includes human PD-L1 (hPD-L1), variants, isoforms, and species homologs of hPD-L1, and analogs having at least one common epitope with hPD-L1. The complete hPD-L1 sequence can be found under GenBank Accession No. Q9NZQ7 (SEQ ID NO: 53).
- “Cytotoxic T Lymphocyte Associated Antigen-4 (CTLA-4)” is a T cell surface molecule and is a member of the immunoglobulin superfamily This protein downregulates the immune system by binding to CD80 and CD86. The term “CTLA-4” as used herein includes human CTLA-4 (hCTLA-4), variants, isoforms, and species homologs of hCTLA-4, and analogs having at least one common epitope with hCTLA-4. The complete hCTLA-4 sequence can be found under GenBank Accession No. P16410 (SEQ ID NO: 54):
- “Lymphocyte Activation Gene-3 (LAGS)” is an inhibitory receptor associated with inhibition of lymphocyte activity by binding to MHC class II molecules. This receptor enhances the function of Treg cells and inhibits CD8+ effector T cell function. The term “LAGS” as used herein includes human LAGS (hLAG3), variants, isoforms, and species homologs of hLAG3, and analogs having at least one common epitope. The complete hLAG3 sequence can be found under GenBank Accession No. P18627 (SEQ ID NO: 55).
- “T Cell Membrane Protein-3 (TIM3)” is an inhibitory receptor involved in the inhibition of lymphocyte activity by inhibition of
T H1 cells responses. Its ligand is galectin 9, which is upregulated in various types of cancers. The term “TIM3” as used herein includes human TIM3 (hTIM3), variants, isoforms, and species homologs of hTIM3, and analogs having at least one common epitope. The complete hTIM3 sequence can be found under GenBank Accession No. Q8TDQo (SEQ ID NO: 56). - The “B7 family” refers to inhibitory ligands with undefined receptors. The B7 family encompasses B7-H3 and B7-H4, both upregulated on tumor cells and tumor infiltrating cells. The complete hB7-H3 and hB7-H4 sequence can be found under GenBank Accession Nos. Q5ZPR3 and AAZ17406 (SEQ ID Nos: 57 and 58) respectively.
- “Vascular Endothelial Growth Factor (VEGF)” is a secreted disulfide-linked homodimer that selectively stimulates endothelial cells to proliferate, migrate, and produce matrix-degrading enzymes, all of which are processes required for the formation of new vessels. In addition to being the only known endothelial cell specific mitogen, VEGF is unique among angiogenic growth factors in its ability to induce a transient increase in blood vessel permeability to macromolecules. The term “VEGF” or “VEGF-A” is used to refer to the 165-amino acid human vascular endothelial cell growth factor and related 121-, 145-, 189-, and 206-amino acid human vascular endothelial cell growth factors, as described by, e.g., Leung et al. Science, 246: 1306 (1989), and Houck et al. Mol. Endocrin., 5: 1806 (1991), together with the naturally occurring allelic and processed forms thereof. VEGF-A is part of a gene family including VEGF-B, VEGF-C, VEGF-D, VEGF-E, VEGF-F, and P1GF. VEGF-A primarily binds to two high affinity receptor tyrosine kinases, VEGFR-1 (Fit-1) and VEGFR-2 (Flk-1/KDR), the latter being the major transmitter of vascular endothelial cell mitogenic signals of VEGF-A.
- As used herein, “immune checkpoint” refers to co-stimulatory and inhibitory signals that regulate the amplitude and quality of T cell receptor recognition of an antigen. In certain embodiments, the immune checkpoint is an inhibitory signal. In certain embodiments, the inhibitory signal is the interaction between PD-1 and PD-L1. In certain embodiments, the inhibitory signal is the interaction between CTLA-4 and CD80 or CD86 to displace CD28 binding. In certain embodiments the inhibitory signal is the interaction between LAG3 and MHC class II molecules. In certain embodiments, the inhibitory signal is the interaction between TIM3 and galectin 9.
- As used herein, “immune checkpoint blocker” refers to a molecule that reduces, inhibits, interferes with or modulates one or more checkpoint proteins. In certain embodiments, the immune checkpoint blocker prevents inhibitory signals associated with the immune checkpoint. In certain embodiments, the immune checkpoint blocker is an antibody, or fragment thereof, that disrupts inhibitory signaling associated with the immune checkpoint. In certain embodiments, the immune checkpoint blocker is a small molecule that disrupts inhibitory signaling. In certain embodiments, the immune checkpoint blocker is an antibody, fragment thereof, or antibody mimic, that prevents the interaction between checkpoint blocker proteins, e.g., an antibody, or fragment thereof, that prevents the interaction between PD-1 and PD-L1. In certain embodiments, the immune checkpoint blocker is an antibody, or fragment thereof, that prevents the interaction between CTLA-4 and CD80 or CD86. In certain embodiments, the immune checkpoint blocker is an antibody, or fragment thereof, that prevents the interaction between LAG3 and MHC class II molecules. In certain embodiments the, the immune checkpoint blocker is an antibody, or fragment thereof, that prevents the interaction between TIM3 and galectin9. The checkpoint blocker may also be in the form of the soluble form of the molecules (or mutation thereof) themselves, e.g., a soluble PD-L1 or PD-L1 fusion.
- The term “ameliorating” refers to any therapeutically beneficial result in the treatment of a disease state, e.g., cancer, including prophylaxis, lessening in the severity or progression, remission, or cure thereof.
- The term “in vivo” refers to processes that occur in a living organism.
- The term “mammal” or “subject” or “patient” as used herein includes both humans and non-humans and include but is not limited to humans, non-human primates, canines, felines, murines, bovines, equines, and porcines.
- The term “percent identity,” in the context of two or more nucleic acid or polypeptide sequences, refer to two or more sequences or subsequences that have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned for maximum correspondence, as measured using one of the sequence comparison algorithms described below (e.g., BLASTP and BLASTN or other algorithms available to persons of skill) or by visual inspection. Depending on the application, the “percent identity” can exist over a region of the sequence being compared, e.g., over a functional domain, or, alternatively, exist over the full length of the two sequences to be compared.
- For sequence comparison, typically one sequence acts as a reference sequence to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
- Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by visual inspection (see generally Ausubel et al., infra).
- One example of an algorithm that is suitable for determining percent sequence identity and sequence similarity is the BLAST algorithm, which is described in Altschul et al., J. Mol. Biol. 215:403-410 (1990). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information website.
- As used herein, the term “gly-ser polypeptide linker” refers to a peptide that consists of glycine and serine residues. An exemplary gly-ser polypeptide linker comprises the amino acid sequence Ser(Gly4Ser)n (SEQ ID NO: 134). In one embodiment, n=1. In one embodiment, n=2. In another embodiment, n=3, i.e., Ser(Gly4Ser)3 (SEQ ID NO: 135). In another embodiment, n=4, i.e., Ser(Gly4Ser)4 (SEQ ID NO: 136). In another embodiment, n=5. In yet another embodiment, n=6. In another embodiment, n=7. In yet another embodiment, n=8. In another embodiment, n=9. In yet another embodiment, n=10. Another exemplary gly-ser polypeptide linker comprises the amino acid sequence (Gly4Ser)n (SEQ ID NO: 137). In one embodiment, n=1 . In one embodiment, n=2. In a preferred embodiment, n=3. In another embodiment, n=4. In another embodiment, n=5. In yet another embodiment, n=6. Another exemplary gly-ser polypeptide linker comprises the amino acid sequence (Gly3Ser)n (SEQ ID NO: 138). In one embodiment, n=1. In one embodiment, n=2. In a preferred embodiment, n=3. In another embodiment, n=4. In another embodiment, n=5. In yet another embodiment, n=6.
- As used herein, “half-life” refers to the time taken for the serum or plasma concentration of a polypeptide to reduce by 50%, in vivo, for example due to degradation and/or clearance or sequestration by natural mechanisms. The extended-PK IL-2 used herein is stabilized in vivo and its half-life increased by, e.g., fusion to HSA, MSA or Fc, through PEGylation, or by binding to serum albumin molecules (e.g., human serum albumin) which resist degradation and/or clearance or sequestration. The half-life can be determined in any manner known per se, such as by pharmacokinetic analysis. Suitable techniques will be clear to the person skilled in the art, and may for example generally involve the steps of suitably administering a suitable dose of the amino acid sequence or compound of the invention to a subject; collecting blood samples or other samples from said subject at regular intervals; determining the level or concentration of the amino acid sequence or compound of the invention in said blood sample; and calculating, from (a plot of) the data thus obtained, the time until the level or concentration of the amino acid sequence or compound of the invention has been reduced by 50% compared to the initial level upon dosing. Further details are provided in, e.g., standard handbooks, such as Kenneth, A. et al., Chemical Stability of Pharmaceuticals: A Handbook for Pharmacists and in Peters et al., Pharmacokinetic Analysis: A Practical Approach (1996). Reference is also made to Gibaldi, M. et al., Pharmacokinetics, 2nd Rev. Edition, Marcel Dekker (1982).
- As used herein, a “small molecule” is a molecule with a molecular weight below about 500 Daltons.
- As used herein, “therapeutic protein” refers to any polypeptide, protein, protein variant, fusion protein and/or fragment thereof which may be administered to a subject as a medicament. An exemplary therapeutic protein is an interleukin, e.g., IL-7.
- As used herein, “synergy” or “synergistic effect” with regard to an effect produced by two or more individual components refers to a phenomenon in which the total effect produced by these components, when utilized in combination, is greater than the sum of the individual effects of each component acting alone.
- The term “sufficient amount” or “amount sufficient to” means an amount sufficient to produce a desired effect, e.g., an amount sufficient to reduce the size of a tumor.
- The term “therapeutically effective amount” is an amount that is effective to ameliorate a symptom of a disease. A therapeutically effective amount can be a “prophylactically effective amount” as prophylaxis can be considered therapy.
- As used herein, “combination therapy” embraces administration of each agent or therapy in a sequential manner in a regiment that will provide beneficial effects of the combination and co-administration of these agents or therapies in a substantially simultaneous manner Combination therapy also includes combinations where individual elements may be administered at different times and/or by different routes but which act in combination to provide a beneficial effect by co-action or pharmacokinetic and pharmacodynamics effect of each agent or tumor treatment approaches of the combination therapy.
- As used herein, “about” will be understood by persons of ordinary skill and will vary to some extent depending on the context in which it is used. If there are uses of the term which are not clear to persons of ordinary skill given the context in which it is used, “about” will mean up to plus or minus 10% of the particular value.
- It must be noted that, as used in the specification and the appended claims, the singular forms “a,” “an” and “the” include plural referents unless the context clearly dictates otherwise.
- Various aspects described herein are described in further detail in the following subsections.
- Interleukin-2 (IL-2) is a cytokine that induces proliferation of antigen-activated T cells and stimulates natural killer (NK) cells. The biological activity of IL-2 is mediated through a multi-subunit IL-2 receptor complex (IL-2R) of three polypeptide subunits that span the cell membrane: p55 (IL-2Rα, the alpha subunit, also known as CD25 in humans), p75 (IL-2RP, the beta subunit, also known as CD 122 in humans) and p64 (IL-2Ry, the gamma subunit, also known as CD 132 in humans). T cell response to IL-2 depends on a variety of factors, including: (1) the concentration of IL-2; (2) the number of IL-2R molecules on the cell surface; and (3) the number of IL-2R occupied by IL-2 (i.e., the affinity of the binding interaction between IL-2 and IL-2R (Smith, “Cell Growth Signal Transduction is Quantal” In Receptor Activation by Antigens, Cytokines, Hormones, and Growth Factors 766:263-271, 1995)). The IL-2:IL-2R complex is internalized upon ligand binding and the different components undergo differential sorting. IL-2Ra is recycled to the cell surface, while IL-2 associated with the IL-2:IL-2Rpγ complex is routed to the lysosome and degraded. When administered as an intravenous (i.v.) bolus, IL-2 has a rapid systemic clearance (an initial clearance phase with a half-life of 12.9 minutes followed by a slower clearance phase with a half-life of 85 minutes) (Konrad et al., Cancer Res. 50:2009-2017, 1990).
- Thus, in some embodiments, IL-2 therapy, such as systemic IL-2, is administered to a subject in an effective amount in combination with an integrin-binding-Fc fusion protein, and optionally an immune checkpoint blocker.
- However, outcomes of systemic IL-2 administration in cancer patients are far from ideal. While 15 to 20 percent of patients respond objectively to high-dose IL-2, the great majority do not, and many suffer severe, life-threatening side effects, including nausea, confusion, hypotension, and septic shock. The severe toxicity associated with IL-2 treatment is largely attributable to the activity of natural killer (NK) cells. NK cells express the intermediate-affinity receptor, IL-2Rpγc, and thus are stimulated at nanomolar concentrations of IL-2, which do in fact result in patient sera during high-dose IL-2 therapy. Attempts to reduce serum concentration, and hence selectively stimulate IL-2RaPγc-bearing cells, by reducing dose and adjusting dosing regimen have been attempted, and while less toxic, such treatments were also less efficacious. Given the toxicity issues associated with high dose IL-2 cancer therapy, numerous groups have attempted to improve anti-cancer efficacy of IL-2 by simultaneously administering therapeutic antibodies. Yet, such efforts have been largely unsuccessful, yielding no additional or limited clinical benefit compared to IL-2 therapy alone. Accordingly, novel IL-2 therapies are needed to more effectively combat various cancers.
- Applicants recently discovered that the ability of IL-2 to control tumors in various cancer models could be substantially increased by attaching IL-2 to a pharmacokinetic modifying group. The resulting molecule, hereafter referred to as “extended-pharmacokinetic (PK) IL-2,” has a prolonged circulation half-life relative to free IL-2. The prolonged circulation half-life of extended-PK IL-2 permits in vivo serum IL-2 concentrations to be maintained within a therapeutic range, leading to the enhanced activation of many types of immune cells, including T cells. Because of its favorable pharmacokinetic profile, extended-PK IL-2 can be dosed less frequently and for longer periods of time when compared with unmodified IL-2. Extended-PK IL-2 is described in detail in International Patent Application NO. PCT/US2013/042057, filed May 21, 2013, and claiming the benefit of priority to US Provisional Patent Application NO. 61/650,277, filed May 22, 2012. The entire contents of the foregoing applications are incorporated by reference herein.
- A. IL-2 and Mutants Thereof
- In certain embodiments, an effective amount of human IL-2 is administered systemically. In some embodiments, an effective amount of an extended-PK IL-2 is administered systemically. In one embodiment, the IL-2 is a human recombinant IL-2 such as Proleukin® (aldesleukin). Proleukin® is a human recombinant interleukin-2 product produced in E. coli. Proleukin® differs from the native interleukin-2 in the following ways: a) it is not glycosylated; b) it has no N-terminal alanine; and c) it has serine substituted for cysteine at amino acid positions 125. Proleukin® exists as biologicially active, non-covalently bound microaggregates with an average size of 27 recombinant interleukin-2 molecules. Proleukin® (aldesleukin) is administered by intravenous infusion. In some aspects, the IL-2 portion of the extended-PK IL-2 is wild-type IL-2 (e.g., human IL-2 in its precursor form (SEQ ID NO: 33) or mature IL-2 (SEQ ID NO: 35)).
- In certain embodiments, the extended-PK IL-2 is mutated such that it has an altered affinity (e.g., a higher affinity) for the IL-2R alpha receptor compared with unmodified IL-2.
- Site-directed mutagenesis can be used to isolate IL-2 mutants that exhibit high affinity binding to CD25, i.e., IL-2Rα, as compared to wild-type IL-2. Increasing the affinity of IL-2 for IL-2Rα at the cell surface will increase receptor occupancy within a limited range of IL-2 concentration, as well as raise the local concentration of IL-2 at the cell surface.
- In certain embodiments, the invention features IL-2 mutants, which may be, but are not necessarily, substantially purified and which can function as high affinity CD25 binders. IL-2 is a T cell growth factor that induces proliferation of antigen-activated T cells and stimulation of NK cells. Exemplary IL-2 mutants which are high affinity binders include those described in WO2013/177187A2 (herein incorporated by reference in its entirety), such as those with amino acid sequences set forth in SEQ ID Nos: 7, 23, 25, 27, 29, and 31. Further exemplary IL-2 mutants with increased affinity for CD25 are disclosed in U.S. Pat. No. 7,569,215, the contents of which are incorporated herein by reference. In one embodiment, the IL-2 mutant does not bind to CD25, e.g., those with amino acid sequences set forth in SEQ ID Nos: 9 and 11.
- IL-2 mutants include an amino acid sequence that is at least 80% identical to SEQ ID NO: 33 that bind CD25. For example, an IL-2 mutant can have at least one mutation (e.g., a deletion, addition, or substitution of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more amino acid residues) that increases the affinity for the alpha subunit of the IL-2 receptor relative to wild-type IL-2. It should be understood that mutations identified in mouse IL-2 may be made at corresponding residues in full length human IL-2 (nucleic acid sequence (accession: NM000586) of SEQ ID NO: 32; amino acid sequence (accession: P60568) of SEQ ID NO: 33) or human IL-2 without the signal peptide (nucleic acid sequence of SEQ ID NO: 34; amino acid sequence of SEQ ID NO: 35). Accordingly, in certain embodiments, the IL-2 moiety of the extended-PK IL-2 is human IL-2. In other embodiments, the IL-2 moiety of the extended-PK IL-2 is a mutant human IL-2.
- IL-2 mutants can be at least or about 50%, at least or about 65%, at least or about 70%, at least or about 80%, at least or about 85%, at least or about 87%, at least or about 90%, at least or about 95%, at least or about 97%, at least or about 98%, or at least or about 99% identical in amino acid sequence to wild-type IL-2 (in its precursor form or, preferably, the mature form). The mutation can consist of a change in the number or content of amino acid residues. For example, the IL-2 mutants can have a greater or a lesser number of amino acid residues than wild-type IL-2. Alternatively, or in addition, IL-2 mutants can contain a substitution of one or more amino acid residues that are present in the wild-type IL-2.
- By way of illustration, a polypeptide that includes an amino acid sequence that is at least 95% identical to a reference amino acid sequence of SEQ ID NO: 33 is a polypeptide that includes a sequence that is identical to the reference sequence except for the inclusion of up to five alterations of the reference amino acid of SEQ ID NO: 33. For example, up to 5% of the amino acid residues in the reference sequence may be deleted or substituted with another amino acid, or a number of amino acids up to 5% of the total amino acid residues in the reference sequence may be inserted into the reference sequence. These alterations of the reference sequence may occur at the amino (N-) or carboxy (C-) terminal positions of the reference amino acid sequence or anywhere between those terminal positions, interspersed either individually among residues in the reference sequence or in one or more contiguous groups within the reference sequence.
- The substituted amino acid residue(s) can be, but are not necessarily, conservative substitutions, which typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid; asparagines, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. These mutations can be at amino acid residues that contact IL-2Rα.
- In general, the polypeptides used in the practice of the instant invention will be synthetic, or produced by expression of a recombinant nucleic acid molecule. In the event the polypeptide is an extended-PK IL-2 (e.g., a fusion protein containing at least IL-2 and a heterologous polypeptide, such as a hexa-histidine tag or hemagglutinin tag or an Fc region or human serum albumin), it can be encoded by a hybrid nucleic acid molecule containing one sequence that encodes IL-2 and a second sequence that encodes all or part of the heterologous polypeptide.
- The techniques that are required to make IL-2 mutants are routine in the art, and can be performed without resort to undue experimentation by one of ordinary skill in the art. For example, a mutation that consists of a substitution of one or more of the amino acid residues in IL-2 can be created using a PCR-assisted mutagenesis technique (e.g., as known in the art and/or described herein for the creation of IL-2 mutants). Mutations that consist of deletions or additions of amino acid residues to an IL-2 polypeptide can also be made with standard recombinant techniques. In the event of a deletion or addition, the nucleic acid molecule encoding IL-2 is simply digested with an appropriate restriction endonuclease. The resulting fragment can either be expressed directly or manipulated further by, for example, ligating it to a second fragment. The ligation may be facilitated if the two ends of the nucleic acid molecules contain complementary nucleotides that overlap one another, but blunt-ended fragments can also be ligated. PCR-generated nucleic acids can also be used to generate various mutant sequences.
- In addition to generating IL-2 mutants via expression of nucleic acid molecules that have been altered by recombinant molecular biological techniques, IL-2 mutants can be chemically synthesized. Chemically synthesized polypeptides are routinely generated by those of skill in the art.
- As noted above, IL-2 can also be prepared as fusion or chimeric polypeptides that include IL-2 and a heterologous polypeptide (i.e., a polypeptide that is not IL-2). The heterologous polypeptide can increase the circulating half-life of the chimeric polypeptide in vivo, and may, therefore, further enhance the properties of IL-2. As discussed in further detail infra, the polypeptide that increases the circulating half-life may be serum albumin, such as human or mouse serum albumin.
- In other embodiments, the chimeric polypeptide can include IL-2 and a polypeptide that functions as an antigenic tag, such as a FLAG sequence. FLAG sequences are recognized by biotinylated, highly specific, anti-FLAG antibodies, as described herein (see also Blanar et al., Science 256: 1014, 1992; LeClair et al., Proc. Natl. Acad. Sci. USA 89:8145, 1992). In certain embodiments, the chimeric polypeptide further comprises a C-terminal c-myc epitope tag.
- Chimeric polypeptides can be constructed using no more than conventional molecular biological techniques, which are well within the ability of those of ordinary skill in the art to perform.
- a. Nucleic Acid Molecules Encoding IL-2
- IL-2, either alone or as a part of a chimeric polypeptide, such as those described herein, can be obtained by expression of a nucleic acid molecule. Thus, nucleic acid molecules encoding polypeptides containing IL-2 or an IL-2 mutant are considered within the scope of the invention, such as those with nucleic acid sequences set forth in SEQ ID Nos: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, and 34. Just as IL-2 mutants can be described in terms of their identity with wild-type IL-2, the nucleic acid molecules encoding them will necessarily have a certain identity with those that encode wild-type IL-2. For example, the nucleic acid molecule encoding an IL-2 mutant can be at least 50%, at least 65%, preferably at least 75%, more preferably at least 85%, and most preferably at least 95% (e.g., 99%) identical to the nucleic acid encoding full length wild-type IL-2 (e.g., SEQ ID NO: 32 or wild-type IL-2 without the signal peptide (e.g., SEQ ID NO: 34).
- The nucleic acid molecules of the invention can contain naturally occurring sequences, or sequences that differ from those that occur naturally, but, due to the degeneracy of the genetic code, encode the same polypeptide. These nucleic acid molecules can consist of RNA or DNA (for example, genomic DNA, cDNA, or synthetic DNA, such as that produced by phosphoramidite-based synthesis), or combinations or modifications of the nucleotides within these types of nucleic acids. In addition, the nucleic acid molecules can be double-stranded or single-stranded (i.e., either a sense or an antisense strand).
- The nucleic acid molecules are not limited to sequences that encode polypeptides; some or all of the non-coding sequences that lie upstream or downstream from a coding sequence (e.g., the coding sequence of IL-2) can also be included. Those of ordinary skill in the art of molecular biology are familiar with routine procedures for isolating nucleic acid molecules. They can, for example, be generated by treatment of genomic DNA with restriction endonucleases, or by performance of the polymerase chain reaction (PCR). In the event the nucleic acid molecule is a ribonucleic acid (RNA), molecules can be produced, for example, by in vitro transcription.
- The isolated nucleic acid molecules can include fragments not found as such in the natural state. Thus, the invention encompasses use of recombinant molecules, such as those in which a nucleic acid sequence (for example, a sequence encoding an IL-2 mutant) is incorporated into a vector (e.g., a plasmid or viral vector) or into the genome of a heterologous cell (or the genome of a homologous cell, at a position other than the natural chromosomal location).
- As described above, IL-2 mutants of the invention may exist as a part of a chimeric polypeptide. In addition to, or in place of, the heterologous polypeptides described above, a nucleic acid molecule of the invention can contain sequences encoding a “marker” or “reporter.” Examples of marker or reporter genes include β-lactamase, chloramphenicol acetyltransferase (CAT), adenosine deaminase (ADA), aminoglycoside phosphotransferase (neon, G418k), dihydrofolate reductase (DHFR), hygromycin-B-hosphotransferase (HPH), thymidine kinase (TK), lacz (encoding β-galactosidase), and xanthine guanine phosphoribosyl transferase (XGPRT). As with many of the standard procedures associated with the practice of the invention, skilled artisans will be aware of additional useful reagents, for example, of additional sequences that can serve the function of a marker or reporter.
- The nucleic acid molecules of the invention can be obtained by introducing a mutation into IL-2-encoding DNA obtained from any biological cell, such as the cell of a mammal. Thus, the nucleic acids used herein (and the polypeptides they encode) can be those of a mouse, rat, guinea pig, cow, sheep, horse, pig, rabbit, monkey, baboon, dog, or cat. Typically, the nucleic acid molecules will be those of a human.
- B. Extended-PK Groups
- As described supra, IL-2 or mutant IL-2 is fused to an extended-PK group, which increases circulation half-life. Non-limiting examples of extended-PK groups are described infra. It should be understood that other PK groups that increase the circulation half-life of IL-2, or variants thereof, are also applicable to extended-PK IL-2.
- In certain embodiments, the serum half-life of extended-PK IL-2 is increased relative to IL-2 alone (i.e., IL-2 not fused to an extended-PK group). In certain embodiments, the serum half-life of extended-PK IL-2 is at least 20, 40, 60, 80, 100, 120, 150, 180, 200, 400, 600, 800, or 1000% longer relative to the serum half-life of IL-2 alone. In other embodiments, the serum half-life of the extended-PK IL-2 is at least 1.5-fold, 2-fold, 2.5-fold, 3-fold, 3.5 fold, 4-fold, 4.5-fold, 5-fold, 6-fold, 7-fold, 8-fold, 10-fold, 12-fold, 13-fold, 15-fold, 17-fold, 20-fold, 22-fold, 25-fold, 27-fold, 30-fold, 35-fold, 40-fold, or 50-fold greater than the serum half-life of IL-2 alone. In certain embodiments, the serum half-life of the extended-PK IL-2 is at least 10 hours, 15 hours, 20 hours, 25 hours, 30 hours, 35 hours, 40 hours, 50 hours, 60 hours, 70 hours, 80 hours, 90 hours, 100 hours, 110 hours, 120 hours, 130 hours, 135 hours, 140 hours, 150 hours, 160 hours, or 200 hours.
- a. Serum Albumin and Serum Albumin Binding Proteins
- In certain embodiments, the extended-PK group is a serum albumin, or fragments thereof. Methods of fusing serum albumin to proteins are disclosed in, e.g., US2010/0144599, US2007/0048282, and US2011/0020345, which are herein incorporated by reference in their entirety. In certain embodiments, the extended-PK group is HSA, or variants or fragments thereof, such as those disclosed in U.S. Pat. No. 5,876,969, WO 2011/124718, WO 2013/075066, and WO 2011/0514789.
- In certain embodiments, the extended-PK group is a serum albumin binding protein such as those described in US2005/0287153, US2007/0003549, US2007/0178082, US2007/0269422, US2010/0113339, W02009/083804, and W02009/133208, which are herein incorporated by reference in their entirety.
- b. PEGylation
- In certain embodiments, an extended-PK IL-2 used herein includes a polyethylene glycol (PEG) domain. PEGylation is well known in the art to confer increased circulation half-life to proteins. Methods of PEGylation are well known and disclosed in, e.g., U.S. Pat. Nos. 7,610,156, 7,847,062, all of which are hereby incorporated by reference.
- PEG is a well-known, water soluble polymer that is commercially available or can be prepared by ring-opening polymerization of ethylene glycol according to methods well known in the art (Sandler and Karo, Polymer Synthesis, Academic Press, New York, Vol. 3, pages 138-161). The term “PEG” is used broadly to encompass any polyethylene glycol molecule, without regard to size or to modification at an end of the PEG, and can be represented by the formula: X-0(CH2CH20)n-1CH2CH2OH, where n is 20 to 2300 and X is H or a terminal modification, e.g., a C1-4 alkyl. In one embodiment, the PEG of the invention terminates on one end with hydroxy or methoxy, i.e., X is H or CH3 (“methoxy PEG”). PEG can contain further chemical groups which are necessary for binding reactions; which results from the chemical synthesis of the molecule; or which is a spacer for optimal distance of parts of the molecule. In addition, such a PEG can consist of one or more PEG side-chains which are linked together. PEGs with more than one PEG chain are called multiarmed or branched PEGs. Branched PEGs can be prepared, for example, by the addition of polyethylene oxide to various polyols, including glycerol, pentaerythriol, and sorbitol. For example, a four-armed branched PEG can be prepared from pentaerythriol and ethylene oxide. Branched PEG are described in, for example, EP-
A 0 473 084 and U.S. Pat. No. 5,932,462, both of which are hereby incorporated by reference. One form of PEGs includes two PEG side-chains (PEG2) linked via the primary amino groups of a lysine (Monfardini et al., Bioconjugate Chem 1995; 6:62-9). - In one embodiment, pegylated IL-2 is produced by site-directed pegylation, particularly by conjugation of PEG to a cysteine moiety at the N- or C-terminus. A PEG moiety may also be attached by other chemistry, including by conjugation to amines.
- PEG conjugation to peptides or proteins generally involves the activation of PEG and coupling of the activated PEG-intermediates directly to target proteins/peptides or to a linker, which is subsequently activated and coupled to target proteins/peptides (see Abuchowski et al., JBC 1977; 252:3571 and JBC 1977; 252:3582, and Harris et. al., in: Poly(ethylene glycol) Chemistry: Biotechnical and Biomedical Applications; (J. M. Harris ed.) Plenum Press: New York, 1992; Chap. 21 and 22).
- A variety of molecular mass forms of PEG can be selected, e.g., from about 1,000 Daltons (Da) to 100,000 Da (n is 20 to 2300), for conjugating to IL-2. The number of repeating units “n” in the PEG is approximated for the molecular mass described in Daltons. It is preferred that the combined molecular mass of PEG on an activated linker is suitable for pharmaceutical use. Thus, in one embodiment, the molecular mass of the PEG molecules does not exceed 100,000 Da. For example, if three PEG molecules are attached to a linker, where each PEG molecule has the same molecular mass of 12,000 Da (each n is about 270), then the total molecular mass of PEG on the linker is about 36,000 Da (total n is about 820). The molecular masses of the PEG attached to the linker can also be different, e.g., of three molecules on a linker two PEG molecules can be 5,000 Da each (each n is about 110) and one PEG molecule can be 12,000 Da (n is about 270).
- One skilled in the art can select a suitable molecular mass for PEG, e.g., based on how the pegylated IL-2 will be used therapeutically, the desired dosage, circulation time, resistance to proteolysis, immunogenicity, and other considerations. For a discussion of PEG and its use to enhance the properties of proteins, see N. V. Katre, Advanced Drug Delivery Reviews 1993; 10:91-114.
- In one embodiment of the invention, PEG molecules may be activated to react with amino groups on IL-2 such as with lysines (Bencham C. O. et al., Anal. Biochem., 131, 25 (1983); Veronese, F. M. et al., Appl. Biochem., 11, 141 (1985); Zalipsky, S. et al., Polymeric Drugs and Drug Delivery Systems, adrs 9-110 ACS Symposium Series 469 (1999); Zalipsky, S. et al., Europ. Polym. J., 19, 1177-1183 (1983); Delgado, C. et al., Biotechnology and Applied Biochemistry, 12, 119-128 (1990)).
- In one embodiment, carbonate esters of PEG are used to form the PEG-IL-2 conjugates. N,N′-disuccinimidylcarbonate (DSC) may be used in the reaction with PEG to form active mixed PEG-succinimidyl carbonate that may be subsequently reacted with a nucleophilic group of a linker or an amino group of IL-2 (see U.S. Pat. Nos. 5,281,698 and 5,932,462). In a similar type of reaction, 1,1′-(dibenzotriazolyl)carbonate and di-(2-pyridyl)carbonate may be reacted with PEG to form PEG-benzotriazolyl and PEG-pyridyl mixed carbonate (U.S. Pat. No. 5,382,657), respectively.
- Pegylation of IL-2 can be performed according to the methods of the state of the art, for example by reaction of IL-2 with electrophilically active PEGs (Shearwater Corp., USA, www.shearwatercorp.com). Preferred PEG reagents are, e.g., N-hydroxysuccinimidyl propionates (PEG-SPA), butanoates (PEG-SBA), PEG-succinimidyl propionate or branched N-hydroxysuccinimides such as mPEG2-NHS (Monfardini, C, et al., Bioconjugate Chem. 6 (1995) 62-69).
- In another embodiment, PEG molecules may be coupled to sulfhydryl groups on IL-2 (Sartore, L., et al., Appl. Biochem. Biotechnol., 27, 45 (1991); Morpurgo et al., Biocon. Chem., 7, 363-368 (1996); Goodson et al., Bio/Technology (1990) 8, 343; U.S. Pat. No. 5,766,897). U.S. Pat. Nos. 6,610,281 and 5,766,897 describe exemplary reactive PEG species that may be coupled to sulfhydryl groups.
- In certain embodiments where PEG molecules are conjugated to cysteine residues on IL-2 the cysteine residues are native to IL-2 whereas in other embodiments, one or more cysteine residues are engineered into IL-2. Mutations may be introduced into the coding sequence of IL-2 to generate cysteine residues. This might be achieved, for example, by mutating one or more amino acid residues to cysteine. Preferred amino acids for mutating to a cysteine residue include serine, threonine, alanine and other hydrophilic residues. Preferably, the residue to be mutated to cysteine is a surface-exposed residue. Algorithms are well-known in the art for predicting surface accessibility of residues based on primary sequence or a protein.
- In another embodiment, pegylated IL-2 comprise one or more PEG molecules covalently attached to a linker.
- In one embodiment, IL-2 is pegylated at the C-terminus. In a specific embodiment, a protein is pegylated at the C-terminus by the introduction of C-terminal azido-methionine and the subsequent conjugation of a methyl-PEG-triarylphosphine compound via the Staudinger reaction. This C-terminal conjugation method is described in Cazalis et al., C-Terminal Site-Specific PEGylation of a Truncated Thrombomodulin Mutant with Retention of Full Bioactivity, Bioconjug Chem. 2004; 15(5): 1005-1009.
- Monopegylation of IL-2 can also be achieved according to the general methods described in WO 94/01451. WO 94/01451 describes a method for preparing a recombinant polypeptide with a modified terminal amino acid alpha-carbon reactive group. The steps of the method involve forming the recombinant polypeptide and protecting it with one or more biologically added protecting groups at the N-terminal alpha-amine and C-terminal alpha-carboxyl. The polypeptide can then be reacted with chemical protecting agents to selectively protect reactive side chain groups and thereby prevent side chain groups from being modified. The polypeptide is then cleaved with a cleavage reagent specific for the biological protecting group to form an unprotected terminal amino acid alpha-carbon reactive group. The unprotected terminal amino acid alpha-carbon reactive group is modified with a chemical modifying agent. The side chain protected terminally modified single copy polypeptide is then deprotected at the side chain groups to form a terminally modified recombinant single copy polypeptide. The number and sequence of steps in the method can be varied to achieve selective modification at the N- and/or C-terminal amino acid of the polypeptide.
- The ratio of IL-2 to activated PEG in the conjugation reaction can be from about 1:0.5 to 1:50, between from about 1: 1 to 1:30, or from about 1:5 to 1: 15. Various aqueous buffers can be used to catalyze the covalent addition of PEG to IL-2, or variants thereof. In one embodiment, the pH of a buffer used is from about 7.0 to 9.0. In another embodiment, the pH is in a slightly basic range, e.g., from about 7.5 to 8.5. Buffers having a pKa close to neutral pH range may be used, e.g., phosphate buffer.
- Conventional separation and purification techniques known in the art can be used to purify PEGylated IL-2, such as size exclusion (e.g. gel filtration) and ion exchange chromatography. Products may also be separated using SDS-PAGE. Products that may be separated include mono-, di-, tri-poly- and un-pegylated IL-2 as well as free PEG. The percentage of mono-PEG conjugates can be controlled by pooling broader fractions around the elution peak to increase the percentage of mono-PEG in the composition.
- In one embodiment, PEGylated IL-2 of the invention contains one, two or more PEG moieties. In one embodiment, the PEG moiety(ies) are bound to an amino acid residue which is on the surface of the protein and/or away from the surface that contacts CD25. In one embodiment, the combined or total molecular mass of PEG in PEG-IL-2 is from about 3,000 Da to 60,000 Da, optionally from about 10,000 Da to 36,000 Da. In one embodiment, PEG in pegylated IL-2 is a substantially linear, straight-chain PEG.
- In one embodiment, PEGylated IL-2 of the invention will preferably retain at least 25%, 50%, 60%, 70%, 80%, 85%, 90%, 95% or 100% of the biological activity associated with the unmodified protein. In one embodiment, biological activity refers to the ability to bind CD25. The serum clearance rate of PEG-modified IL-2 may be decreased by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or even 90%, relative to the clearance rate of the unmodified IL-2. PEG-modified IL-2 may have a circulation half-life which is enhanced relative to the half-life of unmodified IL-2. The half-life of PEG-IL-2, or variants thereof, may be enhanced by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 175%, 200%, 250%, 300%, 400% or 500%, or even by 1000% relative to the half-life of unmodified IL-2. In certain embodiments, the protein half-life is determined in vitro, such as in a buffered saline solution or in serum. In other embodiments, the protein half-life is an in vivo circulation half-life, such as the half-life of the protein in the serum or other bodily fluid of an animal
- c. Other Extended-PK Groups
- In certain embodiments, the extended-PK group is transferrin, as disclosed in U.S. Pat. Nos. 7,176,278 and 8,158,579, which are herein incorporated by reference in their entirety.
- In certain embodiments, the extended-PK group is a serum immunoglobulin binding protein such as those disclosed in US2007/0178082, which is herein incorporated by reference in its entirety.
- In certain embodiments, the extended-PK group is a fibronectin (Fn)-based scaffold domain protein that binds to serum albumin, such as those disclosed in US2012/0094909, which is herein incorporated by reference in its entirety. Methods of making fibronectin-based scaffold domain proteins are also disclosed in US2012/0094909. A non-limiting example of a Fn3-based extended-PK group is Fn3(HSA), i.e., a Fn3 protein that binds to human serum albumin.
- d. Fc Domains
- In certain embodiments, an extended-PK IL-2 includes an Fc domain, as described in WO2013177187. The Fc domain does not contain a variable region that binds to antigen. Fc domains useful for producing the extended-PK IL-2 described herein may be obtained from a number of different sources. In certain embodiments, an Fc domain of the extended-PK IL-2 is derived from a human immunoglobulin. In a certain embodiment, the Fc domain is from a human IgG1 constant region (SEQ ID NO: 1). The Fc domain of human IgG1 is set forth in SEQ ID NO: 2. In certain embodiments, the Fc domain of human IgG1 does not have the upper hinge region (SEQ ID NO: 3). It is understood, however, that the Fc domain may be derived from an immunoglobulin of another mammalian species, including for example, a rodent (e.g. a mouse, rat, rabbit, guinea pig) or non-human primate (e.g. chimpanzee, macaque) species. Moreover, the Fc domain or portion thereof may be derived from any immunoglobulin class, including IgM, IgG, IgD, IgA, and IgE, and any immunoglobulin isotype, including IgG1, IgG2, IgG3, and IgG4.
- In some aspects, an extended-PK IL-2 includes a mutant Fc domain. In some aspects, an extended-PK IL-2 includes a mutant, IgGl Fc domain. In some aspects, a mutant Fc domain comprises one or more mutations in the hinge, CH2, and/or CH3 domains. In some aspects, a mutant Fc domain includes a D265A mutation.
- In one embodiment, the extended-PK IL-2 of the invention lacks one or more constant region domains of a complete Fc region, i.e., they are partially or entirely deleted. In certain embodiments, the extended-PK IL-2 of the invention will lack an entire CH2 domain. In certain embodiments, the extended-PK IL-2 of the invention comprise CH2 domain-deleted Fc regions derived from a vector (e.g., from IDEC Pharmaceuticals, San Diego) encoding an IgG1 human constant region domain (see, e.g., WO02/060955A2 and WO02/096948A2). This exemplary vector is engineered to delete the CH2 domain and provide a synthetic vector expressing a domain-deleted IgG1 constant region. It will be noted that these exemplary constructs are preferably engineered to fuse a binding CH3 domain directly to a hinge region of the respective Fc domain.
- Integrins are a family of extracellular matrix adhesion receptors that regulate a diverse array of cellular functions crucial to the initiation, progression and metastasis of solid tumors. The importance of integrins in tumor progression has made them an appealing target for cancer therapy and allows for the treatment of a variety of cancer types. The integrins present on cancerous cells include αvβ3, αvβ5, and α5β1.
- Knottin proteins are small compact peptides that have high thermal and proteolytic stability and are tolerant to mutagenesis, making them good molecular scaffolds. These peptides contain at least 3 disulfide bonds that form a “knot” core. They also contain several loops exposed to the surface, allowing these loops to bind targets. These loops can be engineered to bind specific targets with high affinity, making them a useful tool for therapy.
- The present invention involves the use of a knottin polypeptide scaffold engineered with an RGD sequence capable of binding integrins, fused to an Fc donor, which confers a therapeutic benefit (also referred to as “knottin-Fc”). As described supra, Fc fragments have been added to proteins and/or therapeutics to extend half-life. In the context of knottin-Fc as used herein, the effector function of Fc contributes to the treatment of a variety of cancers when used in conjunction with systemic IL-2, such as extended-PK IL-2. In certain embodiments, a knottin-Fc that binds two integrins simultaneously is used (2.5D, SEQ ID NO: 93 or 95). In certain embodiments, a knottin-Fc that binds three integrins simultaneously, reflected in Table 1, is used (2.5F, SEQ ID NO: 94 or 96).
- A. Methods of Engineering Knottin Polypeptide Scaffolds
- Knottin polypeptide scaffolds are used to insert an integrin-binding sequence, preferably in the form of a loop, to confer specific integrin binding. Integrin-binding is preferably engineered into a knottin polypeptide scaffold by inserting an integrin-binding peptide sequence, such as an RGD peptide. In some embodiments, insertion of an integrin-binding peptide sequence results in replacement of portion of the native knottin protein. For example, in one embodiment an RGD peptide sequence is inserted into a native solvent exposed loop by replacing all or a portion of the loop with an RGD-containing peptide sequence (e.g., 5-12 amino acid sequence) that has been selected for binding to one or more integrins. The solvent-exposed loop (i.e., on the surface) will generally be anchored by disulfide-linked cysteine residues in the native knottin protein sequence. The integrin-binding replacement amino acid sequence can be obtained by randomizing codons in the loop portion, expressing the engineered peptide, and selecting the mutants with the highest binding to the predetermined ligand. This selection step may be repeated several times, taking the tightest binding proteins from the previous step and re-randomizing the loops.
- Integrin-binding polypeptides may be modified in a number of ways. For example, the polypeptide may be further cross-linked internally, or may be cross-linked to each other, or the RGD loops may be grafted onto other cross linked molecular scaffolds. There are a number of commercially available crosslinking reagents for preparing protein or peptide bioconjugates. Many of these crosslinkers allow dimeric homo- or heteroconjugation of biological molecules through free amine or sulfhydryl groups in protein side chains. More recently, other crosslinking methods involving coupling through carbohydrate groups with hydrazide moieties have been developed. These reagents have offered convenient, facile, crosslinking strategies for researchers with little or no chemistry experience in preparing bioconjugates.
- The EETI-II knottin protein (SEQ ID NO: 39) contains a disulfide knotted topology and possesses multiple solvent-exposed loops that are amenable to mutagenesis. Preferred embodiments use EETI-II as the molecular scaffold.
- Another example of a knottin protein which can be used as a molecular scaffold is AgRP or agatoxin. The amino acid sequences of AgRP (SEQ ID NO: 40) and agatoxin (SEQ ID NO: 41) differ but their structure is identical. Exemplary AgRP knottins are found in Table 1.
- Additional AgRP engineered knottins can be made as described in the above-referenced US 2009/0257952 to Cochran et al. (the contents of which are incorporated herein by reference). AgRP knottin fusions can be prepared using
AgRP loops loop 4 as exemplified above. - The present polypeptides may be produced by recombinant DNA or may be synthesized in solid phase using a peptide synthesizer, which has been done for the peptides of all three scaffolds described herein. They may further be capped at their N-termini by reaction with fluorescein isothiocyanate (FITC) or other labels, and, still further, may be synthesized with amino acid residues selected for additional crosslinking reactions. TentaGel S RAM Fmoc resin (Advanced ChemTech) may be used to give a C-terminal amide upon cleavage. B-alanine is used as the N-terminal amino acid to prevent thiazolidone formation and release of fluorescein during peptide deprotection (Hermanson, 1996). Peptides are cleaved from the resin and side-chains are deprotected with 8% trifluoroacetic acid, 2% triisopropylsilane, 5% dithiothreitol, and the final product is recovered by ether precipitation. Peptides are purified by reverse phase HPLC using an acetonitrile gradient in 0.1% trifluoroacetic acid and a C4 or C18 column (Vydac) and verified using matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF) or electrospray ionization-mass spectrometry (ESI-MS).
- When the present peptides are produced by recombinant DNA, expression vectors encoding the selected peptide are transformed into a suitable host. The host should be selected to ensure proper peptide folding and disulfide bond formation as described above. Certain peptides, such as EETI-II, can fold properly when expressed in prokaryotic hosts such as bacteria.
- Dimeric, trimeric, and tetrameric complexes of the present peptides can be formed through genetic engineering of the above sequences or by reaction of the synthetic cross-linkers with engineered peptides carrying an introduced cysteine residue, for example on the C-terminus of the peptide. These oligomeric peptide complexes can be purified by gel filtration. Oligomers of the present peptides can be prepared by preparing vectors encoding multiple peptide sequences end-to-end. Also, multimers may be prepared by complexing the peptides, such as, e.g., described in U.S. Pat. No. 6,265,539. There, an active HIV peptide is prepared in multimer form by altering the amino-terminal residue of the peptide so that it is peptide-bonded to a spacer peptide that contains an amino-terminal lysyl residue and one to about five amino acid residues such as glycyl residues to form a composite polypeptide. Alternatively, each peptide is synthesized to contain a cysteine (Cys) residue at each of its amino- and carboxy-termini. The resulting di-cysteine-terminated (di-Cys) peptide is then oxidized to polymerize the di-Cys peptide monomers into a polymer or cyclic peptide multimer. Multimers may also be prepared by solid phase peptide synthesis utilizing a lysine core matrix. The present peptides may also be prepared as nanoparticles. See, “Multivalent Effects of RGD Peptides Obtained by Nanoparticle Display,” Montet, et al., J. Med. Chem.; 2006; 49(20) pp 6087-6093. EETI dimerization may be carried out with the present EETI-II peptides according to the EETI-II dimerization paper: “Grafting of thrombopoietin-mimetic peptides into cystine knot miniproteins yields high-affinity thrombopoietin antagonist and agonists,” Krause, et al., FEBS Journal; 2006; 274 pp 86-95. This is further described in PCT application No. PCT/US2013/065610, herein incorporated by reference.
- Synergistic sites on fibronectin and other adhesion proteins have been identified for enhanced integrin binding (Ruoslahti, 1996; Koivunen et al., 1994; Aota et al., 1994; Healy et al., 1995). The ability to incorporate different integrin-specific motifs into one soluble molecule would have an important impact on therapeutic development. Crosslinkers with heterofunctional specificity may be used for creating integrin-binding proteins with synergistic binding effects. In addition, these same crosslinkers could easily be used to create bispecific targeting molecules, or as vehicles for delivery of radionuclides or toxic agents for therapeutic applications.
- B. Integrin-Binding Peptides
- The integrin-binding polypeptides for use in Fc fusions include an integrin-binding loop (e.g., RGD peptide sequence) and a knottin polypeptide scaffold. Such integrin-binding polypeptides are described in U.S. Pat. No. 8,536,301, the contents of which are incorporated herein by reference. As described in U.S. Pat. No. 8,536,301, integrin-binding polypeptides may be varied in the non-RGD residues to a certain degree without affecting binding specificity and potency. For example, if three of the eleven residues were varied, one would have about 70% identity to 2.5D. Table 1 shows exemplary integrin-binding polypeptides within the scope of the invention, and their specific knottin polypeptide scaffold (e.g., EETI-II or AgRP). Preferred integrin-binding polypeptides for use in Fc fusions are peptides 2.5D and 2.5F.
- In certain embodiments, the integrin-binding polypeptide binds to αvβ3, αvβ5, or α5β1 separately.
- In certain embodiments, the integrin-binding polypeptide binds to αvβ3 and αvβ5 simultaneously.
- In certain embodiments, the integrin-binding polypeptide binds to αvβ3, αvβ5, and α5β1 simultaneously.
- In certain embodiments, the integrin-binding loop is within an engineered EETI-II scaffold. In certain embodiments, the lysine in
position 15 of the EETI-II scaffold is replaced with a serine. In certain embodiments, the integrin-binding polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 42 or 43, wherein Xi is selected from the group consisting of A, V, L, P, F, Y, S, H, D, and N; X1 is selected from the group consisting of G, V, L, P, R, E, and Q; X3 is selected from the group consisting of G, A, and P; X7 is selected from the group consisting of W and N; X8 is selected from the group consisting of A, P, and S; X9 is selected from the group consisting of P and R; X10 is selected from the group consisting of A, V, L, P, S, T, and E; and X11 is selected from the group consisting of G, A, W, S, T, K, and E. In a further embodiment, the integrin-binding-Fc fusion comprises an integrin-binding polypeptide, as set forth in SEQ ID Nos: 42 or 43, operably linked to a human IgG Fc domain, as set forth in SEQ ID Nos: 2 or 3. - In certain embodiments, the integrin-binding loop is within an engineered AgRP or agatoxin scaffold.
- In certain embodiments, the integrin-binding polypeptide is 2.5D and 2.5F, disclosed in Table 1. Any of the integrin-binding polypeptides in Table 1 can be used in Fc fusion as described herein.
-
TABLE 1 Integrin Binding Knottin Sequences SEQ ID Peptide Sequence (RGD motif is underlined NO Identifier Scaffold with flanking residues) 67 1.4A EETI-II GC AEPRGDMPWTW CKQDSDCLAGCVCGPNGFCG 68 1.4B EETI-II GC VGGRGDWSPKW CKQDSDCPAGCVCGPNGFCG 69 1.4C EETI-II GC AELRGDRSYPE CKQDSDCLAGCVCGPNGFCG 70 1.4E EETI-II GC RLPRGDVPRPH CKQDSDCQAGCVCGPNGFCG 71 1.4H EETI-II GC YPLRGDNPYAA CKQDSDCRAGCVCGPNGFCG 72 1.5B EETI-II GC TIGRGDWAPSE CKQDSDCLAGCVCGPNGFCG 73 1.5F EETI-II GC HPPRGDNPPVT CKQDSDCLAGCVCGPNGFCG 74 2.3A EETI-II GC PEPRGDNPPPS CKQDSDCRAGCVCGPNGFCG 75 2.3B EETI-II GC LPPRGDNPPPS CKQDSDCQAGCVCGPNGFCG 76 2.3C EETI-II GC HLGRGDWAPVG CKQDSDCPAGCVCGPNGFCG 77 2.3D EETI-II GC NVGRGDWAPSE CKQDSDCPAGCVCGPNGFCG 78 2.3E EETI-II GC FPGRGDWAPSS CKQDSDCRAGCVCGPNGFCG 79 2.3F EETI-II GC PLPRGDNPPTE CKQDSDCQAGCVCGPNGFCG 80 2.3G EETI-II GC SEARGDNPRLS CKQDSDCRAGCVCGPNGFCG 81 2.3H EETI-II GC LLGRGDWAPEA CKQDSDCRAGCVCPNGFCG 82 2.3I EETI-II GC HVGRGDWAPLK CKQDSDCQAGCVCGPNGFCG 83 2.3J EETI-II GC VRGRGDWAPPS CKQDSDCPAGCVCGPNGFCG 84 2.4A EETI-II GC LGGRGDWAPPA CKQDSDCRAGCVCGPNGFCG 85 2.4C EETI-II GC FVGRGDWAPLT CKQDSDCQAGCVCGPNGFCG 86 2.4D EETI-II GC PVGRGDWSPAS CKQDSDCRAGCVCGPNGFCG 87 2.4E EETI-II GC PRPRGDNPPLT CKQDSDCLAGCVCGPNGFCG 88 2.4F EETI-II GC YQGRGDWSPSS CKQDSDCPAGCVCGPNGFCG 89 2.4G EETI-II GC APGRGDWAPSE CKQDSDCQAGCVCGPNGFCG 90 2.4J EETI-II GC VQGRGDWSPPS CKQDSDCPAGCVCGPNGFCG 91 2.5A EETI-II GC HVGRGDWAPEE CKQDSDCQAGCVCGPNGFCG 92 2.5C EETI-II GC DGGRGDWAPPA CKQDSDCRAGCVCGPNGFCG 93 2.5D EETI-II GC PQGRGDWAPTS CKQDSDCRAGCVCGPNGFCG 94 2.5F EETI-II GC PRPRGDNPPLT CKQDSDCLAGCVCGPNGFCG 95 2.5D K15S EETI-II GC PQGRGDWAPTS CSQDSDCLAGCVCGPNGFCG Mutant 96 2.5F K15S EETI-II GC PRPRGDNPPLT CSQDSDCLAGCVCGPNGFCG Mutant 97 2.5H EETI-II GC PQGRGDWAPEW CKQDSDCPAGCVCGPNGFCG 98 2.5J EETI-II GC PRGRGDWSPPA CKQDSDCQAGCVCGPNGFCG 99 3A AgRp GCVRLHESCLGQQVPCCDPAATCYC VVRGDWRKR CYCR 100 3B AgRp GCVRLHESCLGQQVPCCDPAATCYC EERGDMLEK CYCR 101 3C AgRp GCVRLHESCLGQQVPCCDPAATCYC ETRGDGKEK CYCR 102 3D AgRp GCVRLHESCLGQQVPCCDPAATCYC QWRGDGDVK CYCR 103 3E AgRp GCVRLHESCLGQQVPCCDPAATCYC SRRGDMRER CYCR 104 3F AgRp GCVRLHESCLGQQVPCCDPAATCYC QYRGDGMKH CYCR 105 3G AgRp GCVRLHESCLGQQVPCCDPAATCYC TGRGDTKVL CYCR 106 3H AgRp GCVRLHESCLGQQVPCCDPAATCYC VERGDMKRR CYCR 107 3I AgRp GCVRLHESCLGQQVPCCDPAATCYC TGRGDVRMN CYCR 108 3J AgRp GCVRLHESCLGQQVPCCDPAATCYC VERGDGMSK CYCR 109 4A AgRp GCVRLHESCLGQQVPCCDPAATCYC RGRGDMRRE CYCR 110 4B AgRp GCVRLHESCLGQQVPCCDPAATCYC EGRGDVKVN CYCR 111 4C AgRp GCVRLHESCLGQQVPCCDPAATCYC VGRGDEKMS CYCR 112 4D AgRp GCVRLHESCLGQQVPCCDPAATCYC VSRGDMRKR CYCR 113 4E AgRp GCVRLHESCLGQQVPCCDPAATCYC ERRGDSVKK CYCR 114 4F AgRp GCVRLHESCLGQQVPCCDPAATCYC EGRGDTRRR CYCR 115 4G AgRp GCVRLHESCLGQQVPCCDPAATCYC EGRGDVVRR CYCR 116 4H AgRp GCVRLHESCLGQQVPCCDPAATCYC KGRGDNKRK CYCR 117 4I AgRp GCVRLHESCLGQQVPCCDPAXTCYC KGRGDVRRV CYCR 118 4J AgRp GCVRLHESCLGQQVPCCDPAATCYC VGRGDNKVK CYCR 119 5A AgRp GCVRLHESCLGQQVPCCDPAATCYC VGRGDNRLK CYCR 120 5B AgRp GCVRLHESCLGQQVPCCDPAATCYC VERGDGMKK CYCR 121 5C AgRp GCVRLHESCLGQQVPCCDPAATCYC EGRGDMRRR CYCR 122 5D AgRp GCVRLHESCLGQQVPCCDPAATCYC QGRGDGDVK CYCR 123 5E AgRp GCVRLHESCLGQQVPCCDPAATCYC SGRGDNDLV CYCR 124 5F AgRp GCVRLHESCLGQQVPCCDPAATCYC VERGDGMIR CYCR 125 5G AgRp GCVRLHESCLGQQVPCCDPAATCYC SGRGDNDLV CYCR 126 5H AgRp GCVRLHESCLGQQVPCCDPAATCYC EGRGDMKMK CYCR 127 5I AgRp GCVRLHESCLGQQVPCCDPAATCYC IGRGDVRRR CYCR 128 5J AgRp GCVRLHESCLGQQVPCCDPAATCYC EERGDGRKK CYCR 129 6B AgRp GCVRLHESCLGQQVPCCDPAATCYC EGRGDRDMK CYCR 130 6C AgRp GCVRLHESCLGQQVPCCDPAATCYC TGRGDEKLR CYCR 131 6E AgRp GCVRLHESCLGQQVPCCDPAATCYC VERGDGNRR CYCR 132 6F AgRp GCVRLHESCLGQQVPCCDPAATCYC ESRGDVVRK CYCR 133 7C AgRp GCVRLHESCLGQQVPCCDPAATCYCYGRGDNDLRCYCR - The present polypeptides target αvβ3, αvβ5, and in some cases α5β1 integrin receptors. They do not bind to other integrins tested, such as αiibβ3, where there was little to no affinity.
- Thus, these engineered integrin-binding polypeptides have broad diagnostic and therapeutic applications in a variety of human cancers that specifically overexpress the above named integrins. As described below, these polypeptides bind with high affinity to both detergent-solubilized and tumor cell surface integrin receptors.
- The αvβ3 (and αvβ5) integrins are also highly expressed on many tumor cells including osteosarcomas, neuroblastomas, carcinomas of the lung, breast, prostate, and bladder, glioblastomas, and invasive melanomas The αvβ3 integrin has been shown to be expressed on tumor cells and/or the vasculature of breast, ovarian, prostate, and colon carcinomas, but not on normal adult tissues or blood vessels. Also, the α5β1 integrin has been shown to be expressed on tumor cells and/or the vasculature of breast, ovarian, prostate, and colon carcinomas, but not on normal adult tissue or blood vessels. The present, small, conformationally-constrained polypeptides (about 33 amino acids) are so constrained by intramolecular bonds. For example, EETI-II has three disulfide linkages. This will make it more stable in vivo. These peptides target αv integrins alone, or both αv and α5β3 integrins. Until now, it is believed that the development of a single agent that can bind αvβ3, αvβ5, and α5β1 integrins with high affinity and specificity has not been achieved. Since all three of these integrins are expressed on tumors and are involved in mediating angiogenesis and metastasis, a broad spectrum targeting agent (i.e., αvβ3, αvβ5, and α5β1) will likely be more effective for diagnostic and therapeutic applications.
- The present engineered knottin-Fc fusions have several advantages over previously identified integrin-targeting compounds. They possess a compact, disulfide-bonded core that confers proteolytic resistance and exceptional in vivo stability.
- Our studies indicate the half-life of integrin-binding-Fc fusion protein in mouse serum to be greater than 90 hours. Their larger size (˜3-4 kDa) and enhanced affinity compared to RGD-based cyclic peptides confer enhanced pharmacokinetics and biodistribution for molecular imaging and therapeutic applications. These knottin-Fc proteins are small enough to allow for chemical synthesis and site-specific conjugation of imaging probes, radioisotopes, or chemotherapeutic agents. Furthermore, they can easily be chemically modified to further improve in vivo properties if necessary.
- C. Knottin-Fc Fusion
- The knottin-Fc fusions described herein and in U.S. Patent Application No. 2014/0073518, herein incorporated by reference in its entirety, combine an engineered integrin-binding polypeptide (within a knottin scaffold) and an Fc domain or antibody like construct capable of binding FcγR and inducing ADCC.
- The Fc portion of an antibody is formed by the two carboxy terminal domains of the two heavy chains that make up an immunoglobin molecule. The IgG molecule contains 2 heavy chains (˜50 kDa each) and 2 light chains (˜25 kDa each). The general structure of all antibodies is very similar, a small region at the tip of the protein is extremely variable, allowing millions of antibodies with slightly different tip structures to exist. This region is known as the hypervariable region (Fab). The other fragment contains no antigen-binding activity but was originally observed to crystallize readily, and for this reason was named the Fc fragment, for Fragment crystallizable. This fragment corresponds to the paired CH2 and CH3 domains and is the part of the antibody molecule that interacts with effector molecules and cells. The functional differences between heavy-chain isotypes lie mainly in the Fc fragment. The hinge region that links the Fc and Fab portions of the antibody molecule is in reality a flexible tether, allowing independent movement of the two Fab arms, rather than a rigid hinge. This has been demonstrated by electron microscopy of antibodies bound to haptens. Thus the present fusion proteins can be made to contain two knottin peptides, one on each arm of the antibody fragment.
- The Fc portion varies between antibody classes (and subclasses) but is identical within that class. The C-terminal end of the heavy chain forms the Fc region. The Fc region plays an important role as a receptor binding portion. The Fc portion of antibodies will bind to Fc receptors in two different ways. For example, after IgG and IgM bind to a pathogen by their Fab portion their Fc portions can bind to receptors on phagocytic cells (like macrophages) inducing phagocytosis.
- The present knottin-Fc fusions can be implemented such that the Fc portion is used to provide dual binding capability, and/or for half-life extension, for improving expression levels, etc. The Fc fragment in the knottin-Fc can be, for example, from murine IgG2a or human IgG1. Linkers can be optionally used to connect the knottin to the Fc portion. Preferably, the linkers do not affect the binding affinity of the knottin-Fc to integrins or Fc receptors. A variety of Fc domain gene sequences (e.g., mouse and human constant region gene sequences) are available in the form of publicly accessible deposits.
- a. Fc-Domains
- A variety of Fc domain gene sequences (e.g., mouse and human constant region gene sequences) are available in the form of publicly accessible deposits. Constant region domains comprising an Fc domain sequence can be selected lacking a particular effector function and/or with a particular modification to reduce immunogenicity. Many sequences of antibodies and antibody-encoding genes have been published and suitable Fc domain sequences (e.g., hinge, CH2, and/or CH3 sequences, or portions thereof) can be derived from these sequences using art recognized techniques. The genetic material obtained using any of the foregoing methods may then be altered or synthesized to obtain polypeptides used herein. It will further be appreciated that alleles, variants and mutations of constant region DNA sequences are suitable for use in the methods disclosed herein.
- Knottin-Fc suitable for use in the methods disclosed herein may comprise one or more Fc domains (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, or more Fc domains). In one embodiment, the Fc domains may be of different types. In one embodiment, at least one Fc domain present in a knottin-Fc comprises a hinge domain or portion thereof. In another embodiment, a knottin-Fc comprises at least one Fc domain which comprises at least one CH2 domain or portion thereof. In another embodiment, a knottin-Fc comprises at least one Fc domain which comprises at least one CH3 domain or portion thereof. In another embodiment, a knottin-Fc comprises at least one Fc domain which comprises at least one CH4 domain or portion thereof. In another embodiment, a knottin-Fc comprises at least one Fc domain which comprises at least one hinge domain or portion thereof and at least one CH2 domain or portion thereof (e.g, in the hinge-CH2 orientation). In another embodiment, a knottin-Fc comprises at least one Fc domain which comprises at least one CH2 domain or portion thereof and at least one CH3 domain or portion thereof (e.g, in the CH2-CH3 orientation). In another embodiment, a knottin-Fc comprises at least one Fc domain comprising at least one hinge domain or portion thereof, at least one CH2 domain or portion thereof, and least one CH3 domain or portion thereof, for example in the orientation hinge-CH2-CH3, hinge-CH3-CH2, or CH2-CH3-hinge.
- In certain embodiments, a knottin-Fc comprises at least one complete Fc region derived from one or more immunoglobulin heavy chains (e.g., an Fc domain including hinge, CH2, and CH3 domains, although these need not be derived from the same antibody). In other embodiments a knottin-Fc comprises at least two complete Fc domains derived from one or more immunoglobulin heavy chains. In certain embodiments, the complete Fc domain is derived from a human IgG immunoglobulin heavy chain (e.g., human IgG1).
- In another embodiment, a knottin-Fc comprises at least one Fc domain comprising a complete CH3 domain. In another embodiment, a knottin-Fc comprises at least one Fc domain comprising a complete CH2 domain. In another embodiment, a knottin-Fc comprises at least one Fc domain comprising at least a CH3 domain, and at least one of a hinge region, and a CH2 domain. In one embodiment, a knottin-Fc comprises at least one Fc domain comprising a hinge and a CH3 domain. In another embodiment, a knottin-Fc comprises at least one Fc domain comprising a hinge, a CH2, and a CH3 domain. In certain embodiments, the Fc domain is derived from a human IgG immunoglobulin heavy chain (e.g., human IgG1). In certain embodiments, a human IgG1 Fc domain is used with a hinge region mutation, substitution, or deletion to remove or substitute one or more hinge retion cysteine residues.
- The constant region domains or portions thereof making up an Fc domain of a knottin-Fc may be derived from different immunoglobulin molecules. For example, a polypeptide used in the invention may comprise a CH2 domain or portion thereof derived from an IgG1 molecule and a CH3 region or portion thereof derived from an IgG3 molecule. In another example, a knottin-Fc can comprise an Fc domain comprising a hinge domain derived, in part, from an IgG1 molecule and, in part, from an IgG3 molecule. As set forth herein, it will be understood by one of ordinary skill in the art that an Fc domain may be altered such that it varies in amino acid sequence from a naturally occurring antibody molecule.
- In other constructs it may be desirable to provide a peptide spacer between one or more constituent Fc domains. For example, a peptide spacer may be placed between a hinge region and a CH2 domain and/or between a CH2 and a CH3 domain. For example, compatible constructs could be expressed wherein the CH2 domain has been deleted and the remaining CH3 domain (synthetic or unsynthetic) is joined to the hinge region with a 1-20, 1-10, or 1-5 amino acid peptide spacer. Such a peptide spacer may be added, for instance, to ensure that the regulatory elements of the constant region domain remain free and accessible or that the hinge region remains flexible. Preferably, any linker peptide compatible with the instant invention will be relatively non-immunogenic and not prevent proper folding of the Fc.
- b. Changes to Fc Amino Acids
- In certain embodiments, an Fc domain is altered or modified, e.g., by amino acid mutation (e.g., addition, deletion, or substitution). As used herein, the term “Fc domain variant” refers to an Fc domain having at least one amino acid modification, such as an amino acid substitution, as compared to the wild-type Fc from which the Fc domain is derived. For example, wherein the Fc domain is derived from a human IgG1 antibody, a variant comprises at least one amino acid mutation (e.g., substitution) as compared to a wild type amino acid at the corresponding position of the human IgG1 Fc region.
- In certain embodiments, the hinge region of human IgG1 Fc domain is altered by an amino acid substitution or deletion to mutate or remove one or more of three hinge region cysteine residues (located at residues 220, 226, and 229 by EU numbering). In some aspects, the upper hinge region is deleted to remove a cysteine that pairs with the light chain. For example, amino acids “EPKSC” in the upper hinge region are deleted, as set forth in SEQ ID NO: 3. In other aspects, one or more of three hinge region cysteines is mutated (e.g., to serine). In certain embodiments, cysteine 220 is mutated to serine.
- In certain embodiments, the Fc variant comprises a substitution at an amino acid position located in a hinge domain or portion thereof. In another embodiment, the Fc variant comprises a substitution at an amino acid position located in a CH2 domain or portion thereof. In another embodiment, the Fc variant comprises a substitution at an amino acid position located in a CH3 domain or portion thereof. In another embodiment, the Fc variant comprises a substitution at an amino acid position located in a CH4 domain or portion thereof.
- In certain embodiments, a knottin-Fc fusion comprises an Fc variant comprising more than one amino acid substitution. The knottin-Fc fusion used in the methods described herein may comprise, for example, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acid substitutions. Preferably, the amino acid substitutions are spatially positioned from each other by an interval of at least 1 amino acid position or more, for example, at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid positions or more. More preferably, the engineered amino acids are spatially positioned apart from each other by an interval of at least 5, 10, 15, 20, or 25 amino acid positions or more.
- In certain embodiments, a knottin-Fc fusion comprises an amino acid substitution to an Fc domain which alters the antigen-independent effector functions of the polypeptide, in particular the circulating half-life of the polypeptide.
- In one embodiment, the knottin-Fc exhibits enhanced binding to an activating FcyR (e.g. Fcγl, Fcγla, or FcγRIIIa). Exemplary amino acid substitutions which altered FcR or complement binding activity are disclosed in International PCT Publication No. WO 2005/063815 which is incorporated by reference herein. In certain embodiments the Fc region contains at least one of the following mutations: S239D, S239E, L261A, H268D, S298A, A330H, A330L, I332D, I332E, I332Q, K334V, A378F, A378K, A378W, A378Y, H435S, or H435G. In certain embodiments, the Fc region contains at least one of the following mutations: S239D, S239E, I332D or I332E or H268D. In certain embodiments, the Fc region contains at least one of the following mutations: I332D or I332E or H268D.
- The knottin-Fc used herein may also comprise an amino acid substitution which alters the glycosylation of the knottin-Fc. For example, the Fc domain of the knottin-Fc may comprise an Fc domain having a mutation leading to reduced glycosylation (e.g., N- or O-linked glycosylation) or may comprise an altered glycoform of the wild-type Fc domain (e.g., a low fucose or fucose-free glycan). In another embodiment, the knottin-Fc has an amino acid substitution near or within a glycosylation motif, for example, an N-linked glycosylation motif that contains the amino acid sequence NXT or NXS. Exemplary amino acid substitutions which reduce or alter glycosylation are disclosed in WO05/018572 and US2007/0111281, which are incorporated by reference herein. In other embodiments, the knottin-Fc used herein comprises at least one Fc domain having engineered cysteine residue or analog thereof which is located at the solvent-exposed surface. In certain embodiments, the knottin-Fc used herein comprises an Fc domain comprising at least one engineered free cysteine residue or analog thereof that is substantially free of disulfide bonding with a second cysteine residue. Any of the above engineered cysteine residues or analogs thereof may subsequently be conjugated to a functional domain using art-recognized techniques (e.g., conjugated with a thiol-reactive heterobifunctional linker).
- In one embodiment, the knottin-Fc used herein may comprise a genetically fused Fc domain having two or more of its constituent Fc domains independently selected from the Fc domains described herein. In one embodiment, the Fc domains are the same. In another embodiment, at least two of the Fc domains are different. For example, the Fc domains of the knottin-Fc used herein comprise the same number of amino acid residues or they may differ in length by one or more amino acid residues (e.g., by about 5 amino acid residues (e.g., 1, 2, 3, 4, or 5 amino acid residues), about 10 residues, about 15 residues, about 20 residues, about 30 residues, about 40 residues, or about 50 residues). In yet other embodiments, the Fc domains of the knottin-Fc used herein may differ in sequence at one or more amino acid positions. For example, at least two of the Fc domains may differ at about 5 amino acid positions (e.g., 1, 2, 3, 4, or 5 amino acid positions), about 10 positions, about 15 positions, about 20 positions, about 30 positions, about 40 positions, or about 50 positions).
- In certain embodiments, immune checkpoint blockers are used in combination with other therapeutic agents described herein (e.g., extended-PK IL-2 and integrin-binding-Fc fusion protein). T cell activation and effector functions are balanced by co-stimulatory and inhibitory signals, referred to as “immune checkpoints.” Inhibitory ligands and receptors that regulate T cell effector functions are overexpressed on tumor cells. Subsequently, agonists of co-stimulatory receptors or antagonists of inhibitory signals, result in the amplification of antigen-specific T cell responses. In contrast to therapeutic antibodies which target tumor cells directly, immune checkpoint blockers enhance endogenous anti-tumor activity. In certain embodiments, the immune checkpoint blocker suitable for use in the methods disclosed herein, is an antagonist of inhibitory signals, e.g., an antibody which targets, for example, PD-1, PD-L1, CTLA-4, LAGS, B7-H3, B7-H4, and TIM3. These ligands and receptors are reviewed in Pardon, D., Nature. 12: 252-264, 2012.
- Disclosed herein are methods for treating a subject afflicted with diseases such as cancer, which methods comprise administering to the subject a composition comprising a therapeutically effective amount of a molecule which blocks the immune checkpoint, and an integrin-binding-Fc fusion protein. In certain embodiments, the methods for treating a subject afflicted with diseases such as cancer, which methods comprise administering to the subject a composition comprising a therapeutically effective amount of a molecule which blocks the immune checkpoint, an integrin-binding-Fc fusion protein, and IL-2 (e.g., extended-PK IL-2). In certain embodiments, the immune checkpoint blocker is an antibody or an antigen-binding portion thereof, that disrupts or inhibits signaling from an inhibitory immunoregulator. In certain embodiments, the immune checkpoint blocker is a small molecule that disrupts or inhibits signaling from an inhibitory immunoregulator.
- In certain embodiments, the inhibitory immunoregulator (immune checkpoint blocker) is a component of the PD-1/PD-L1 signaling pathway. Accordingly, certain embodiments provide methods for immunotherapy of a subject afflicted with cancer, which methods comprise administering to the subject a therapeutically effective amount of an antibody or an antigen-binding portion thereof that disrupts the interaction between the PD-1 receptor and its ligand, PD-L1. Antibodies known in the art which bind to PD-1 and disrupt the interaction between the PD-1 and its ligand, PD-L1, and stimulates an anti-tumor immune response, are suitable for use in the methods disclosed herein. In certain embodiments, the antibody or antigen-binding portion thereof binds specifically to PD-1. For example, antibodies that target PD-1 include, e.g., nivolumab (BMS-936558, Bristol-Myers Squibb) and pembrolizumab (lambrolizumab, MK03475, Merck). Other suitable antibodies for use in the methods disclosed herein are anti-PD-1 antibodies disclosed in U.S. Pat. No. 8,008,449, herein incorporated by reference. In certain embodiments, the antibody or antigen-binding portion thereof binds specifically to PD-L1 and inhibits its interaction with PD-1, thereby increasing immune activity. Antibodies known in the art which bind to PD-L1 and disrupt the interaction between the PD-1 and PD-L1, and stimulates an anti-tumor immune response, are suitable for use in the methods disclosed herein. For example, antibodies that target PD-L1 and are in clinical trials, include BMS-936559 (Bristol-Myers Squibb) and MPDL3280A (Genetech). Other suitable antibodies that target PD-L1 are disclosed in U.S. Pat. No. 7,943,743, herein incorporated by reference. It will be understood by one of ordinary skill that any antibody which binds to PD-1 or PD-L1, disrupts the PD-1/PD-L1 interaction, and stimulates an anti-tumor immune response, are suitable for use in the methods disclosed herein.
- In certain embodiments, the inhibitory immunoregulator is a component of the CTLA-4 signaling pathway. Accordingly, certain embodiments provide methods for immunotherapy of a subject afflicted with cancer, which methods comprise administering to the subject a therapeutically effective amount of an antibody or an antigen-binding portion thereof that targets CTLA-4 and disrupts its interaction with CD80 and CD86. Exemplary antibodies that target CTLA-4 include ipilimumab (MDX-010, MDX-101, Bristol-Myers Squibb), which is FDA approved, and tremelimumab (ticilimumab, CP-675, 206, Pfizer), currently undergoing human trials. Other suitable antibodies that target CTLA-4 are disclosed in WO 2012/120125, U.S. Pat. Nos. 6,984720, 6,682,7368, and U.S. Patent Applications 2002/0039581, 2002/0086014, and 2005/0201994, herein incorporated by reference. It will be understood by one of ordinary skill that any antibody which binds to CTLA-4, disrupts its interaction with CD80 and CD86, and stimulates an anti-tumor immune response, are suitable for use in the methods disclosed herein.
- In certain embodiments, the inhibitory immunoregulator is a component of the LAG3 (lymphocyte activation gene 3) signaling pathway. Accordingly, certain embodiments provide methods for immunotherapy of a subject afflicted with cancer, which methods comprise administering to the subject a therapeutically effective amount of an antibody or an antigen-binding portion thereof that targets LAG3 and disrupts its interaction with MHC class II molecules. An exemplary antibody that targets LAG3 is IMP321 (Immutep), currently undergoing human trials. Other suitable antibodies that target LAG3 are disclosed in U.S. Patent Application 2011/0150892, herein incorporated by reference. It will be understood by one of ordinary skill that any antibody which binds to LAG3, disrupts its interaction with MHC class II molecules, and stimulates an anti-tumor immune response, are suitable for use in the methods disclosed herein.
- In certain embodiments, the inhibitory immunoregulator is a component of the B7 family signaling pathway. In certain embodiments, the B7 family members are B7-H3 and B7-H4. Accordingly, certain embodiments provide methods for immunotherapy of a subject afflicted with cancer, which methods comprise administering to the subject a therapeutically effective amount of an antibody or an antigen-binding portion thereof that targets B7-H3 or -H4. The B7 family does not have any defined receptors but these ligands are upregulated on tumor cells or tumor-infiltrating cells. Preclinical mouse models have shown that blockade of these ligands can enhance anti-tumor immunity. An exemplary antibody that targets B7-H3 is MGA271 (Macrogenics), currently undergoing human trials. Other suitable antibodies that target B7 family members are disclosed in U.S. Patent Application 2013/0149236, herein incorporated by reference. It will be understood by one of ordinary skill that any antibody which binds to B7-H3 or H4, and stimulates an anti-tumor immune response, are suitable for use in the methods disclosed herein.
- In certain embodiments, the inhibitory immunoregulator is a component of the TIM3 (T cell membrane protein 3) signaling pathway. Accordingly, certain embodiments provide methods for immunotherapy of a subject afflicted with cancer, which methods comprise administering to the subject a therapeutically effective amount of an antibody or an antigen-binding portion thereof that targets TIM3 and disrupts its interaction with galectin 9. Suitable antibodies that target TIM3 are disclosed in U.S. Patent Application 2013/0022623, herein incorporated by reference. It will be understood by one of ordinary skill that any antibody which binds to TIM3, disrupts its interaction with galectin 9, and stimulates an anti-tumor immune response, are suitable for use in the methods disclosed herein.
- It should be understood that antibodies targeting immune checkpoints suitable for use in the methods disclosed herein are not limited to those described supra. Moreover, it will be understood by one of ordinary skill in the art that other immune checkpoint targets can also be targeted by antagonists or antibodies in the methods described herein, provided that the targeting results in the stimulation of an anti-tumor immune response as reflected in, e.g., an increase in T cell proliferation, enhanced T cell activation, and/or increased cytokine production (e.g., IFN-γ, IL-2).
- In certain embodiments, an antagonist of vascular endothelial growth factor (VEGF) is used in place of an immune checkpoint blocker. VEGF has recently been demonstrated to play a role in immune suppression (Liang, W.-C. et al. J. Biol. Chem. (2006) Vol 281: 951-961; Voron, T. et al. Front Oncol (2014) Vol. 4:
Article 70; Terme, M. et al., Clin Dev Immunol (2012) Vol. 2012: Article ID 492920; Kandalaft, E. et al., Curr Top Microbiol Immunol (2011) Vol 344: 129-48), therefore blocking its activity would enhance the immune response, similar to that of an immune checkpoint blocker. A “VEGF antagonist” refers to a molecule capable of neutralizing, blocking, inhibiting, abrogating, reducing or interfering with VEGF activities including its binding to one or more VEGF receptors. Non-limiting examples of VEGF antagonists include anti-VEGF antibodies and antigen-binding fragments thereof, receptor molecules and derivatives which bind specifically to VEGF thereby sequestering its binding to one or more receptors (e.g., a VEGF receptor), anti-VEGF receptor antibodies, VEGF receptor antagonists such as small molecule inhibitors of the VEGFR tyrosine kinases, or a dominant negative VEGF. - In certain embodiments, the VEGF antagonist is an antibody. An “anti-VEGF antibody” is an antibody that binds to VEGF with sufficient affinity and specificity. Non-limiting examples of anti-VEGF antibodies are described in U.S. Pat. Nos. 6,884,879, 7,060,269, 6,582,959, 6,703,030, 6,054,297, US Patent Application Nos. 2006009360, 20050186208, 20030206899, 20030190317, 20030203409, 20050112126, and PCT Publication Nos. WO 98/45332, 96/30046, 94/10202, 05/044853, 13/181452. The contents of these patents and patent applications are herein incorporated by reference. In certain embodiments the VEGF antibody is bevacizumab (Avastin® Genentech/Roche) or ranibizumab (Lucentis® Genentech/Roche).
- In certain embodiments, the VEGF antagonist binds to the VEGF receptor. VEGF receptors, or fragments thereof, that specifically bind to VEGF can be used to bind to and sequester the VEGF protein, thereby preventing it from activating downstream signaling. In certain embodiments, the VEGF receptor, or VEGF binding fragment thereof, is a soluble VEGF receptor, such as sFlt-1. The soluble form of the receptor exerts an inhibitory effect on the biological activity of VEGF by binding to VEGF, thereby preventing it from binding to its natural receptors present on the surface of target cells. Non-limiting examples of VEGF antagonists which bind the VEGF receptor are disclosed in PCT Application Nos. 97/44453, 05/000895 and U.S. Patent Application No. 20140057851. In certain embodiments the VEGF antagonist is a polypeptide with a bifunctional single-chain antagonistic human VEGF variant comprising a modified VEGF wherein the modified VEGF comprises a loop with an integrin-recognition RGD sequence, as described in U.S. Pat. Nos. 8,741,839, herein incorporated by reference.
- In certain embodiments, the extended-PK group is optionally fused to IL-2 via a linker. In certain embodiments, an integrin-binding polypeptide is fused to an Fc fragment via a linker. Suitable linkers are well known in the art, such as those disclosed in, e.g., US2010/0210511 US2010/0179094, and US2012/0094909, which are herein incorporated by reference in its entirety. Exemplary linkers include gly-ser polypeptide linkers, glycine-proline polypeptide linkers, and proline-alanine polypeptide linkers. In a certain embodiment, the linker is a gly-ser polypeptide linker, i.e., a peptide that consists of glycine and serine residues.
- Exemplary gly-ser polypeptide linkers comprise the amino acid sequence Ser(Gly4Ser)n (SEQ ID NO: 134). In one embodiment, n=1. In one embodiment, n=2. In another embodiment, n=3, i.e., Ser(Gly4Ser)3 (SEQ ID NO: 135). In another embodiment, n=4, i.e., Ser(Gly4Ser)4 (SEQ ID NO: 136). In another embodiment, n=5. In yet another embodiment, n=6. In another embodiment, n=7. In yet another embodiment, n=8. In another embodiment, n=9. In yet another embodiment, n=10. Another exemplary gly-ser polypeptide linker comprises (Gly4Ser)n (SEQ ID NO: 137). In one embodiment, n=1. In one embodiment, n=2. In a certain embodiment, n=3. In another embodiment, n=4. In another embodiment, n=5. In yet another embodiment, n=6. Another exemplary gly-ser polypeptide linker comprises (Gly3Ser)n (SEQ ID NO: 138). In one embodiment, n=1. In one embodiment, n=2. In a certain embodiment, n=3. In another embodiment, n=4. In another embodiment, n=5. In yet another embodiment, n=6.
- The integrin-binding-Fc fusion protein suitable for use in the methods disclosed herein, can be used in conjunction with one or more therapeutic agents. In one embodiment, the therapeutic agent is a therapeutic antibody. In another embodiment, the therapeutic agent is a therapeutic protein. In another embodiment, the therapeutic agent is a small molecule. In another embodiment, the therapeutic agent is an antigen. In another embodiment, the therapeutic agent is a population of cells.
- Also provided herein are engineered molecules that comprise two or more of IL-2, and an antibody (e.g., a therapeutic antibody, an immune checkpoint blocker, or an antibody that antagonizes VEGF) or antibody fragment described herein. Such engineered molecules can effectively reduce the number of components to be administered to a subject (e.g., a cancer patient) in the methods described herein. In some embodiments, the antibody or antibody fragment serves as the scaffold for conjugation with other components (e.g., IL-2).
- Accordingly, in certain embodiments, the engineered molecule comprises IL-2 and an antibody or antibody fragment. In a particular embodiment, the antibody for use in the engineered protein is a bispecific antibody, wherein one component is a therapeutic antibody and the other component is an antibody that binds to an immune checkpoint blocker or an antibody that antagonizes VEGF activity. Methods for generating bispecific antibodies are known in the art.
- Accordingly, in certain embodiments, the engineered molecule comprises IL-2 and a bispecific antibody which binds to a therapeutic target and an immune checkpoint blocker or an antibody that antagonizes VEGF.
- In certain embodiments, the IL-2 component for use in the engineered protein is an IL-2 lacking a pharmacokinetic moiety (i.e., a non-extended-PK IL-2). In other embodiments, the IL-2 comprises a pharmacokinetic moiety (an extended-PK IL-2).
- In certain embodiments, the components of the engineered molecule are conjugated to the antibody or bispecific antibody with or without a linker. Suitable linkers for conjugation are described herein and extensively described in the art.
- Regions to which polypeptide-based components (e.g., IL-2) of the engineered molecule can be fused, with or without a linker, to the antibody are generally known in the art, and include, for example, the C-terminus of the antibody heavy chain, and the C-terminus of the antibody light chain.
- In certain embodiments, components of the engineered molecule do not interfere with the function of the other components. By way of example, when the engineered protein comprises a therapeutic antibody and IL-2, the IL-2 will be fused to the therapeutic antibody in a manner such that the antibody retains its antigen-binding function, and IL-2 retains the ability to interact with its receptor. The methods described herein, e.g., in the Examples, can be used to determine whether components of the engineered protein retain their respective functions.
- In some aspects, the polypeptides described herein (e.g., IL-2, such as extended-PK IL-2, and knottin-Fc) are made in transformed host cells using recombinant DNA techniques. To do so, a recombinant DNA molecule coding for the peptide is prepared. Methods of preparing such DNA molecules are well known in the art. For instance, sequences coding for the peptides could be excised from DNA using suitable restriction enzymes. Alternatively, the DNA molecule could be synthesized using chemical synthesis techniques, such as the phosphoramidate method. Also, a combination of these techniques could be used.
- The methods of making polypeptides also include a vector capable of expressing the peptides in an appropriate host. The vector comprises the DNA molecule that codes for the peptides operatively linked to appropriate expression control sequences. Methods of affecting this operative linking, either before or after the DNA molecule is inserted into the vector, are well known. Expression control sequences include promoters, activators, enhancers, operators, ribosomal nuclease domains, start signals, stop signals, cap signals, polyadenylation signals, and other signals involved with the control of transcription or translation.
- The resulting vector having the DNA molecule thereon is used to transform an appropriate host. This transformation may be performed using methods well known in the art.
- Any of a large number of available and well-known host cells may be used in the practice of this invention. The selection of a particular host is dependent upon a number of factors recognized by the art. These include, for example, compatibility with the chosen expression vector, toxicity of the peptides encoded by the DNA molecule, rate of transformation, ease of recovery of the peptides, expression characteristics, bio-safety and costs. A balance of these factors must be struck with the understanding that not all hosts may be equally effective for the expression of a particular DNA sequence. Within these general guidelines, useful microbial hosts include bacteria (such as E. coli sp.), yeast (such as Saccharomyces sp.) and other fungi, insects, plants, mammalian (including human) cells in culture, or other hosts known in the art.
- Next, the transformed host is cultured and purified. Host cells may be cultured under conventional fermentation conditions so that the desired compounds are expressed. Such fermentation conditions are well known in the art. Finally, the peptides are purified from culture by methods well known in the art.
- The compounds may also be made by synthetic methods. For example, solid phase synthesis techniques may be used. Suitable techniques are well known in the art, and include those described in Merrifield (1973), Chem. Polypeptides, pp. 335-61 (Katsoyannis and Panayotis eds.); Merrifield (1963), J. Am. Chem. Soc. 85: 2149; Davis et al. (1985), Biochem. Intl. 10: 394-414; Stewart and Young (1969), Solid Phase Peptide Synthesis; U.S. Pat. No. 3,941,763; Finn et al. (1976), The Proteins (3rd ed.) 2: 105-253; and Erickson et al. (1976), The Proteins (3rd ed.) 2: 257-527. Solid phase synthesis is the preferred technique of making individual peptides since it is the most cost-effective method of making small peptides. Compounds that contain derivatized peptides or which contain non-peptide groups may be synthesized by well-known organic chemistry techniques.
- Other methods are of molecule expression/synthesis are generally known in the art to one of ordinary skill.
- The nucleic acid molecules described above can be contained within a vector that is capable of directing their expression in, for example, a cell that has been transduced with the vector. Accordingly, in addition to extended-PK IL-2 and knottin-Fc mutants, expression vectors containing a nucleic acid molecule encoding an extended-PK IL-2 or knottin-Fc mutant and cells transfected with these vectors are among the certain embodiments.
- Vectors suitable for use include T7-based vectors for use in bacteria (see, for example, Rosenberg et al., Gene 56: 125, 1987), the pMSXND expression vector for use in mammalian cells (Lee and Nathans, J. Biol. Chem. 263:3521, 1988), and baculovirus-derived vectors (for example the expression vector pBacPAKS from Clontech, Palo Alto, Calif.) for use in insect cells. The nucleic acid inserts, which encode the polypeptide of interest in such vectors, can be operably linked to a promoter, which is selected based on, for example, the cell type in which expression is sought. For example, a T7 promoter can be used in bacteria, a polyhedrin promoter can be used in insect cells, and a cytomegalovirus or metallothionein promoter can be used in mammalian cells. Also, in the case of higher eukaryotes, tissue-specific and cell type-specific promoters are widely available. These promoters are so named for their ability to direct expression of a nucleic acid molecule in a given tissue or cell type within the body. Skilled artisans are well aware of numerous promoters and other regulatory elements which can be used to direct expression of nucleic acids.
- In addition to sequences that facilitate transcription of the inserted nucleic acid molecule, vectors can contain origins of replication, and other genes that encode a selectable marker. For example, the neomycin-resistance (neor) gene imparts G418 resistance to cells in which it is expressed, and thus permits phenotypic selection of the transfected cells. Those of skill in the art can readily determine whether a given regulatory element or selectable marker is suitable for use in a particular experimental context.
- Viral vectors that can be used in the invention include, for example, retroviral, adenoviral, and adeno-associated vectors, herpes virus, simian virus 40 (SV40), and bovine papilloma virus vectors (see, for example, Gluzman (Ed.), Eukaryotic Viral Vectors, CSH Laboratory Press, Cold Spring Harbor, N.Y.).
- Prokaryotic or eukaryotic cells that contain and express a nucleic acid molecule that encodes an extended-PK IL-2 or knottin-Fc mutant are also features of the invention. A cell of the invention is a transfected cell, i.e., a cell into which a nucleic acid molecule, for example a nucleic acid molecule encoding an extended-PK IL-2 mutant or knottin-Fc, has been introduced by means of recombinant DNA techniques. The progeny of such a cell are also considered within the scope of the invention.
- The precise components of the expression system are not critical. For example, an extended-PK IL-2 or knottin-Fc mutant can be produced in a prokaryotic host, such as the bacterium E. coli, or in a eukaryotic host, such as an insect cell (e.g., an Sf21 cell), or mammalian cells (e.g., COS cells, NIH 3T3 cells, or HeLa cells). These cells are available from many sources, including the American Type Culture Collection (Manassas, Va.). In selecting an expression system, it matters only that the components are compatible with one another. Artisans or ordinary skill are able to make such a determination. Furthermore, if guidance is required in selecting an expression system, skilled artisans may consult Ausubel et al. (Current Protocols in Molecular Biology, John Wiley and Sons, New York, N.Y., 1993) and Pouwels et al. (Cloning Vectors: A Laboratory Manual, 1985 Suppl. 1987).
- The expressed polypeptides can be purified from the expression system using routine biochemical procedures, and can be used, e.g., as therapeutic agents, as described herein.
- In certain embodiments, IL-2 is administered together (simultaneously or sequentially) with a knottin-Fc. In certain embodiments, IL-2 is administered prior to the administration of a knottin-Fc. In certain embodiments, IL-2 is administered concurrently with the administration of a knottin-Fc. In certain embodiments, IL-2 is administered subsequent to the administration of a knottin-Fc. In certain embodiments, the IL-2 and a knottin-Fc are administered simultaneously. In other embodiments, the IL-2 and a knottin-Fc are administered sequentially. In yet other embodiments, the IL-2 and a knottin-Fc are administered within one, two, or three days of each other.
- In certain embodiments, IL-2 and knottin-Fc are administered with an immune checkpoint blocker. In certain embodiments the immune checkpoint blocker is an anti-PD-1 antibody. In certain embodiments, the immune checkpoint blocker is an anti-CTLA-4 antibody. In certain embodiments, an antagonist of VEGF is used in place of an immune checkpoint blocker.
- Pharmaceutical compositions of the invention can be administered in combination therapy, i.e., combined with other agents. Agents include, but are not limited to, in vitro synthetically prepared chemical compositions, antibodies, antigen binding regions, and combinations and conjugates thereof. In certain embodiments, an agent can act as an agonist, antagonist, allosteric modulator, or toxin.
- In certain embodiments, the invention provides for separate pharmaceutical compositions comprising extended-PK IL-2 with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant, and another pharmaceutical composition comprising a knottin-Fc with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant. In certain embodiments, the invention further provides for a separate pharmaceutical composition comprising an immune checkpoint blocker (or an antagonist of VEGF) with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant. In certain embodiments, the pharmaceutical compositions comprise both extended-PK IL-2 and knottin-Fc with a pharmaceutically acceptable diluents, carrier, solubilizer, emulsifier, preservative and/or adjuvant. In certain embodiments, the pharmaceutical composition comprises extended-PK IL-2, knottin-Fc, and an immune checkpoint blocker (or an antagonist of VEGF) with a pharmaceutically acceptable diluents, carrier, solubilizer, emulsifier, preservative and/or adjuvant.
- In certain embodiments, the invention provides for pharmaceutical compositions comprising extended-PK IL-2, together with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant, and another pharmaceutical composition comprises a knottin-Fc, together with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant. In certain embodiments, the invention provides for pharmaceutical compositions comprising an immune checkpoint blocker, together with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant. In certain embodiments, each of the agents, e.g., extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), can be formulated as separate compositions. In certain embodiments, acceptable formulation materials preferably are nontoxic to recipients at the dosages and concentrations employed. In certain embodiments, the formulation material(s) are for s.c. and/or I.V. administration. In certain embodiments, the pharmaceutical composition can contain formulation materials for modifying, maintaining or preserving, for example, the pH, osmolality, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption or penetration of the composition. In certain embodiments, suitable formulation materials include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine or lysine); antimicrobials; antioxidants (such as ascorbic acid, sodium sulfite or sodium hydrogen-sulfite); buffers (such as borate, bicarbonate, Tris-HCl, citrates, phosphates or other organic acids); bulking agents (such as mannitol or glycine); chelating agents (such as ethylenediamine tetraacetic acid (EDTA)); complexing agents (such as caffeine, polyvinylpyrrolidone, beta-cyclodextrin or hydroxypropyl-beta-cyclodextrin); fillers; monosaccharides; disaccharides; and other carbohydrates (such as glucose, mannose or dextrins); proteins (such as serum albumin, gelatin or immunoglobulins); coloring, flavoring and diluting agents; emulsifying agents; hydrophilic polymers (such as polyvinylpyrrolidone); low molecular weight polypeptides; salt-forming counterions (such as sodium); preservatives (such as benzalkonium chloride, benzoic acid, salicylic acid, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid or hydrogen peroxide); solvents (such as glycerin, propylene glycol or polyethylene glycol); sugar alcohols (such as mannitol or sorbitol); suspending agents; surfactants or wetting agents (such as pluronics, PEG, sorbitan esters, polysorbates such as polysorbate 20, polysorbate 80, triton, tromethamine, lecithin, cholesterol, tyloxapal); stability enhancing agents (such as sucrose or sorbitol); tonicity enhancing agents (such as alkali metal halides, preferably sodium or potassium chloride, mannitol sorbitol); delivery vehicles; diluents; excipients and/or pharmaceutical adjuvants. (Remington's Pharmaceutical Sciences, 18th Edition, A. R. Gennaro, ed., Mack Publishing Company (1995). In certain embodiments, the formulation comprises PBS; 20 mM NaOAC, pH 5.2, 50 mM NaCl; and/or 10 mM NAOAC, pH 5.2, 9% Sucrose. In certain embodiments, the optimal pharmaceutical composition will be determined by one skilled in the art depending upon, for example, the intended route of administration, delivery format and desired dosage. See, for example, Remington's Pharmaceutical Sciences, supra. In certain embodiments, such compositions may influence the physical state, stability, rate of in vivo release and rate of in vivo clearance of extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF).
- In certain embodiments, the primary vehicle or carrier in a pharmaceutical composition can be either aqueous or non-aqueous in nature. For example, in certain embodiments, a suitable vehicle or carrier can be water for injection, physiological saline solution or artificial cerebrospinal fluid, possibly supplemented with other materials common in compositions for parenteral administration. In certain embodiments, the saline comprises isotonic phosphate-buffered saline. In certain embodiments, neutral buffered saline or saline mixed with serum albumin are further exemplary vehicles. In certain embodiments, pharmaceutical compositions comprise Tris buffer of about pH 7.0-8.5, or acetate buffer of about pH 4.0-5.5, which can further include sorbitol or a suitable substitute therefore. In certain embodiments, a composition comprising extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), can be prepared for storage by mixing the selected composition having the desired degree of purity with optional formulation agents (Remington's Pharmaceutical Sciences, supra) in the form of a lyophilized cake or an aqueous solution. Further, in certain embodiments, a composition comprising extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), can be formulated as a lyophilizate using appropriate excipients such as sucrose.
- In certain embodiments, the pharmaceutical composition can be selected for parenteral delivery. In certain embodiments, the compositions can be selected for inhalation or for delivery through the digestive tract, such as orally. The preparation of such pharmaceutically acceptable compositions is within the ability of one skilled in the art.
- In certain embodiments, the formulation components are present in concentrations that are acceptable to the site of administration. In certain embodiments, buffers are used to maintain the composition at physiological pH or at a slightly lower pH, typically within a pH range of from about 5 to about 8.
- In certain embodiments, when parenteral administration is contemplated, a therapeutic composition can be in the form of a pyrogen-free, parenterally acceptable aqueous solution comprising a desired extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), in a pharmaceutically acceptable vehicle. In certain embodiments, a vehicle for parenteral injection is sterile distilled water in which extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), are formulated as a sterile, isotonic solution, properly preserved. In certain embodiments, the preparation can involve the formulation of the desired molecule with an agent, such as injectable microspheres, bio-erodible particles, polymeric compounds (such as polylactic acid or polyglycolic acid), beads or liposomes, that can provide for the controlled or sustained release of the product which can then be delivered via a depot injection. In certain embodiments, hyaluronic acid can also be used, and can have the effect of promoting sustained duration in the circulation. In certain embodiments, implantable drug delivery devices can be used to introduce the desired molecule.
- In certain embodiments, a pharmaceutical composition can be formulated for inhalation. In certain embodiments, extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), can be formulated as a dry powder for inhalation. In certain embodiments, an inhalation solution comprising extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), can be formulated with a propellant for aerosol delivery. In certain embodiments, solutions can be nebulized. Pulmonary administration is further described in PCT application No. PCT/US94/001875, which describes pulmonary delivery of chemically modified proteins.
- In certain embodiments, it is contemplated that formulations can be administered orally. In certain embodiments, extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), that is administered in this fashion can be formulated with or without those carriers customarily used in the compounding of solid dosage forms such as tablets and capsules. In certain embodiments, a capsule can be designed to release the active portion of the formulation at the point in the gastrointestinal tract when bioavailability is maximized and pre-systemic degradation is minimized In certain embodiments, at least one additional agent can be included to facilitate absorption of extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF). In certain embodiments, diluents, flavorings, low melting point waxes, vegetable oils, lubricants, suspending agents, tablet disintegrating agents, and binders can also be employed.
- In certain embodiments, a pharmaceutical composition can involve an effective quantity of extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), in a mixture with non-toxic excipients which are suitable for the manufacture of tablets. In certain embodiments, by dissolving the tablets in sterile water, or another appropriate vehicle, solutions can be prepared in unit-dose form. In certain embodiments, suitable excipients include, but are not limited to, inert diluents, such as calcium carbonate, sodium carbonate or bicarbonate, lactose, or calcium phosphate; or binding agents, such as starch, gelatin, or acacia; or lubricating agents such as magnesium stearate, stearic acid, or talc.
- Additional pharmaceutical compositions will be evident to those skilled in the art, including formulations involving extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), in sustained- or controlled-delivery formulations. In certain embodiments, techniques for formulating a variety of other sustained- or controlled-delivery means, such as liposome carriers, bio-erodible microparticles or porous beads and depot injections, are also known to those skilled in the art. See for example, PCT Application No. PCT/US93/00829 which describes the controlled release of porous polymeric microparticles for the delivery of pharmaceutical compositions. In certain embodiments, sustained-release preparations can include semipermeable polymer matrices in the form of shaped articles, e.g. films, or microcapsules. Sustained release matrices can include polyesters, hydrogels, polylactides (U.S. Pat. No. 3,773,919 and EP 058,481), copolymers of L-glutamic acid and gamma ethyl-L-glutamate (Sidman et al., Biopolymers, 22:547-556 (1983)), poly (2-hydroxyethyl-methacrylate) (Langer et al., J. Biomed. Mater. Res., 15: 167-277 (1981) and Langer, Chem. Tech., 12:98-105 (1982)), ethylene vinyl acetate (Langer et al., supra) or poly-D(−)-3-hydroxybutyric acid (EP 133,988). In certain embodiments, sustained release compositions can also include liposomes, which can be prepared by any of several methods known in the art. See, e.g., Eppstein et al, Proc. Natl. Acad. Sci. USA, 82:3688-3692 (1985); EP 036,676; EP 088,046 and EP 143,949.
- The pharmaceutical composition to be used for in vivo administration typically is sterile. In certain embodiments, this can be accomplished by filtration through sterile filtration membranes. In certain embodiments, where the composition is lyophilized, sterilization using this method can be conducted either prior to or following lyophilization and reconstitution. In certain embodiments, the composition for parenteral administration can be stored in lyophilized form or in a solution. In certain embodiments, parenteral compositions generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
- In certain embodiments, once the pharmaceutical composition has been formulated, it can be stored in sterile vials as a solution, suspension, gel, emulsion, solid, or as a dehydrated or lyophilized powder. In certain embodiments, such formulations can be stored either in a ready-to-use form or in a form (e.g., lyophilized) that is reconstituted prior to administration.
- In certain embodiments, kits are provided for producing a single-dose administration unit. In certain embodiments, the kit can contain both a first container having a dried protein and a second container having an aqueous formulation. In certain embodiments, kits containing single and multi-chambered pre-filled syringes (e.g., liquid syringes and lyosyringes) are included.
- In certain embodiments, the effective amount of a pharmaceutical composition comprising extended-PK IL-2 and/or one or more pharmaceutical compositions comprising a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), to be employed therapeutically will depend, for example, upon the therapeutic context and objectives. One skilled in the art will appreciate that the appropriate dosage levels for treatment, according to certain embodiments, will thus vary depending, in part, upon the molecule delivered, the indication for which extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), are being used, the route of administration, and the size (body weight, body surface or organ size) and/or condition (the age and general health) of the patient. In certain embodiments, the clinician can titer the dosage and modify the route of administration to obtain the optimal therapeutic effect. In certain embodiments, a typical dosage of extended-PK IL-2 and a knottin-Fc can each range from about 0.1 pg/kg to up to about 100 mg/kg or more, depending on the factors mentioned above. In certain embodiments, the dosage can range from 0.1 pg/kg up to about 100 mg/kg; or 1 pg/kg up to about 100 mg/kg; or 5 pg/kg up to about 100 mg/kg.
- In certain embodiments, a typical dosage for an immune checkpoint blocker can range from about 0.1 mg/kg to up to about 300 mg/kg or more, depending on the factors mentioned above. In certain embodiments, the dosage can range from 1 mg/kg up to about 300 mg/kg; or 5 mg/kg up to about 300 mg/kg; or 10 mg/kg up to about 300 mg/kg.
- In certain embodiments, the frequency of dosing will take into account the pharmacokinetic parameters of extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), in the formulation used. In certain embodiments, a clinician will administer the composition until a dosage is reached that achieves the desired effect. In certain embodiments, the composition can therefore be administered as a single dose, or as two or more doses (which may or may not contain the same amount of the desired molecule) over time, or as a continuous infusion via an implantation device or catheter. Further refinement of the appropriate dosage is routinely made by those of ordinary skill in the art and is within the ambit of tasks routinely performed by them. In certain embodiments, appropriate dosages can be ascertained through use of appropriate dose-response data. As described in the Examples below, dosing can occur daily, every other day, or weekly, all with similar anti-tumor responses.
- In certain embodiments, the route of administration of the pharmaceutical composition is in accord with known methods, e.g. orally, through injection by intravenous, intraperitoneal, intracerebral (intra-parenchymal), intracerebroventricular, intramuscular, subcutaneously, intra-ocular, intraarterial, intraportal, or intralesional routes; by sustained release systems or by implantation devices. In certain embodiments, the compositions can be administered by bolus injection or continuously by infusion, or by implantation device. In certain embodiments, individual elements of the combination therapy may be administered by different routes.
- In certain embodiments, the composition can be administered locally via implantation of a membrane, sponge or another appropriate material onto which the desired molecule has been absorbed or encapsulated. In certain embodiments, where an implantation device is used, the device can be implanted into any suitable tissue or organ, and delivery of the desired molecule can be via diffusion, timed-release bolus, or continuous administration. In certain embodiments, it can be desirable to use a pharmaceutical composition comprising extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), in an ex vivo manner In such instances, cells, tissues and/or organs that have been removed from the patient are exposed to a pharmaceutical composition comprising extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), after which the cells, tissues and/or organs are subsequently implanted back into the patient.
- In certain embodiments, extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), can be delivered by implanting certain cells that have been genetically engineered, using methods such as those described herein, to express and secrete the polypeptides. In certain embodiments, such cells can be animal or human cells, and can be autologous, heterologous, or xenogeneic. In certain embodiments, the cells can be immortalized. In certain embodiments, in order to decrease the chance of an immunological response, the cells can be encapsulated to avoid infiltration of surrounding tissues. In certain embodiments, the encapsulation materials are typically biocompatible, semi-permeable polymeric enclosures or membranes that allow the release of the protein product(s) but prevent the destruction of the cells by the patient's immune system or by other detrimental factors from the surrounding tissues.
- The extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), and/or nucleic acids expressing them, described herein, are useful for treating a disorder associated with abnormal apoptosis or a differentiative process (e.g., cellular proliferative disorders or cellular differentiative disorders, such as cancer). Non-limiting examples of cancers that are amenable to treatment with the methods of the present invention are described below.
- Examples of cellular proliferative and/or differentiative disorders include cancer (e.g., carcinoma, sarcoma, metastatic disorders or hematopoietic neoplastic disorders, e.g., leukemias). A metastatic tumor can arise from a multitude of primary tumor types, including but not limited to those of prostate, colon, lung, breast and liver. Accordingly, the compositions used herein, comprising, e.g., extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), can be administered to a patient who has cancer.
- As used herein, we may use the terms “cancer” (or “cancerous”), “hyperproliferative,” and “neoplastic” to refer to cells having the capacity for autonomous growth (i.e., an abnormal state or condition characterized by rapidly proliferating cell growth). Hyperproliferative and neoplastic disease states may be categorized as pathologic (i.e., characterizing or constituting a disease state), or they may be categorized as non-pathologic (i.e., as a deviation from normal but not associated with a disease state). The terms are meant to include all types of cancerous growths or oncogenic processes, metastatic tissues or malignantly transformed cells, tissues, or organs, irrespective of histopathologic type or stage of invasiveness. “Pathologic hyperproliferative” cells occur in disease states characterized by malignant tumor growth. Examples of non-pathologic hyperproliferative cells include proliferation of cells associated with wound repair.
- The terms “cancer” or “neoplasm” are used to refer to malignancies of the various organ systems, including those affecting the lung, breast, thyroid, lymph glands and lymphoid tissue, gastrointestinal organs, and the genitourinary tract, as well as to adenocarcinomas which are generally considered to include malignancies such as most colon cancers, renal-cell carcinoma, prostate cancer and/or testicular tumors, non-small cell carcinoma of the lung, cancer of the small intestine and cancer of the esophagus.
- The term “carcinoma” is art recognized and refers to malignancies of epithelial or endocrine tissues including respiratory system carcinomas, gastrointestinal system carcinomas, genitourinary system carcinomas, testicular carcinomas, breast carcinomas, prostatic carcinomas, endocrine system carcinomas, and melanomas. The mutant IL-2 polypeptides can be used to treat patients who have, who are suspected of having, or who may be at high risk for developing any type of cancer, including renal carcinoma or melanoma, or any viral disease. Exemplary carcinomas include those forming from tissue of the cervix, lung, prostate, breast, head and neck, colon and ovary. The term also includes carcinosarcomas, which include malignant tumors composed of carcinomatous and sarcomatous tissues. An “adenocarcinoma” refers to a carcinoma derived from glandular tissue or in which the tumor cells form recognizable glandular structures.
- Additional examples of proliferative disorders include hematopoietic neoplastic disorders. As used herein, the term “hematopoietic neoplastic disorders” includes diseases involving hyperplastic/neoplastic cells of hematopoietic origin, e.g., arising from myeloid, lymphoid or erythroid lineages, or precursor cells thereof. Preferably, the diseases arise from poorly differentiated acute leukemias (e.g., erythroblastic leukemia and acute megakaryoblastic leukemia). Additional exemplary myeloid disorders include, but are not limited to, acute promyeloid leukemia (APML), acute myelogenous leukemia (AML) and chronic myelogenous leukemia (CML) (reviewed in Vaickus, L. (1991) Crit. Rev. in Oncol./Hemotol. 11:267-97); lymphoid malignancies include, but are not limited to acute lymphoblastic leukemia (ALL) which includes B-lineage ALL and T-lineage ALL, chronic lymphocytic leukemia (CLL), prolymphocytic leukemia (PLL), hairy cell leukemia (HLL) and Waldenstrom's macro globulinemia (WM). Additional forms of malignant lymphomas include, but are not limited to non-Hodgkin lymphoma and variants thereof, peripheral T cell lymphomas, adult T cell leukemia/lymphoma (ATL), cutaneous T cell lymphoma (CTCL), large granular lymphocytic leukemia (LGF), Hodgkin's disease and Reed-Sternberg disease.
- It will be appreciated by those skilled in the art that amounts for each of the extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), that are sufficient to reduce tumor growth and size, or a therapeutically effective amount, will vary not only on the particular compounds or compositions selected, but also with the route of administration, the nature of the condition being treated, and the age and condition of the patient, and will ultimately be at the discretion of the patient's physician or pharmacist. The length of time during which the compounds used in the instant method will be given varies on an individual basis.
- It will be appreciated by those skilled in the art that the B16 melanoma model used herein is a generalized model for solid tumors. That is, efficacy of treatments in this model is also predictive of efficacy of the treatments in other non-melanoma solid tumors. For example, as described in Baird et al. (J Immunology 2013; 190:469-78; Epub Dec. 7, 2012), efficacy of cps, a parasite strain that induces an adaptive immune resposnse, in mediating anti-tumor immunity against B16F10 tumors was found to be generalizable to other solid tumors, including models of lung carcinoma and ovarian cancer. In another example, results from a line of research into VEGF targeting lymphocytes also shows that results in B16F10 tumors were generalizable to the other tumor types studied (Chinnasamy et al., JCI 2010; 120:3953-68; Chinnasamy et al., Clin Cancer Res 2012; 18:1672-83). In yet another example, immunotherapy involving LAG-3 and PD-1 led to reduced tumor burden, with generalizable results in a fibrosarcoma and colon adenocarcinoma cell lines (Woo et al., Cancer Res 2012;72:917-27).
- In certain embodiments, the extended-PK IL-2, knottin-Fc, and optional immune checkpoint blocker (or an antagonist of VEGF), are used to treat cancer.
- In certain embodiments, the extended-PK IL-2, knottin-Fc, and optional immune checkpoint blocker (or an antagonist of VEGF) are used to treat melanoma, leukemia, lung cancer, breast cancer, prostate cancer, ovarian cancer, colon cancer, renal carcinoma, and brain cancer.
- In certain embodiments, the extended-PK IL-2, knottin-Fc and optional immune checkpoint blocker (or an antagonist of VEGF) inhibit growth and/or proliferation of tumor cells.
- In certain embodiments, the extended-PK IL-2, knottin-Fc, and optional immune checkpoint blocker (or an antagonist of VEGF) reduce tumor size.
- In certain embodiments, the extended-PK IL-2, knottin-Fc, and optional immune checkpoint blocker (or an antagonist of VEGF) inhibit metastases of a primary tumor.
- In certain embodiments, knottin-Fc and an immune checkpoint blocker (or an antagonist of VEGF), with or without IL-2, inhibit growth and/or proliferation of tumor cells. In certain embodiments, knottin-Fc and an immune checkpoint blocker (or an antagonist of VEGF), with or without IL-2, reduce tumor size. In certain embodiments, knottin-Fc and an immune checkpoint blocker, with or without IL-2, inhibit metastases of a primary tumor.
- It will be appreciated by those skilled in the art that reference herein to treatment extends to prophylaxis as well as the treatment of the noted cancers and symptoms.
- A kit can include extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF), as disclosed herein, and instructions for use. The kits may comprise, in a suitable container, extended-PK IL-2, an integrin binding knottin-Fc, an optional immune checkpoint blocker (or an antagonist of VEGF), one or more controls, and various buffers, reagents, enzymes and other standard ingredients well known in the art. Certain embodiments include a kit with extended-PK IL-2, knottin-Fc, and optional immune checkpoint blocker (or an antagonist of VEGF) in the same vial. In certain embodiments, a kit includes extended-PK IL-2, knottin-Fc, and optional immune checkpoint blocker (or an antagonist of VEGF) in separate vials.
- The container can include at least one vial, well, test tube, flask, bottle, syringe, or other container means, into which extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF) may be placed, and in some instances, suitably aliquoted. Where an additional component is provided, the kit can contain additional containers into which this component may be placed. The kits can also include a means for containing extended-PK IL-2, a knottin-Fc, and optionally an immune checkpoint blocker (or an antagonist of VEGF) and any other reagent containers in close confinement for commercial sale. Such containers may include injection or blow-molded plastic containers into which the desired vials are retained. Containers and/or kits can include labeling with instructions for use and/or warnings.
- The present disclosure is further illustrated by the following examples, which should not be construed as further limiting. The contents of all figures and all references, Genbank sequences, patents and published patent applications cited throughout this application are expressly incorporated herein by reference. In particular, the disclosures of PCT publication WO 13/177187, U.S. Pat. No. 8,536,301, and U.S. Patent Publication No. 2014/0073518 are expressly incorporated herein by reference.
- Below are examples of specific embodiments for carrying out the methods described herein. The examples are offered for illustrative purposes only, and are not intended to limit the scope of the present invention in any way. Efforts have been made to ensure accuracy with respect to numbers used (e.g., amounts, temperatures, etc.), but some experimental error and deviation should, of course, be allowed for. The practice of the present invention will employ, unless otherwise indicated, conventional methods of protein chemistry, biochemistry, recombinant DNA techniques and pharmacology, within the skill of the art. Such techniques are explained fully in the literature. See, e.g., T. E. Creighton, Proteins: Structures and Molecular Properties (W. H. Freeman and Company, 1993); A. L. Lehninger, Biochemistry (Worth Publishers, Inc., current addition); Sambrook, et al., Molecular Cloning: A Laboratory Manual (2nd Edition, 1989); Methods In Enzymology (S. Colowick and N. Kaplan eds., Academic Press, Inc.); Remington's Pharmaceutical Sciences, 18th Edition (Easton, Pa.: Mack Publishing Company, 1990); Carey and Sundberg Advanced Organic Chemistry 3rd Ed. (Plenum Press) Vols A and B (1992).
- Moreover, while the examples below employ extended-PK IL-2 of mouse origin (i.e., both the extended-PK group (mouse serum albumin) and IL-2 are of mouse origin) and mouse Fc fused to an integrin-binding knottin, it should be understood that corresponding human extended-PK IL-2 (i.e., human serum albumin (HSA) and human IL-2, and variants thereof) and integrin-binding-human-Fc (i.e., Fc from human IgG1 fused to knottin) can be readily generated by those of ordinary skill in the art using methods described supra, and used in the methods disclosed herein.
- To address the lack of general tumor-associated antigens, a knottin-Fc protein was engineered. The knottin-Fc protein comprises two parts: 1) an engineered cystine knot (knottin) peptide that binds with high affinity to tumor-associated αvβ3, αvβ5, and α5β1 integrin receptors (specifically 2.5F, SEQ ID NO: 94 or 96), and 2) an antibody Fc domain that mediates immune effector functions in vivo. The knottin-Fc used is 2.5F with a KISS substitution, fused to a mouse IgG2a Fc domain, SEQ ID NO: 45, unless stated otherwise.
- To determine the effects of the knottin-Fc on tumor growth, 2.5×105 B16F10 murine melanoma cells were injected into the flanks of C57BL/6 mice subcutaneously. Prophylactic treatment was done with 80 μg knottin-Fc, 80 μg knottin-D265A (The D265A mutation in the murine IgG2a Fc domain eliminates binding to FcγR and complement), or 200 μg TA99, administered intraperitoneally every two days, starting on the day of tumor inoculation, for a total of ten treatments. TA99 is an antibody which binds to TYRP-1, (an antigen found on melanoma cells) and inhibits melanoma tumor growth.
- Tumor area was measured and plotted (
FIG. 2 ). Tumor area was measured using calipers. The longest dimension of the tumor in any direction was measured first, followed by the measurement of the longest perpendicular dimension. The two values were then multiplied to quantify tumor area in square millimeters. - Both the TA99 treatment and the knottin-Fc treatment controlled tumor growth to a similar extent. The failure of knottin-D265A to prevent tumor growth indicates that tumor control by knottin-Fc is mediated by the effector function of Fc.
- A therapeutic study was conducted to examine the effect of adding MSA/IL-2 to knottin-Fc treatment. Tumors were established by injecting C57BL/6 mice subcutaneously with 1×106B16F10 murine melanoma cells. 30 μg MSA/IL-2 and/or 500 μg knottin-Fc was administered intraperitoneally on day 6 after tumor inoculation and every 6 days after that for 4 treatments total.
- Tumor area was measured and plotted (
FIG. 3A ). While MSA/IL-2 and knottin-Fc alone had no effect on tumor growth, the combination of MSA/IL-2 and knottin-Fc effectively controlled tumor growth. A Kaplan-Meier survival plot revealed that the combination of MSA/IL-2 and knottin-Fc extended the survival of these mice, whereas monotherapies had no significant effect (FIG. 3B ). - A separate therapeutic study was conducted to examine the effect of MSA/IL-2 on knottin-Fc efficacy in a tumor type that has no reported targetable antigens. 1×106 MC38 murine colon carcinoma cells were injected into the flanks of C57BL/6 mice. 6 days after tumor inoculation and every 6 days after for a total of 4 treatments, 30 μg MSA-IL-2 and/or 500 μg knottin-Fc was administered intraperitoneally.
- Tumor growth was controlled with the combination of MSA/IL-2 and knottin-Fc, but not when each component was administered as a monotherapy (
FIG. 4A ). A Kaplan-Meier survival plot shows an increase in survival in the mice treated with the combination of MSA/IL-2 and knottin-Fc compared to when each component was administered as a monotherapy (FIG. 4B ). - An additional study was conducted to examine the effects of MSA/IL-2 on knottin-Fc efficacy in a different tumor type. Ag104A fibrosarcoma tumors were established by injecting 1.0×106 Ag104A cells into the flanks of C3H/HeN mice. Starting six days after tumor inoculation and every 6 days after, 30 μg MSA/IL-2 and/or 500 μg knottin-Fc was administered intraperitoneally.
- Tumor growth was controlled with the combination of MSA/IL-2 and knottin-Fc, but not when each component was administered as a monotherapy (
FIG. 5A ). A Kaplan-Meier survival plot shows an increase in survival in mice treated with the combination of MSA/IL-2 and knottin-Fc compared to when each component was administered alone (FIG. 5B ). - The results of Example 1 indicate that effector function is required for tumor control by knottin-Fc. To determine the role of effector function in tumor control by synergistic treatment with MSA/IL-2, a further study was conducted using both B16F10 and MC38 cells. 1×106 B16F10 cells (
FIGS. 6A and 6B ) or MC38 cells (FIGS. 7A and 7B ) were injected into the flanks of C57BL/6 mice. 30 μg MSA-IL-2 was administered intraperitoneally on day 6 after tumor inoculation and every 6 days after that for 4 treatments total. 500 μg knottin-Fc or knottin-D265AFc (the D265A mutation in the murine IgG2a Fc domain eliminates binding to FcγR and complement) was administered intraperitoneally on day 6 after tumor inoculation and every six days thereafter for a total of 4 treatments. - Individual tumor size measurements (
FIGS. 6A and 7A ) and survival plots (FIGS. 6B and 7B ) indicate that tumor control by knottin-Fc requires the effector function of Fc. - To determine the effect of antibodies on knottin-Fc and extended-PK IL-2 synergistic tumor control, an additional study was carried out using B16F10 cells. 1×106 B16F10 cells were injected into the flanks of C57BL/6 mice. 30 μg MSA/IL-2 was administered every 6 days beginning on day 6 after tumor inoculation for a total of 5 treatments and 200 μg knottin-Fc was administered daily from days 6-30 after tumor inoculation. Antibodies against TYRP-1 (TA99) were administered at 100 μg per mouse every 6 days starting on day 6 after B16F10 tumor inoculation. Antibodies against PD-1 were administered at 200 μg per mouse every 6 days starting on day 6 after tumor inoculation.
- Individual tumor size measurements (
FIGS. 8A ) and a survival plot (FIGS. 8B ) indicate that antibodies enhanced tumor control via knottin-Fc and MSA/IL-2. However, this is only effective if the antibody targets an antigen present on the tumor cells. Combining knottin-Fc and MSA/IL-2 with a therapeutic antibody or immune checkpoint blocker increased the efficacy of tumor control and survival improvement. - To determine the effect of antibodies on knottin-Fc and extended-PK IL-2 synergistic tumor control, an additional study was carried out using MC38 cells. 1×106 MC38 cells were injected into the flanks of C57BL/6 mice. 30 μg MSA/IL-2 and 500 μg knottin-Fc were administered every 6 days beginning on day 6 after tumor inoculation for a total of 4 treatments. Antibodies against PD-1 were administered at 200 μg per mouse every 6 days starting on day 6 after tumor inoculation.
- Individual tumor size measurements (
FIGS. 9A ) and survival plots (FIGS. 9B ) indicate that antibodies enhanced tumor control via knottin-Fc and MSA/IL-2. However, this is only effective if the antibody targets an antigen present on the tumor cells. The most effective treatment was to combine knottin-Fc and MSA/IL-2 with an immune checkpoint blockade (anti-PD-1) antibody. - To determine the minimum dosing requirement for an anti-tumor response, the B16F10 melanoma and MC38 colon carcinoma tumor models were used and knottin-Fc was administered daily, every other day, or weekly. 1×106 B16F10 cells (
FIG. 10 ) or 1×106 MC38 cells (FIG. 11 ) were injected into the flanks of C57BL/6 mice. 30 μg of MSA/IL-2 was administered on days 6, 12, 18, and 24 after tumor inoculation. 200 μg of knottin-Fc was administered daily or every other day starting on day 6 and ending on day 28. 500 μg of knottin-Fc was administered on days 6, 12, 18, and 24 for the weekly regimen. In both models, administration of knottin-Fc in conjunction with MSA/IL-2 every other day or every 6 days was equivalent to daily administration. - The determine the optimal placement of Fc fused to knottin for an anti-tumor response, Fc was fused to either the N-terminus (Knottin-Fc) or the C-terminus (Fc-Knottin). 2.5×105 B16F10 melanoma cells were injected into the flanks of C57BL/6 mice. 80 μg of knottin-Fc, 80 μg of Fc-knottin, or 200 μg of IgG-knottin was administered immediately after tumor inoculation and every two days after, for a total of 10 treatments. Tumor area was measured (
FIG. 12 ). There was essentially no difference in efficacy between the different knottin-Fc fusion proteins. - To validate this finding, another mouse tumor model was utilized. 1×106 MC38 colon carcinoma cells were injected into the flanks of albino C57BL/6 mice. 200 μg of knottin-Fc or Fc-knottin were administered immediately after tumor inoculation and every two days after, for a total of 10 treatments. Tumor area was measured (
FIG. 13 ). There was essentially no difference in efficacy between knottin-Fc and Fc-knottin. The results from both of these mouse tumor models indicate that the placement of Fc in the knottin-Fc fusion protein does not affect efficacy for an anti-tumor response. - To determine optimal integrin-binding-knottin-Fc constructs, a fusion protein was made containing a (Gly4Ser)3 linker in between the knottin and the Fc domain. No difference in integrin binding affinity to U87MG glioblastoma cells were observed compared to integrin-binding-knottin-Fc containing no linker (data not shown).
- To determine if the combination of knottin-Fc and MSA/IL-2 could protect treated mice from a secondary challenge, the MC38 tumor model was used. 1×106 MC38 cells were injected into the flanks of C57BL/6 mice and both 30 μg MSA/IL-2 and 500 μg knottin-Fc were administered every 6 days beginning on day 6 after tumor inoculation for a total of 4 treatments. 16-20 weeks after the initial tumor inoculation, previously cured mice or age-matched naïve mice were inoculated with 1×106 MC38 cells in the opposite flank. No further treatment was administered.
- Individual tumor size measurements (
FIG. 14A ) and survival plot (FIG. 14B ) indicate that knottin-Fc and MSA/IL-2 protect previously treated mice against secondary tumor challenge, demonstrating a potent and sustained immune response against the tumors. - To assess the efficacy of a knottin-Fc that targets all three integrins (i.e., αvβ3, αvβ5, and αvβ1, “2.5F_knottin-Fc” SEQ ID NO: 45) compared to a knottin-Fc that targets only two integrins (i.e., αvβ3 and αvβ5, “2.5D_knottin-Fc” SEQ ID NO: 47) in controlling tumor growth, an experiment was conducted using three different tumors models (i.e., B16F10, MC38, and Ag104A). 1×106 B16F10 (
FIGS. 15A and 15B ) or MC38 cells (FIGS. 16A and 16B ) were injected into the flanks of C57BL/6 mice. 1.0×106 Ag104A cells (FIGS. 17A and 17B ) were injected into the flanks of C3H/HeN mice. 30 μg MSA/IL-2, 500 μg 2.5F_knottin-Fc and/or 2.5D_knottin-Fc were administered every 6 days beginning on day 6 after tumor inoculation for a total of 4 treatments. - Individual tumor size measurements (
FIGS. 15A, 16A and 17A ) and survival plots (FIGS. 15B, 16B and 17B ) indicate that a knottin-Fc that targets all three integrins more effectively controls tumor growth than a knottin-Fc that only targets two integrins. - To assess the role of various immune cell populations in the improved survival of mice with MC38 tumors treated with knottin-Fc and MSA/IL-2, depletion experiments were conducted. 400 μg anti-CD8, anti-CD4, anti-NK1.1, anti-Ly6G or anti-CD19 antibodies were administered every four days for a total of six treatments starting on
day 4 after tumor inoculation. 300 μg anti-CSF-1R antibody was administered every two days for a total of eleven treatments starting onday 4 of tumor inoculation. 30 μg cobra venom factor (CVF) was administered every 6 days for a total of 4 treatments starting onday 5 after tumor inoculation. Anti-CD8 depletes CD8+ T cells, anti-CD4 depletes CD4+ T cells, anti-NK1.1 depletes natural killer cells, anti-Ly6G depletes neutrophils, anti-CD19 depletes B cells, and anti-CSF-1R depletes tissue-resident/tumor-resident macrophages. CVF inhibits complement activity. - Individual tumor size measurements (
FIG. 18A ) and survival plots (FIG. 18B ) indicate that CD8+ T cells and macrophages are particularly important for the synergistic effect of knottin-Fc and MSA/IL-2 on tumor control. - In addition to the immune cell depletions, Batf3−/− mice were used to evaluate the role of cross-presenting CD8+ dendritic cells. Batf3−/− mice lack the function of the basic leucine zipper transcription factor, ATF-like 3. Deletion of Batf3 has been shown to prevent the development of CD8+ dendritic cells, which are important for the cross-presentation of exogenous antigen on MHC Class I.
- Tumor areas of treated C57BL/6 (i.e. “control”) and Batf3−/− mice were measured and plotted (
FIG. 19A ), and demonstrated less tumor control in Batf3−/− mice treated with MSA/IL-2 and knottin-Fc. A Kaplan-Meier survival plot was also generated, and revealed a significant decrease in survival in Batf3−/− mice treated with knottin-Fc and MSA/IL-2 compared to C57BL/6 mice (FIG. 19B ). This indicated that cross-presentation by dendritic cells may be a factor that contributes to the efficacy of the combination therapy on controlling the growth of MC38 tumors. - Since CD8+ T cells were found to be critical for efficacy of the knottin-Fc and MSA-IL-2 combination, and IFNγ was previously reported to be important in the efficacy of MSA-IL-2 and therapeutic antibody combinations (Zhu et al., Cancer Cell (2015) Vol 27: 489-501), the role of IFNγ was investigated in the MC38 tumor model. 1×106 MC38 were injected into the flanks of C57BL/6 mice. 30 μg MSA/IL-2 and 500 μg knottin-Fc were administered every 6 days beginning on day 6 after tumor inoculation for a total of 4 treatments. 200 μg of anti-INFγ antibody was administered every two days for a total of eleven treatments starting on
day 5 after rumor inoculation. - As shown in
FIGS. 20A and 20B , IFNγ depletion did not significantly affect tumor control or survival of mice with MC38 tumors. - To determine whether the efficacy of tumor control could be enhanced by inhibiting suppressors of the immune system, an antagonist of vascular endothelial growth factor (VEGF) or cytotoxic T-lymphocyte-associated protein 4 (CTLA-4) was administered in mice with MC38 or B16F10 tumors. 1×106 MC38 cells (
FIGS. 21A, 21B and 22 ) or B16F10 (FIGS. 23A and 23B ) were injected into the flanks of C57BL/6 mice. 30 μg MSA/IL-2, 500 μg knottin-Fc, and 200 μg anti-VEGF antibody or anti-CTLA-4 antibody were administered every 6 days beginning on day 6 after tumor inoculation for a total of 4 treatments. - Synthetic genes, encoding the heavy (VH) and light (VL) chain variable regions of anti-VEGF (clone B20-4.1.1) (Bagri et al., Clin. Cancer Res. (2010) Vol 16: 3887-900) and anti-CTLA-4 (9D9) (Selby et al., Cancer Immunol. Res. (2013) Vol 1:32-42) antibodies, were codon-optimized for expression in mammalian cells (GeneArt, Life Technologies). B20-4.1.1 antibody constructs were generated by PCR-amplification of DNA inserts encoding for VH and VL regions and cloned via Gibson assembly into separate gWiz expression vectors (Genlantis) containing a CMV promoter, a kanamycin antibiotic resistance gene and the DNA sequence encoding for either murine IgG2a heavy-chain (CH1, CH2 and CH3) or light-chain (CL) constant regions (see below
Sequence - Anti-VEGF antibody B20-4.1.1 was expressed in transiently transfected human embryonic kidney (HEK293-F) cells using the Free-Style 293 Expression System (Life Technologies) as described previously (Zhu et al., Cancer Cell (2015) Vol 27: 489-501). Antibody 9D9 was expressed in transiently transfected Chinese hamster ovary (CHO) cells and provided by EPFL Protein expression core facility (http://pecf.epfl.ch). After 7 days of expression, cells were removed by centrifugation (15,000×g for 30 min at 4° C.) and filtration (0.22 μm PES membranes filter) and the proteins in the supernatant purified by protein A chromatography according to the manufacturer's instructions (GE Healthcare). Eluted antibodies were further desalted and purified on a
HiLoad Superdex 200 10/600 size exclusion column (GE Healthcare) connected to an AKTApurifier system and equilibrated withbuffer PBS 1× pH 7.4. The purified antibodies were concentrated using a 30000 NMWL Amicon Ultra centrifugal filter device (Millipore) at 4000 g and 4° C. and quantified by measuring absorbance at 280 nm using a NanoDrop 2000 spectrophotometer (Thermo Scientific). Molecular weights were confirmed by reducing and non-reducing SDS/PAGE. Purity was evaluated by FPLC. Protein samples were analyzed by SDS-PAGE under denaturating and reducing conditions using NuPAGE 4-12% Bis-Tris Gels (Life Technologies) in MOPS buffer followed by Coomassie staining. Native size and oligomerization state of antibodies after concentration were also analyzed by size-exclusion chromatography with aSuperdex 200 10/300 GL column (GE Healthcare) connected to an AKTApurifier system and equilibrated withbuffer PBS 1× pH 7.4. - Tumor area was measured and plotted (
FIGS. 21A, 22 and 23A ) and survival plots were generated (FIG. 21B and 23B ). The triple combinations (i.e., MSA/IL-2+knottin-Fc+anti-VEGF and MSA/IL-2+knottin-Fc+anti-CTLA-4) significantly controlled tumor growth and improved survival compared to the double combinations (i.e., MSA/IL-2+anti-VEGF and knottin-Fc+anti-VEGF or MSA/IL-2+anti-CTLA-4 and knottin-Fc+anti-CTLA-4). This is similar to the results observed when adding an anti-PD-1 antibody to the combination of MSA/IL-2 and knottin-Fc, which indicated that other suppressors of the immune system could be inhibited to improve the efficacy of the combination of MSA/IL-2+knottin-Fc. The improved therapeutic efficacy by addition of an anti-VEGF antibody was also observed in RENCA (renal adenocarcinoma) and LLC (Lewis lung carcinoma) tumor models (data not shown). - Those skilled in the art will recognize or be able to ascertain, using no more than routine experimentation, many equivalents of the specific embodiments described herein described herein. Such equivalents are intended to be encompassed by the following claims.
-
TABLE 2 Sequence Summary SEQ ID NO Description Sequence 1 Human ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL IgG1 TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNT constant KVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR region TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST (amino acid YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR sequence) EPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQKSLSLSPGK 2 Human EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV IgG1 Fc VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV domain LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT (amino acid LPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP sequence) VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK 3 Human DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV IgG1 Fc SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH domain QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR (amino acid DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS sequence) DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP Deletion GK (ΔEPKSC) Upper Hinge 4 Mouse IL-2 GCACCCACTTCAAGCTCCACTTCAAGCTCTACAGCGGAAGCAC (nucleic AGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACCTGG acid AGCAGCTGTTGATGGACCTACAGGAGCTCCTGAGCAGGATGGA sequence) GAATTACAGGAACCTGAAACTCCCCAGGATGCTCACCTTCAAA TTTTACTTGCCCAAGCAGGCCACAGAATTGAAAGATCTTCAGTG CCTAGAAGATGAACTTGGACCTCTGCGGCATGTTCTGGATTTGA CTCAAAGCAAAAGCTTTCAATTGGAAGATGCTGAGAATTTCAT CAGCAATATCAGAGTAACTGTTGTAAAACTAAAGGGCTCTGAC AACACATTTGAGTGCCAATTCGATGATGAGTCAGCAACTGTGG TGGACTTTCTGAGGAGATGGATAGCCTTCTGTCAAAGCATCATC TCAACAAGCCCTCAA 5 Mouse IL-2 APTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMEN (amino acid YRNLKLPRMLTFKFYLPKQATELKDLQCLEDELGPLRHVLDLTQS sequence) KSFQLEDAENFISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRR WIAFCQSIISTSPQ 6 QQ6210 GCACCCACTTCAAGCTCCACTTCAAGCTCTACAGCGGAAGCAC (nucleic AACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACCTGG acid AGCAGCTGTTGATGGACCTACAGGAACTCCTGAGTAGGATGGA sequence) GGATCACAGGAACCTGAGACTCCCCAGGATGCTCACCTTCAAA TTTTACTTGCCCGAGCAGGCCACAGAATTGGAAGATCTTCAGTG CCTAGAAGATGAACTTGAACCACTGCGGCAAGTTCTGGATTTG ACTCAAAGCAAAAGCTTTCAATTGGAAGATGCTGAGAATTTCA TCAGCAATATCAGAGTAACTGTTGTAAAACTAAAGGGCTCTGA CAACACATTTGAGTGCCAATTCGACGATGAGCCAGCAACTGTG GTGGACTTTCTGAGGAGATGGATAGCCTTCTGTCAAAGCATCAT CTCAACAAGCCCTCAA 7 QQ6210 APTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMED (amino acid HRNLRLPRMLTFKFYLPEQATELEDLQCLEDELEPLRQVLDLTQSK sequence) SFQLEDAENFISNIRVTVVKLKGSDNTFECQFDDEPATVVDFLRRW IAFCQSIISTSPQ 8 E76A GCACCCACTTCAAGCTCCACTTCAAGCTCTACAGCGGAAGCAC (nucleic AGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACCTGG acid AGCAGCTGTTGATGGACCTACAGGAGCTCCTGAGCAGGATGGA sequence) GAATTACAGGAACCTGAAACTCCCCAGGATGCTCACCTTCAAA TTTTACTTGCCCAAGCAGGCCACAGAATTGAAAGATCTTCAGTG CCTAGAAGATGCTCTTGGACCTCTGCGGCATGTTCTGGATTTGA CTCAAAGCAAAAGCTTTCAATTGGAAGATGCTGAGAATTTCAT CAGCAATATCAGAGTAACTGTTGTAAAACTAAAGGGCTCTGAC AACACATTTGAGTGCCAATTCGATGATGAGTCAGCAACTGTGG TGGACTTTCTGAGGAGATGGATAGCCTTCTGTCAAAGCATCATC TCAACAAGCCCTCAA 9 E76A APTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMEN (amino acid YRNLKLPRMLTFKFYLPKQATELKDLQCLEDALGPLRHVLDLTQS sequence) KSFQLEDAENFISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRR WIAFCQSIISTSPQ 10 E76G GCACCCACTTCAAGCTCCACTTCAAGCTCTACAGCGGAAGCAC (nucleic AGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACCTGG acid AGCAGCTGTTGATGGACCTACAGGAGCTCCTGAGCAGGATGGA sequence) GAATTACAGGAACCTGAAACTCCCCAGGATGCTCACCTTCAAA TTTTACTTGCCCAAGCAGGCCACAGAATTGAAAGATCTTCAGTG CCTAGAAGATGGTCTTGGACCTCTGCGGCATGTTCTGGATTTGA CTCAAAGCAAAAGCTTTCAATTGGAAGATGCTGAGAATTTCAT CAGCAATATCAGAGTAACTGTTGTAAAACTAAAGGGCTCTGAC AACACATTTGAGTGCCAATTCGATGATGAGTCAGCAACTGTGG TGGACTTTCTGAGGAGATGGATAGCCTTCTGTCAAAGCATCATC TCAACAAGCCCTCAA 11 E76G APTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMEN (amino acid YRNLKLPRMLTFKFYLPKQATELKDLQCLEDGLGPLRHVLDLTQS sequence) KSFQLEDAENFISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRR WIAFCQSIISTSPQ 12 D265A ATGAGGGTCCCCGCTCAGCTCCTGGGGCTCCTGCTGCTCTGGCT Fc/Flag CCCAGGTGCACGATGTGAGCCCAGAGTGCCCATAACACAGAAC (nucleic CCCTGTCCTCCACTCAAAGAGTGTCCCCCATGCGCAGCTCCAGA acid CCTCTTGGGTGGACCATCCGTCTTCATCTTCCCTCCAAAGATCA sequence) AGGATGTACTCATGATCTCCCTGAGCCCCATGGTCACATGTGTG (C-terminal GTGGTGGCCGTGAGCGAGGATGACCCAGACGTCCAGATCAGCT flag tag is GGTTTGTGAACAACGTGGAAGTACACACAGCTCAGACACAAAC underlined) CCATAGAGAGGATTACAACAGTACTCTCCGGGTGGTCAGTGCC CTCCCCATCCAGCACCAGGACTGGATGAGTGGCAAGGAGTTCA AATGCAAGGTCAACAACAGAGCCCTCCCATCCCCCATCGAGAA AACCATCTCAAAACCCAGAGGGCCAGTAAGAGCTCCACAGGTA TATGTCTTGCCTCCACCAGCAGAAGAGATGACTAAGAAAGAGT TCAGTCTGACCTGCATGATCACAGGCTTCTTACCTGCCGAAATT GCTGTGGACTGGACCAGCAATGGGCGTACAGAGCAAAACTACA AGAACACCGCAACAGTCCTGGACTCTGATGGTTCTTACTTCATG TACAGCAAGCTCAGAGTACAAAAGAGCACTTGGGAAAGAGGA AGTCTTTTCGCCTGCTCAGTGGTCCACGAGGGTCTGCACAATCA CCTTACGACTAAGACCATCTCCCGGTCTCTGGGTAAAGGTGGC GGATCTGACTACAAGGACGACGATGACAAGTGATAA 13 D265A MRVPAQLLGLLLLWLPGARCEPRVPITQNPCPPLKECPPCAAPDLL Fc/Flag GGPSVFIFPPKIKDVLMISLSPMVTCVVVAVSEDDPDVQISWFVNN (amino acid VEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNN sequence) RALPSPIEKTISKPRGPVRAPQVYVLPPPAEEMTKKEFSLTCMITGF (C-terminal LPAEIAVDWTSNGRTEQNYKNTATVLDSDGSYFMYSKLRVQKST flag tag is WERGSLFACSVVHEGLHNHLTTKTISRSLGKGGGSDYKDDDDK underlined) 14 D265A ATGAGGGTCCCCGCTCAGCTCCTGGGGCTCCTGCTGCTCTGGCT Fc/wt mIL-2 CCCAGGTGCACGATGTGAGCCCAGAGTGCCCATAACACAGAAC (nucleic CCCTGTCCTCCACTCAAAGAGTGTCCCCCATGCGCAGCTCCAGA acid CCTCTTGGGTGGACCATCCGTCTTCATCTTCCCTCCAAAGATCA sequence) AGGATGTACTCATGATCTCCCTGAGCCCCATGGTCACATGTGTG (C-terminal GTGGTGGCCGTGAGCGAGGATGACCCAGACGTCCAGATCAGCT 6x his tag is GGTTTGTGAACAACGTGGAAGTACACACAGCTCAGACACAAAC underlined) CCATAGAGAGGATTACAACAGTACTCTCCGGGTGGTCAGTGCC CTCCCCATCCAGCACCAGGACTGGATGAGTGGCAAGGAGTTCA AATGCAAGGTCAACAACAGAGCCCTCCCATCCCCCATCGAGAA AACCATCTCAAAACCCAGAGGGCCAGTAAGAGCTCCACAGGTA TATGTCTTGCCTCCACCAGCAGAAGAGATGACTAAGAAAGAGT TCAGTCTGACCTGCATGATCACAGGCTTCTTACCTGCCGAAATT GCTGTGGACTGGACCAGCAATGGGCGTACAGAGCAAAACTACA AGAACACCGCAACAGTCCTGGACTCTGATGGTTCTTACTTCATG TACAGCAAGCTCAGAGTACAAAAGAGCACTTGGGAAAGAGGA AGTCTTTTCGCCTGCTCAGTGGTCCACGAGGGTCTGCACAATCA CCTTACGACTAAGACCATCTCCCGGTCTCTGGGTAAAGGAGGG GGCTCCGCACCCACTTCAAGCTCCACTTCAAGCTCTACAGCGGA AGCACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCA CCTGGAGCAGCTGTTGATGGACCTACAGGAGCTCCTGAGCAGG ATGGAGAATTACAGGAACCTGAAACTCCCCAGGATGCTCACCT TCAAATTTTACTTGCCCAAGCAGGCCACAGAATTGAAAGATCTT CAGTGCCTAGAAGATGAACTTGGACCTCTGCGGCATGTTCTGG ATTTGACTCAAAGCAAAAGCTTTCAATTGGAAGATGCTGAGAA TTTCATCAGCAATATCAGAGTAACTGTTGTAAAACTAAAGGGC TCTGACAACACATTTGAGTGCCAATTCGATGATGAGTCAGCAA CTGTGGTGGACTTTCTGAGGAGATGGATAGCCTTCTGTCAAAGC ATCATCTCAACAAGCCCTCAACACCATCACCACCATCACTGATA A 15 D265A MRVPAQLLGLLLLWLPGARCEPRVPITQNPCPPLKECPPCAAPDLL Fc/wt mIL-2 GGPSVFIFPPKIKDVLMISLSPMVTCVVVAVSEDDPDVQISWFVNN (amino acid VEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNN sequence) RALPSPIEKTISKPRGPVRAPQVYVLPPPAEEMTKKEFSLTCMITGF (C-terminal LPAEIAVDWTSNGRTEQNYKNTATVLDSDGSYFMYSKLRVQKST 6x his tag is WERGSLFACSVVHEGLHNHLTTKTISRSLGKGGGSAPTSSSTSSST underlined) AEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRML TFKFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENF ISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRRWIAFCQSIISTS PQHHHHHH** 16 D265A Fc/ ATGAGGGTCCCCGCTCAGCTCCTGGGGCTCCTGCTGCTCTGGCT QQ6210 CCCAGGTGCACGATGTGAGCCCAGAGTGCCCATAACACAGAAC (nucleic CCCTGTCCTCCACTCAAAGAGTGTCCCCCATGCGCAGCTCCAGA acid CCTCTTGGGTGGACCATCCGTCTTCATCTTCCCTCCAAAGATCA sequence) AGGATGTACTCATGATCTCCCTGAGCCCCATGGTCACATGTGTG (C-terminal GTGGTGGCCGTGAGCGAGGATGACCCAGACGTCCAGATCAGCT 6x his tag is GGTTTGTGAACAACGTGGAAGTACACACAGCTCAGACACAAAC underlined) CCATAGAGAGGATTACAACAGTACTCTCCGGGTGGTCAGTGCC CTCCCCATCCAGCACCAGGACTGGATGAGTGGCAAGGAGTTCA AATGCAAGGTCAACAACAGAGCCCTCCCATCCCCCATCGAGAA AACCATCTCAAAACCCAGAGGGCCAGTAAGAGCTCCACAGGTA TATGTCTTGCCTCCACCAGCAGAAGAGATGACTAAGAAAGAGT TCAGTCTGACCTGCATGATCACAGGCTTCTTACCTGCCGAAATT GCTGTGGACTGGACCAGCAATGGGCGTACAGAGCAAAACTACA AGAACACCGCAACAGTCCTGGACTCTGATGGTTCTTACTTCATG TACAGCAAGCTCAGAGTACAAAAGAGCACTTGGGAAAGAGGA AGTCTTTTCGCCTGCTCAGTGGTCCACGAGGGTCTGCACAATCA CCTTACGACTAAGACCATCTCCCGGTCTCTGGGTAAAGGAGGG GGCTCCGCACCCACTTCAAGCTCCACTTCAAGCTCTACAGCGGA AGCACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCA CCTGGAGCAGCTGTTGATGGACCTACAGGAACTCCTGAGTAGG ATGGAGGATCACAGGAACCTGAGACTCCCCAGGATGCTCACCT TCAAATTTTACTTGCCCGAGCAGGCCACAGAATTGGAAGATCTT CAGTGCCTAGAAGATGAACTTGAACCACTGCGGCAAGTTCTGG ATTTGACTCAAAGCAAAAGCTTTCAATTGGAAGATGCTGAGAA TTTCATCAGCAATATCAGAGTAACTGTTGTAAAACTAAAGGGC TCTGACAACACATTTGAGTGCCAATTCGACGATGAGCCAGCAA CTGTGGTGGACTTTCTGAGGAGATGGATAGCCTTCTGTCAAAGC ATCATCTCAACAAGCCCTCAACACCATCACCACCATCACTGATA A 17 D265A Fc/ MRVPAQLLGLLLLWLPGARCEPRVPITQNPCPPLKECPPCAAPDLL QQ6210 GGPSVFIFPPKIKDVLMISLSPMVTCVVVAVSEDDPDVQISWFVNN (amino acid VEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNN sequence) RALPSPIEKTISKPRGPVRAPQVYVLPPPAEEMTKKEFSLTCMITGF (C-terminal LPAEIAVDWTSNGRTEQNYKNTATVLDSDGSYFMYSKLRVQKST 6x his tag is WERGSLFACSVVHEGLHNHLTTKTISRSLGKGGGSAPTSSSTSSST underlined) AEAQQQQQQQQQQQQHLEQLLMDLQELLSRMEDHRNLRLPRML TFKFYLPEQATELEDLQCLEDELEPLRQVLDLTQSKSFQLEDAENFI SNIRVTVVKLKGSDNTFECQFDDEPATVVDFLRRWIAFCQSIISTSP QHHHHHH 18 D265A Fc/ ATGAGGGTCCCCGCTCAGCTCCTGGGGCTCCTGCTGCTCTGGCT E76A CCCAGGTGCACGATGTGAGCCCAGAGTGCCCATAACACAGAAC (nucleic CCCTGTCCTCCACTCAAAGAGTGTCCCCCATGCGCAGCTCCAGA acid CCTCTTGGGTGGACCATCCGTCTTCATCTTCCCTCCAAAGATCA sequence) AGGATGTACTCATGATCTCCCTGAGCCCCATGGTCACATGTGTG (C-terminal GTGGTGGCCGTGAGCGAGGATGACCCAGACGTCCAGATCAGCT 6x his tag is GGTTTGTGAACAACGTGGAAGTACACACAGCTCAGACACAAAC underlined) CCATAGAGAGGATTACAACAGTACTCTCCGGGTGGTCAGTGCC CTCCCCATCCAGCACCAGGACTGGATGAGTGGCAAGGAGTTCA AATGCAAGGTCAACAACAGAGCCCTCCCATCCCCCATCGAGAA AACCATCTCAAAACCCAGAGGGCCAGTAAGAGCTCCACAGGTA TATGTCTTGCCTCCACCAGCAGAAGAGATGACTAAGAAAGAGT TCAGTCTGACCTGCATGATCACAGGCTTCTTACCTGCCGAAATT GCTGTGGACTGGACCAGCAATGGGCGTACAGAGCAAAACTACA AGAACACCGCAACAGTCCTGGACTCTGATGGTTCTTACTTCATG TACAGCAAGCTCAGAGTACAAAAGAGCACTTGGGAAAGAGGA AGTCTTTTCGCCTGCTCAGTGGTCCACGAGGGTCTGCACAATCA CCTTACGACTAAGACCATCTCCCGGTCTCTGGGTAAAGGAGGG GGCTCCGCACCCACTTCAAGCTCCACTTCAAGCTCTACAGCGGA AGCACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCA CCTGGAGCAGCTGTTGATGGACCTACAGGAGCTCCTGAGCAGG ATGGAGAATTACAGGAACCTGAAACTCCCCAGGATGCTCACCT TCAAATTTTACTTGCCCAAGCAGGCCACAGAATTGAAAGATCTT CAGTGCCTAGAAGATGCTCTTGGACCTCTGCGGCATGTTCTGGA TTTGACTCAAAGCAAAAGCTTTCAATTGGAAGATGCTGAGAAT TTCATCAGCAATATCAGAGTAACTGTTGTAAAACTAAAGGGCT CTGACAACACATTTGAGTGCCAATTCGATGATGAGTCAGCAAC TGTGGTGGACTTTCTGAGGAGATGGATAGCCTTCTGTCAAAGC ATCATCTCAACAAGCCCTCAACACCATCACCACCATCACTGATA A 19 D265A Fc/ MRVPAQLLGLLLLWLPGARCEPRVPITQNPCPPLKECPPCAAPDLL E76A GGPSVFIFPPKIKDVLMISLSPMVTCVVVAVSEDDPDVQISWFVNN (amino acid VEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNN sequence) RALPSPIEKTISKPRGPVRAPQVYVLPPPAEEMTKKEFSLTCMITGF (C-terminal LPAEIAVDWTSNGRTEQNYKNTATVLDSDGSYFMYSKLRVQKST 6x his tag is WERGSLFACSVVHEGLHNHLTTKTISRSLGKGGGSAPTSSSTSSST underlined) AEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRML TFKFYLPKQATELKDLQCLEDALGPLRHVLDLTQSKSFQLEDAEN FISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRRWIAFCQSIIST SPQHHHHHH 20 D265A Fc/ ATGAGGGTCCCCGCTCAGCTCCTGGGGCTCCTGCTGCTCTGGCT E76G CCCAGGTGCACGATGTGAGCCCAGAGTGCCCATAACACAGAAC (nucleic CCCTGTCCTCCACTCAAAGAGTGTCCCCCATGCGCAGCTCCAGA acid CCTCTTGGGTGGACCATCCGTCTTCATCTTCCCTCCAAAGATCA sequence) AGGATGTACTCATGATCTCCCTGAGCCCCATGGTCACATGTGTG (C-terminal GTGGTGGCCGTGAGCGAGGATGACCCAGACGTCCAGATCAGCT 6x his tag is GGTTTGTGAACAACGTGGAAGTACACACAGCTCAGACACAAAC underlined) CCATAGAGAGGATTACAACAGTACTCTCCGGGTGGTCAGTGCC CTCCCCATCCAGCACCAGGACTGGATGAGTGGCAAGGAGTTCA AATGCAAGGTCAACAACAGAGCCCTCCCATCCCCCATCGAGAA AACCATCTCAAAACCCAGAGGGCCAGTAAGAGCTCCACAGGTA TATGTCTTGCCTCCACCAGCAGAAGAGATGACTAAGAAAGAGT TCAGTCTGACCTGCATGATCACAGGCTTCTTACCTGCCGAAATT GCTGTGGACTGGACCAGCAATGGGCGTACAGAGCAAAACTACA AGAACACCGCAACAGTCCTGGACTCTGATGGTTCTTACTTCATG TACAGCAAGCTCAGAGTACAAAAGAGCACTTGGGAAAGAGGA AGTCTTTTCGCCTGCTCAGTGGTCCACGAGGGTCTGCACAATCA CCTTACGACTAAGACCATCTCCCGGTCTCTGGGTAAAGGAGGG GGCTCCGCACCCACTTCAAGCTCCACTTCAAGCTCTACAGCGGA AGCACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCA CCTGGAGCAGCTGTTGATGGACCTACAGGAGCTCCTGAGCAGG ATGGAGAATTACAGGAACCTGAAACTCCCCAGGATGCTCACCT TCAAATTTTACTTGCCCAAGCAGGCCACAGAATTGAAAGATCTT CAGTGCCTAGAAGATGGTCTTGGACCTCTGCGGCATGTTCTGGA TTTGACTCAAAGCAAAAGCTTTCAATTGGAAGATGCTGAGAAT TTCATCAGCAATATCAGAGTAACTGTTGTAAAACTAAAGGGCT CTGACAACACATTTGAGTGCCAATTCGATGATGAGTCAGCAAC TGTGGTGGACTTTCTGAGGAGATGGATAGCCTTCTGTCAAAGC ATCATCTCAACAAGCCCTCAACACCATCACCACCATCACTGATA A 21 D265A Fc/ MRVPAQLLGLLLLWLPGARCEPRVPITQNPCPPLKECPPCAAPDLL E76G GGPSVFIFPPKIKDVLMISLSPMVTCVVVAVSEDDPDVQISWFVNN (amino acid VEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNN sequence) RALPSPIEKTISKPRGPVRAPQVYVLPPPAEEMTKKEFSLTCMITGF (C-terminal LPAEIAVDWTSNGRTEQNYKNTATVLDSDGSYFMYSKLRVQKST 6x his tag is WERGSLFACSVVHEGLHNHLTTKTISRSLGKGGGSAPTSSSTSSST underlined) AEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRML TFKFYLPKQATELKDLQCLEDGLGPLRHVLDLTQSKSFQLEDAEN FISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRRWIAFCQSIIST SPQHHHHHH 22 mIL-2 QQ GCACCCACCTCAAGCTCCACTTCAAGCTCTACAGCGGAAGCAC 6.2-4 AACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACCTGG (nucleic AGCAGCTGTTGATGGACCTACAGGAGCTCCTGAGCAGGATGGA acid GGATTCCAGGAACCTGAGACTCCCCAGGATGCTCACCTTCAAA sequence) TTTTACTTGCCCAAGCAGGCCACAGAATTGGAAGATCTTCAGTG CCTAGAAGATGAACTTGAACCTCTGCGGCAAGTTCTGGATTTG ACTCAAAGCAAAAGCTTTCAATTGGAAGATGCTGAGAATTTCA TCAGCAATATCAGAGTAACTGTTGTAAAACTAAAGGGCTCTGA CAACACATTTGAGTGCCAATTCGATGATGAGCCAGCAACTGTG GTGGGCTTTCTGAGGAGATGGATAGCCTTCTGTCAAAGCATCAT CTCAACGAGCCCTCAA 23 mIL-2 QQ APTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMEDS 6.2-4 RNLRLPRMLTFKFYLPKQATELEDLQCLEDELEPLRQVLDLTQSKS (amino acid FQLEDAENFISNIRVTVVKLKGSDNTFECQFDDEPATVVGFLRRWI sequence) AFCQSIISTSPQ 24 mIL-2QQ GCACCCACCTCAAGCTCCACTTCAAGCTCTACAGCGGAAGCAC 6.2-8 AACAGCAGCAGCAGCAGCAGCAGCACCTGGAGCAGCTGTTGAT (nucleic GGACCTACAGGAGCTCCTGAGTAGGATGGAGGATCACAGGAAC acid CTGAGACTCCCCAGGATGCTCACCTTCAAATTTTACTTGCCCAA sequence) GCAGGCCACAGAATTGGAAGATCTTCAGTGCCTAGAAGATGAA CTTGAACCTCTGCGGCAAGTTCTGGATTTGACTCAAAGCAAAA GCTTTCAATTGGAAGATGCTGAGAATTTCATCAGCAATATCAG AGTAACTGTTGTAAAACTAAAGGGCTCTGACAACACATTTGAG TGCCAATTCGATGATGAGCCAGCAACTGTGGTGGACTTTCTGA GGAGATGGATAGCCTTCTGTCAAAGCATCATCTCAACAAGCCC TCGA 25 mIL-2 QQ APTSSSTSSSTAEAQQQQQQQQHLEQLLMDLQELLSRMEDHRNLR 6.2-8 LPRMLTFKFYLPKQATELEDLQCLEDELEPLRQVLDLTQSKSFQLE (amino acid DAENFISNIRVTVVKLKGSDNTFECQFDDEPATVVDFLRRWIAFCQ sequence) SIISTSPR 26 mIL-2QQ GCACCCACCTCAAGCTCCACTTCAAGCTCTACAGCGGAAGCAC 6.2-10 AACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACCTGG (nucleic AGCAGCTGTTGATGGACCTACAGGAACTCCTGAGTAGGATGGA acid GGATCACAGGAACCTGAGACTCCCCAGGATGCTCACCTTCAAA sequence) TTTTACTTGCCCGAGCAGGCCACAGAATTGGAAGATCTTCAGTG CCTAGAAGATGAACTTGAACCACTGCGGCAAGTTCTGGATTTG ACTCAAAGCAAAAGCTTTCAATTGGAAGATGCTGAGAATTTCA TCAGCAATATCAGAGTAACTGTTGTAAAACTAAAGGGCTCTGA CAACACATTTGAGTGCCAATTCGACGATGAGCCAGCAACTGTG GTGGACTTTCTGAGGAGATGGATAGCCTTCTGTCAAAGCATCAT CTCAACAAGCCCTCAG 27 mIL-2 QQ APTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMED 6.2-10 HRNLRLPRMLTFKFYLPEQATELEDLQCLEDELEPLRQVLDLTQSK (amino acid SFQLEDAENFISNIRVTVVKLKGSDNTFECQFDDEPATVVDFLRRW sequence) IAFCQSIISTSPQ 28 mIL-2 QQ GCACCCACCTCAAGCTCCACTTCAAGCTCTACAGCGGAAGCAC 6.2-11 AACAGCAGCAGCAGCAGCAGCAGCAGCACCTGGAGCAGCTGTT (nucleic GATGGACCTACAGGAGCTCCTGAGCAGGATGGAGGATTCCAGG acid AACCTGAGACTCCCCAGAATGCTCACCTTCAAATTTTACTTGCC sequence) CGAGCAGGCCACAGAATTGAAAGATCTCCAGTGCCTAGAAGAT GAACTTGAACCTCTGCGGCAAGTTCTGGATTTGACTCAAAGCA AAAGCTTTCAATTGGAAGATGCTGAGAATTTCATCAGCAATAT CAGAGTAACTGTTGTAAAACTAAAGGGCTCTGACAACACATTT GAGTGCCAATTCGACGATGAGCCAGCAACTGTGGTGGACTTTC TGAGGAGATGGATAGCCTTCTGTCAAAGCATCATCTCAACAAG CCCTCAG 29 mIL-2 QQ APTSSSTSSSTAEAQQQQQQQQQHLEQLLMDLQELLSRMEDSRNL 6.2-11 RLPRMLTFKFYLPEQATELKDLQCLEDELEPLRQVLDLTQSKSFQL (amino acid EDAENFISNIRVTVVKLKGSDNTFECQFDDEPATVVDFLRRWIAFC sequence) QSIISTSPQ 30 mIL-2 QQ GCACCCACCTCAAGCTCCACTTCAAGCTCTACAGCGGAAGCAC 6.2-13 AACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACCTGG (nucleic AGCAGCTGTTGATGGACCTACAGGAGCTCCTGAGTAGGATGGA acid GGATCACAGGAACCTGAGACTCCCCAGGATGCTCACCTTCAAA sequence) TTTTACTTGCCCGAGCAGGCCACAGAATTGAAAGATCTCCAGT GCCTAGAAGATGAACTTGAACCTCTGCGGCAGGTTCTGGATTT GACTCAAAGCAAAAGCTTTCAATTGGAAGATGCTGAGAATTTC ATCAGCAATATCAGAGTAACTGTTGTAAAACTAAAGGGCTCTG ACAACACATTTGAGTGCCAATTCGATGATGAGCCAGCAACTGT GGTGGACTTTCTGAGGAGATGGATAGCCTTCTGTCAAAGCATC ATCTCAACAAGCCCTCAG 31 mIL-2 QQ APTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMED 6.2-13 HRNLRLPRMLTFKFYLPEQATELKDLQCLEDELEPLRQVLDLTQS (amino acid KSFQLEDAENFISNIRVTVVKLKGSDNTFECQFDDEPATVVDFLRR sequence) WIAFCQSIISTSPQ 32 Full length ATGTACAGGATGCAACTCCTGTCTTGCATTGCACTAAGTCTTGC human IL-2 ACTTGTCACAAACAGTGCACCTACTTCAAGTTCTACAAAGAAA (nucleic ACACAGCTACAACTGGAGCATTTACTGCTGGATTTACAGATGA acid TTTTGAATGGAATTAATAATTACAAGAATCCCAAACTCACCAG sequence) GATGCTCACATTTAAGTTTTACATGCCCAAGAAGGCCACAGAA CTGAAACATCTTCAGTGTCTAGAAGAAGAACTCAAACCTCTGG AGGAAGTGCTAAATTTAGCTCAAAGCAAAAACTTTCACTTAAG ACCCAGGGACTTAATCAGCAATATCAACGTAATAGTTCTGGAA CTAAAGGGATCTGAAACAACATTCATGTGTAATATGCTGATGA GACAGCAACCATTGTAGAATTTCTGAACAGATGGATTACCTTTT GTCAAAGCATCATCTCAACACTGACTTGA 33 Full length MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILN humanIL-2 GINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLN (amino acid LAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFL sequence) NRWITFCQSIISTLT 34 Human IL-2 GCACCTACTTCAAGTTCTACAAAGAAAACACAGCTACAACTGG without AGCATTTACTGCTGGATTTACAGATGATTTTGAATGGAATTAAT signal AATTACAAGAATCCCAAACTCACCAGGATGCTCACATTTAAGT peptide TTTACATGCCCAAGAAGGCCACAGAACTGAAACATCTTCAGTG (nucleic TCTAGAAGAAGAACTCAAACCTCTGGAGGAAGTGCTAAATTTA acid GCTCAAAGCAAAAACTTTCACTTAAGACCCAGGGACTTAATCA sequence) GCAATATCAACGTAATAGTTCTGGAACTAAAGGGATCTGAAAC AACATTCATGTGTAATATGCTGATGAGACAGCAACCATTGTAG AATTTCTGAACAGATGGATTACCTTTTGTCAAAGCATCATCTCA ACACTGACTTGA 35 Human IL-2 APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFY without MPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINV signal IVLELKGSETTFMCEYADETATIVEFLNRWITFCQSIISTLT peptide (amino acid sequence) 36 Human MDMRVPAQLLGLLLLWLPGARCADAHKSEVAHRFKDLGEENFK serum ALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKS albumin LHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDN (amino acid PNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPEL sequence) LFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRL KCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVH TECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSH CIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLY EYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEF KPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTL VEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKT PVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADI CTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEK CCKADDKETCFAEEGKKLVAASQAALGLGGGSAPTSSSTKKTQL QLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQ CLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFM CEYADETATIVEFLNRWITFCQSIISTLTGGGS 37 Mature DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNE HSA(amino VTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMAD acid CCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETF sequence) LKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLL PKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRF PKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQ DSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKD VCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLE KCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKF QNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMP CAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALE VDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPK ATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQA ALGLGGGSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTR MLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPR DLISNINVIVLELKGSETTFMCEYADETATIVEFLNRWITFCQSIIST LTGGGS 38 Human ATGGATATGCGGGTGCCTGCTCAGCTGCTGGGACTGCTGCTGCT serum GTGGCTGCCTGGGGCTAGATGCGCCGATGCTCACAAAAGCGAA albumin GTCGCACACAGGTTCAAAGATCTGGGGGAGGAAAACTTTAAGG (nucleic CTCTGGTGCTGATTGCATTCGCCCAGTACCTGCAGCAGTGCCCC acid TTTGAGGACCACGTGAAACTGGTCAACGAAGTGACTGAGTTCG sequence) CCAAGACCTGCGTGGCCGACGAATCTGCTGAGAATTGTGATAA AAGTCTGCATACTCTGTTTGGGGATAAGCTGTGTACAGTGGCCA CTCTGCGAGAAACCTATGGAGAGATGGCAGACTGCTGTGCCAA ACAGGAACCCGAGCGGAACGAATGCTTCCTGCAGCATAAGGAC GATAACCCCAATCTGCCTCGCCTGGTGCGACCTGAGGTGGACG TCATGTGTACAGCCTTCCACGATAATGAGGAAACTTTTCTGAAG AAATACCTGTACGAAATCGCTCGGAGACATCCTTACTTTTATGC ACCAGAGCTGCTGTTCTTTGCCAAACGCTACAAGGCCGCTTTCA CCGAGTGCTGTCAGGCAGCCGATAAAGCTGCATGCCTGCTGCC TAAGCTGGACGAACTGAGGGATGAGGGCAAGGCCAGCTCCGCT AAACAGCGCCTGAAGTGTGCTAGCCTGCAGAAATTCGGGGAGC GAGCCTTCAAGGCTTGGGCAGTGGCACGGCTGAGTCAGAGATT CCCAAAGGCAGAATTTGCCGAGGTCTCAAAACTGGTGACCGAC CTGACAAAGGTGCACACCGAATGCTGTCATGGCGACCTGCTGG AGTGCGCCGACGATCGAGCTGATCTGGCAAAGTATATTTGTGA GAACCAGGACTCCATCTCTAGTAAGCTGAAAGAATGCTGTGAG AAACCACTGCTGGAAAAGTCTCACTGCATTGCCGAAGTGGAGA ACGACGAGATGCCAGCTGATCTGCCCTCACTGGCCGCTGACTTC GTCGAAAGCAAAGATGTGTGTAAGAATTACGCTGAGGCAAAGG ATGTGTTCCTGGGAATGTTTCTGTACGAGTATGCCAGGCGCCAC CCAGACTACTCCGTGGTCCTGCTGCTGAGGCTGGCTAAAACAT ATGAAACCACACTGGAGAAGTGCTGTGCAGCCGCTGATCCCCA TGAATGCTATGCCAAAGTCTTCGACGAGTTTAAGCCCCTGGTGG AGGAACCTCAGAACCTGATCAAACAGAATTGTGAACTGTTTGA GCAGCTGGGCGAGTACAAGTTCCAGAACGCCCTGCTGGTGCGC TATACCAAGAAAGTCCCACAGGTGTCCACACCCACTCTGGTGG AGGTGAGCCGGAATCTGGGCAAAGTGGGGAGTAAATGCTGTAA GCACCCTGAAGCCAAGAGGATGCCATGCGCTGAGGATTACCTG AGTGTGGTCCTGAATCAGCTGTGTGTCCTGCATGAAAAAACAC CTGTCAGCGACCGGGTGACAAAGTGCTGTACTGAGTCACTGGT GAACCGACGGCCCTGCTTTAGCGCCCTGGAAGTCGATGAGACT TATGTGCCTAAAGAGTTCAACGCTGAGACCTTCACATTTCACGC AGACATTTGTACCCTGAGCGAAAAGGAGAGACAGATCAAGAA ACAGACAGCCCTGGTCGAACTGGTGAAGCATAAACCCAAGGCC ACAAAAGAGCAGCTGAAGGCTGTCATGGACGATTTCGCAGCCT TTGTGGAAAAATGCTGTAAGGCAGACGATAAGGAGACTTGCTT TGCCGAGGAAGGAAAGAAACTGGTGGCTGCATCCCAGGCAGCT CTGGGACTGGGAGGAGGATCTGCCCCTACCTCAAGCTCCACTA AGAAAACCCAGCTGCAGCTGGAGCACCTGCTGCTGGACCTGCA GATGATTCTGAACGGGATCAACAATTACAAAAATCCAAAGCTG ACCCGGATGCTGACATTCAAGTTTTATATGCCCAAGAAAGCCA CAGAGCTGAAACACCTGCAGTGCCTGGAGGAAGAGCTGAAGCC TCTGGAAGAGGTGCTGAACCTGGCCCAGAGCAAGAATTTCCAT CTGAGACCAAGGGATCTGATCTCCAACATTAATGTGATCGTCCT GGAACTGAAGGGATCTGAGACTACCTTTATGTGCGAATACGCT GACGAGACTGCAACCATTGTGGAGTTCCTGAACAGATGGATCA CCTTCTGCCAGTCCATCATTTCTACTCTGACAGGCGGGGGGAGC 39 EETI-II GC PRILMR CKQDSDCLAGCVCGPNGFCG from Knottin Database 40 AgRP from GCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCR- Knottin KLGTAMNPCSRT Database “-” indicates where mini protein can be formed 41 Omega EDN--CIAEDYGKCTWGGTKCCRGRPCRCSMIGTN agatoxin CECTPRLIMEGLSFA from Knottin Database “-” indicates where mini protein can be formed 42 EETI-II GCXXXRGDXXXXXCKQDSDCLAGCVCGPNGFCG Library 43 EETI-II GCXXXRGDXXXXXCSQDSDCLAGCVCGPNGFCG K15S Mutation Library 44 2.5F- GGTTGTCCAAGACCAAGAGGTGATAATCCACCATTGACTTGTTC (K15S) TCAAGATTCTGATTGTTTGGCTGGTTGTGTTTGTGGTCCAAATG mIgG2aFc GTTTTTGTGGTGGTCGACTAGAGCCCAGAGTGCCCATAACACA Nucleic GAACCCCTGTCCTCCACTCAAAGAGTGTCCCCCATGCGCAGCTC Acid CAGACCTCTTGGGTGGACCATCCGTCTTCATCTTCCCTCCAAAG Sequence ATCAAGGATGTACTCATGATCTCCCTGAGCCCCATGGTCACATG TGTGGTGGTGGATGTGAGCGAGGATGACCCAGACGTCCAGATC AGCTGGTTTGTGAACAACGTGGAAGTACACACAGCTCAGACAC AAACCCATAGAGAGGATTACAACAGTACTCTCCGGGTGGTCAG TGCCCTCCCCATCCAGCACCAGGACTGGATGAGTGGCAAGGAG TTCAAATGCAAGGTCAACAACAGAGCCCTCCCATCCCCCATCG AGAAAACCATCTCAAAACCCAGAGGGCCAGTAAGAGCTCCACA GGTATATGTCTTGCCTCCACCAGCAGAAGAGATGACTAAGAAA GAGTTCAGTCTGACCTGCATGATCACAGGCTTCTTACCTGCCGA AATTGCTGTGGACTGGACCAGCAATGGGCGTACAGAGCAAAAC TACAAGAACACCGCAACAGTCCTGGACTCTGATGGTTCTTACTT CATGTACAGCAAGCTCAGAGTACAAAAGAGCACTTGGGAAAG AGGAAGTCTTTTCGCCTGCTCAGTGGTCCACGAGGGTCTGCACA ATCACCTTACGACTAAGACCATCTCCCGGTCTCTGGGTAAA 45 2.5F- GCPRPRGDNPPLTCSQDSDCLAGCVCGPNGFCGEPRVPITQNPCPP (K15S) LKECPPCAAPDLLGGPSVFIFPPKIKDVLMISLSPMVTCVVVDVSED mIgG2aFc DPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDW Amino MSGKEFKCKVNNRALPSPIEKTISKPRGPVRAPQVYVLPPPAEEMT Acid KKEFSLTCMITGFLPAEIAVDWTSNGRTEQNYKNTATVLDSDGSY Sequence FMYSKLRVQKSTWERGSLFACSVVHEGLHNHLTTKTISRSLGK 46 2.5D- GGTTGTCCACAAGGCAGAGGTGATTGGGCTCCAACTTCTTGTTC (K15S) TCAAGATTCTGATTGTTTGGCTGGTTGTGTTTGTGGTCCAAATG mIgG2aFc GTTTTTGTGGTGGTCGACTAGAGCCCAGAGTGCCCATAACACA Nucleic GAACCCCTGTCCTCCACTCAAAGAGTGTCCCCCATGCGCAGCTC Acid CAGACCTCTTGGGTGGACCATCCGTCTTCATCTTCCCTCCAAAG Sequence ATCAAGGATGTACTCATGATCTCCCTGAGCCCCATGGTCACATG TGTGGTGGTGGATGTGAGCGAGGATGACCCAGACGTCCAGATC AGCTGGTTTGTGAACAACGTGGAAGTACACACAGCTCAGACAC AAACCCATAGAGAGGATTACAACAGTACTCTCCGGGTGGTCAG TGCCCTCCCCATCCAGCACCAGGACTGGATGAGTGGCAAGGAG TTCAAATGCAAGGTCAACAACAGAGCCCTCCCATCCCCCATCG AGAAAACCATCTCAAAACCCAGAGGGCCAGTAAGAGCTCCACA GGTATATGTCTTGCCTCCACCAGCAGAAGAGATGACTAAGAAA GAGTTCAGTCTGACCTGCATGATCACAGGCTTCTTACCTGCCGA AATTGCTGTGGACTGGACCAGCAATGGGCGTACAGAGCAAAAC TACAAGAACACCGCAACAGTCCTGGACTCTGATGGTTCTTACTT CATGTACAGCAAGCTCAGAGTACAAAAGAGCACTTGGGAAAG AGGAAGTCTTTTCGCCTGCTCAGTGGTCCACGAGGGTCTGCACA ATCACCTTACGACTAAGACCATCTCCCGGTCTCTGGGTAAA 47 2.5D- GCPQGRGDWAPTSCSQDSDCLAGCVCGPNGFCGEPRVPITQNPCP (K15S) PLKECPPCAAPDLLGGPSVFIFPPKIKDVLMISLSPMVTCVVVDVSE mIgG2aFc DDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQD Amino WMSGKEFKCKVNNRALPSPIEKTISKPRGPVRAPQVYVLPPPAEE Acid MTKKEFSLTCMITGFLPAEIAVDWTSNGRTEQNYKNTATVLDSDG Sequence SYFMYSKLRVQKSTWERGSLFACSVVHEGLHNHLTTKTISRSLGK 48 2.5F- GCPRPRGDNPPLTCSQDSDCLAGCVCGPNGFCGEPKSCDKTHTCP (K15S) PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV hIgG1Fc KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG Amino KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQ Acid VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS Sequence KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 49 2.5F- GCPRPRGDNPPLTCSQDSDCLAGCVCGPNGFCGDKTHTCPPCPAP (K15S) ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY hIgG1Fc VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC Fc Upper KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC Hinge LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV Deletion DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (ΔEPKSC) Amino Acid Sequence 50 2.5D- GCPQGRGDWAPTSCSQDSDCLAGCVCGPNGFCGEPKSCDKTHTC (K15S) PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV hIgG1Fc KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG Amino KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQ Acid VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS Sequence KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 51 2.5D- GCPQGRGDWAPTSCSQDSDCLAGCVCGPNGFCGDKTHTCPPCPA (K15S) PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW hIgG1Fc YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK Fc Upper CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT Hinge CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV Deletion LSLSPGK (ΔEPKSC) Amino Acid Sequence 52 hPD-1 MQIPQAPWPVVWAVLQLGWRPGWFLDSPDPWNPPTFFPALLVVT amino acid EGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPG sequence QDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIK ESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGSL VLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGEL DFQWREKTPEPPVPCVPEQTEYATIVFPSGMGTSSPARRGSADGPR SAQPLRPEDGHCSWPL 53 hPD-L-1 MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVE amino acid KQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLK sequence DQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAP YNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGK TTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVI PELPLAHPPNERTHLVILGAILLCLGVALTFIFR LRKGRMMDVKKCGIQDTNSK KQSDTHLEET 54 hCTLA-4 MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPA amino acid VVLASS sequence RGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYM MGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMY PPPYY LGIGNGTQIY VIDPEPCPDS DFLLWILAAVSSGLFFYSFL LTAVSLSKML KKRSPLTTGVYVKMPPTEPE CEKQFQPYFIPIN 55 hLAG3 MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLP amino acid CSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAP sequence SSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSL WLRPAR RADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLR ASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESF LFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVY AGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGD FTLRL EDVSQAQAGT YTCHIHLQEQ QLNATVTLAIITVTPKSFGS PGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLL SQPWQCQLYQGERLLGAAVYFTEL SSPGAQRSGR APGALPAGHL LLFLILGVLS LLLLVTGAFG FHLWRRQWRPRRFSALEQGI HPPQAQSKIE ELEQEPEPEPEP EPEPEPEP EPEQL 56 hTIM3 MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPG amino acid NLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFR sequence KGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTP APTR QRDFTAAFPR MLTTRGHGPA ETQTLGSLPD INLTQISTLA NELRDSRLANDLRDSGATIRGIYIGAGICAGLALALIFGALIFKWYS HSKEKIQNLSLISLANLPPSGLANAVAEGIRSEENIYTIEENVYEVEE PNEYYCYVSSRQQPSQPLGCRFAMP 57 hB7-H3 MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVG amino acid TDATLCC SFSPEPGFSLQLNLIWQLT DTKQLVHSFA sequence EGQDQGSAYA NRTALFPDLLAQGNASLRLQRVRVADEGSFCFVSIRDFGSAAVSL QVAA PYSKPSMTLE PNKDLRPGDT VTITCSSYQG YPEAEVFWQD GQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRN PVLQQD AHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSF SPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFP DLLAQ GNASLRLQRV RVADEGSFTC FVSIRDFGSA AVSLQVAAPY SKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLT GNVTT SQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAH GSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSC EEEN AGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA 58 hB7-H4 MASLGQILFWSIISIIIILAGAIALIIGFGISAFSMPEVNVDYNASSETL amino acid RCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKV sequence VSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNS KASLCVSSFFAISWALLPLSPYLMLK 59 Anti-VEGF ATGGGCTGGTCCCTGATCCTGCTGTTCCTGGTGGCTGTGGCCACTG clone B20- GCGTGCACTCT GAAGTGCAGCTGGTGGAATCTGGCGGCGGA 4.1.1 Heavy CTGGTGCAGCCTGGCGGATCTCTGAGACTGAGCTGTGCCG Chain CCAGCGGCTTCAGCATCAGCGGCAGCTGGATCTTCTGGGTG nucleicacid CGCCAGGCCCCTGGAAAGGGCCTGGAATGGGTGGGAGCCA sequence TCTGGCCTTTTGGCGGCTACACCCACTACGCCGACAGCGTG AAGGGCCGGTTTACCATCAGCGCCGACACCAGCAAGAACA CCGCCTACCTCCAGATGAACAGCCTGCGGGCCGAGGACAC CGCCGTGTACTATTGTGCCAGATGGGGCCACAGCACCTCCC CCTGGGCCATGGATTATTGGGGCCAGGGAACCCTCGTGAC CGTGTCCTCTGCCAAAACAACAGCCCCATCGGTCTATCCACTG GCCCCTGTGTGTGGAGGTACAACTGGCTCCTCGGTGACTCTAGG ATGCCTGGTCAAGGGTTATTTCCCTGAGCCAGTGACCTTGACCT GGAACTCTGGCTCACTGTCCAGTGGTGTGCACACCTTCCCAGCT CTCCTCCAATCTGGCCTCTACACCCTCAGCAGCTCAGTGACTGT AACCTCGAACACCTGGCCCAGCCAGACCATCACCTGCAATGTG GCCCACCCGGCAAGCAGCACCAAAGTGGACAAGAAAATTGAG CCCAGAGTGCCCATAACACAGAACCCCTGTCCTCCACTCAAAG AGTGTCCCCCATGCGCAGCTCCAGACCTCTTGGGTGGACCATCC GTCTTCATCTTCCCTCCAAAGATCAAGGATGTACTCATGATCTC CCTGAGCCCCATGGTCACATGTGTGGTGGTGGATGTGAGCGAG GATGACCCAGACGTCCAGATCAGCTGGTTTGTGAACAACGTGG AAGTACACACAGCTCAGACACAAACCCATAGAGAGGATTACAA CAGTACTCTCCGGGTGGTCAGTGCCCTCCCCATCCAGCACCAGG ACTGGATGAGTGGCAAGGAGTTCAAATGCAAGGTCAACAACAG AGCCCTCCCATCCCCCATCGAGAAAACCATCTCAAAACCCAGA GGGCCAGTAAGAGCTCCACAGGTATATGTCTTGCCTCCACCAG CAGAAGAGATGACTAAGAAAGAGTTCAGTCTGACCTGCATGAT CACAGGCTTCTTACCTGCCGAAATTGCTGTGGACTGGACCAGC AATGGGCGTACAGAGCAAAACTACAAGAACACCGCAACAGTC CTGGACTCTGATGGTTCTTACTTCATGTACAGCAAGCTCAGAGT ACAAAAGAGCACTTGGGAAAGAGGAAGTCTTTTCGCCTGCTCA GTGGTCCACGAGGGTCTGCACAATCACCTTACGACTAAGACCA TCTCCCGGTCTCTGGGTAAA 60 Anti-VEGF MGWSLILLFLVAVATGVHS EVQLVESGGGLVQPGGSLRLSCAASG clone B20- FSISGSWIFWVRQAPGKGLEWVGAIWPFGGYTHYADSVKGRF 4.1.1 Heavy TISADTSKNTAYLQMNSLRAEDTAVYYCARWGHSTSPWAMDY Chain WGQGTLVTVSSAKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYF amino acid PEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTI sequence TCNVAHPASSTKVDKKIEPRVPITQNPCPPLKECPPCAAPDLLGGPS VFIFPPKIKDVLMISLSPMVTCVVVDVSEDDPDVQISWFVNNVEVH TAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNRALP SPIEKTISKPRGPVRAPQVYVLPPPAEEMTKKEFSLTCMITGFLPAEI AVDWTSNGRTEQNYKNTATVLDSDGSYFMYSKLRVQKSTWERG SLFACSVVHEGLHNHLTTKTISRSLGK 61 Anti-VEGF ATGGACATGAGAGTGCCCGCCCAGCTGCTGGGACTTCTGCTGCTGT clone B20- GGCTGCCAGGCGCCAGATGC GACATCCAGATGACCCAGAGCC 4.1.1 CCAGCAGCCTGTCTGCCAGCGTGGGCGACAGAGTGACCAT Light CACCTGTAGAGCCTCTCAGGGCGTGCGGACAAGCCTGGCC Chain TGGTATCAGCAGAAGCCTGGCAAGGCCCCCAAGCTGCTGAT nucleic acid CTACGATGCCAGCTCTCTGGCCAGCGGCGTGCCCAGCAGAT sequence TTTCTGGCAGCGGCTCCGGCACCGACTTCACCCTGACAATC AGCTCCCTCCAGCCCGAGGACTTCGCCACCTACTACTGCCA GCAGAGCTACAAGAGCCCCCTGACCTTTGGCCAGGGCACC AAGGTGGAAATCAAGCGGGCTGATGCTGCACCAACTGTATCC ATCTTCCCACCATCCAGTGAGCAGTTAACATCTGGAGGTGCCTC AGTCGTGTGCTTCTTGAACAACTTCTACCCCAAAGACATCAATG TCAAGTGGAAGATTGATGGCAGTGAACGACAAAATGGCGTCCT GAACAGTTGGACTGATCAGGACAGCAAAGACAGCACCTACAGC ATGAGCAGCACCCTCACGTTGACCAAGGACGAGTATGAACGAC ATAACAGCTATACCTGTGAGGCCACTCACAAGACATCAACTTC ACCCATTGTCAAGAGCTTCAACAGGAATGAGTGT 62 Anti-VEGF MDMRVPAQLLGLILLWLPGARC DIQMTQSPSSLSASVGDRVTITC clone B20- RASQGVRTSLAWYQQKPGKAPKLLIYDASSLASGVPSRFSGSG 4.1.1 Light SGTDFTLTISSLQPEDFATYYCQQSYKSPLTFGQGTKVEIKRAD Chain AAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQ amino acid NGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTS sequence TSPIVKSFNRNEC 63 Anti-CTLA- ATGGGCTGGTCCCTGATCCTGCTGTTCCTGGTGGCTGTGGCCACC 4 clone 9D9 GGCGTGCACTCT GAAGCCAAGCTCCAGGAATCCGGCCCTGTG Heavy CTCGTGAAGCCTGGCGCCTCTGTGAAGATGAGCTGCAAGG Chain CCAGCGGCTACACCTTTACCGACTACTACATGAACTGGGTC nucleic acid AAGCAGAGCCACGGCAAGTCTCTGGAATGGATCGGCGTGA sequence TCAACCCCTACAACGGCGACACCAGCTACAACCAGAAGTTC AAGGGCAAGGCCACCCTGACCGTGGACAAGAGCAGCAGCA CCGCCTACATGGAACTGAACAGCCTGACCAGCGAGGACAG CGCCGTGTACTATTGCGCCCGGTACTACGGCAGTTGGTTCG CCTATTGGGGCCAGGGCACCCTGATCACCGTGTCCACAGCC AAAACAACAGCCCCATCGGTCTATCCACTGGCCCCTGTGTGTG GAGGTACAACTGGCTCCTCGGTGACTCTAGGATGCCTGGTCAA GGGTTATTTCCCTGAGCCAGTGACCTTGACCTGGAACTCTGGCT CACTGTCCAGTGGTGTGCACACCTTCCCAGCTCTCCTCCAATCT GGCCTCTACACCCTCAGCAGCTCAGTGACTGTAACCTCGAACA CCTGGCCCAGCCAGACCATCACCTGCAATGTGGCCCACCCGGC AAGCAGCACCAAAGTGGACAAGAAAATTGAGCCCAGAGTGCC CATAACACAGAACCCCTGTCCTCCACTCAAAGAGTGTCCCCCAT GCGCAGCTCCAGACCTCTTGGGTGGACCATCCGTCTTCATCTTC CCTCCAAAGATCAAGGATGTACTCATGATCTCCCTGAGCCCCAT GGTCACATGTGTGGTGGTGGATGTGAGCGAGGATGACCCAGAC GTCCAGATCAGCTGGTTTGTGAACAACGTGGAAGTACACACAG CTCAGACACAAACCCATAGAGAGGATTACAACAGTACTCTCCG GGTGGTCAGTGCCCTCCCCATCCAGCACCAGGACTGGATGAGT GGCAAGGAGTTCAAATGCAAGGTCAACAACAGAGCCCTCCCAT CCCCCATCGAGAAAACCATCTCAAAACCCAGAGGGCCAGTAAG AGCTCCACAGGTATATGTCTTGCCTCCACCAGCAGAAGAGATG ACTAAGAAAGAGTTCAGTCTGACCTGCATGATCACAGGCTTCTT ACCTGCCGAAATTGCTGTGGACTGGACCAGCAATGGGCGTACA GAGCAAAACTACAAGAACACCGCAACAGTCCTGGACTCTGATG GTTCTTACTTCATGTACAGCAAGCTCAGAGTACAAAAGAGCAC TTGGGAAAGAGGAAGTCTTTTCGCCTGCTCAGTGGTCCACGAG GGTCTGCACAATCACCTTACGACTAAGACCATCTCCCGGTCTCT GGGTAAA 64 Anti-CTLA- MGWSLILLFLVAVATGVHS EAKLQESGPVLVKPGASVKMSCKAS clone 9D9 GYTFTDYYMNWVKQSHGKSLEWIGVINPYNGDTSYNQKFKG Heavy KATLTVDKSSSTAYMELNSLTSEDSAVYYCARYYGSWFAYWG Chain QGTLITVSTAKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEP amino acid VTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITC sequence NVAHPASSTKVDKKIEPRVPITQNPCPPLKECPPCAAPDLLGGPSVF IFPPKIKDVLMISLSPMVTCVVVDVSEDDPDVQISWFVNNVEVHTA QTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNRALPSPI EKTISKPRGPVRAPQVYVLPPPAEEMTKKEFSLTCMITGFLPAEIAV DWTSNGRTEQNYKNTATVLDSDGSYFMYSKLRVQKSTWERGSLF ACSVVHEGLHNHLTTKTISRSLGK 65 Anti-CTLA- ATGGACATGAGAGTGCCCGCCCAGCTGCTGGGACTTCTGCTGCTGT clone 9D9 GGCTGCCAGGCGCCAGATGC GACATCGTGATGACCCAGACCA Light Chain CCCTGAGCCTGCCTGTGTCCCTGGGAGATCAGGCCAGCATC nucleic acid AGCTGTCGGAGCAGCCAGAGCATCGTGCACAGCAACGGCA sequence ACACCTACCTGGAATGGTATCTCCAGAAGCCCGGCCAGAGC CCCAAGCTGCTGATCTACAAGGTGTCCAACCGGTTCAGCGG CGTGCCCGACAGATTTTCTGGCAGCGGCTCCGGCACCGACT TCACCCTGAAGATCTCCCGGGTGGAAGCCGAGGACCTGGG CGTGTACTACTGTTTTCAAGGCAGCCACGTGCCCTACACCT TCGGCGGAGGCACCAAGCTGGAAATCAAGCGGGCTGATGCT GCACCAACTGTATCCATCTTCCCACCATCCAGTGAGCAGTTAAC ATCTGGAGGTGCCTCAGTCGTGTGCTTCTTGAACAACTTCTACC CCAAAGACATCAATGTCAAGTGGAAGATTGATGGCAGTGAACG ACAAAATGGCGTCCTGAACAGTTGGACTGATCAGGACAGCAAA GACAGCACCTACAGCATGAGCAGCACCCTCACGTTGACCAAGG ACGAGTATGAACGACATAACAGCTATACCTGTGAGGCCACTCA CAAGACATCAACTTCACCCATTGTCAAGAGCTTCAACAGGAAT GAGTGT 66 Anti-CTLA- MDMRVPAQUGLILLWLPGARC DIVMTQTTLSLPVSLGDQASISC 4 clone 9D9 RSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRF Light Chain SGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTEGGGTKLE amino acid IKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKID sequence GSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCE ATHKTSTSPIVKSFNRNEC
Claims (22)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/407,011 US20220193197A1 (en) | 2014-08-12 | 2021-08-19 | Synergistic tumor treatment with il-2 and integrin-binding-fc fusion protein |
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201462036554P | 2014-08-12 | 2014-08-12 | |
PCT/US2015/044920 WO2016025642A1 (en) | 2014-08-12 | 2015-08-12 | Synergistic tumor treatment with il-2 and integrin-binding-fc-fusion protein |
US201715501028A | 2017-02-01 | 2017-02-01 | |
US16/230,466 US11096989B2 (en) | 2014-08-12 | 2018-12-21 | Synergistic tumor treatment with an extended pharmacokinetic IL-2 and integrin-binding-Fc fusion protein |
US17/407,011 US20220193197A1 (en) | 2014-08-12 | 2021-08-19 | Synergistic tumor treatment with il-2 and integrin-binding-fc fusion protein |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/230,466 Continuation US11096989B2 (en) | 2014-08-12 | 2018-12-21 | Synergistic tumor treatment with an extended pharmacokinetic IL-2 and integrin-binding-Fc fusion protein |
Publications (1)
Publication Number | Publication Date |
---|---|
US20220193197A1 true US20220193197A1 (en) | 2022-06-23 |
Family
ID=54007995
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/501,028 Active US10166273B2 (en) | 2014-08-12 | 2015-08-12 | Synergistic tumor treatment with antibodies targeting PD-1, PD-L1 or CTLA4 and integrin-binding-Fc-fusion protein |
US16/230,466 Active US11096989B2 (en) | 2014-08-12 | 2018-12-21 | Synergistic tumor treatment with an extended pharmacokinetic IL-2 and integrin-binding-Fc fusion protein |
US17/407,011 Pending US20220193197A1 (en) | 2014-08-12 | 2021-08-19 | Synergistic tumor treatment with il-2 and integrin-binding-fc fusion protein |
Family Applications Before (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/501,028 Active US10166273B2 (en) | 2014-08-12 | 2015-08-12 | Synergistic tumor treatment with antibodies targeting PD-1, PD-L1 or CTLA4 and integrin-binding-Fc-fusion protein |
US16/230,466 Active US11096989B2 (en) | 2014-08-12 | 2018-12-21 | Synergistic tumor treatment with an extended pharmacokinetic IL-2 and integrin-binding-Fc fusion protein |
Country Status (7)
Country | Link |
---|---|
US (3) | US10166273B2 (en) |
EP (2) | EP3180018B1 (en) |
JP (1) | JP6800141B2 (en) |
AU (1) | AU2015301753B2 (en) |
CA (2) | CA2957717C (en) |
DK (1) | DK3180018T3 (en) |
WO (1) | WO2016025642A1 (en) |
Families Citing this family (32)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2008045252A2 (en) * | 2006-10-04 | 2008-04-17 | The Board Of Trustees Of The Leland Stanford Junior University | Engineered integrin binding peptides |
WO2013177187A2 (en) | 2012-05-22 | 2013-11-28 | Massachusetts Institute Of Technology | Synergistic tumor treatment with extended-pk il-2 and therapeutic agents |
EP3640375A3 (en) | 2012-12-11 | 2020-07-29 | Albert Einstein College of Medicine | Methods for high throughput receptor/ligand identification |
WO2017139570A1 (en) | 2016-02-12 | 2017-08-17 | Massachusetts Intitute Of Technology | Synergistic tumor treatment with il-2, an integrin-binding-fc fusion protein, and a cancer vaccinne |
EP3213768A1 (en) | 2016-03-01 | 2017-09-06 | LODOCO CLINICAL Kft | Combination of low dose immune checkpoint blockade with high dose il-2 for treating metastatic cancer |
KR20190044029A (en) | 2016-05-18 | 2019-04-29 | 알버트 아인슈타인 컬리지 오브 메디슨, 인크. | Variant PD-L1 polypeptides, T-cell modulated multimeric polypeptides and methods for their use |
JP7071288B2 (en) | 2016-05-18 | 2022-05-18 | キュー バイオファーマ, インコーポレイテッド | T cell regulatory multimeric polypeptide and its usage |
US10690573B2 (en) * | 2016-05-25 | 2020-06-23 | Cytoskeleton, Inc. | Methods of reducing viscosity of biological samples |
EP3558339B1 (en) | 2016-12-22 | 2024-01-24 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
EP3565829A4 (en) | 2017-01-09 | 2021-01-27 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
EP3568150A4 (en) * | 2017-01-10 | 2020-12-02 | Xcella Biosciences, Inc. | Combination tumor treatment with an integrin-binding-fc fusion protein and immune modulator |
US10350266B2 (en) | 2017-01-10 | 2019-07-16 | Nodus Therapeutics, Inc. | Method of treating cancer with a multiple integrin binding Fc fusion protein |
CN110520436A (en) | 2017-03-15 | 2019-11-29 | 潘迪恩治疗公司 | Target immunological tolerance |
CA3054955A1 (en) | 2017-03-15 | 2018-09-20 | Cue Biopharma, Inc. | Methods for modulating an immune response |
AU2018273914A1 (en) | 2017-05-24 | 2019-11-14 | Pandion Operations, Inc. | Targeted immunotolerance |
JP2020520671A (en) * | 2017-05-24 | 2020-07-16 | ノバルティス アーゲー | Antibody-cytokine grafted proteins and methods of use |
MX2019014023A (en) | 2017-05-24 | 2020-02-17 | Novartis Ag | Antibody-cytokine engrafted proteins and methods of use in the treatment of cancer. |
US10946068B2 (en) | 2017-12-06 | 2021-03-16 | Pandion Operations, Inc. | IL-2 muteins and uses thereof |
US10174091B1 (en) | 2017-12-06 | 2019-01-08 | Pandion Therapeutics, Inc. | IL-2 muteins |
WO2019139896A1 (en) | 2018-01-09 | 2019-07-18 | Cue Biopharma, Inc. | Multimeric t-cell modulatory polypeptides and methods of use thereof |
AU2019219200A1 (en) * | 2018-02-12 | 2020-08-06 | BioNTech SE | Treatment using cytokine encoding RNA |
US20210230242A1 (en) * | 2018-06-18 | 2021-07-29 | Anwita Biosciences, Inc. | Cytokine fusion proteins and uses thereof |
GB201810329D0 (en) * | 2018-06-22 | 2018-08-08 | Bicycletx Ltd | Peptide ligands for binding to integrin avB3 |
US11235032B2 (en) | 2019-01-23 | 2022-02-01 | Massachusetts Institute Of Technology | Combination immunotherapy dosing regimen for immune checkpoint blockade |
EP3921851B1 (en) | 2019-02-06 | 2023-10-18 | Cornell University | Darc expression as prognosticator of immunotherapy outcomes |
US20200282013A1 (en) * | 2019-03-08 | 2020-09-10 | DrugCendR, Inc. | Low-dose cytokine co-administered with irgd for treating cancer |
BR112021023345A2 (en) | 2019-05-20 | 2022-02-01 | Pandion Operations Inc | Targeted immunotolerance in madcam |
AU2020392166A1 (en) * | 2019-11-27 | 2022-05-26 | Gi Innovation, Inc. | Pharmaceutical composition for treatment of cancer, comprising immune checkpoint inhibitor and fusion protein including IL-2 protein and CD80 protein |
EP4087865A2 (en) | 2020-01-10 | 2022-11-16 | Bright Peak Therapeutics AG | Modified il-2 polypeptides and uses thereof |
WO2021168079A1 (en) | 2020-02-21 | 2021-08-26 | Pandion Operations, Inc. | Tissue targeted immunotolerance with a cd39 effector |
TW202208395A (en) | 2020-05-12 | 2022-03-01 | 美商信號生物製藥公司 | Multimeric t-cell modulatory polypeptides and methods of use thereof |
WO2022056014A1 (en) | 2020-09-09 | 2022-03-17 | Cue Biopharma, Inc. | Mhc class ii t-cell modulatory multimeric polypeptides for treating type 1 diabetes mellitus (t1d) and methods of use thereof |
Family Cites Families (83)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
US3941763A (en) | 1975-03-28 | 1976-03-02 | American Home Products Corporation | PGlu-D-Met-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-Gly-NH2 and intermediates |
US4263428A (en) | 1978-03-24 | 1981-04-21 | The Regents Of The University Of California | Bis-anthracycline nucleic acid function inhibitors and improved method for administering the same |
IE52535B1 (en) | 1981-02-16 | 1987-12-09 | Ici Plc | Continuous release pharmaceutical compositions |
DE3374837D1 (en) | 1982-02-17 | 1988-01-21 | Ciba Geigy Ag | Lipids in the aqueous phase |
HUT35524A (en) | 1983-08-02 | 1985-07-29 | Hoechst Ag | Process for preparing pharmaceutical compositions containing regulatory /regulative/ peptides providing for the retarded release of the active substance |
EP0143949B1 (en) | 1983-11-01 | 1988-10-12 | TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION | Pharmaceutical composition containing urokinase |
US5128319A (en) | 1987-08-28 | 1992-07-07 | Board Of Regents, The University Of Texas System | Prophylaxis and therapy of acquired immunodeficiency syndrome |
US5766897A (en) | 1990-06-21 | 1998-06-16 | Incyte Pharmaceuticals, Inc. | Cysteine-pegylated proteins |
JP3051145B2 (en) | 1990-08-28 | 2000-06-12 | 住友製薬株式会社 | Novel polyethylene glycol derivative modified peptide |
US6582959B2 (en) | 1991-03-29 | 2003-06-24 | Genentech, Inc. | Antibodies to vascular endothelial cell growth factor |
US20030206899A1 (en) | 1991-03-29 | 2003-11-06 | Genentech, Inc. | Vascular endothelial cell growth factor antagonists |
WO1994004679A1 (en) | 1991-06-14 | 1994-03-03 | Genentech, Inc. | Method for making humanized antibodies |
US5281698A (en) | 1991-07-23 | 1994-01-25 | Cetus Oncology Corporation | Preparation of an activated polymer ester for protein conjugation |
FR2686899B1 (en) | 1992-01-31 | 1995-09-01 | Rhone Poulenc Rorer Sa | NOVEL BIOLOGICALLY ACTIVE POLYPEPTIDES, THEIR PREPARATION AND PHARMACEUTICAL COMPOSITIONS CONTAINING THEM. |
WO1994001451A2 (en) | 1992-07-13 | 1994-01-20 | Bionebraska, Inc. | Method for modification of recombinant polypeptides |
US5382657A (en) | 1992-08-26 | 1995-01-17 | Hoffmann-La Roche Inc. | Peg-interferon conjugates |
RO119721B1 (en) | 1992-10-28 | 2005-02-28 | Genentech Inc. | Antagonists of vascular endotelial cell growth factor |
US5446090A (en) | 1993-11-12 | 1995-08-29 | Shearwater Polymers, Inc. | Isolatable, water soluble, and hydrolytically stable active sulfones of poly(ethylene glycol) and related polymers for modification of surfaces and molecules |
US5932462A (en) | 1995-01-10 | 1999-08-03 | Shearwater Polymers, Inc. | Multiarmed, monofunctional, polymer for coupling to molecules and surfaces |
IL117645A (en) | 1995-03-30 | 2005-08-31 | Genentech Inc | Vascular endothelial cell growth factor antagonists for use as medicaments in the treatment of age-related macular degeneration |
US6100071A (en) | 1996-05-07 | 2000-08-08 | Genentech, Inc. | Receptors as novel inhibitors of vascular endothelial growth factor activity and processes for their production |
WO1998045331A2 (en) | 1997-04-07 | 1998-10-15 | Genentech, Inc. | Anti-vegf antibodies |
US20020032315A1 (en) | 1997-08-06 | 2002-03-14 | Manuel Baca | Anti-vegf antibodies |
JP4191258B2 (en) | 1997-04-07 | 2008-12-03 | ジェネンテック・インコーポレーテッド | Humanized antibodies and methods for forming humanized antibodies |
US6884879B1 (en) | 1997-04-07 | 2005-04-26 | Genentech, Inc. | Anti-VEGF antibodies |
US6703030B2 (en) | 1998-06-16 | 2004-03-09 | Marvin E. Klein | Amino fruit acid composition and method for the treatment of skin |
US6682736B1 (en) | 1998-12-23 | 2004-01-27 | Abgenix, Inc. | Human monoclonal antibodies to CTLA-4 |
US7087411B2 (en) | 1999-06-08 | 2006-08-08 | Regeneron Pharmaceuticals, Inc. | Fusion protein capable of binding VEGF |
US7605238B2 (en) | 1999-08-24 | 2009-10-20 | Medarex, Inc. | Human CTLA-4 antibodies and their uses |
AU784012B2 (en) | 1999-08-24 | 2006-01-12 | E. R. Squibb & Sons, L.L.C. | Human CTLA-4 antibodies and their uses |
US20050287153A1 (en) | 2002-06-28 | 2005-12-29 | Genentech, Inc. | Serum albumin binding peptides for tumor targeting |
US7034121B2 (en) | 2000-01-27 | 2006-04-25 | Genetics Institue, Llc | Antibodies against CTLA4 |
WO2002096948A2 (en) | 2001-01-29 | 2002-12-05 | Idec Pharmaceuticals Corporation | Engineered tetravalent antibodies and methods of use |
IL157142A0 (en) | 2001-01-29 | 2004-02-08 | Idec Pharma Corp | Modified antibodies and methods of use |
US7176278B2 (en) | 2001-08-30 | 2007-02-13 | Biorexis Technology, Inc. | Modified transferrin fusion proteins |
US7696320B2 (en) | 2004-08-24 | 2010-04-13 | Domantis Limited | Ligands that have binding specificity for VEGF and/or EGFR and methods of use therefor |
PT2316852E (en) | 2002-11-08 | 2014-06-23 | Ablynx Nv | Stabilized single domain antibodies |
US7610156B2 (en) | 2003-03-31 | 2009-10-27 | Xencor, Inc. | Methods for rational pegylation of proteins |
NZ621449A (en) | 2003-05-30 | 2015-07-31 | Genentech Inc | Treatment with anti-vegf antibodies |
WO2005007121A2 (en) | 2003-07-18 | 2005-01-27 | Massachusetts Institute Of Technology | Mutant interleukin-2(il-2) polypeptides |
WO2005044853A2 (en) | 2003-11-01 | 2005-05-19 | Genentech, Inc. | Anti-vegf antibodies |
EP1664116A4 (en) | 2003-08-22 | 2009-06-03 | Biogen Idec Inc | Improved antibodies having altered effector function and methods for making the same |
WO2005063815A2 (en) | 2003-11-12 | 2005-07-14 | Biogen Idec Ma Inc. | Fcϝ receptor-binding polypeptide variants and methods related thereto |
JP5006651B2 (en) | 2003-12-05 | 2012-08-22 | ブリストル−マイヤーズ スクウィブ カンパニー | Inhibitor of type 2 vascular endothelial growth factor receptor |
US20050251617A1 (en) | 2004-05-07 | 2005-11-10 | Sinclair Alan W | Hybrid non-volatile memory system |
SI1729795T1 (en) | 2004-02-09 | 2016-04-29 | Human Genome Sciences, Inc. | Albumin fusion proteins |
US20060009360A1 (en) | 2004-06-25 | 2006-01-12 | Robert Pifer | New adjuvant composition |
EP2439273B1 (en) | 2005-05-09 | 2019-02-27 | Ono Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics |
CA2605781A1 (en) | 2005-05-09 | 2007-04-12 | Glycart Biotechnology Ag | Antigen binding molecules having modified fc regions and altered binding to fc receptors |
LT2397156T (en) * | 2005-06-08 | 2017-02-27 | Dana-Farber Cancer Institute, Inc. | Methods and compositions for the treatment of persistent infections and cancer by inhibiting the programmed cell death 1 (PD-1)pathway |
ES2546333T3 (en) | 2005-07-01 | 2015-09-22 | E. R. Squibb & Sons, L.L.C. | Human monoclonal antibodies to ligands 1 (PD-L1) of programmed death |
US20070269422A1 (en) | 2006-05-17 | 2007-11-22 | Ablynx N.V. | Serum albumin binding proteins with long half-lives |
JP5102833B2 (en) | 2006-07-24 | 2012-12-19 | バイオレクシス ファーマシューティカル コーポレーション | Exendin fusion protein |
KR100762642B1 (en) * | 2006-08-21 | 2007-10-01 | 삼성전자주식회사 | Method for displaying sms message background picture in terminal including sms function and terminal thereof |
EP2069402A2 (en) | 2006-09-08 | 2009-06-17 | Ablynx N.V. | Serum albumin binding proteins with long half-lives |
WO2008045252A2 (en) | 2006-10-04 | 2008-04-17 | The Board Of Trustees Of The Leland Stanford Junior University | Engineered integrin binding peptides |
ATE516814T1 (en) | 2007-02-02 | 2011-08-15 | Bristol Myers Squibb Co | 10FN3 DOMAIN FOR THE TREATMENT OF DISEASES ACCOMPANIED BY UNDESIRABLE ANGIOGENESIS |
KR101143294B1 (en) | 2007-05-01 | 2012-05-24 | 퀄컴 인코포레이티드 | Position location for wireless communication systems |
JP2011507543A (en) | 2007-12-27 | 2011-03-10 | ノバルティス アーゲー | Improved fibronectin-based binding molecules and their use |
KR20100132535A (en) | 2008-03-31 | 2010-12-17 | 글락소 그룹 리미티드 | Drug fusions and conjugates |
CN102076713B (en) | 2008-05-02 | 2015-03-25 | 诺华股份有限公司 | Improved fibronectin-based binding molecules and uses thereof |
AR072999A1 (en) | 2008-08-11 | 2010-10-06 | Medarex Inc | HUMAN ANTIBODIES THAT JOIN GEN 3 OF LYMPHOCYTARY ACTIVATION (LAG-3) AND THE USES OF THESE |
TWI496582B (en) | 2008-11-24 | 2015-08-21 | 必治妥美雅史谷比公司 | Bispecific egfr/igfir binding molecules |
US8741839B2 (en) | 2009-01-18 | 2014-06-03 | The Board Of Trustees Of The Leland Stanford Junior University | Polypeptides targeting vascular endothelial growth factor receptor-2 and αvβ3 integrin |
WO2010093771A1 (en) | 2009-02-11 | 2010-08-19 | Bristol-Myers Squibb Company | Combination vegfr2 therapy with temozolomide |
CN105567699A (en) | 2009-10-30 | 2016-05-11 | 诺维信生物制药丹麦公司 | Albumin variants |
JP5998060B2 (en) | 2010-03-04 | 2016-09-28 | マクロジェニクス,インコーポレーテッド | Antibodies reactive with B7-H3, immunologically active fragments thereof and uses thereof |
WO2011124718A1 (en) | 2010-04-09 | 2011-10-13 | Novozymes A/S | Albumin derivatives and variants |
CN105175532B (en) | 2010-04-13 | 2023-01-17 | 百时美施贵宝公司 | Fibronectin based scaffold domain proteins that bind PCSK9 |
EP2638173B1 (en) | 2010-11-08 | 2019-06-19 | The Board of Trustees of The Leland Stanford Junior University | Fusion proteins comprising an engineered knottin peptide and uses thereof |
GB201103955D0 (en) | 2011-03-09 | 2011-04-20 | Antitope Ltd | Antibodies |
WO2013006490A2 (en) | 2011-07-01 | 2013-01-10 | Cellerant Therapeutics, Inc. | Antibodies that specifically bind to tim3 |
US20140315817A1 (en) | 2011-11-18 | 2014-10-23 | Eleven Biotherapeutics, Inc. | Variant serum albumin with improved half-life and other properties |
WO2013177187A2 (en) | 2012-05-22 | 2013-11-28 | Massachusetts Institute Of Technology | Synergistic tumor treatment with extended-pk il-2 and therapeutic agents |
SG11201407859YA (en) | 2012-05-31 | 2014-12-30 | Genentech Inc | Methods of treating cancer using pd-l1 axis binding antagonists and vegf antagonists |
WO2013180295A1 (en) | 2012-06-01 | 2013-12-05 | 日本電信電話株式会社 | Packet transfer processing method and packet transfer processing device |
US20140057851A1 (en) | 2012-08-24 | 2014-02-27 | WKD Holding Oy | Anti-Angiogenic Gene Therapy With Soluble VEGF Receptors -1, -2 and -3 Together With Paclitaxel Prolongs Survival Of Mice With Human Ovarian Carcinoma |
JP5988157B2 (en) | 2012-10-29 | 2016-09-07 | 株式会社リコー | Thermal fixing device and image forming apparatus provided with the same |
US20140154255A1 (en) * | 2012-11-30 | 2014-06-05 | Abbvie Biotherapeutics Inc. | Anti-vegf antibodies and their uses |
US20150017120A1 (en) * | 2013-06-13 | 2015-01-15 | Massachusetts Institute Of Technology | Synergistic tumor treatment with extended-pk il-2 and adoptive cell therapy |
WO2015103643A2 (en) * | 2014-01-06 | 2015-07-09 | The General Hospital Corporation | Integrin antagonists |
US9300829B2 (en) | 2014-04-04 | 2016-03-29 | Canon Kabushiki Kaisha | Image reading apparatus and correction method thereof |
-
2015
- 2015-08-12 JP JP2017507391A patent/JP6800141B2/en active Active
- 2015-08-12 CA CA2957717A patent/CA2957717C/en active Active
- 2015-08-12 EP EP15754359.6A patent/EP3180018B1/en active Active
- 2015-08-12 WO PCT/US2015/044920 patent/WO2016025642A1/en active Application Filing
- 2015-08-12 EP EP19187839.6A patent/EP3646879B1/en active Active
- 2015-08-12 US US15/501,028 patent/US10166273B2/en active Active
- 2015-08-12 DK DK15754359T patent/DK3180018T3/en active
- 2015-08-12 CA CA3133162A patent/CA3133162C/en active Active
- 2015-08-12 AU AU2015301753A patent/AU2015301753B2/en active Active
-
2018
- 2018-12-21 US US16/230,466 patent/US11096989B2/en active Active
-
2021
- 2021-08-19 US US17/407,011 patent/US20220193197A1/en active Pending
Also Published As
Publication number | Publication date |
---|---|
JP2017524713A (en) | 2017-08-31 |
CA3133162C (en) | 2024-02-13 |
US10166273B2 (en) | 2019-01-01 |
CA2957717A1 (en) | 2016-02-18 |
EP3180018B1 (en) | 2019-07-24 |
DK3180018T3 (en) | 2019-10-28 |
WO2016025642A1 (en) | 2016-02-18 |
CA2957717C (en) | 2021-10-19 |
JP6800141B2 (en) | 2020-12-16 |
EP3646879A1 (en) | 2020-05-06 |
AU2015301753B2 (en) | 2021-04-08 |
EP3646879B1 (en) | 2024-04-03 |
CA3133162A1 (en) | 2016-02-18 |
AU2015301753A1 (en) | 2017-03-02 |
US20170216402A1 (en) | 2017-08-03 |
EP3180018A1 (en) | 2017-06-21 |
US11096989B2 (en) | 2021-08-24 |
US20190343925A1 (en) | 2019-11-14 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20220193197A1 (en) | Synergistic tumor treatment with il-2 and integrin-binding-fc fusion protein | |
US10350266B2 (en) | Method of treating cancer with a multiple integrin binding Fc fusion protein | |
US9844582B2 (en) | Synergistic tumor treatment with extended-PK IL-2 and therapeutic agents | |
KR102609197B1 (en) | Interleukin 15 protein complex and use thereof | |
US20210077576A1 (en) | Combination tumor treatment with an integrin-binding-fc fusion protein and immune stimulator | |
US10888603B2 (en) | Methods of treating cancer cells expressing tumor-associated integrins | |
US20150017120A1 (en) | Synergistic tumor treatment with extended-pk il-2 and adoptive cell therapy | |
CA3113618A1 (en) | Collagen-localized immunomodulatory molecules and methods thereof | |
US20220257729A1 (en) | Combination of integrin-targeting knottin-fc fusion and anti-cd47 antibody for the treatment of cancer | |
WO2020249757A1 (en) | Immunoconjugates comprising a single chain diabody and interleukin-15 or interleukin-15 and a sushi domain of interleukin-15 receptor alpha | |
KR20230117122A (en) | pH dependent mutant interleukin-2 polypeptide |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: THE BOARD OF TRUSTEES OF THE LELAND STANFORD JUNIOR UNIVERSITY, CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:COCHRAN, JENNIFER R.;REEL/FRAME:059088/0417 Effective date: 20170330 Owner name: MASSACHUSETTS INSTITUTE OF TECHNOLOGY, MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:WITTRUP, KARL DANE;KWAN, BYRON HUA;REEL/FRAME:059088/0079 Effective date: 20140829 Owner name: NATIONAL INSTITUTES OF HEALTH (NIH), U.S. DEPT. OF HEALTH AND HUMAN SERVICES (DHHS), U.S. GOVERNMENT, MARYLAND Free format text: CONFIRMATORY LICENSE;ASSIGNOR:MASSACHUSETTS INSTITUTE OF TECHNOLOGY;REEL/FRAME:059239/0808 Effective date: 20170320 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
AS | Assignment |
Owner name: NATIONAL INSTITUTES OF HEALTH (NIH), U.S. DEPT. OF HEALTH AND HUMAN SERVICES (DHHS), U.S. GOVERNMENT, MARYLAND Free format text: CONFIRMATORY LICENSE;ASSIGNOR:MASSACHUSETTS INSTITUTE OF TECHNOLOGY;REEL/FRAME:065790/0665 Effective date: 20210827 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |